35C8L

Catalytic antibody 5c8, fab-inhibitor complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG 5C8
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8L01
5E2UH 5F6IC 3OZ9H 3C2AL 3RWCA 4DZBA 1GGCL 3MFFA 3FTGB 3UTQB 4YHNB 4XH2B 4KQ3L 4XWOD 4XCYA 2F8XC 4U7SA 1FZOA 1TZIB 1U91A 4MJ2A 2GT9B 1A47A 5E00A 3IAGC 4M7KH 3CH1B 1NMAL 1TTGA 1XIWD 4NFDA 1EXUA 4JRYA 4Y4FB 3U2SB 4P46B 1JRHH 4WCYL 4HIEA 1EZVX 4Q0XH 4Y8DC 1JFQL 3MJ9L 2VL5B 5C9JA 1KJMB 4YLQT 4RGOH 2VAJA 4X6BB 1H0DB 4HWZB 1MCWM 5F9AC 3VXNA 1Z3GL 4Z7UA 2BMKA 1R3LB 3OGCA 4JM2F 3K0WA 3VXMB 2XZAH 2PW1A 3HLAA 5JDSA 1U8LA 4CVZA 4DUXA 2VLKE 4NKMB 1KIPB 4KMLB 5ESVA 1KJVB 4QYOB 4OCMC 3BN9C 3P4NB 4LF3B 4DCQB 1U8QB 1A6TB 3QDGA 1EEZB 4P4KA 3GRWL 5IEKA 1F4XL 5LCVH 3ULVF 2N1KA 4X7TB 4UQ3B 5HGGS 3WE6A 1CXFA 2VWEE 5DUPH 3VXTB 4POZC 4XXDA 1SYSA 4PJBF 3W81A 3DX7A 1E4XH 2HVJB 2Y07H 3RBGA 1MCWW 3MRJA 5J1AA 1VPOL 3WD5L 4X5XB 1HNFA 2Z93A 5L0QB 4P0DA 4HKJA 5GRVL 1IM3B 4M62H 4HKXB 4MJIB 1QACA 5MEPA 3HZKB 4HULB 3LEYH 5DHYA 3J7HA 2EDFA 4P23A 4XMLL 1RIVH 3UO1L 4DVBA 2ATPA 3BZ4B 4N68A 3QXUA 4BA8A 2CD0A 1L4IA 3BH9A 3O45A 2H2PC 4ZUVA 5I74B 4F7MB 4O5LL 1G7IA 5D2NC 5IB4B 1AE6H 2OJZH 4G5ZL 4HKBA 5I1IL 1IAIM 4E42A 3THML 12E8L 3O6KL 1I1AD 4WWKD 3K3QA 4I2XB 5C07B 3QIWB 3THMH 3RWEA 3DROB 3MV7E 4BKLB 1AFVH 5EBWA 5ELIA 3KPNA 4UOW0 4OCWL 2NY1B 1E4KC 4NO0B 4D9LL 1IQWH 4GS7C 3L5WA 4OV5A 1F3DJ 4CAGA 4PGZA 3K81A 3BVNB 1UACL 2P5EE 3LQMA 5E8DL 1T6WA 3H9HB 3TBSA 5D6DC 1LK3H 4U31A 1YPZE 3ZDZE 4J4PD 2ITDA 3RU8L 2QADD 3KAAA 2H6PB 5D1QC 1A8JH 3LKNB 3CFCL 4XVUD 4WWKC 5C0AB 1B0GB 5L2KB 3GMMB 4X5LA 2WSKA 3AMLA 2G60L 3B9EA 4KKCD 1SEBA 3TBWA 3WHE1 4QRRB 4YZFE 3PP4L 1Y6KR 2VSCA 3FT4A 4TRPL 4ETQB 3CVHL 4N9GA 2WWMC 1YECL 1T7ZA 4MNQA 4P9MH 4N0CD 1FVEB 2H8PB 3C60C 3MRQA 1YECH 3C5ZB 3QQ3B 1I1YA 3B2VL 5D1QD 1U42A 3VMOA 4X6FA 4JJ5A 4PRBB 4JHAH 3MV8E 5C0ND 4Z7QE 1A4JA 2R1YA 2R9HC 1FLTX 2Y23A 3U1SH 2VERN 3CC5A 5LXGL 4JO4L 5F7EH 4ZYKA 2R0LH 1LNUA 3HPLB 5EZOH 1XF3A 4XBGB 4MNGA 5BV7L 3QAZC 2XIDA 2EDYA 1CLOH 2NY2D 4MNHA 4L1HA 1UWEH 1FFPA 4XPGH 1BP3B 2P8MA 5D7JA 3KLAB 3ARGC 4NHUB 4OCYL 2I60H 4N0CC 4X0KB 5CJOL 3W2DL 2ZCLH 4NBYB 5CBAA 3WS6C 1T0MA 3ZDXE 2DOCA 3QEQA 3WEXA 5I1CH 3MV01 2A1WL 4NNYB 1WZ1H 4RMQA 3SDXB 4ESKA 5D5MB 1TQCB 3MROB 1BM3H 5DD3H 4XMLH 1MWAA 1N5AB 2Y9RT 1BVLB 5FO8A 4GRLA 3JUZA 4WEBH 5ISZE 2O93L 1IQDA 1WEJH 1DLHB 4ODXA 2CJUL 1JWMA 1N8ZB 1WC7A 5ESAA 3EYUL 1U8NA 1Q1JH 2OR7A 5I1IH 1L6XA 3I6GB 5GGSA 1WFTA 3BH8A 3CFDA 3SKJL 4KXZH 4P2QB 3N9GL 2VXVH 4OJFL 4LNVA 1TQBB 3HNSL 1FV1B 4QRTB 4UMGA 1A2YB 2FL5A 5C09A 1TTFA 3IDXH 3OB8A 1MEXH 5DI8B 4JLRB 3TV3H 3IDGB 3QUKA 4TVPD 4MQXC 3QWRA 3TBWB 4PGCA 2Z35A 1YEFL 5IBUB 3VGFA 4WGVB 5D8JH 4F7EB 4HKBB 3DXAB 1LK3L 1KLGB 2DQTH 1UM4H 3HMWL 5MERA 5DJ2B 4PJHB 4EDXA 1GC1C 3FFCD 4WHDA 3IDJA 2A6JB 5TPWL 2Y06L 3LIZL 5D2LA 2G5BB 3DXAE 3TPUB 3L3DA 3LIZH 3U9PH 4FQHB 5D7SL 3MV7A 4LLDB 4R4ND 1HKFA 4APQB 3T0EC 1BOGB 3IVKB 2H6PA 5E5MA 1ZXQA 2FYYB 4G8FB 3BQUC 1RUQH 2OTPA 3WFDL 4GAFB 2J88L 2VDNH 5FKAB 2XYCA 1WT5C 1U2HA 1BQUA 3T0DA 1WBYB 4O4YL 1T03L 4KXZI 4H0HB 4I48A 1WBXA 3SDDC 2ED7A 1D9KD 2X89A 4OFDA 1IQWL 2EZ0D 1P4LA 4XC1L 1U3HB 5HHPA 5BRZE 4LRNH 1J1PL 3MXVH 1C12A 1NC2D 43C9A 2DWDB 4R8WH 1L0XA 3MFGB 2IH1B 4FABL 1MAKA 4KVCL 1MCBA 1FRGH 4YEEA 1JIBA 2R1WB 1BBJB 4M8QB 2BC4A 2P5WA 2X7LB 1CFNB 1M7DB 2B4CC 4MAUL 2NX5B 2FEDC 4ORGB 3GM8A 3TIDA 4R4FL 1S7RA 3MV8D 4GKZA 5I1EH 4W6YB 2GKIA 1NLBH 4ZSOA 2VLRE 2X4QB 4EN3D 3IDNB 3LRSA 5J6HB 5AZ2L 3OKDA 3B9KC 1F4AA 4Y19E 1IAIH 3QUZB 3WIHA 1MQKH 3Q6GH 4AH2A 1FVCB 1G6VK 5D7JC 1ZHBB 4G7VH 2MCPL 5A40E 2Z35B 4JVWA 4PJIB 3B5TA 4J4PC 3GBML 5CEXA 5I0ZA 4WJ5B 2C4XA 3BW9B 3KYNA 5BV7C 4JFHE 3V6FB 2HT3D 3H9SB 4Y4HD 5D5MF 3KNBA 4K3EH 4ZFZA 3ISWA 8FABA 1CU4H 3PHQB 4P2OB 3G5YB 5FB8A 4P2YA 2J12B 1FVDB 2AJUL 4PJEB 3Q1SH 3C9NB 4KVNL 4YHNA 3UTQA 4BUHA 5HPOA 5FO9B 3V52L 4HFWA 4BM7A 1DEEB 4QRRE 1NCDL 3D39B 2EECA 1UZ6F 4FQLH 4AL8H 1IQDB 4ODXB 1T1XB 1J8HB 5GGQH 4KZDL 1S7TB 5HYJD 2Q76A 3SDCB 1BAFH 3DIFA 1S7UB 3CVIL 4OZ4B 1WGOA 4PJXE 5EO0A 3V7AG 3IJYA 3HMWH 5EA0H 5KZCB 2R0WH 1V3JA 3CFDB 4KDTC 1PJ9A 5C0AE 3DURB 4J12A 2WUBL 5GJTH 3DRQB 2WUBH 1KB5L 2XZQH 1ED3A 4OZFA 2K7QA 5C0DA 5DJYB 3T09A 2EKSA 3DXAD 3QUXC 1R3LA 2NY3D 1OAZH 3ULVH 1U8OB 1KULA 3MRMB 1AR2A 2J8UB 4UAOC 4H20L 1X4XA 5JW3L 4NT6A 4ZFOB 4DGVH 4WFEE 2F9BT 2NY4C 4PJ7E 3NN8A 1WSST 4JKPL 5J56B 4LARH 1SVCP 5I75C 5TE4L 2Q86B 4NKIH 4M43L 4P2CG 1KTDB 5IVXA 3O0RH 3N1MC 1DN0A 4M5YL 4WIQA 2AAVA 1CE1L 2F74B 1B0RB 1HHGA 3KPLA 2D31B 1HQ4B 3EYQC 4XXDB 3T0EA 4U6VL 5T3ZH 1T2QH 1UKQA 5JPMB 3LHPL 4WJ5A 1SYVB 1D5BA 3OWEA 3IETA 4TQEH 5ANMB 4B7LA 4QXUH 3WS3B 1TPXB 4YWGL 3V6FA 3K8LA 3DVNB 4YUEL 1RUPH 3MMEB 2NY4D 4NWTH 4KK8D 1KENL 4UILH 1LO5A 4HK3J 3ZKSD 1A14L 4XMPH 1MFDH 1KTLA 1R5WB 2WBWB 4RDQF 3DETC 43C9B 3SDCD 4Y16C 4IRSB 4HIXL 2KZ1B 5HD8C 5CSBA 3IB4A 2YPVL 5DJZB 1CGWA 1OAYH 5MP6L 3QYCA 1I3VA 4KFZC 4KUCD 4Y5XC 3TCLA 2ZPKH 3MLWL 5SWZD 1P1ZA 2V5TA 2OP4H 4H1LG 3KPNB 3OZ9L 2CLZB 5ITBL 3T2PA 4OB5L 4J4PA 4DN4H 4YHYB 4L8SB 4QHMA 