35C8L

Catalytic antibody 5c8, fab-inhibitor complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG 5C8
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8L01
1BGXH 4XGZA 1MCDA 1TTFA 3IDGA 3BGFB 4HF5H 4O51A 3BN3B 1IM3A 4MD4B 5SX4H 5GSVA 3KXFB 4FN0A 3GSUB 4FQXA 4RFOH 1E4XL 5JW4N 4E42A 3TH4T 2NY4B 4HPOH 3OR6A 3RP1A 1KN4H 1LNUB 1XIWB 4I5BB 3PV7A 2JCCE 1C1EH 1IC1A 1JRHL 4F7MB 5IBUG 4Q9CA 4OCYH 5JDJA 3TN0C 4RFEA 3LN5B 5EU3B 1CFTB 4JFEA 2A74A 3U2SB 4ZTPH 4Y19D 3QXUA 6FABH 2EYSB 5FGBA 1NCAH 3GHEH 4LLQA 1DLHB 4QRRD 5IROA 3U9UB 1A6WL 4RFOL 1IEAA 5DRWA 2G9HB 2MJWA 1A7QH 2VXVL 5ADPL 1YEHL 1AHWA 2Q86A 5IVXA 2CGRH 2H1PL 2VLKD 1Z5LA 1TENA 5DTFB 3MLYH 1LE9A 4POYA 1BIHA 2MPAH 3HKFA 5EIVA 3STZB 4OZIB 4TN9A 3L5WA 2V17L 1UA6L 3HG1A 1A1OB 3VGEA 2XN9A 3HZKB 1X4XA 4YEEA 3IKCB 1CF8H 4HC1A 1FNSH 4UTBL 1E4KA 4JFOB 5D1QD 4P9ML 3V6FA 2HKHH 3U0PB 4MA1B 1K6QL 4J1UA 4ZS6C 1HCVA 3VXUD 3G6JF 1FAKT 1M7IA 5HI3C 1WICA 3CSPA 4D0DA 1L7IL 1OCWL 2G75B 4X7SH 5BVPH 4GQ9L 2UV3A 5BZWA 3VD3A 4PLNC 1RZIB 1S7RA 4Y2DD 2R4RH 4HIXH 4NKDA 3X14A 4HCRH 5L8JB 4XPTH 4LHQB 4GW1A 1A8JH 3I75B 4GXUM 1WEJH 2OCFD 4XNMA 4KK9D 5TDPB 2E8YA 3WDIA 4OQTA 3BEWA 4QT5B 2FEDD 1OARH 4XXDB 4OCWL 4NRXB 4UBDD 3MRHA 2IQ9H 4WFHE 3ZKQD 1D3CA 1QLFB 1DQMH 43C9B 3WS6C 2XZQL 4TQEL 1X5AA 4NNXB 3L3OB 5DJ6B 4F9LC 4DVBA 3VE0B 1CGSH 5LJYH 4QRRA 2DLFL 5LQBH 5EU6A 2LU7A 3VW3H 2DAVA 1P2CA 5CILH 5JXED 4P9HC 2DYPB 3AREB 5C07B 1E0OB 3CUPB 2P4AB 3MOQA 4WW1B 2YK1H 5ID1B 1H8OA 3J7HA 4Y4KA 1X7QA 1W72H 4JPKH 1H5BC 3UTTB 1JNNH 1INDL 3CU7A 2P24B 3Q6FB 2ZKHL 5E5UB 4AJ0A 5F96L 5IQ9B 3RZCC 4XCFL 2R1WB 3BDYL 4PJ8C 3BN9C 3FRPG 3HZVA 5IJKA 1CXFA 1HXYB 2I9LB 1QD0A 3D0LB 2UWEB 1AKJD 3NH7L 4R96B 4QT5A 4YHML 4RGNB 5C0AD 5BCAA 1DL7H 2JCCA 1QKZH 4ZMAT 1D9KD 3AREC 1D5ZB 5BV7B 3MRDB 3FJTA 3SGJA 1SQ2N 2HAZA 4IHOA 3RPKA 4MHHG 4M5YH 1RURL 5E8EB 4XRCB 5EO0A 5KVDL 3OKDA 3QHFL 3GMLA 1P4IH 1ORQA 4M6OH 1DE4A 5ITFA 5D6CA 2EIBA 1CI5A 3D18A 4AQ1B 5JHLH 4KUCD 4PRIA 4C4KO 2AS5M 1VFMA 3I3DA 1YY9C 2Q6WA 1IM9A 4Q74A 5LKNA 3MOAH 4X7FC 4L8CB 5I6XB 1QKZL 2NXZB 4XMLL 4LLDB 1AKJB 1QOKA 1LK2A 3AXLA 4JQVA 4TNWF 5DMGD 1S7TB 2O61A 1TCRA 1U3HC 1IGFL 2ZG2A 5D7IE 1J0JA 4MQ7A 3MRPA 5JLZA 2EH8L 3VCLA 2XZCH 4GRMA 1CFSB 5E6ID 3RPIB 4RFNB 4GH7B 4OI7A 1T1WB 3HFML 2QQNH 1GCFA 1S9XB 3OZ9L 5IEKB 2Q76A 5DWUH 5EIIA 3QUZA 1OSZA 1D5MA 3PQYD 5CBEA 5F9WB 2K1MA 4DUXA 3HC4L 2FECI 3U9UA 4F37K 3WS6A 1OSPH 1CICB 4DN3L 1K5NB 4ZDHA 3I6KA 4Z78A 3E8UH 