3SKOB 2UZIH 3QEGH 1VGKA 3QCTL 1RZKH 5CSZB 5T1MA 3ARSA 4HWBL 3SHSA 2UY7A 3HS0B 4RZCA 1JV5B 3UTTE 4QHLB 1Q9LA 3RI5F 4F33A 1BLNB 4GLRI 3V5HB 1FPTL 1B88A 1GAFH 5IFJB 2IBZY 2LFGA 1IM9A 5D71L 5HVHB 4NKOB 4JREC 1CD1A 5CHNA 5ALBH 3LS4H 3DBXA 2BVPA 2AJSH 4AIOA 1U9KA 4MS8D 2HAZA 4G8GB 2DS4A 3ARGB 3SKMB 4OFYD 4P5KB 5KBNC 3TGXA 3QUMB 4OZFH 4JQXC 3NABL 3GMQA 1CL7L 3A6BL 4NQSA 3HAEA 2VXVL 1YQVL 5EPMB 4HXBL 1MJ8H 3NH7H 4G6FB 4QY8B 2Q8BL 1CD8A 1M7IB 4XPBL 2XZCL 5IMLB 1R3KA 1U0QA 1H3TA 3BP6A 1ADQH 3PF2A 1MPAL 2P46B 4G9FA 5CEZE 4GG6E 1HCFX 1MHEA 3HTLX 1KEML 1VESA 4NO2B 1N0XH 4KDWA 5DQJB 4LCWD 3KR3H 4P23C 5F9JB 2IMNA 2FIKA 3KYKH 3I75A 3TNNA 3DTXA 1KJMA 4D9QD 2DRUA 4TULH 1KT2B 5ICYA 4KI5C 1RZ8A 4U7MA 5B3JE 2GJZB 1TCRB 1AGBB 3P9LA 3UJJL 5ESQA 4WNQA 3KPSE 4PJAA 1XGPB 4JFFB 3I2CL 4NCDA 4K7PX 4G6AC 1ZANL 3MJ6A 3B2UD 1JPFB 1I7ZA 3LKOB 1A6AB 2YPVH 1F45A 5FM8A 2CUHA 3ROLA 4GUPB 2A74A 3S35X 2CGRL 2E5EA 1DVFB 1G7HA 3SDXF 4Y1AE 4QTHA 5I19H 4PYHA 1WIPA 4EI5A 1QNZH 1SBSL 3VFNB 5LJYH 2F54A 4DZBB 1A1OB 4OCRL 4YDVB 1S8DA 3TH3T 4F7CA 1DQQB 1RK1A 1E28B 5KTEH 1K3IA 4MHHG 4F2MB 1U92A 4NKOA 4PJCF 2NY3C 1ACYH 1IGML 1LP9F 3RX5A 4EN3A 1I7TA 3O6FC 4J6RL 1I3UA 4GKOA 5HHMD 2HVJA 3ROOB 1A9EB 2GJ6E 2EIDA 5HHVL 3EHBC 2ADIA 3RU8H 3AROA 4NQDB 3LN4B 4Z7VE 3B5GA 3HE7C 1BQSA 3D9AH 3U6RB 2X05A 1IC7L 5AYQA 3VG9B 5C9JB 4MQ7A 1HXMA 5DFWH 2VLJE 2E6PA 5LQBH 2A9NL 1HYSC 2YK1L 3O2VL 4OF3A 4HT1H 4U0RB 4MDIB 1H3GA 3OR7B 1JTPA 3OGCB 4HX1B 1NGXB 4NYLA 5DC9B 1NEZB 1YY8B 4RFNC 5D7IA 3FAXA 3W9EB 1B6UA 2EE6A 3NACL 2E9IA 3MLYL 1F2QA 4UUJB 4GQ9L 3N1PC 2DD8L 2DQGL 3LOWA 5CGMA 1Y0LA 1OVZA 4C83A 1F97A 5SWQA 2PW2A 1EEZA 3KYOB 5CHNB 1LO2H 2XN9D 3KPSD 1OARH 4UINH 4HC1L 4PJDE 1C12B 1UB5B 1K5NA 1RUML 2DQCL 5CLWA 5D1QA 5JOEA 2MKWA 3RVWC 1MELA 2FX8H 3FOMA 3C8KA 1BF2A 2AI0L 1I9IH 1DEDA 3WS6A 2XPGB 4XHQA 4NO5A 2OJEA 1H3PH 1VKXA 2I60L 5BS0B 1PDKA 5DQ9B 5L8JB 4GRMA 5J89A 2CXGA 4P23B 1Y18B 5BZDA 2CMRH 2UWEE 1BFOA 3GSQB 3AB0C 3EJYC 4I18B 4EN3B 1XT5A 4F37F 1ROWA 4XP1L 4MA1C 4Y4HA 5D93C 2ATPB 1MWAL 5T3XL 3MJ8A 2ZWLT 2W38A 4PD4K 4APQD 2F53B 5F3HA 4NO0D 2DQUH 5E4IA 3RWGB 3I75B 1OSZA 4YBQD 5J3HC 5IQ7H 3QQ9D 5AZEH 3TFKD 1YQVH 4Y2DB 4OLUH 2BXYA 3CLEL 5L9DL 5HYSA 4NKQB 4DOHE 1OPGH 3SBWC 3IDXL 4I77H 4PJCE 2B2XL 1FJ1B 1QSZA 3QZWG 2F19H 4XPHL 1P69B 1T22B 4KRMB 4NO3B 3EO9L 4OGZA 4H88L 1L0YA 1VFMA 2XTLA 4LFHD 4JFPA 1R3JA 5D7IB 2OR8A 3BZFB 1UM4L 4I3RL 3ARDA 4TOYH 1N3NB 4LIQE 1NC4B 3NIGE 1NFIB 4OGYL 1UT9A 1BVKB 2BHUA 5FHBH 4M9OA 3CFCH 4N0YH 1Z0MA 4JO1L 4B7IA 3UYRL 3L5HA 3WHXA 4C83B 2D4DA 1CK0L 1CGTA 1JNNH 2GSGA 2WIMA 4GG8B 2D3VA 3PV6A 4PJEE 4ZOEA 2BCKB 3OKEA 1OAKH 4P3CH 3I3EA 3S37X 4GSDL 1HHIA 1ZGLM 1RFDL 4L29B 3GSNL 1UXWA 4Z78A 4PRPA 3QBTB 5D1XC 2BNQB 1LEKB 5IT2L 4PJDB 3JV6A 4LAQL 4YE4H 5DMIH 2ICEB 4UOJA 3QUYC 3OJDB 3JV5A 4U1MB 1X5GA 4JFXA 2YSSB 2ERJB 1FDLL 5MEQA 4GMTL 5DHVH 2HWZL 5LBSL 4Q9BA 5ICZB 3IDYB 2A9MH 3SQBA 4M7KL 1ZT7B 4MLSA 1J5OL 4PRNB 4D0DA 4FABH 1AGDA 1VFAA 1NFDF 4YNYA 3KWWA 3KLAA 1U3ZA 4PJ5D 4Z5RB 3WUWG 3DUUB 4PY7B 3LZFL 4RMWA 5J13C 3T3PE 4FG6D 4LDLB 1NAKL 2MPAH 4IS6B 5CJQL 4L9LA 1JF5A 4OF0A 1LO3H 1NKOA 3QRGL 1A5FL 1FZOB 1TZIA 2CUMA 4YBLB 2PO6D 1NANH 4HV8B 4XP1H 2R8SL 4FQXD 4NHCH 1D6VH 5MI0B 5GJSH 5F7LB 3R8BB 4ENED 3NFNA 8CGTA 3IDIA 3ZKQD 1HKLL 2C1OA 4M7LH 5HYIA 1ZEAL 4P2QA 1Z9LA 2AVGA 4M7LL 4P4RA 5KSAB 3BZEA 3QIBC 4Y1AB 1OM3H 3NVQA 1IZJA 4P5MB 5AZEL 4XZUA 4XC3L 4TSBL 3VA6A 3UAJC 3PL6C 3QNXB 2CK2A 1QLRB 4XVJL 1WFOA 4K7FB 3VWKC 4XB8A 2FECL 1YNKH 4PJHE 4M7LT 3UPRB 5FK9A 2NXYD 3K74B 1M6OA 4FQXC 3MPCA 1II4E 3B9AA 1IFHH 3RVXC 2FJHB 4I0PC 4M1GL 4PJGF 4TOYL 4M1GH 5EWIH 3MA9H 4RWHA 5FUCE 3T1WA 4RA0C 5GJTL 2EEBA 1CF8L 5KSBB 4EI5D 4YGVB 4PIRF 3WKMH 2VDQH 4RWYL 3UO1H 3TLRA 4JY5L 1KLUA 4LP5A 4OCSH 1D6EA 3V5KB 4YDIH 1DZBA 5IJKA 2HJLA 2ZG2A 5GRZA 2LVCA 5JTWA 5DJ0B 4KJWD 4PTTA 3EJJX 1AE6L 4Y19A 5DMKB 3VFGH 2O5YL 1A3QA 3ARGD 5I1KL 4JFHD 4WTWA 3UBXA 2P5WD 3MJ9A 4P49A 2Q7NA 3RKDD 2X4TB 5KTEL 1UG9A 5FECB 5C2UB 4G9DB 1PG7H 1QFWL 4JQXA 1T5WB 3K7UA 3DOSA 2CDFB 5F96H 3H42L 3ARTA 3BIAX 1GHFH 4RISH 4ZNEA 4XVSL 1MNUH 3OKMB 1UKTA 1S7TA 5JHDD 4WW2B 1S9XA 3VXSA 1EBAA 1W72L 4CJ1A 5MHSE 4XHJC 4QHUA 5E5RB 4QXWA 2XICA 3OAYK 4CW1A 2P5WB 4X7FC 3IFOB 5E8EA 2X4OB 3O4OC 4TNVK 2HTKD 3BZEB 3L3JB 2XACC 1QQDA 2R9HD 5EG6C 5C7XH 3WUWB 2FEEI 1Z9OA 1MI5A 3QDHA 4KDVA 4XMPL 1IKNA 4DQOL 4M6AA 4GAGL 1DFBH 4DTGL 1ZHBA 1INEH 4NWUL 1UJ3B 4EEEA 2FCBA 3HCVB 4KKBC 3OHXA 1NMBL 2HRLA 3S4SA 5TFSH 2O5XL 3ROLB 1U93B 4P5TD 2CKBH 2IALB 3IT8D 4KMTH 2V2XA 4LKCA 1SJXA 1UYWL 1YEIH 1DR9A 3VRIB 2AXFA 2KZWA 3UTPD 5B39B 5LCVL 3SDAD 3LS5H 4TSBH 1TVHA 4JQIL 1TDQA 2UYLA 2NY6B 5IP4A 1IKFL 3EAKA 4KK5D 2V5MA 1IGYA 3MRDA 4G9FD 3QWRD 1U8IA 4XCNB 1ETZA 1SYVA 4S1QH 4MD4B 1W72B 2EICA 1YY9C 3WD5H 1N59A 3LEVH 1AO7D 1Y6MR 3CDGA 2P5EB 3F62A 1GGBH 1NFDB 5CJOH 3DMMD 4LGPB 1RSFA 4XH2A 1KTLB 4J3WA 2J2ZA 3MRIB 3IAPA 2WWKT 1K3ZA 2MCPH 4G7VL 3W5NA 2AJSL 4MDIA 4I2XE 2R23A 4LK4A 1U36A 1MCRA 5CZXD 1TLKA 1RJZA 1H15B 2J8UA 6FABL 2ZOLA 1FH5H 3QHFH 2H1PH 5T1LB 