4K94L 4OD1H 1G6RH 4XX1G 5GGTH 4KHTL 5KS9E 1J05B 3CDFA 5KVFH 3D5OF 3O8XD 3ESVF 3WXWH 2HJKA 2YWZA 1P9MC 4J3TA 1MCFA 3SKMB 3QULB 1UCBH 2R0ZH 3DUUA 3VH8G 2FJFB 3O45A 2IADB 4OZ4B 4ALAL 1LO4H 5KS9A 3GSOA 2AJVL 1BFOB 4ONOA 4ZTOL 4KKBC 2Z93A 3QQ3B 1SM3H 3I3BA 3QA3B 1FFOA 4N9OB 5FV2A 1JUFB 2DQFB 4RRPA 5CILL 2L7JA 4O00A 1KB5B 3UX9B 3V4UL 2AJ3A 1DBJH 1E6OL 3RGVA 3A67H 2X4UB 4ODWA 5E9DD 3IAPA 1J87A 1JK8B 2VDML 2CUIA 1FZMA 3U83A 2WNGA 4NRYB 4FQQA 3STLA 3FONB 4WI6A 2QSQA 2P8LA 2X7LB 1DQLL 5HJ3A 5DRNA 1I7UB 5HGGS 3UTSA 3G6AB 5KSBE 2ZUUA 5EBWA 2YD4A 3W82A 3O4LE 1QSED 1N0XL 4FQXD 1LE9B 4C54A 1A1OA 4DEPB 4PJ8B 3U48A 3FQTB 3QJFA 4XCEB 5DA0B 3EDJA 2K7PA 3FT2A 1G0YR 1KEGH 1DQQA 1T3FA 3L5JA 1T0MB 5CJQH 3MRKA 3I2CL 4E9LA 1FZJA 4XWOD 5GRVL 3ROLB 1U58A 2X05A 5GZNC 5KVDH 4TUOB 4W68A 5SX4I 4R2GB 5CZXC 3HE7B 1RIUL 5J1AA 3V5DA 3SKOB 2RFXA 1Q9WA 3IXTA 3RA7L 2CDEB 4Z5RB 5I8KH 2A9NH 3D6GA 1LNUA 2B7DT 2G75A 2WANA 1W8OA 4M4PA 4M7JH 3MRNB 2XKNA 4MJ6B 1Y6NR 4TOYL 2EECA 4DK6A 3BKML 4XCCH 1YEDA 2AJYH 5CP7B 3S97C 2Z31D 5I6XC 5CSZA 4NGHL 2IC2A 3G6AA 4N9GB 1YNKH 1KIQA 4OZGE 2EO9A 2E7HA 2J88L 1MFBL 1GSMA 1W72A 3P4NA 5DMKB 1QACA 4JFZL 4NRZB 4P59H 4WU7B 1LVEA 1T0NA 1KNOA 3CX5J 1A6TB 2HWZH 4PGCB 4OCSL 1XF2B 1F42A 2JJSC 1EHLH 4LPXA 3DSFL 1LEIB 4LLYB 1MIEL 4DKEH 2DJUA 3O2DL 3V4VL 3NIFE 1E4KC 4D9RD 4GLRI 2YD3A 5I1GL 3OR7B 5GGRA 2UWEF 5F9OH 3RTQC 5FA3A 1YA5A 1H0DA 2MFNA 1OAKL 3V52L 2VITA 1HEZA 5GRJL 4C58B 3JV0A 2SEBB 1H8NA 4F15B 3CXDL 3MBED 2YPKB 4MA3B 2NLJB 4HH8A 2X1PA 1OVZA 4LP5A 3CVIL 3RL2A 4EI6B 3TLRA 4ZFOB 3FB8A 3K4ZA 3V4VH 1RUAL 3FL7A 4J4PA 5E94B 4OLXL 1HQRA 4Y5VC 3SHSA 1H3VA 4QTHB 2VRAA 1IVLA 3MLSL 3SO3B 3S8WA 4YHIA 5CBEB 2H2SD 4FZ8H 5DJAA 1H3TA 4MJID 2YUWA 4PP2B 4CBPA 5ITFB 3C5ZB 2W9LA 1IKFH 1MHPH 2XIDA 1NAMB 5HYSG 4KKBD 2FGZA 1XCTB 3SDXE 4PGEB 2VH5L 4P3CL 5CKGA 4P23A 3WFBL 4YGVB 1HDMB 2OL3H 4MX7B 4X0KB 1AE6L 5JUEL 4HIHA 3TBSA 1I3GL 1MPAL 3K7UA 2V5MA 1T6VN 1BVZA 2CQVA 5CEZH 3MSPA 5HYJA 3UTTA 5EFIA 3BVNA 4K7FB 1MCIA 4TTGA 2DMBA 4YDVA 3OQ3B 3SKMA 5MP6L 4UTAH 4PRHD 5TDNB 5GRVK 3LMJL 2FJFA 4M1DH 2X9WA 4JDZB 3ARUA 5B3NA 4PPTA 1NBVH 2LAAA 3JWOL 5I16A 4OGYL 3HHRB 4QHMB 3S6CA 1MNUH 1A6UL 4P2RE 3ARDA 1CK0L 4LP4A 1P84K 2FX8L 1LO5A 1JUFA 2DQFA 4U0RC 4OLVL 5D1QC 4JLRB 4PRBB 1CXEA 3BRDA 2NTSP 3CFEA 4JRYA 4FQCL 1OQXA 1FV1B 1MLCA 4WO4C 5FYJH 5FF6A 1VA9A 4MB5A 2QV2A 1ZHBB 4ODHL 4OZHA 4IHOB 2ITDA 4HKXB 1JNNL 4W81A 3NTCH 4OZIF 1RUML 5C0FB 2FWOA 4ZFGL 4L8BB 1MAML 