2FEDD 4PJ7B 3U4EA 1NGQL 1L9NA 2ICES 3WUWA 1CBVH 4M7ZB 1SY6L 4HUXB 3VMNA 1SY6H 5CCKH 1MUJB 4WU5A 3HLAB 2PW1B 4QOKD 4WWID 5IB1A 1C16A 2EYTB 3O8XA 4MB4A 4UZGA 3WS3A 2CDEA 1OGAA 1AI1H 4CU6A 3UTZB 3T2QA 1RVFH 5EBLB 3ABZA 3RDTB 1KSRA 2O5ZL 1FFNB 1RVFL 2WBJA 4LKXA 3GSNA 3MBEB 3V7AE 1S7WA 5ACZA 4I13B 4QTIL 1Y18A 5BZDB 3PNWA 3EBAA 3C5JB 4PJXB 4KQ4H 1JNLL 3O4OB 1BJ1H 3FTGA 1N5YH 4P46D 4KUZH 5F71A 4F7TB 3MZGB 1PEZA 4KTDL 4N0FA 3I2CH 3D2UA 5C0BA 3C6LA 1CDYA 3T1FB 1U91B 5DT1L 3ILQC 5DTFA 3FB5A 2X4NB 1FZKB 3ARPA 5CILL 5GRWA 1PSKL 5HPMB 3GJFB 3H6JA 1PSKH 2IANA 4O51B 4HXAH 4BZ1L 3ZSTA 3ULSB 2DQJL 5GGTA 5I19L 4Z95H 4PGBA 5L6YH 1B3JA 3O11B 4EOWL 1X7QA 2A6KA 1ADQA 2EDHA 3TT3H 4BFBD 1X4ZA 1JNHB 1ND0A 3OXRA 5IIEB 4N0UB 4ONFH 4PTUA 5CP7A 4CMHB 5ADOL 4XC1H 1KCRL 4WO4C 4EDWL 3HAEH 2QTEA 3K46A 4G9FE 5E4EB 3DSNA 3VFTA 5EU3B 3DYOA 3MJ7B 3MREB 1F90H 1QBLL 3MUZ1 4G8FA 2FJGA 1JGDA 4ZAKD 4DCQA 2ZOKA 2V2XB 4TVPH 2FRGP 3PWJB 4OCYH 4RA3A 3UTPE 1E6JH 1WBXB 1AGCB 2YWZA 5KJRL 1E6JL 4R0LB 3MA7B 4MXWL 2YD9A 5E2WH 3VRLE 3CVHB 3MCKB 1D9KB 1WAAF 4DKFH 4G8GA 2Y1VA 4WHTB 1NPUA 2XTJC 5IB1B 3P73B 2EC9U 4I5BB 2FECI 2I07A 2IJ0C 4IEFB 4BK5A 2IEPA 1WBZB 1CLYH 3CUPA 4O2CA 1BBJA 3TF7C 4AEHH 2FX9L 1X5XA 3H2WA 4MD0A 3GSNB 2QQQA 5I16A 4ZS6D 4AMKL 4JZJC 4IJ3B 3Q5YA 5TF1H 4LLQA 5GIRA 1S9KC 3UYPA 4BZ2H 4KKLD 3K4DA 3P9WB 4U1LB 5HY9B 1KC5L 3T0ED 2Y07L 1ZHNA 4WUUE 5FOBB 4YNYB 1JHKH 2VE6A 3MUJA 4NNPL 5C0IA 5I1HL 2VDRL 1UM5H 1QEWB 1U8JA 1FPTH 5L7XL 1BZ7A 5C0BE 2X9WA 4FQ2L 2UWEF 1WAAE 5T1KB 5LGHH 4ZS6C 5HGHA 4XPFL 4OIIL 2A1WH 4LQFH 3A0OA 4JY5H 1JNLH 3PHOB 3M1BA 2IAMD 5ABDE 4UV7H 2DBJA 1P7KA 4FQIH 5FUOH 3LRHA 4LSDA 4S2SA 1I7ZB 3LKOA 2H3NB 2N56A 3VFTB 4OKVA 4HUVA 3IDUA 4WI4A 2PF6A 3WJLA 1C08A 2NYYD 5ENWB 4AT6A 3VFGL 1CL7H 3O6KH 1UXSB 3P0YL 5MENA 4P2QE 3X17A 2XN9B 4QXGL 2GFBA 4P4RB 5F93C 5GXBB 5KSAA 2O61A 2V5YA 3JVGA 1NGQH 5EN2B 4AEFA 2NR6C 4FMFA 1OTSD 5F7DA 1KGCE 3ZL4H 3FFDA 3LD8B 5E2JA 1AXTL 4LCCB 2V9QA 1CE1H 3AS0A 1KPUB 1C5CH 5D9SA 4U6VH 3WSQH 3IRZA 2I07B 4XMKH 1UH2A 2BNRA 5I9QC 1UA6L 1AJ7H 3C5SA 1WC7B 5E4EC 5HSFA 4K23H 2GTWA 3G9AB 3GMLB 4R4FH 5EOCL 1OD7A 4MQ7B 1KIRB 5JIKA 4I0KA 3GMNB 2OL3L 1FL5B 1BFOB 4L4TD 4HKZB 2NR6D 3ZE0E 4L3EE 5D7SH 5HHOE 1I4FA 1LO4L 3D39D 4NYLB 1OWWA 1CFVL 5B39G 3RVUD 4X98B 1A6ZA 3FO2B 2EE9A 5DVNA 4F57H 3MV8B 2BNQE 1NEUA 3VD7A 4CDGC 1AKJD 2FX9H 4GKNA 4PJFB 5C08E 4FQCL 4J3VA 4R6UA 4PJBA 2IADA 2VAAB 3EO0B 4NBZB 3CD4A 2B20A 4MJ5A 4BJLA 1TVBA 3V6ZB 4OZIB 2NY0B 4JHWL 3NCBB 2HWZH 4DVRL 3QIUD 5SWQB 2D7TH 1X5IA 1I8IA 4LHUG 1FJ1A 3SCMB 3E6FB 3LV3B 5ILTH 5DRNA 4JFDA 3RVUC 1A6UL 5E8OB 2HG5A 3Q0HA 4OLYH 5FKPB 5D1ZD 4D0BB 1N8ZA 3N50A 2HJKA 5F89A 3TO2A 3SDAB 3M17A 3TZVB 5DRWB 2H45A 5DQ9A 3AM8C 4UOW1 3SJVA 4NRZA 1EJOL 4X6DF 5CJQH 1FG2B 1GAFL 1FV1A 2YZ1A 5F7HA 4FA8A 1SVZA 1TQBC 1ZVSB 2B1AH 4R9HA 3UPAA 2E6QA 5EZJA 1CLYL 2CLRA 5LWYL 3NABH 2OI9B 2JK5A 4IMKC 1CGVA 5IVNA 3VFUB 2X42A 5C07E 4YHKL 1C5DA 3GJEB 3LKRB 3TPUA 1QRNB 2V17H 4LHJB 5J7CC 3V52H 5IHZA 3AUVA 2HKHH 1WITA 3P4MA 4ZUUA 3HB3D 5EIIB 1YEFH 1AP2B 4I0PA 1A6VH 3AXLA 3KJ4C 1CIUA 3PIQA 3VW3H 3QB7C 4ODSL 4DW2H 1NLDL 1FNEA 2XFXA 4JPKL 3ZKNC 1DBBL 5GGUB 2Z8SA 3CFEB 3HZMB 3L9RB 1TETH 1X5YA 2J6EA 2Y7QB 4UT7H 1JNNL 1MLCB 2VLRD 4P57A 1G9NL 4PRPB 3K4AA 4KAQH 3EYOB 4M93C 3BXNA 3RNKB 1MCDA 1S5HB 4YAQA 4YE4L 2BZDA 4FFWD 1UENA 2P42B 2JB5L 1GVIA 4G3YH 3U82B 2FR4A 5ACMA 5E99L 4LLYA 4FQCH 3V4UH 1S7RB 4P5MA 4Y4FC 1RZ8B 5SWSA 4ONFL 2GW5A 2PNDA 4ZO7A 2LU4A 4J1UB 4EQ2A 1TZHB 3RTQB 2XQBL 3DV4B 1ZT7A 5HGBB 2MCG1 4ODVL 3VXME 3GSWB 3QO0B 3L3IA 5ID1A 5DJXA 4E0RA 4KK9D 4BFEA 3MBED 5HHNA 1B4JL 3R1GL 4LEOA 2BNQD 3FQXA 3LKQB 2CRYA 2GJ6B 4GXVL 3U46B 5CD3A 2FB4L 5I15H 4LKXB 4QHNA 1QG3A 1K4CA 2Q86A 3BRGC 1HH9A 4IOSD 5JA8B 1FL6B 3T8XA 1T2XA 2YKLH 1QSFA 3DMMA 2A9NH 1FZMA 4L4TE 4Q97A 5IHZB 2KUTA 2Q3ZA 1XR9B 2Y25A 3KPOA 2NZ9D 3ROOA 5EBMB 2WM0A 2NXZD 5MEOB 4NQEB 3F7PC 4JPIB 3GHEH 4I9WE 3IETB 1J8HA 1GGTA 5ANMA 3VXRB 1W0VA 5LGJB 2RCSL 4FQQB 3TO2B 5DMYA 3P9MA 5CFHA 2F54D 2EEDA 2E7CA 4WU7A 5C6WH 3QUMH 4OZFB 2XA3A 1HSBB 1LO5B 4LPTA 3EOAB 4L8CA 4PLNC 4ODUA 3EFFA 4TNWF 2XTJB 3RUGA 1NGZB 2F58H 4L3CB 1LE5B 1CDUA 3BWUC 3OR7A 4IDJL 3L1OH 4E5XA 3RL2B 1VEMA 1TJIL 1MCOH 3RQ3A 2ZZUT 5CKGA 1EPFA 1JUFA 1JGUL 2HT3C 4Y4HC 2FJGB 4DFHA 4PB0L 1MFAL 4YXLH 3PWPE 2LABA 3QJHB 2NNAA 5E7FA 1B2WL 1MY5A 3L5IA 4N1HB 4MQTB 4ONHA 3VRLF 3NCJL 2VITB 4AZ8A 3SGDI 5FO7A 1GGIL 3WIHL 4BQ8A 1RHFA 3O3EB 3VXNB 3VWJA 35C8H 3QG6B 3BEVA 1UH4A 3MYZA 1F6LL 5HTSA 2GCYB 1J7VR 4CADA 5INDB 3L6FA 3UPCA 2HJLB 1DCLA 5IBLD 3MLSH 3L7FA 1LO0H 3SE3A 1CDCA 1JV5A 1MI5E 1U3YA 5DJCA 2IF7A 3EYUH 5T5NG 5JHLL 1EV2E 3CFEA 3HZMA 4LKCB 3L3GA 1F4XH 2AJ3A 5DJAB 1FL6A 4MQSB 4YXKL 4OGXH 4YBHA 5I1GL 3O3BA 5JNYA 4AG4H 2KPNA 1DDHB 5BRZA 3RNQA 5IQ9B 3QA3B 2A6IB 2R56L 1EGJH 3V0AC 1YC8A 1J0ZA 3GKWL 3H0TA 1JF1B 3ULUH 3E8UL 1T1YA 2YUXA 1W0VB 3S88L 1KV3A 2NY0D 4PYGA 1G9MC 1M1SA 3CX2A 5E8EB 1BD2B 2EC8A 2P5EA 4QOKA 3PJSB 4CW1B 1EEQA 3CZFB 4KUCF 3BJLA 5CP3A 1NCNA 5JW5B 4UT7L 1F4WL 4CL7A 3QQ4A 4DQOH 4EJ1C 1INQB 3DV4A 1FQ9C 3D0VB 1WFNA 1WUNT 1F3RB 4TTGA 1CTNA 4NPYB 3CDCA 5DK2A 3FAWA 2VKXA 4JG1L 4NZRL 4LFHG 5HI4D 1CE6A 2NXYC 4YHYC 3IFNH 2BVUA 3WV0A 1I8KB 4HIEB 5JXEA 1NDMB 4UTAL 2J8OA 1HHJA 1YJDL 2RR3A 3BIBX 4MMXC 4PB9L 3SGEI 5DA4A 4GMTH 1QSFB 1QFWH 1FDLH 5E5UB 3AAZA 1IGCH 4MNQE 4HIIB 4JM2D 4U2ZA 4XCYB 3KDMB 4LLUB 1OGTA 3CFKA 5GISH 4BFGA 5KVEH 5HVHC 1R6VA 1G7PB 1XGRB 1NSNL 3WMSA 4CU7A 1FNSH 3WFCL 2IH3B 2C3VA 5ANME 1EXUB 4JRYB 2Y4SA 3D0LB 3FO0L 4FQJH 4LSPH 2ATKA 2BVEA 4TSCH 3TJEH 3B9DA 3T4YA 3TJEL 1A6TA 1J0KA 4GQPH 3P30H 3CDGB 2HFFA 4BSWA 2NW2A 4XCCL 3SCMC 5D71H 5CINH 5I1CL 4WW1A 3ZYJA 5GRUH 1MQKL 3Q6GL 1F6AB 5D7KD 4Z7WA 4DKFL 3ARZA 3NA9L 1YUHB 3EZ8A 4Y2OA 1RZFL 5EUOB 3VGHA 2OQJB 3V9FA 2VMFA 2Q8AH 4CJ0A 5GJSL 5HPMA 1KIPA 5ESVB 3TZVC 4JFEB 5IMKB 3KXFE 3O9WB 1YEGL 5IM7B 5SWZA 4NSKB 1QSFE 1OGAD 3TIEB 1FN4B 3REWA 4PJAE 3GB7B 4HAGA 1B0WA 3VWJB 5DFTA 4U6YA 4XVJH 4RGNB 4U6TA 4Y4KD 2PTUA 3HE6B 1MUJA 4WU5B 4BH8A 1I9EA 2FJFB 4HZLA 4KPHH 5IESL 2R56H 1UQSB 4QHKI 4CVXA 4DN3H 2Q1EA 4OLXL 1RJCA 4F80A 1DQML 3RPIA 5E70A 1JGDB 3DYPA 4RRPG 5IVOA 3MACL 4I3RH 2H26B 3RY5A 4CNIA 3FB8B 2X4PB 1P4BH 4YDLC 3C5ZD 5DD0L 3BQUB 4PJ8C 4ETYA 4NNYA 1YMME 1DQDH 4Q6IB 3VD9A 3U9PL 5ETUA 1RIVL 5I8OH 5CZKA 4LPUA 1ZHKA 3BD4A 3U30B 2JKXA 4F8TA 1F11A 4PLOB 2V5SA 4ZUSB 4P23D 3QIBB 2E7HA 2H32B 3QEHB 4XRCB 5BJTB 3FO1B 1FGVH 4MA3B 3C08L 2VN7A 5FF6B 4RFOH 1MY7A 3CNKA 1B0GA 4U49A 3C5ZC 4IMKA 1A2YA 2FL5B 4N8VG 4LLQB 5GIRB 1PLGL 4JR9H 4G8IA 4PLJC 4R8WL 4GW4A 1FZJB 2YD3A 3VDBA 3SY0B 4V1DA 4QWWC 4QRRD 1AH1A 4XMKL 1A9BB 4UV4L 1RIUH 4K7PH 1S7SA 1I1FB 5I30H 2YC1A 5GGTL 1IGFH 4XNUH 5BV7B 1IBGH 5E56A 5EIQA 3BGMB 3GMMA 4OZHB 5LQBL 5EUKA 3SE8L 2VXTH 3FT2A 3MA7A 3R0NA 2E6JA 3MX0A 3FRPG 1I9RH 1QPPA 2XTJE 2P8MB 4U1HB 5D96C 5D6CA 4U1GB 3MCLL 1IGTB 4M5ZH 3ULVD 1N3NA 1MVUB 1R3HA 3LEXA 3LKSB 2HFFB 2Q20A 4KZEH 2NW2B 5CIPB 1DSFL 3FOLA 4X5WB 2G2RA 1XR8B 4IRSC 3QEQB 4M1CC 1NCAL 1T4KB 5GZOD 4PRAB 1CGSH 1OSPH 4QNPE 3FCTA 3RTQA 3UP1A 5F7EL 4OLWH 4HMCA 5DI8A 1KPRA 2PYED 1DBKH 4AJ0A 1XGTA 4LPCA 5GS1B 2X4SA 3WXWH 2EO9A 5F9OH 5INCA 1BAFL 1YMMA 5GS3A 5FGRA 2PR4L 3CXDL 3QH3B 3NIDF 1T3FA 3FRUB 4J3TA 1UWGH 2AABH 1AR1D 4U1MA 4R26L 4HAFA 2VXSH 3ALPA 1SJHA 4UDUB 4NNXB 5M95B 4MXWH 5IEHA 2BRRL 3P2TA 3QXTA 4PFEA 3WFHA 3L95A 4PGCB 3WIIL 4UT6L 3UC0L 1G1CA 2QADC 1VB9A 5DO2C 2HLAA 2H3NA 5A2FA 5IKCA 1Q1JL 2QEJA 2FDBP 1L0QA 1NJ9A 4D0CB 1INDL 4OLVH 2V2WA 4HCRL 1EFXB 4UDTB 2UV3A 4Y5VA 1HIMH 1B6DA 5D5ME 5IB3B 1G7JA 3U36B 4OD3H 4L9LB 3IJSA 2HJFA 4K8RD 4LASH 4P2OD 2V7NB 1EFQA 3DX8A 2VLKD 3AU1A 3I3BA 1ZSDB 2H32A 5DD1H 3TH2T 5DZLA 2EE3A 4ELKA 1MHHA 3KR3L 4HF5L 5JMOC 3QPQC 3MA9L 1CFTB 4HJ0C 3WFEL 4EDXB 1S9YA 2E7LC 3C60A 1EERB 2GJJA 4X4YA 4QT5B 3CJJA 2ZUTA 1ZGLP 3CK0H 2XZZA 5FYKL 5EFIB 3GEWB 4F3FB 4BELD 4RRPA 2BOCB 1A3RH 1YMHB 4Y2DC 5I2IA 1QRNE 5KSUB 3MCLH 3TT1H 3DV6B 4X7EC 1EUUA 4EOWH 4PB9H 4PJ8D 4PJEA 4O2EB 1JF6A 4RGMB 3N1GC 3MV9E 4Z95L 3C8HA 3PNWB 4HS3A 2EDBA 1X5KA 3BDBA 5FB8B 3L3KB 4BSVA 4E41E 4LGSB 1CQYA 1HCVA 4JPWH 3BYYA 1YNLL 5FYJD 1KLUB 2ESVA 2GEEA 4JR9L 1WZKA 1XF4B 4HS6B 1WICA 2R0LL 3MXWL 1T1XA 1CDGA 3CX5K 1IGJA 4HIHA 3WSQL 1HYSD 1NCTA 1K6QL 4NN6B 4X7DC 5C86A 4CVUA 1Q94B 4FZEL 4KVCH 3VFWB 3UTSE 1WCBB 4YBLC 4YXHH 3U7WL 1R3IL 4LSPL 1JJUA 4IHOA 3RWFB 5IFAL 5EO0B 3BGFC 3IDIB 4TPRH 4L5FH 3G5YA 3ZDZF 5KJRH 3VI4E 1A14H 3NCMA 4A2MA 2ENYA 5GRJL 1JZ2A 4XPTH 2YPLA 4JZJA 4JVPA 2HVKA 2QHRL 4FOMA 3U0TA 5HHME 3QHZH 3D48R 5DK2B 3T4AB 1G0XA 3MRNB 4Y4FA 1M71B 4W70A 4PBWD 5J9PA 1JYXA 3SPVA 2P24B 1X5LA 1AD9B 5E6IC 1G6RH 1I9JL 1BX2A 1N2RB 1XCTB 4ELME 1HE7A 4ACPA 2IANE 4R0LA 5HYSG 5IJKC 3LS5L 3WNPA 3U1SL 1B0RA 3IXTB 2D7TL 1PY4A 1GC1H 2CIKA 1C1EH 2KL6A 4X8JB 2QHLA 5FYLL 5I75B 1AY1H 4F9PC 3OTTA 2YD7A 1WF5A 2EKJA 3BN3B 3MR9A 1IC4H 5GS0H 1PQZA 4HD9A 3MLRL 5D7LD 1JPSH 3U7AA 3ARVA 1SHMA 4HS8L 5F7KC 1NGWB 3MACH 4OFIA 5CLTA 1A7RH 2VDRH 1BIHA 1OTUC 4IRSD 2WWKO 3K2UH 2W9DL 4LNRA 3HE6C 3T8XB 3DRQA 1CD9B 3QULA 3ARBC 1JI1A 1Q8MA 3FFCA 1XF5B 4S1RL 3U4AA 5EOCJ 4U1SA 5E00B 1RV6X 4ZUWA 3DO7B 2IWGA 5BVJA 4YIQA 1QFUL 3TVMC 4P46A 5JR1L 2B0SL 1QKZH 5EZIH 3KVQA 2D7OA 3ECBA 4EBQH 5JHLH 5KS9B 1OY3B 1L7IH 4HPOH 4EN3C 2GUOB 2XN9E 3CU1A 4L8CB 5D93B 4ODUB 1YEKH 1Z5LB 2VABA 4UAOB 2MWCA 4HEME 3G5XA 1NDGA 5CWSB 2DYPB 4LP4A 3G5VA 4MA8H 2M8XA 2ORBL 2RFXA 2BOCA 3ARXA 3D69A 4L4JA 5FUZH 3T4AA 1P7QB 4QXUL 1MI5D 2C3WA 3RL1A 1GOGA 3S4SB 3WDJA 4ZG1A 4OQTA 1VSCA 3W9DB 3QUYD 3DROA 3FMGH 3P4NA 2VL5A 3O3AA 1X4YA 4MJ6A 1G7MB 3PDDA 1AGFA 1G1YA 3BPCA 2RAMA 3VGGA 2BVPB 4HS6A 4NP4L 1CXIA 4HWNA 4WUUB 4UIMA 4LSUH 3TBSB 5HHOD 2DBLH 1JBJA 2BDNH 4NUGH 4HUUB 3S7GA 5SX4I 4IOIB 4WI3A 1ZOXA 1PD6A 2XOTA 3VXUE 2ZPKL 2A74B 3QIUA 2QR0B 1UGNA 3MV11 3T2NH 5SWSE 1YDPA 4HJ0D 4HXAL 1OAQL 1ORSB 5F3BB 3BPOC 3U4BH 4LCYB 5D1XA 3F5WA 4OAWA 5LGKA 2PYFA 2RIKA 4HPYL 4LCCC 3MRFB 3NZ8A 4R7DA 3EFFB 32C2A 4N9OB 3QUXD 3O3BB 2WV3A 2ZSWB 3TP4A 2DQIH 5HHXL 3OKKA 3MRKA 3O45B 4WVRA 4ZUVB 4F7MA 5D1ZB 2EH7L 4HWBH 2FX8L 5HD8D 2QSQA 3O3UN 3RVTD 3RL2A 4RZCB 3RHWF 4YFDB 1JPSL 3NIFE 