1NCWH 3G04A 3LHPL 2WMPA 3ILPA 1CN4A 1OHQA 3S4SG 2DQIL 3O8XA 5FUCE 1MELA 1WGOA 3JWDL 3LD8C 3UJIL 3LKQB 1KEML 3DV6B 2AJSH 3O3DB 3QIUC 4PTUA 2Z35B 1TCRB 2BXYA 4AM0B 4GXVL 4H26A 5C0RH 4M7KL 2LQRA 5DJXB 1EFQA 3SDCC 3RX7A 4N0CD 1MFCL 3VCLB 4OGAC 1QO3A 2VLRA 3SCMD 2WIIA 2NY4D 3Q1SL 4LLWA 1KIRA 4Q6IB 1PZ5A 4IS6A 3MV7A 3N1PC 3T0EC 3T0EA 2UY6A 5IMMA 4F3FA 2OJEA 4U4BA 4TRPH 5DHXB 2GT9B 3RNKA 1FSKB 4OF8A 2CLVB 4D9QD 3GSQA 3IVKA 1NCBL 3CNKA 3QIBB 5CIPB 3LCYA 1CLCA 15C8H 2XFXB 5DJ2A 5C2BL 4LLUB 4FMFA 1YDPB 5TGBB 3AMLA 2VDQH 5ICXA 4BZ2L 2J12B 3VRJA 1OT1A 1UKQA 5D1ZD 5GGSY 2A2QT 5GGRY 3VXOB 5D7IA 1ZLVK 3FFDB 1J1OL 2X89D 4XP6L 3D39E 5DQDL 1KTRL 3PGFH 1JGEA 4GJTB 5JQHC 3DV6A 3GFUA 4OLXH 1CXIA 3CXDH 4TSCH 5ACLA 1AR1D 2AAVA 5TE6L 3VXNA 3BGFC 4K3JH 4X6BA 4U6HB 2F74B 4L4TE 4Y4HB 2V9RA 1VKXB 1FL3B 1YJDH 4PY7B 1V3JA 4PV8A 4OLUL 5GGRB 3WYRA 4RWYL 3NIGE 5DFVD 3QHZH 4FQIL 1Z3GH 4XWGH 4K9EC 4XPAH 5HHPB 3X12A 3O3EB 2VR4A 3SJVB 3TA3B 3HB3D 4RAUA 2J4WL 4LGSB 3TN0B 3U82B 4XAKE 4WTZA 1KBGH 2J7LA 5ENWB 4MB4A 1RK1B 3DX6B 5JA9A 2E27H 1HKLH 4TSAH 1K3IA 4OB5L 4YIQB 4MLIA 3ULVD 4TSBH 4X99A 3ZSSA 1A0QL 1Z9OA 3IS1X 4ZUWB 5HHVH 2W92A 2QQLL 2XXCB 4CN6A 3IB4A 4YFLI 2DLHA 4YK4C 2MCPL 1JPSL 1A6UH 1LP9B 2ZCHH 3B9KA 3RWCA 3C60B 5DVNA 5TDOB 1NKRA 3VGAC 4HUVB 4Z9KB 3TWCH 3IDYC 2C3VA 4ZNEE 4QRPE 5E2UH 1KBGL 3OKMA 2WWMC 6FABL 4OJFH 5DJZB 4E42B 2AERT 4I1NB 2FX8H 2NY7H 5I1IL 3CCHB 4W4OC 3WD5H 3DGCR 2BNRD 4IIQC 5K9JL 3ARED 3EJYD 1A6PA 4K2UL 2V6HA 3CFDA 3PWLB 4BQ9A 2ZOLB 5EPMB 2P5EB 4XP9H 3RHWK 1BM3H 3WJJC 3BAEL 2LTQB 3EYVA 3O2DA 1ZWIA 3SOBH 4JFFB 4LSUL 2W0LA 3O3AB 4K9EL 2DIBA 5ETUA 4NZRH 2ZWLT 2BNRA 5T3XE 1Z9SA 2CO6B 5IJVA 3AS0A 3FOMB 3GMPA 2IG2L 3BKJH 2HTLD 2EDXA 4LASL 2EDRA 4DKDC 3G5VA 2BNQA 1QLRB 1D9KB 4IIQB 4G8GB 1YQVL 1C7TA 4LBEB 4HD9A 1FL6B 25C8L 1HH6A 1UT9A 3DRTA 1FO0H 2R2CA 3L7EB 4QXTA 3FO2B 3AMKA 5D5ME 2J6EH 1EJ6A 3SKNB 3FO9B 3DLQR 2FEEI 4NO2B 2BNQE 3PUCA 1EJOH 1FO0B 4N0UB 2ZNWA 4YFEA 3S88H 4OGXH 1CD0A 2NY0B 4JY6B 1ZLWK 1EHXA 1RZJH 4DK3A 2DKUA 3MV11 5FA4A 3D3VD 3SQOH 4MA7L 3C6LA 3K1DA 3Q6FA 2HH0H 3PGCA 5A3ID 1LDSA 4G7VL 4M8QA 2OK0L 3E6HA 2ICWI 1BBJA 3MNZB 4PJGA 4G8GD 1I1RA 4TYUA 3EYUL 3MLRL 3RX5A 2RB8A 5F3HB 3UO1H 1H3GA 3O41B 1BQLL 1T22B 3O2DH 3WJLA 1XCQB 3QEQE 3V6ZA 1MCSA 3DI3B 5F89B 2P45B 5E9DA 4HKXA 3MRMA 2JCCF 4G3YL 4CRPA 4Y4HC 3NCBB 3FB5B 4JQIL 1OB1B 2CDGA 1UKSA 5B38G 5I73B 5E1AB 1BQSA 3O9WD 2GSGB 1NAMA 4NBZB 2Q6WB 5DRZA 4G5ZL 3DV4B 1YMMA 