3ZO0A 5EU5A 1N64H 1A6PA 3OXSA 2VR5A 4WW2F 3LMJL 5FGCB 4HLZG 4N1CA 3B5HA 4I2XA 2XT1B 2DQHL 2EDTA 4HSQA 4OI7A 2PTTB 4HUXA 5F9WB 3QG6A 1KB5H 2B4CL 2GCYA 4CMMB 3MR9B 3G5VB 4NZDA 1H5BC 1IEHA 1F3DH 1PG7W 3W11C 4Y5YC 3H9HA 3QXWA 5F7WC 2J6EL 1QBML 2EDQA 3GSUB 5K59F 4P5KA 4KY1L 3RDTA 2H2SD 4KTEH 3B8YA 1INDH 4OLVL 4HGMA 1C8PA 2W1NA 3SBWA 3ARUA 4I0PD 3TH4T 3I9GL 4FTVB 4OIAA 2VOTA 3LKNA 4ZOBA 2Q8BH 2G2RB 3HNSH 3TBYB 1CG9A 5BCAA 5TE4H 4KVNH 1MJ8L 4QRPA 1ZGLB 1AGFB 2PCPB 5KSAD 2EDRA 3GSRA 4NQXB 3OKLB 1JYNA 4LHQB 1GZQB 3IXAA 3ZT5A 3RY6A 4LMQE 1OF2A 1XH3B 1Q9WB 5F7FA 3BH9B 1DLHA 4H88H 3RGHA 3ULUL 2CLRB 2YD2A 4NQDA 3CSBA 3ZYOA 2KQNA 1AO7A 1C5BH 1DBBH 2BRQA 1B2WH 1KCSL 5L2JA 2IC2A 4ODSH 4DW2L 4H26B 3PL6B 2LU3A 3BH8B 3LN5A 3SJVD 4QXTB 4KJYA 1NAMH 3BUYA 5EU6E 4I4WA 5DRZA 3RBSA 4LQFL 3RKDC 3WNMA 1CK0H 1JNJA 15C8L 1NC2B 1OP9A 1WTGT 4WNQB 3S5LG 3NAAL 2EDKA 3WUZA 5J12C 1ZANH 5JO5B 2A6DA 2WP3O 1FSKC 3OAZK 3JUYA 3HR5B 2Z31B 3KXFB 3VFOA 1A7PL 2DQFA 4NHUA 1A3RL 1P6FA 4LVHC 1H3UA 5JZ7D 2A2QT 3HNVH 5D7JB 3RWGA 3C5ZA 3QQ3A 1PX4A 2DIBA 3SO5A 4HK0A 1WWCA 4ELMB 4WUKH 5C70A 2E27L 4L8BB 1QNZL 1HHJB 1OPGL 1H8SA 1AKJA 3DRTB 1RK0B 4LRNL 3Q6FB 1YN6A 3H7BB 2CSPA 4RCAA 1G7QA 2EXWC 2QQLL 3VRJA 1EJ6A 3K8KA 2VJXA 3LHPH 5E8DH 1LMKA 1WIOA 2ZUVA 3FOMB 1N0LA 3TN0B 3WFCH 4WUUD 4KKBD 3LDBC 4C4KT 1NUFA 2XWJB 4M4RA 5IHUH 1CXKA 4RMUA 1YEDA 1FC1A 3FMGL 3QCUH 4R97C 1NFDE 1GCFA 5E1HB 3V5DB 2J4WL 2APXA 3MV7D 1FO0A 5GSVA 1HOCB 4GG8A 3G6AB 5IK3B 1QHOA 3UTSB 2VXUL 1QZ1A 2FHBA 1DFBL 4DTGH 1YUHA 4JDVB 2EC9T 4N90E 3PWUA 2YN3A 1KPVA 4LAQH 2BVTA 1WAAA 5JHDE 2J6EH 2Q6WA 4KTEL 3TA3B 3I6GA 3MV9B 4XP6L 3GI9L 5T5FL 4K94H 5J0BA 3QDJB 1RAMA 4XNQA 3REWB 4Y0GA 5J6GB 1EK3A 5DVKA 3TJHD 4XP5L 1CGSL 4IRJA 1DBAH 4H1LH 4XAKD 4X99A 2WQRA 1ONQA 5DDHA 4CGTA 1NSNH 3B2UC 1D5IL 2VRAA 3QEGL 4YHPA 1T1ZA 1XZ0A 2B7DT 2VL4A 3CU7A 3MLRH 2NY1D 1TJIH 3BHBB 1Q0XH 1A6ZB 3FO2A 1KG0B 5CZXC 3MO1B 1N0XL 2HKFL 2DQDL 2H26A 3HC4H 4HUWB 1NLDH 2MPAL 3RUGF 1VKXB 1T0NB 2ARJQ 2ED9A 4RGOL 3SQOH 4C56D 3PGDA 3DSFH 4Z7WE 2XZQL 4Q2ZB 5I17B 1IC5L 3PV6B 4FXGB 3ZT6A 4LMQI 1MIEH 3RPKA 3X14B 4UV7L 1DQDL 1G7QB 3EOBB 4LPWA 5I66B 2N4IA 5JW4R 2DWDA 5ETUB 3QRFM 3HZVB 1QHPA 5C71A 1DQTA 2NW3B 2ICEA 1LEIB 2HG5B 4ZTPL 2VC2L 5EU4B 2AS5M 1I1CA 4IJ3C 3LN5B 2EIZB 3LKSA 3FO1A 5I1KH 4M6MH 1BBDH 1ZVHA 4F7PB 4PV9B 3CLEH 3DO3A 1T21A 1AXSA 1ITCA 4Y5XB 3U9UB 3GSVA 2GSGB 2FBJL 5BXFA 4XNZC 1IEAB 4HJGA 3AVEA 4JM4H 1BJ8A 1YN7B 4OCXL 3BZDA 1KELH 2Q7YA 4YHLH 3VW3L 3W39B 1EAPA 3X11A 2E7LA 2AQ3A 4UV4H 4ZD3L 4M3KB 4APQC 4ZFFA 1GXEA 2J8HA 4JN2B 4UBDD 4WY7H 2VQUA 3BKML 2Y6SC 1BREA 5IW1A 5FGBA 4N0YL 1RI8A 1BQHG 1H3VA 2APWA 3GMOB 5HDBF 2DIAA 1JWUB 5IQ9A 3RNQB 1MCEA 4JFYA 1UJTA 2X4UB 3QDJD 4EVNB 3EYFA 3BIKB 4CU8A 4HT1L 1WCQA 4GBXA 3U0PB 4HZAA 5IKCB 1YYLL 4RGND 2OXHA 2R2BB 1F2XK 3AM8A 4UB0L 2NX5A 3P0VL 2CDGB 4LQ1A 2A83B 3E6HB 3P0VH 1EFXA 4UDTA 4N5EC 4BK4A 3B8SA 4LLVA 3S9DB 1JZ4A 1LE9B 5FECA 3GK8H 1IAKA 3PWVB 2AV1B 4Q2ZA 3C2AH 4L4TB 4M48L 2C7UB 2ZCHH 5J6HA 3H42H 1RIHH 4A6YL 4Y4KA 5LBSH 3MRCA 3FCTB 3RZCA 5IBLC 3QUYB 3BWAA 1ZVSA 2AV7B 3S98A 5T3XE 3QH3A 3ARFA 3BN9D 4IMLA 1WZMA 4OZ4A 4G7YL 3IJYB 1O5DT 3MNVA 1KJ2H 1NBZB 2HKFH 4F9LC 4U1KB 3ZLQC 2Q3AA 3MRGA 4L5FL 4YGVA 5CINL 5BZWA 1JGVH 5DJ8B 5DQDL 3T0EB 4LLUA 1R24A 1IGIH 4UIMB 3PIQB 1IGIL 2V5RA 3EHBD 3HCVA 4M7ZC 4U3XA 3P4MB 1MAJA 4FFYH 5EIIA 1LEGB 3VFVA 2QL1A 3HHRB 4W6WB 4AEHL 4QGYA 2YPLD 2IMMA 1FLRL 3EW3B 1LK2A 4FXLA 4Q9RL 3MRPB 2IAMB 5DEFB 3HNTL 1HWHB 2ZUSA 1L6ZA 2W65B 1DN0B 1KF9B 3OR6A 3LRGA 1MRFH 4KGLA 2VZVA 4QNPF 4Z7WB 1HXYA 3PABA 1WIUA 4XPHH 1MREL 5GSRA 5SX4H 1U8IB 1KEMH 4ZFGL 3VD4A 5I71B 5ISZD 4NT6B 3CVIH 2A0LC 4G80B 1AQDA 4KV5F 5DUBB 4ZTOL 2GYSA 3OXSB 4ENEC 4ZXBA 4ORZC 2G9HA 3S4SG 2NYYC 2I9TB 1XGQA 4FXKB 1NUGA 4RWYH 2JCCE 4XPFH 1DQLH 1ZT4B 1KLFA 1DVFD 4L8SA 4QOKE 5AAMA 1I8LC 1HHGB 4KAQL 2QJDA 1TZHA 4DKAA 1OAZL 5F1NA 1W0YT 3EFDL 1HHHA 3JXAA 5DJZA 4LCUA 3OSKA 4MCYA 1Q9LB 1OT2A 1QFUH 3L3IB 4F33B 3QUZD 1MJUL 1MFEL 1FP5A 5A43C 4O5LH 3QHFL 5DMIL 3F7RA 3QDGB 2Y36H 3V95A 3ARQA 1S7XB 2HT4D 1JN6B 2PUQT 5F8RC 1LWRA 1RUAL 4JFEE 2B39A 3O0RL 3TNMB 4NCC1 4I3SH 2VXQH 4GBXC 1KCRH 4F8QA 3X13A 5EUOE 5CEZH 4MA8L 3BAEH 5I8KL 3T08A 4BZYA 1WWWX 2WWMD 1A4KB 1URLA 4D9RE 2DI7A 4HF5H 4ONGH 4GXVH 3Q2CA 2FHCA 4HMEA 3FQNA 1U3JA 3WLWC 3D1MC 1CXEA 3VFPB 1KJ2L 5C0AA 1F5WA 4WHYH 4HKXA 1KTKE 4M1CD 4WI2A 2AXFB 3MRIA 3I6KB 2CIIB 2AKRB 5E24E 2RB8A 4ODTL 4KK9C 3VH8B 1TZGL 4GW4B 4PREB 2HFTA 4PJGA 3LDBB 3MOAH 1RJZB 1QSED 4M3JA 3B9KA 3TM6A 5AG9A 3KPQA 5TDOB 2DQFB 4DZ8B 4MD4A 2W0FB 4YH6A 4MNQB 5C0JB 5KVFL 5C0FB 4KMTL 2CKBL 5TGBA 1DQJA 5EBWB 2FD6L 4TUJA 4LDEB 4QCIA 5TDNB 3CZJA 5HHOB 4HBCH 1I9JH 4XAWH 5EUOF 5C07A 4YK4C 2J5LC 1MRDL 1JZ5A 5EUKB 1V05A 4YPGA 1XF3B 1FC2D 1IKFH 1M4KA 4OV5B 1GH7A 3VGBA 4QRUB 2DTMH 4U1JA 1YNKL 1FRGL 2YRPA 1TQCC 3CMOH 4LCUB 3OX8B 3RGVD 1MFAH 2YA0A 1CXLA 4X9GA 1AXIB 4Z0BH 4E42B 5A16B 5EC1A 2OYPA 1BD2E 3DSFL 5E2VH 3LEYL 4NZTL 1FORL 2WINB 1K4DB 1FO0H 3QULB 5C0EB 2NY5C 3P9LB 3PQYE 3KJ6L 2H9GB 4R4BA 