2I24N 1JWUA 1CG9B 1JF1A 1X6LA 4WCYL 3WDHA 1YQ2A 1EDQA 3EO1A 1AGFA 5JR1L 5IVZB 3ARSA 3O45B 4OZ4A 3TFKC 2MHAB 2E27L 2Y5TA 4ELME 4NN5C 5B8CC 2MPAL 3ZE2F 3L5HA 1XFPA 5FXCH 3K8LA 4KUZL 3MLWH 3UTPE 1A2YB 2VNCA 3V0AC 5I1CL 3MLPA 3WXVL 2F58L 1FFPA 2IMNA 4L4VE 3QXDA 1AQDA 1RZ8A 5DC9B 2H6PA 2V7HB 3JXAA 2IALA 2D31A 4U1HA 3GM8A 3MPCA 5JR1H 3QWOB 2R1YB 4PJ9B 3ZHDA 1JGDA 4YDJB 5IB5A 3CXHJ 1G9ML 4X7SL 1II4E 5CEZE 3B9KC 3QQ9C 1NJ9B 1NUFA 4WIQA 4WWID 4JGUA 4YC2C 4JY4A 3FRUB 3BPCA 4PJ8A 4I3SH 1FPTH 3FCTB 1QSEB 3BJLA 4HFWB 1OD7A 4EI5A 3MO1B 4I4WA 4PTTB 3WNMA 2HT4C 3DVGA 4IRJC 1H5BA 4MDIB 4CVZB 1ERNA 2NXYB 1A7OL 3WUZA 3ZYJA 3BP5B 4MJ5B 3VFMA 4WUUA 1TJGH 4LEOB 3BZFA 4XNXH 1OP5K 4YAQB 1R3KA 1OSPL 2W38A 1FNEB 3VRLE 1CDGA 1KTKE 1YEHH 4HWBA 4JO2H 3CJJA 1QSFD 2DMCA 4FQHB 1I3VA 5IM7A 1SY6L 4KHTH 1EX0A 2VIRB 3CLEH 2Z0BA 2VQ1B 4NKMA 5EO1B 4D3CH 5IBTH 2YA1A 4GXUN 4MJ2A 5JPNB 4FOMA 4MSWB 5J6HB 5JOPE 3U4BL 1C5DB 4XNMB 1QFOA 1A7NH 4K7PH 2BZDA 3KPSB 5JMRA 5L88H 4MAYC 4AEHL 3VDAA 3G5YA 4GQ9H 5CS7A 4K23H 2ZP0T 4EVNB 2HKHL 4PJ5A 5HVFB 3RIAF 5I71B 4MNQD 1EEQA 5IVXF 2FEEL 3P11H 1WWBX 5KVEH 5LGHL 5F6HI 1JPFB 1I9JH 1SY6H 1A9BB 1ETZB 3D85D 2P44B 4OCWH 4LQ1A 1IM3B 1ND0A 3DGGB 5C08D 3AGVA 2NY3D 1D5BB 4KMTL 3T77A 1FFNB 4LEOA 1BLNA 2NY2D 1Q94A 3D0VA 2F5AH 4ODUB 4D2NA 2IBZX 1JN6A 1ZTXL 1KSRA 3B83A 3EDKA 3EGSA 4P4KA 3QG7H 3QP3A 5KSAA 2IAMD 2ZOLA 2CLRB 3VFGH 5MEND 1DFBL 3GKZA 2AJUL 4JFEB 5D9SA 3W0WA 5J0BA 3N0PB 4UDUA 5C0DA 4XVTH 3LQMA 1JGLH 4QHLB 5CWSA 3GI8L 5KSVB 3MBEB 3I2CH 3W81A 3PIQB 4JFDE 1RIHL 1PDKA 1H8SA 5HDBF 4P2QD 4PR5B 1ZTXH 4NWUH 3EOBB 1DQJA 4WDIA 3MRDA 4P5TB 3VFOA 1JTOA 5F89A 2DLTA 2W91A 4UV4H 4WTWA 1QFUH 1KN4L 1JZ6A 4HMDA 4DVRH 2CH8A 1ZV5A 2IBZY 4DCQB 5C92A 1ZOXA 3ILQC 1UVQA 3PABA 5EG6C 3QZWA 5KJRH 3LH2L 3BDYH 4KU1A 3MRJB 3C87A 5CJOH 1EFXA 3Q0HA 5D4QA 1Q94B 4AIXA 5I1CH 5MENB 3MRCA 4WY7L 5J12B 4XPGH 5E8NB 3JSSA 4J6RH 4JM2F 3OKNB 2HFEA 5EUOF 4QYOA 3PHQA 1WVZA 5D1QA 5D6DC 4F9LA 5DK2B 3WFEL 2XV6B 1TQBB 3C6LD 3L5XH 1C5BL 3U46A 2E7LA 2VZ1A 4KI5E 5I8EB 2SEBA 4L1DA 1BX2A 4K8RC 1CT8B 3TO4C 3KDMA 1RMFH 3DJ9A 2EIZB 5A2IH 1OWRM 1JNHB 1UJ3C 3H7BB 3RU8L 1DEDA 5INDB 2W65B 2CXKA 4X5WB 3ZDZE 5F8QC 4JN1L 2E6PA 4FXGB 2JJUA 1NGPH 5DS8B 3WDJA 1MI5B 1WBZA 4WWKD 4PB9H 3R06A 3BRFA 4K8RH 5M94B 2X4OB 1P6AB 1TNNA 3OF6A 4LVNB 3RDTB 2NX5E 4WV1A 1U3ZA 2AXJA 1U8JA 4NYLA 3LRSA 4ACPA 5C8JA 3LKRB 3R8QA 1A6TA 2FL5A 2Z8SA 1U8IB 5GRJH 4OFDA 4PP2A 4Q9RH 4XWOC 4R7NB 3SPVB 5DWUL 1UEMA 1XF5A 2MQCA 3HZYB 4OQTL 3MRCB 3MLVL 1KB9K 2R4RL 5IWLA 3CAFA 3OKNA 4ZFZB 3VMNA 4YDKH 2VDMH 1HHJA 1SJEA 3QCVL 1MRDH 3MO1A 4YHNA 1NLDL 3U7AA 1NCNA 1QFHA 2DIJA 4YBQC 5KG9B 5BV7H 3MODH 3RKDC 1WK0A 4A2MA 2WBJA 5E2JA 4WI2A 3LS4L 1ZHLA 3P0GB 3T1FA 1UEYA 4NDMB 1OAUH 1RV6X 1BFSA 5IMKB 3E2HB 1HINH 3FB8B 4NKIL 1F90L 2YC1B 3F5WB 5GZOC 1NPUA 1P7KB 3UJJH 4G7YL 5KN5A 1X5ZA 2L0DA 4WI5A 3LEXB 3M1BA 3V0VA 1MJJA 5EO1A 3O6KH 1CD1B 2EDJA 1CGWA 4JJ5A 5DT1H 1F3JB 2NY3C 5CEZL 1AHWC 5IK3B 5I18L 3P0VH 4LCCB 2C9AA 3CFCH 1RZGB 1KCSL 2CPCA 2V2WB 2VLKE 5F7UA 1YEFH 3LMJH 4JREB 4M1DL 5I30H 3MROA 3QNXB 4QO1A 1EZVY 1KJ3H 3ULUF 4K3HA 3L3IA 5GS0D 1HHJB 5F6IB 4XP4H 1JVKA 1AD9B 4FTVD 2L7UA 3GDBA 3QPQD 3OB0K 2CLZB 1TXKA 1OPGL 4LCWB 1RZJC 5FDWA 3DXAD 1VFUA 5JW4R 4YNYA 4L3AA 3G08B 3WN5A 3NTCL 3HCVB 1EO8L 3QUKA 1TLKA 4PJAA 1CGSL 4P5TC 2IGFL 3VDBA 4F7TB 1Q9WB 3IXTB 1KEGL 1IGTB 5KSAD 5LQBL 2A77L 1BBDH 4OF6A 4YBLC 3G5ZB 3BT2L 1A1MA 5BQ7A 4ZFFB 3HMXL 5EC2A 3WIHH 4PJXE 1G7LA 3KPQA 1NC2B 4YX2L 3RWFB 1GJIA 4XPBH 3SE3A 2K3TA 2UZYB 4KJPC 4EDXB 4KJYB 2BOCB 4NP4L 3H9HB 1WZMA 3QIBA 3QQ4A 5C0CD 3OGCA 1YYLL 4X6CA 1XF4A 2QR0A 3TGXA 3L3HB 3MJ9L 1CFNB 1G6RB 5I1AA 3L5WB 4K3DL 1NFDB 3WKMH 4UT9H 4K8RL 3GMMA 2OQJA 3U7YL 4Y2DB 4GMTL 3QBTB 3N1MC 3I85A 3VXNB 1F97A 1L6XA 3IU3B 4AIZA 3EYOB 3B2UD 1AQKL 5FHBH 1UZ6E 4GMSH 2OS7A 1BQHB 5BJTB 5L7XL 2DI8A 2EEBA 1P5VA 3GGWA 4BSVB 2P5EA 4BZ2H 4TUJA 4LSTL 2HT3D 4QTIL 4I3SL 4P48A 2X4UA 12E8L 1IGJB 4XC1H 1HKFA 5IESH 3RNKB 4KPHH 4EDXA 1JPGB 3BEWB 4Y2DC 3WO4C 5DRNB 2E9IA 1QR4A 4PR5A 3N85L 1G7HA 3ILQD 4IDJL 4CADB 1HQRB 4UI2A 3T4AA 1MRDL 5DJDB 3U36B 4HKZA 1Z9LA 2AK1L 3S7GA 1OAKH 4NNPL 4W6XB 1W0YT 3ARZA 2VLME 3ZDZF 1MREL 3TPKA 3MRIA 2VLMD 4G6JH 3DGGA 3K46A 1CE1H 2H8PA 4FZ8L 1P84J 5EA0H 3FQUB 4PJFB 5E2VL 3UEZA 5GGSA 3UTZA 4YR6A 3QSKB 5L9DH 3VGDA 1MWAA 2VXQL 3GI9H 5BRZA 4RZCB 5HYQA 3K2MC 1AFVH 5IQ9A 4J12A 5FO7A 2GJ6E 3O3BB 4PJGB 3KNBB 5D2LB 1I9JL 4ODXB 4DWHA 3L6FA 3AB0C 4JVUA 2DWDA 3U9PL 4PJCB 4XHJC 5J89A 1KGCE 4S1DD 4V2CB 3RWEB 3O41A 2Q7YA 5ETUB 1KJ2H 3M45A 3RWDA 4RQQB 4XP4L 2IH1B 1NDGA 1Q0XH 5DJDA 3HB3C 5I76A 2X70A 4L8DB 1XF3B 3VWJB 5IFAL 5JTWA 2B0SH 4F2MA 4UTAL 3S5LA 5ESAA 3ZTJH 3QT2A 1NGXB 4NO2A 4TPRH 2PO6C 4F33A 3CSYB 3T3PF 1CG9A 5ADOL 1TQCC 1B0RA 5E8PA 2N56A 4Z7NE 5E5RB 1J1XH 3MXVH 3FQXB 3KPMA 4NC0B 3BT2H 3CDCA 1KIPB 3EYSL 5I9QB 3V79C 4NC1E 1ROWA 4N68A 4NQUA 1S7VB 2ZSWA 4U49A 1W0VA 4P2OC 2E6JA 2J8UB 1ZWIB 5I8CB 4UT9L 3ULVC 