5KSVB 1KN2L 2EXYC 4YC2B 3ULUE 4UT6H 2A73A 2JIXD 3EIFA 3KPRA 4PP1D 3LD8C 5BVJB 1A4KA 3RIFF 5GGVL 4GMSL 1OL0A 1FLRH 4HG4K 3VFMA 2EYRA 5F1KC 1P4IL 5B38G 4H8WH 2ZSWA 2X09A 4OCXH 5IESH 2XA8L 4NQCE 4GS7B 2P5ED 4K71B 4U1LA 3D2UB 5C0BB 3D0VA 5GRYA 3EGSA 5A3ID 1C7SA 5JXEC 3QFJA 4L3EA 1MFBL 2W0FA 5K9QI 1KEGH 1A7OL 1NCCH 3HMXA 2VUOA 5FHBL 3PWNB 3OF6D 2HFGH 4Y2DA 1AGCA 3QEUA 1GZPB 2B5IC 4UT9L 5EORL 5D5MA 1CFQB 5J13B 4MAYB 4L4VA 4F2MA 1MCLA 2QSCL 1HINL 3KJ4B 3VWKD 3WEXB 1LGVA 3JWDH 1A1NA 3VE0B 5FUOL 1E27B 4QRQB 4KKAD 1JWMB 1OGTB 4K7PY 1KJ2B 2NY0C 1NC4D 3NA4A 4XI5C 2YEZB 4CRPA 3AREB 5H94B 4OLZL 1QSEE 4LBEA 2Y5EA 4JPVH 3MRQB 1FVEA 2H8PA 3ZKXC 2QKIB 2PXYA 3CSYA 4ZNCD 3HI1A 3DWTA 5IB5B 5E2UL 3V4VH 1T80A 3VDAA 1U3HD 3WHXB 4FZ8L 3D5OF 3O11A 4CN1A 1GGCH 4Y5XA 1RUAH 5A2JH 4LEXL 5I74C 3NCYS 3VXRE 2VDML 1P53A 1FHGA 2DN7A 1OT1A 3ARBD 3DNKA 4FTVD 2EDDA 4M6NH 2BJML 4LGRB 2DLEA 4LPVA 3STZB 5HYJB 4K2UL 4XVTL 3QUZC 3C8KB 3ARED 3W0WB 4JEGB 4AM0B 4XI5D 1Q9KA 1U8JB 4TUJB 1NAKH 4JFEA 5IMKA 1VCAA 1E4JA 2VXSL 4WI9A 1A4JB 5HGHB 1KIRA 2OI9C 2BOBB 4P2OC 3VJ6B 4CMMA 2X40A 3IJHB 4OFPA 5FGBC 4U6YB 2B4CH 2XZAL 4NKDB 3MOBH 5FOBA 5KS9E 4PD4J 4R7NA 3QI9C 2NXZB 1JPGA 4JFPB 5DVMA 3RJQB 3S8WA 3JWDC 3MLYH 1RZIB 4JFQA 3LH2L 5EN2A 4MJID 5FM5O 1P7QD 3O2DA 4BZ2L 4HIJB 3WNKA 1EZVY 1ZS8B 3UJIL 5KN5A 1PG7X 3MLTA 3LQZA 3TVMD 2R1WA 3WXWL 5GGRY 2XTJD 4PJHF 2BC4B 1T0PB 2IG2H 3OJDA 4F7EA 5BMFL 5BJTA 5AG8A 5EH1A 4TNVF 5JOFB 2R0WL 3ELAT 4EUPA 5JW4M 1TVDA 5F89B 3SDAA 1A7RL 2AK4A 5IB5A 3DX9A 2AGJL 1U8HB 4XNMB 3DHJA 5J1SC 4FNLL 3LQAH 1FNGA 3IXTA 2P1YA 4X6CA 3QFJE 1R24B 4MAYC 3PQYD 2ZUQB 2L0DA 2FGWH 5F44A 1T83A 3Q5OA 5CIPH 1OB1A 1S9VA 4PJDA 2JJVA 5C0GB 5CGYC 1PFCA 4M8QA 2FX7L 5JHDA 2XKSA 3CLFH 2IGFL 4P2QD 4PRPD 4PJBB 1UXSA 4NM8L 1X5AA 4IRZH 1NGYB 3PDGA 5HHMB 2AXHA 2XZCH 1HILA 4OGXL 1PGRB 5J6GA 3TN0D 4Y16D 5ADOH 3MBXH 3QISA 2IQ9L 2D31A 4M5YH 3F8UB 4XT1C 5I73B 5FO9A 2HH0L 2DI8A 4OTXH 4BH7B 5JPMA 1S3KL 5FA4A 3F12A 2FLBT 4EQ3A 4GW5B 3SDCA 1UA6H 4HUKB 1QSEA 5DHVA 1NCCL 3S88H 1EO8H 5CGYD 2Z8VC 2ZSVB 4TVSa 1R0AH 1R5IA 3QWQB 5IFAH 4PUBL 5IG7A 5C7XL 1TCMA 4MA1B 1UB6A 1QYGL 1G7JB 4NC2B 2R69L 3V5DA 2MQ3A 3CFBA 4JZNB 1CLZH 5H2BB 2DQEL 3QUZA 2FATL 1OTSC 5JOPD 4P3CL 1IAIL 5EBGA 4BQ6A 3NBNA 2LTQB 1U95B 1J12A 2DB8A 3VGAC 5FM5M 4NC0B 5FV2A 1U41A 3QZWB 4HGWA 3GHBL 3D18A 3OAYH 1OAQH 4IDLA 4LLYB 4X7SH 4MJ6B 1IC1A 3UJTH 5IOPA 5IEHB 4OT1H 4LCIL 1WK0A 4UDUA 2OS7A 5EC2A 4C56A 5TF1L 3MXVL 1MCNA 1MHPL 2FWOB 3DVGB 3SN6N 1U8MB 3ILQD 5ILTL 1DBKL 2C1PB 1G6RA 4PTTB 4HV8A 4PP2A 5DFVD 1VGKB 2DIJA 1DUYA 4KHTH 3VCLA 1F90L 2IG2L 1VACB 3JWOH 4YXHL 3DIFB 4PB0H 2DQDH 3QSKB 2VLRB 1IEBB 3V6OA 3VFRA 1KCUL 5HGAA 3M17B 2PYFB 1T0NA 4J2XA 2W9DH 3LN9A 4FNLH 5KSAC 1CICD 3GI8L 2VDLL 3STLA 3BP4B 4LHUD 2F53D 2QHRH 5KN5B 3EUUA 3MLTB 4PJEF 4GG6A 3SO3B 4ZUUB 5IW3A 3MRMA 4WW2A 1VHPA 4UU9B 25C8L 1ETZB 4MB5A 3OKMA 4JGJA 4PJ7F 4IM8A 1JMZA 4XBPA 5L8KB 5KG9A 1FH5L 2XFXB 4KY1H 4A2LA 4HCRH 3EDKA 1N7MH 4PV9A 3SE9H 4NOFA 3GIZH 2Q87A 5L2KD 3FQTA 3A6OA 1HH6B 3P4LA 3IFOA 2WBJD 4QY8A 2APFA 2DI9A 2BNUB 3IYLW 3TBVA 5EULV 1RUMH 2DQCH 1A6WH 2XY1A 5CUSL 3VFSB 5L88L 1U95A 3RWDA 1Q0XL 5DD1L 1WV7T 3HRZA 5KSBF 5JPNB 2FR4B 1S7QB 4MVBD 2YD5A 2C3XA 5IVXB 2N7AA 2GAZA 3WE6B 4OIIH 3L7EB 5IEKB 1TETL 4WWKB 3ZE0F 2WINA 3O6FD 3PWPA 5E9DD 3BEWB 5C6TH 1KB5B 2G75B 2ICCA 1QO3A 1G6RB 4PJ8A 3RVTC 4X6DA 1D5BB 1A6AA 4G6KH 2IPTL 2FO4A 4X5XA 3HC0B 2UVFA 4NZUH 2VLRA 3F7YB 2B5IB 3FQWB 4FQQA 1N4XH 4WTXA 2BK8A 2ED8A 1W2KT 3VFNA 4O58L 4ZAKA 4R96B 4GRWH 5KAQF 2IAMA 4O58H 5K59E 5EU7C 1Z2KA 4OT1L 4M00A 1ACYL 1IGMH 3ME0A 5DHYB 1JPTH 3E1F1 4OZHE 1TVHB 3ZKMC 4M61B 3MFFB 4DAGH 4JE4B 2ID5A 4FQXB 4OB5H 4OTXL 5ISZB 1OOAA 4N0FB 3FN0L 1Y6NR 2CRZA 3MRCB 4NO2A 4NQDD 1JF1A 2ZCKL 3OHXB 1U8KB 3MOQA 4P3DB 2XWBB 4O51A 2BFVH 3VD3A 4E41A 3QJHA 3C60D 4NWTL 4EI6B 1OAUH 2GUOA 4Z7UE 3L5WB 1IJ9A 3MRGB 2ARJA 5DK0B 4Y4FD 3EYQD 5HI3C 1P2CA 3C8DA 4GAGH 4JKKA 4TVPE 1XR9A 3JWNC 4G9FB 1A7BA 2HRPH 3SKMA 1EFXD 3QNZB 3BKYH 2KDGA 1XEDA 4PR5A 5I1DA 1V3KA 4N0UE 2X89D 1Q0YL 1YEDB 1G9NC 1CU4L 3B2VH 5EIVA 1Y0LB 2D0FA 3FFCE 3T65B 2W65A 2BY2A 4OUUB 5IFJA 5C92A 3QNYB 5FO7B 1DDHA 1KIQB 1OARL 5LXGH 2BSRA 1C1EL 2P8PB 2DQIL 4NN6C 4LLMA 3BP6B 4L8DB 4U3CA 4WHTA 3AB0B 2VLLB 4PRIE 3HUJB 5ACLA 4KV5E 3VXQB 2XKUA 4NJ9L 4S1SL 1ZAGA 4YIQB 1ZLSL 4QEGA 1I1YB 5J1AB 3BE1L 3ULSA 5DO2D 4OM0L 3V7MA 5A1AA 2BHYA 3FQNB 5L2KE 3PP3H 1EH9A 4RAVB 4OF5A 2PYEA 1VGEH 2DTSA 4R7DB 4WHYG 2VH5H 1IAOB 1LO3L 4NO0A 4DVBB 1ND0B 5IIEA 1T66C 3K8MA 4XNXL 1YPZB 1BM3L 5DD3L 2P48B 4FQIL 4PJAB 3NGBC 4XWOC 5F1NB 4YHPB 4M02A 4LSRL 1CE6B 4MQXD 4J3UA 3V79C 4OZIF 5JPNA 1JPGB 1MFEH 1P7QA 1NCUA 2R0KH 2X9XA 1P6AB 4JFQB 4RAHA 3N9GH 4OJFH 1FL3A 1G7MA 1CBVL 2HT2D 5E0QA 2AK1H 3MGOA 3AAZB 2COQA 2DWEA 1E4XL 1A0QH 1WTLA 3MJGX 3X3GH 1EGJL 5I6XB 1BPVA 4QO1A 4GRLB 4ZD3H 1NUDA 3RPIB 1CZ8L 2Z91B 1X5HA 4LCYA 4K8RL 5D1XB 2JJSC 1Q72H 4ISVA 4NM4H 3BQUD 3VD5A 5EC1B 1IILE 3MSPA 5F1OB 4JFED 4X6FB 1KNOB 2F8OA 4MJIE 1JPST 3B6SB 2VDQL 2R69H 4KRLB 1MJ7L 2XKNB 3HFMH 