1IC5L 4PJEA 2J1KA 4FXKA 1MAMH 2P8PA 1ZVSB 4TVPE 3NABL 3WL9A 2D7TL 5HGDB 3FN0H 3MCLH 1ZANL 3B6SA 3GMNA 3ZYOA 2B8OT 3MUZ1 3R06B 4KWUA 5DJAB 3U7YH 5IMMB 5JPMA 4LBEA 2CRMA 1RIUH 2BXZA 3GRWA 5F9OL 4A2LA 2NZ9C 3HE6B 3UPRA 1M05A 3IF1B 2FDBP 2APWA 3HG1E 3PL6D 5I71C 1AGEB 5EU5B 3GJEA 1KTDB 3HG1D 4QY8A 1WLHA 5MI0C 2BSTB 1WBYB 2FZ3A 4OCYL 2HLAB 3H9SB 1P6FA 4HIXL 1KELH 2I27N 2A0LC 4NUGH 2XTJC 1ZANH 5D93C 3E6FB 3T0AA 1G7PB 5D1XA 1T04A 2RHEA 4EDWL 5T1LD 5BOPA 2NW3B 1I3RA 3Q5YA 3QULA 1JP5A 4AMKL 2GUOA 3FO0H 4Z77B 2ZUQB 2ZCHL 3BISA 2FJHB 3C08L 3MRPB 5HTSA 4AYFA 4EN3A 2YD2A 3OKLB 4UAOC 4ZPVA 1NGZA 3SDAB 2DB8A 4BELD 4IOIA 4QCIB 4LSSH 5D8JH 3TA3A 1EGJH 2QTEA 3W39B 1PEZA 3MA9H 2WIMA 3IT8D 3MRMB 5F9JA 1U6AH 5CFHA 1BJMA 2IQAA 3GI9L 4FQQB 4U1SB 2FHCA 2JF1A 5CLTA 2D0HA 1S5IL 4NQDD 2C1OB 1IGCL 2DI9A 1QP1A 5KZCD 2I26N 5H94B 1NCCL 4HUWA 4WEUD 5L9DL 2X4SA 4HKZB 2OP4H 1F90H 3HS0B 1INEL 4LSUH 1MHCB 4XPAL 2AV7A 3KJ6H 3U30C 4B50A 3DO3A 2XXMB 3SEPA 4WTXA 4L4VA 4IRJB 3T77B 3TT1L 4HIIA 2JB5L 4WW2F 1VEMA 3GSUA 3C9NA 2W59A 4Q58C 1RURH 3MREB 3MUY1 2VERN 5DHVA 2D7MA 4JB9H 3FN9A 1RVFL 5DVMA 2NY2B 5SWZD 3WSQH 1XIWA 4PJAB 5B8CB 2WINA 3V0WL 4NQEA 1JI2A 4GRWB 3QXDB 1DBKL 3EJJX 4LFHG 4GW1B 3TFKD 3MV9E 3QCTL 4E41D 2OI9B 3KYKL 5TPWH 1YMHB 1NFIB 2FX7H 5DUBB 2AV1B 5KSVA 4WHCA 4YO0A 1DTUA 3O2WL 3HZMB 5F7HA 4PJ7A 5D7IF 5IB3A 3LD8B 3RTQB 1FE8H 4YXLH 1P4LA 4EUPH 2BY2A 1INDH 5DLML 3WNLA 4XMKL 1RUPH 5F96H 4UB0L 5CCKL 1U91B 5F6IC 4HWUA 1X4YA 1OGAA 4KVCL 3RVUD 2PO6A 4PJAE 5I1AB 4OZGB 1DANU 1S3KH 3BAEH 1MCJA 3T3ME 4OCXH 5JW5A 4LNRB 3F7QA 4U6VL 4DTGL 5DD5H 3AU1B 5DK2A 4JZJB 3VFSB 1GGIH 3BKYL 1UZ6F 5CJ5A 1A47A 3HI1B 5LXGL 4NHUA 1Q8MA 1YNKL 2DQEL 3HI6H 5EH1A 2CDEA 2YHGA 5HHOE 4HLZG 1J0YA 1EHLL 3MJ9H 2AEQL 3C6LB 4RMQA 3E2HC 4NKMB 5IWLC 2NY1D 3N9GH 3ZHKA 1KV3A 2VDKH 1N4XH 1C5DA 1TVDA 2Q7YB 4YDLB 4WI4A 3T09A 1JPGA 4Z7WE 1T1ZB 4JLRA 4GOSA 4LVEA 2FB4L 4M7LH 1RZJL 1ZLUK 1GIGH 4YUEH 1A9EA 3MCG1 3CPLA 1EHNA 3L95B 4XP1L 2EC9T 1I9EA 1O5DT 2BFVH 2IJ0C 3MJGX 1F2QA 5M7QA 4JRYD 1FCGA 3NIGF 4J4PD 1S7SA 3C09B 3UZVB 3B2VL 4NOBA 4Z7UF 3QFJA 5FM8A 1HDMA 4H8WH 4I0CC 3O0RL 3CDGA 3QDMD 3OV6A 3UJTH 3QWRA 4LVHC 4Y19E 4C56B 2ZG3A 4NWUL 3ZKMD 1MHPL 4MXQC 3LSOB 5CKAA 4OUUB 4H5SA 4NQXB 1B2WH 2GIYA 2H26A 2KKQA 2HFFA 2VZUA 5C0DB 3TO4D 1YEEL 2LFGA 5KJRL 3UXFA 4ONFH 1MF2L 4PRDB 1CDUA 3ETBF 4PRPD 1RK0A 3TBVA 4ZFOA 4GBXB 1MJUL 4FTVE 2BDNH 3NCFB 3T1WA 5IVOA 3O0RH 2YN5A 1N64L 1AQDB 4P3CH 5HDLA 