5DMJB 3HUJF 5F7NC 2LV4A 3FFDB 3SDAC 1HINH 4Q6IA 2EZ0C 3VI4F 4CMHC 2AKRA 1A9EA 2WUCL 3X12B 1KLGA 4OKDA 1FFPB 1MJUH 1J88A 5TFSL 5H35B 3VXUD 1FFQA 3PGCB 4JFZL 1OSZB 4MVBC 3HNVL 4EXPX 4FG6C 3LSOB 2ZOKB 3NTCH 4RMVA 1DQJB 1J0JA 1G0YR 2LAAA 3T0XA 3VWKA 3EYVB 1NCBL 4MA7H 3GK8L 4ZS7H 5J1TC 5IJVB 1P7KB 3PWLB 2FJFA 4HZLB 1F4YL 1J1PH 4X9HA 2W0PA 3LKPB 2A6DB 4JDZB 3WJLC 43CAA 4QF1A 2FYYA 4Z7VB 4JHZA 4IIQA 4N8VB 4NQDE 4AENA 1FNSL 5GGRB 1BOGA 1K8IA 4MAUH 4NJAH 2OJEB 3MJ9H 4FTVA 3F58L 4PJFA 3S5LA 2F15A 2LVEA 5A16A 1NQBA 3NCCB 4H5SA 1NFKA 4JCLA 5D70L 1MQ8A 1WWAX 3WJJA 4D2NA 3ETBF 3H3BC 3RDTD 1K5NB 2WLYA 4WW1B 1HZHL 4Y4KB 4ZQKA 2R2CA 4I18C 1I85C 1HHIB 4KTYA 3BGFB 4PRHD 2X7LA 1X3DA 3H3KA 1OLLA 4L4VE 3ESUF 2Z31D 3OKYA 1FFOA 4KJYB 1QSFD 3VFMB 3RFZC 2GI7A 2D4FA 4JM2B 5C09B 3B9VA 4Q74A 3OQ3B 3SGDH 2FBJH 3QXAA 1BQLL 5E6IA 3M1BB 4U3HA 2R2HA 4HKZA 1BQLH 3GDBA 5FYJE 1MH5B 5E9DA 3FQUA 5GHWL 3T3PF 3HR5A 2P7TA 3MJ8B 3O9WC 1QSVA 1F11B 4PJ9B 1FZJA 2H2SC 4HWUA 3SEPA 4FFZL 4DWHA 4RSVA 5E5MB 1MFBH 3HR6A 5J4MA 1Q9KB 3MNWA 4ZSOE 5KSBE 1NC4A 1VENA 3KLHC 3BPNC 2ZNWA 1QLEH 2Z31C 4GKZB 2BVOA 5BVPH 3OKNB 4NZTH 3S6CA 1REIA 3VXPB 2G5BA 4KQ4L 2IADB 3MGOB 15C8H 3LRSB 1T83C 1MIEL 2VLJA 3SKNB 1BF8A 3KYAA 5C6TL 1E27A 2DKUA 3FT3B 5I8OL 5FYKH 2DM3A 5ICZA 3Q6FA 3TBTA 4WO4D 5HGDB 4AQ1B 4Z7VA 5T1DL 3EFDH 4X98A 4XHJD 1LO0L 5EZLB 4P4KC 1TJGL 4Z7QF 2QKIA 1I3RA 5HJ3B 3ZDYF 3AREA 4FP8H 3EDJA 1N4XL 4NQEE 4ORGA 4WW2C 4YR6B 3TIDB 4RFOL 1KNOA 5IW6B 2YSSA 3UBXB 12E8H 4PGEB 1L7IL 2L7JA 3QP3A 2C1OB 4HPOL 4YO0A 1EMTL 1PYWA 5C0RL 5IFHH 3JZ7A 3EJYD 1SJVA 4X5WA 2ZG3A 4GW1A 2VQ1B 3GJFH 5E1AB 2OK0H 2X9YA 2XQYG 5CJ8A 1M05A 1DEEA 4Z78B 5DS8A 1QLRA 3UTSA 1BGXL 5EO1B 4WFFE 5I76A 4OZGA 5FM4A 3U83A 5INCB 1UACH 1V3LA 5AD0A 3EO1A 2D9CA 3SY0A 1J5OH 1XGTB 3ARWA 2JK5B 3PWUB 4YX2H 1CICB 4HDIB 1J05A 2NTFA 4MD5B 4YX2L 1G0DA 5HDBE 3UTTB 3V2AR 3TFKC 1IT9L 3KNBB 5I15L 5FYJL 1RZJL 1CFTA 3F58H 4XX1E 3MV9A 2DAVA 2J3SA 4UILL 3KPMB 4YHZL 5J12B 3LVEA 4JQVA 5CAYB 4LIQL 4Z8FL 2PYEE 7FABL 4AH2B 5D2NA 4LIQH 1INEL 5BO1L 1YN7A 4Z8FH 2EDEA 3CX5J 4LVHB 2VISB 1IE5A 4ZDHA 1S9VB 3T77B 4PJ9A 4KH2A 5IBTL 3FB7B 1I8MB 2NY6C 5MP6H 3L3OA 4LSSL 5E8OA 1PKQB 2PKDA 1RJYB 2VDNL 5DD5H 3BSZH 5ITFA 4FQ1H 4H5SB 1UYWH 1YEIL 3L3HB 8FABB 4NNXA 4KI5F 5FXCH 1YNLH 2DM4A 5F1SA 5JXAH 4N8CH 5DUML 2QQNH 5I1AB 2V7NA 3VXRD 1UC6A 5C09D 1O0VA 1ZWIA 5EZOL 4IDJH 3LCYA 2H2PD 4X9IA 3EOBA 4U1GC 5IWLA 4UIKH 2GT9A 4NDMA 2DTML 1QBLH 3P3YA 5EZLA 4AIXA 2SEBA 5FGSA 1A7NH 4R4NC 3LEVL 3PV7A 1JZ8A 1N59B 1RJLA 3WFZA 3FRPA 3BP5A 3CXDH 2HT4C 2V2WB 5FFLA 2D0HA 3NN8B 1AD0A 4JM2A 3QQNA 2ZUUA 1FGNL 2MKLC 2R29H 1IC5H 2Y5TB 3RWIA 4I1NB 2C7UA 3C6LC 1MFCL 1KN4L 3OAUL 1YEJH 5GRUL 4P57B 4F3FA 4H0GA 3VI3F 4CDHA 2GSIB 4NKMA 5C2BH 1MWAH 3WL9A 5IV2A 2VUYA 4Z7NE 5HYEA 4U6XA 3MUGB 4H20H 5JW3H 5C6PB 1CICA 1FNEB 3PHSA 4RNRA 2YUZA 1LHZA 4ZFFB 3LH2H 3NOIA 1T7YA 4PJDF 2CKBB 5BW7C 1KTDA 2YXMA 3MUY1 3OG6B 2OZ4A 3QNYA 4JO2H 3KPMA 3RDTC 2PETA 1T7WA 4LASL 3NGBB 1WT5A 1YEKL 4X7TA 5KANG 4KKCC 4OD3L 3DMMB 3MBXL 2HLFC 4KPHL 1JYVA 1TFHA 1U6AH 3C2SA 2XA8H 3BDYL 5KW9H 5D7JD 1AI1L 4AQOA 4OD1H 4P3WA 3O2WH 1VACA 3O6LL 5J3HD 2UWEB 1KBGH 3RY6C 3O6LH 3VXUA 1RY7B 3GMQB 5DJAA 1HH9B 4WTZG 1DQLL 2V6HA 4J1UA 5B4MD 4YHZH 2IFFL 1PVHA 3ULVL 3SKUD 2G60H 4ZPVB 5K9OB 5EFIA 3DO7A 3WFBL 4KTDH 3UROR 1G7IB 5IT2H 3U2SA 2MMXA 2R23B 3H9SE 4WV1C 2B0SH 4W4OA 2Z93B 2JJTC 1HYRC 2CQVA 1RURH 4ZXBB 4IRZL 3QJFA 5AWNL 5D1ZC 1BOYA 1CGUA 4PJIE 1OP5H 4FQ1L 3HI6H 4DK6A 4HWZA 1JK8B 1JHLL 3V4UL 3CSPA 3EOAA 2XQYK 1QFWM 1N2RA 3H8NA 5DMGC 3BUTA 1ZT4A 5DJ8A 2WAHA 3MRRA 1GOHA 5B4MC 3DBXB 1C5CL 2A9ML 1Q9OA 2I5YL 1MOEA 4LHUA 2BJMH 4PP1C 3WHE0 4RGNC 3MRJB 4NQEA 1ZA3B 1KJVA 4QYOA 4XPGL 2W0KA 5D4QA 3V5HA 3LB6C 4X6DE 4Y2DD 3V0WL 2FB4H 3QI9A 3QCUL 1L7TL 3MLVH 3RIAK 2F5AH 3H7LA 2XKNA 4XPTL 2X2YA 3BPCB 1WZ1L 3D85B 2WANA 3OKOA 3TN0C 2AJZB 5CSGA 3BP4A 4PLKC 2WMPA 4PJ8B 4HK3N 2YD4A 3ARBB 1SMOA 5F8QC 4H1LB 4I9WD 1CYGA 4DUWA 4Q6IC 4P9ML 1BMGA 4TYUA 4NQSB 3PXHA 5J9PB 3HPJA 4LU5L 3KPRD 2R1XA 1F6FB 5CEYB 3DHMA 4JRXE 4DGYL 2VSDA 3QT2A 1HH6A 3B4NA 1IMHC 1J9CT 1MCIA 4N8CL 5DUMH 5E8PB 4N0UA 5GS2H 3NPSC 4KKAC 3IS0X 4MNHB 3WL9B 1BZ9A 5L88H 4MNGB 2DYPA 5DC0A 3KHQA 4JFFE 3L7FB 4NUJA 1DN2A 1WISA 1FIGH 2ADGB 2OBGA 3KPPA 2G5RA 3QIWA 3MRHA 3K1KC 4NSKA 1G7HB 4Z0XB 3DTXB 5T3ZE 2NCMA 1MCFA 4IIQC 5F9JA 3SDDD 1EX0A 4K3HA 5CBAB 3QWOA 4AYFA 1KYOJ 4PTUB 1GJIA 2VH5L 3NFSH 2R39A 3KYOA 3X13B 2QSCH 3MRRB 1X44A 5FO8B 2BERA 1UQSA 1HSAB 5DYOB 5BQ7B 1F8TH 4PRID 3MLXL 1CFSA 2GTZB 3D0LA 1J18A 1AIFB 5GZNC 4PRHB 5DLML 2VQTA 3FO9B 2V9TA 3IKCB 4B41A 5KS9A 5E99H 1SBSH 4JJ5B 4QTHB 4GAJH 1DUZB 4YHMH 2BNRD 4YHML 1S78C 1HXMB 4PG9A 1J1XL 5JW4Q 2DF3A 2BSED 2GK2A 2HKHL 3OKOB 3MTRA 2R2HB 1MNUL 2YBRB 1S3KH 1H3WM 3HUJA 1X6NA 4OD1L 2OSLA 4RMSA 5C0FA 5HI5C 2YRLA 1FFRA 1S7VB 1MCHA 1IT9H 4LCWE 1JE6A 4C58B 5JQ6L 4PRBA 3O9WA 3OPZH 3ZYIA 3KLDA 5ICXB 1KCLA 1T5XB 2GITB 3VA2C 2DLFH 3V8OA 1IAOA 4CVWA 4ZOCA 4QHKJ 3RRQA 4BUGA 3CK0L 3M45A 3MCKA 1BVZA 1F6AA 2YK1H 3O2VH 2DBLL 