3DMMA 3W39A 3ZTNH 3WD5L 1J11A 2K9UA 5EOCJ 1A6VH 5GS1A 3LQAC 5KS9F 3LZFH 1DE4B 3I6KB 4YHZH 5EWIH 4JFYB 1IQWH 1EUUA 1XR8A 2L4OA 3CLEL 4XP5L 2Z91A 4P5KA 3D39D 1WZLA 3ZE2E 3U4BH 4X0KA 1OLZA 1G7MB 1NBYA 3P9MB 3EOYG 3NCCB 2WBWB 1U8NB 2DJ4A 4XXCA 3QIBC 2A73A 3OWEA 1H5BB 1PYWB 1TZHB 2ZOKB 1EFXD 4PLJC 3S35X 4MQ7B 3HNVH 1BOGB 3A0OA 4P9HL 4J23A 3MCKB 3CX2A 5ITBH 4KQ3L 3MV7B 3QXWA 3QRFM 2P8PB 4X4ZA 3SGKA 3QDGB 2XN9D 3N06B 3M17A 5HGDA 3RJDA 1FAIL 1J1XL 3NCJL 5T3ZL 2VABB 3QNZB 3PGDB 2NY7L 2YD5A 3CZFB 3OKKB 3BEVB 5DD6A 2AXFB 1QLEL 1FNAA 5ILTL 1MFDH 2X4NA 3PXHA 4HSQA 1IAOB 4LFHD 1VACB 4OBSA 1OOAA 3BKMH 3S35H 1UACL 3A6BH 2P47B 1IQDA 3QO1A 1G6VK 4Q9QL 4NZRL 4NGHH 4MNHB 2Y5TB 5D70H 4Y8DC 2IFFH 15C8L 5C2BH 5B39A 2ED7A 4BUHA 1NGQL 3HLAA 5BW7A 5J6GB 5DMGC 3REWA 1I9IL 5EOTB 1IGMH 1JMXA 3GGWB 5TE7H 3TYGL 1FLRH 2Q76B 4LPWA 1GIGL 2P5EE 2CD0A 2R9HD 4LLWB 4CU8A 2PXYA 5EUKB 1YZZA 2VABA 1UH3A 3I84A 1OP9A 2Y6SD 4O5LL 3TBYB 3IDYB 4KQ4H 5FGBC 3VWKC 1DN0B 1SJHA 3T2QA 4ZUTA 3SGDI 2F19H 4Z95L 2YSSB 3QG6A 5C9JB 4ONGL 2X7LA 2XNAA 3QUYA 3PDGA 5F7NC 4H25A 1RPQA 3MLWL 4C83A 4O02H 1QSEA 4JREC 3BGMA 1BMGA 4NNXA 5ESVB 2JJVA 3OL2A 5C0NC 4HUVA 3AFLA 4M43H 3QDAA 3CFKA 4Z7UA 3WLBB 3LPGA 4ZD3L 4NQVB 1HHHB 4XCNA 4JDTL 2ZUQC 3O6FD 3PWVB 5K9QI 5C0EA 2AJZA 4UQ2A 3HE7A 1VERA 3RZWA 3PQYE 1KFAH 2VN4A 3TIEA 1ZGLP 4QYOB 4MNGB 1MQKL 2DQGH 3VXMB 3VGHA 1OTSC 1EGJA 4D9LH 3NPSC 4JKPL 2VIRA 5DXWA 5D7SL 3TO2B 4RNRA 4Q2ZA 1CGYA 4FQJH 3PGCB 4MCYA 2R15A 3L6FB 4APQB 4OZHE 3QCVH 4OKDA 2VDOL 4S0SD 4HW6A 4Y1AE 2G60L 4ZXBC 3F58H 1CGTA 1IEBB 3W5NA 1CD9B 3T8XA 3H0TA 2QQQA 2R4SH 4G8FA 1NQBA 1I1FA 3RWJA 4M6ML 4FABH 2X42A 4DZ8B 3CMGA 4UBDC 4XZUB 3O6FB 4JZOB 2XZCL 5F88B 3OPZH 4QXTB 3BUYB 4XPTL 5D7SH 2FR4A 3RQ3A 5J56B 2AW2A 2FL5B 3OSKA 4MMZC 1CIUA 1GC1C 1BVLB 4FG6C 3D18B 3OZ9H 4ZUSB 3ECBA 5E1AA 1T7YA 3VD5A 3NA9H 5ISZD 5MEQA 4GO6B 1PG7X 1FNGB 5E9DE 4KDTA 3C2AH 3V5DB 5J1AB 5E6ZA 4HS8H 3EUUA 3H42L 25C8H 4WV1C 2BVPB 1I75A 1I8KB 5JQ6H 1N5AA 1VGKB 4FTVA 1SEQL 3PWLA 3ZO0A 2Y07H 3ISWA 4I0PB 1WIUA 3AS3A 5SV4A 2X4TB 3EDDA 1OY3B 2AGJL 5IHUH 3D9AH 3O4LD 4PGBA 2NLJA 4EI5D 4LSQH 1MFDL 2QEJA 3PIQA 2V17H 4KZDH 4G6JL 2VLJE 5T1DL 3OKEA 1IAMA 4L5FL 3ZKXB 5C86A 4NQED 3BYYA 2GY5A 3TIDA 1K4CA 3BKYH 2BCKB 4LRNH 4DOHB 1HYRC 3GUTA 4S11A 3UPCA 2EKSB 3PGDA 1OAUL 3KS0H 1J12A 1D5IL 5DVKA 4JFXB 2XACC 3DRTB 3QI9B 5DK0A 1FGVL 2BERA 4WU5B 3OG6B 1HN1A 5HGAA 2R2EB 1AO7D 2HLAA 3H9SA 5IR1A 3SDDB 2DTML 3CUPA 3QXAA 