3JSSA 4LSUL 4V1DB 1UM6H 5TE6H 3RWJA 4QRSB 3F12B 5F70A 4OI9A 1C08B 5ENWA 1OAYL 1UVQA 2A77H 5C8JA 1XIWC 1YY8A 3TPKA 4U6HB 2X4PA 5FCSH 1U58B 1FN4A 1VFUA 2IPUK 1RULH 4JFDD 4X0KA 1PYWB 5E8NA 4S1DD 1JL8A 3CPLA 1JPTL 4L4VB 5GGSY 1OSPL 2ICWA 1IGCL 2QQNL 1MWAB 3O3DB 2D7NA 2JF1A 2L7UA 3QDGD 4OZGE 4JFOB 4JN1L 5MHSD 2ILLA 1FYTE 5DRNB 3E3QE 1ZHKB 1D7FA 1BVLA 4XP9H 1FYHB 1Q38A 1WFUA 2ZKHL 4XP9L 3STBA 4OGAC 3TVMA 3WJJC 3BUYB 3BESR 3TIEA 3V8CA 2DL2A 3FB8A 3GMNA 2WW8A 5T1KA 3FB6B 1KN4H 4G43B 1MIMH 2PCPA 4RBPH 4F9LA 3GGWB 5EO9A 1TNMA 3IU4L 1BZ9B 1HZHH 2W9EH 3WCYA 3MGAA 3RY4A 4WO4A 1MCKA 3DXAA 1V3MA 1LEKA 2R8SH 1DUYB 3MGTA 4XNZB 3DI3B 4LPYA 5FKAA 3V0VA 1T2JA 3H9SA 1QRND 1ZK9A 3L5XL 4ZFZB 5IBUG 1OM3L 4ZO6A 5DJ6A 5L9DH 2VAAA 3OJVC 1DBJL 1HI6B 1A6WL 5CUSH 4EI5C 5HYSB 2HN7B 4FQHA 3DGGA 4OD2A 1DLFH 4Y8AA 3REVA 1F3JA 3RX7A 4NO3A 5DYOA 3NIFF 2J8UE 3F7VB 5BQ7A 1ADQL 2ADJA 1QLFB 4MSWB 3UTSD 5IR1A 1W0WB 4OKVB 5GGQL 3SDYL 1JRHI 2PN5A 4KZDH 1Z9MA 5FEBA 1AHWA 1C5BL 1OW0A 3ZTJG 3JTTB 4BFIB 4M93B 5E03A 1NFIA 1CZ8H 4ZTOH 3BP5B 4LBEB 1YNTB 3BZFA 5ADPL 1R0AL 3SQOL 4V1DD 1RHHA 4JY4B 4JO1H 4E41D 3KYKL 4J23A 3MV9D 1KENH 2OTUA 1P9MA 2I9LA 2HMID 5E7BA 3T0BA 3TYFB 2DDQL 3H7BA 1J8HE 2FATH 3GSNH 4JFOA 2AQ2A 2WIIB 3D39E 4HH8A 4YDKL 2BVYA 5D7LE 3CFJB 3DI2B 4ZFOA 2FJHA 5GS1A 4X9FA 4IOFC 1RUQL 2R0KL 4JFXB 2W07A 2CGRH 2VLKB 3KG5A 1MAML 4KK6D 4NN5B 4P2OA 1SQ2N 4YXKH 2WBKA 4NKIL 5F88B 3WLBB 1XR8A 5KAQG 4MJ5B 3UEZA 5IB2B 5JW4N 4DAGL 2EKSB 3BOVA 3LKRA 4D9LH 1D5ZA 1V7MH 4NGHL 1A0QL 5E94A 2HH0H 5ID0B 4MS8C 1T66D 43CAB 3EO9H 1U8OA 5I8CB 5E9DB 3TCXA 3RAJL 2VDKL 2FLRT 5A2LH 4Y19B 4D0DB 1H5BA 4S0TD 2DMBA 3PE9A 1A6UH 4U6HA 2JCCA 5H37G 5JZ7C 4TSCL 1OAUL 4ZMAT 4P5TB 3QQ9C 3O4LB 2NX5E 2ZUXA 5D2LE 3O3DA 5CBEB 3U30C 5T33H 5IUSA 3G6AA 4Z7OE 3ZTJH 2HN7A 3X3FL 2VIRB 3HUJE 2QSTA 3AREC 3GKZA 4JCMA 4POZD 5TE6L 3I50L 4A6YB 4OFVA 4D94A 3TO4B 1KXQE 1Q0YH 2WNGA 3RWFA 5DGQA 5GGUA 4U05A 2EH8L 3SDDB 4HG4J 3WN5C 5C9KA 3BP7A 2DD8H 2DQGH 4Z6AT 4W4OC 4XAWL 2LQRA 2AJUH 1VADB 4K94L 3QUML 3B9KD 3DX9B 4XNMA 5DK3A 2DLIA 2CUIA 1R5WA 1F4YH 2VQ1A 3N1QC 4QHMB 4HEPG 3KPLB 1AY1L 1QBAA 4X4MA 3N1FC 5EO1A 2BSSB 5I8EB 4NRXA 1T6VN 4LCWB 2E9BA 5FA3A 4OLXH 5F9OL 1BLNA 2D7QA 3F6LA 2VNCA 3DV6A 5FYKE 4YXLL 2RGSA 3QCVL 3CCHB 5EU7E 4OSUL 3TWCH 2I25N 5D70H 1H0DA 5F88A 3BPLC 4UNVA 5DF0A 2NZIA 4P59L 4MXVE 3ARDC 4KKLC 4OZFG 3OKNA 1RZJC 1T5WA 4P59H 3P77A 4BSVB 2YD6A 4GXUN 5E94B 3VXTA 4F37K 1I7UB 2C1PA 3GSWA 2VLLA 3H3PH 4GAYA 1EVUA 3SE4A 3WNOA 4GBXB 4MWFB 3X11B 2AW2A 2IPTH 5ITFB 2H1PL 1HSBA 4LARL 4MJIA 1LP9E 1QPXA 1HNGA 3GO1L 4NC1C 3GMOA 4YPJA 2KKQA 5JOPE 4C56E 3ARDD 1F02I 1AXTH 1KOAA 2OZ4L 3W11D 4WI5A 2X1QA 4EXKA 3UTOA 2PO6C 1H15A 1TTUA 1DL7H 5MEOA 3QZWA 4NQED 4QHUB 1IFHL 4D3CL 1W8NA 3SPVB 5JIPA 4YUEH 1MSPA 2DKMA 3OPZL 3T2OA 1MJ7H 3D9AL 3KYMA 3U4EB 2OL3H 3GMRA 2UZXB 5KVDH 1J1OH 4YDIL 2ADFH 4U33A 2HVKB 4WV1A 1U8LB 4CVZB 4PP2B 5SX5K 4WEMB 2WP3T 2CKNA 3ARGA 4XCNA 3G04A 4Q7DA 2OLDA 2MNUA 1SJEB 2EYSB 1LEGA 3TO4C 2JB5H 4AIZB 1BFTA 1BEYH 3NACH 3UJTL 5T3ZD 2CH8A 2E27H 3D2UD 5DA0B 5C0BD 3KLHD 1NFDA 4YDJA 4JJHA 3LQAC 1S7WB 4K94C 3RWCB 1FCGA 3DETD 1K8DA 4JO3H 4HIIA 1HXYB 3ALWA 3FJTA 5B21A 4XP4H 2VDMH 5EOTB 3V4PH 1T20A 4GRWE 1CD1B 4J6RH 4EDWH 1X5JA 2K3TA 1SEBB 1CLOL 4U1IB 1CR9L 3PABB 4X6DB 2C4FU 2DYPD 3IKKA 3M07A 3GJFA 3UCRA 2GJ6D 4G80A 5DTFB 4GUPA 4XPAL 3ARFB 1FZKA 5D7IE 2CRIA 2JE8A 1BD2A 1NGWA 4H0IA 5MEPB 3FQTB 1K85A 1IM3A 3OXRB 4M1DL 1LDSA 2R0ZH 4P9HL 1E28A 2DICA 1FGNH 2R29L 4Y16B 1VGEL 5GPRA 1NLBL 3IS1X 2GJZA 1XFPA 2AJVH 4DOHB 1NDGB 5CWSA 1LE5A 3OKKB 4B53A 1ZE3C 3FKUS 1D5XA 5E9DE 3EDEA 2FZ3B 2YMXL 4Z7OF 3T3ME 2Q8AL 2NY7L 1OGAB 2UUDH 5M94B 1NGXA 5FAAA 5GGVH 3MJ7A 1NAMB 1FIEA 5CD5D 5DZNA 2FD6H 1NMCB 3O3AB 4BKLA 3I9GH 4EI6A 1XGQB 3CDFA 4EUPH 3JV0A 5GS2D 4OZGF 3P77B 1DBJH 1P4IH 2AJYH 1U92B 5F1IB 5I18L 3AFLA 4X4XB 4Y5VC 4ZQKB 5CCKL 2NXZC 1MREH 1HEZB 1NH6A 1ZLWH 4PG2C 1CD0A 5BS0E 2CRMA 1V7NL 2UWEA 3W9EA 1KEGL 5GGVY 4O9HH 5EWIL 3TVMB 1ORQA 3UYOD 1W8OA 1ES0A 5CD5C 1P4BL 4M03A 1JN6A 1B9ZA 1BFSA 4FXKA 1MFCH 4K9EC 1QTYT 4NQTA 1RK1B 4PJXA 5ISZA 2XRAH 3G6DH 4PLJD 1N5YL 3G6DL 1ZHNB 4OCSL 3CFKB 3FHQA 5DXWA 5IF0B 1A1MB 3JV4A 3H3PL 3ILPB 4YHIB 1HHHB 5IMOB 4Q9QH 3G08A 2R15A 3MRLB 2P45B 3QIBA 4JG1H 4OUOA 3QJFB 5F6HJ 5IGXH 4NO5B 1TJGH 1BZ7B 4LSVL 2ATKB 3QDME 1ORSA 5MERB 4R2GD 2I24N 4UB0H 2R4SL 3RWEB 4FHBD 5LG1A 3VXSD 3G6JE 4WEUD 5SWZE 2VLJB 1OAXL 1PLGH 5F96L 1JNHA 4ELMF 2BY1A 4C59B 2OZ4H 1DBML 1T2QL 5CJXA 1T22A 3FHAA 3QNZA 4OZHF 4PJCA 3QFJB 5DURB 3WBDA 1B4JH 3R1GH 3B9KB 3E8UH 4YFLF 3K2MC 3KPQB 5TDOA 1V8HA 1P5UA 5FYLE 2OX5A 1KJ3H 1R3JB 3TC9A 3MRHB 4NM4L 3SE3C 5IM7A 4XTRC 2DLGA 3KS0H 4MD0B 3T65A 2XWTB 2FHFA 4N8PA 9CGTA 1L7TH 3MLVL 4H8WC 4KGJA 4HLZH 1E4WH 3DRTA 4MGXA 4GW1B 2ADFL 3EYSL 1N5AA 4L8DA 3JTSA 3I6LE 3QHZL 4IRJD 4OZGB 3QO1B 1ZLVH 3I50H 2AJZA 5E6YA 5HY9A 4L29A 5CS7A 1KPUA 4JKLA 4KROC 3NA9H 1KYOK 4UQ2A 5HYQA 1EO5A 1VA9A 4K07A 4JB9H 5IWLC 1GIGL 2JIXA 2VDPL 1N26A 3T2NL 2HTLC 4ZPTA 1BEYL 5ESAB 2XPGA 1GPOL 3P4OB 4WRLA