1CVSC 1PY4A 5IF0B 1MCOL 5T1KB 2Q8BL 3TH2T 4DEPC 4JZJC 3LKQA 4HIHB 4PIRF 1J05A 5EBLA 4LCYA 4EI5B 4GUPB 3U46B 2VE6A 3KYAA 5BVJA 5IW6B 4HWZB 2Y6SC 3UROR 1MIML 4UMGA 1W0WB 1MSPA 1A0QH 1S9YA 3P3YA 3MJ6A 4X8JB 5BS0D 1OWWA 3OKLA 3E6HB 1M7XA 3MGTA 3WFDH 1U3HD 4LKCB 3BP4B 2ARWA 3JVGA 3MNZA 4JQIH 4JM2A 4JM2C 5DQDH 4FXKB 2UVFA 1KTLB 3OKEB 4PJBF 3DX9A 1TETH 3IDIA 2Y4SA 3T2NL 2VDLH 1OAZL 4FFVD 3SE4A 3IJHA 5JOPD 1CXLA 5BZDB 4WNQA 1C08A 1LDPH 2CIIB 1KG0A 3TEUA 1KIUA 1RZKH 3BEVA 5B21A 4ENEC 4O58L 3T0VA 1YJDL 1LEKA 1EV2E 2LVEA 2YOCA 2NXYD 4EOWL 1CLYH 5C9KA 5AEAA 2ADIB 5H94A 1ADQH 3G6DL 2EDDA 5EBWB 2P5WE 4PJ5B 4ZPTB 1TVBB 5FUZL 5I1DB 1HH9B 4XB7A 4B0MM 1A7BA 1PJ9A 1A7PL 4JN1H 2H32A 5K59F 1D6VH 1WZKA 2IPTL 3ROOA 4JPIA 2Q3AA 5DFWH 1F3RB 1U8NA 4O58H 4HMEA 2D03H 1SJXA 2NR6D 1FYTB 1V3MA 1BLNB 1DSFL 4IRJD 4Y4KC 1I7RB 2VXUH 4H88L 5FYKD 5DJXA 4OM0L 5FYKE 4EN3B 3TIEB 3EGSB 4P4KB 3GBNL 4HGMA 2HTLC 1UA6H 3MCKA 3VWKD 2BSRA 4KI5C 4F57H 1T5WA 4N0RA 1EA9C 2BNUA 4R4ND 4YDLC 3BO8A 4F7CB 3L3KA 1TNMA 3JWNC 1DJSA 2FJGB 2VMFA 4KK6D 5TDPA 5CGYD 2QBWA 1N3NB 1Q0YH 4AMKH 2D03L 3LQAH 4WGVB 3T65B 2VLJA 3BKCH 1I8LC 4B7IA 1CIDA 2ENYA 3C5SB 5JIKA 2AEPL 3TH3T 3HMWH 2OL3A 3T4AB 4Q97A 3BPOC 3AROA 3F7YB 2IAMB 1HHKB 4JFED 4L5FH 4OD2B 1KNOB 4OV5B 3PL6C 3WLBA 5DVLA 4KC3B 2ICCA 1S78C 4JANA 4S1SH 3LB6D 5ERWA 3FB7A 3IDGB 1MFNA 1UG9A 4JVPA 2P7TB 4YFDB 2BK8A 4J1UB 3NIFF 3FFCA 1R0AH 3ZZ1A 5KVEL 1ZK9A 1SEBB 5GRZA 2BNUB 5TF0A 5KTEL 5D7KE 1X5HA 2HJLB 3SDAC 5JOFA 4D0CA 4HK3N 3VXTB 3GK8L 4NRYA 4ETQA 3PWNB 2BSSA 3VFVA 3EOAA 1P7QB 2ZCLL 1RU9H 4JG1H 1P4LB 3QH3B 3KLAA 2DQTH 4X6CE 1JBJA 3PHOA 3CVHA 3OKDB 4X4YA 1BOYA 4JFDB 2Y5EA 5L6YH 4GKZB 5K9QG 1ACZA 1Q72H 4TUKL 3RWIA 4RISH 1WT5A 1M4KA 3AS2A 2NY6C 5GHWH 3U30B 4PRPE 5DO2D 4C59B 5GSRB 1UWEL 3H9YA 3CSYA 4YHYB 3MREA 4KROD 1SEBA 2NCMA 1D6EB 3ABZA 2DI7A 5JW4M 3U0PA 3T4YB 4UQ2B 3NAAH 2QLVB 2VDLL 4WFED 4N0YH 4KRLB 5EDXA 3BDXA 3QCUH 1LDPL 2Y1VA 3UYOD 4D0BA 5FFLA 3RZCD 2WZPD 4D0CB 3MYJA 5LWYH 3S36L 1AGCA 4KVCH 4FNLL 1BGXL 4YWGH 2ZPKL 2ESVE 3D0LA 4R96A 1F6LL 1S3KL 4JR9L 4YQXH 2DN7A 1NBQA 4LKCA 3MRLA 4PJBA 4G8IB 4GRWH 1KF9B 1MCLA 4OCXL 3L5XL 3DX9B 3RRQA 2GQHA 3S96A 3VJ6B 5HDQH 3DSFH 1GGTA 5FHBL 3SCMC 3TT3L 4J6RL 4GBXD 5L7XH 1GGCH 1CGVA 4DVBB 3MV8B 1MI5E 5IBLD 4BK4A 3NABH 3DVFA 4IBLT 2V2XA 3DROA 4LLYA 4RX4A 5DURB 4EQ2A 3V52H 2ZPKH 1AXSA 5IW3A 5IR1B 1S7SB 1KCRH 5EBMB 4L8BA 3RZCB 3FQUA 4PJFA 3IFLL 2R0LL 3JV5A 4GKOA 4ODBD 4S1QL 5J9PB 3S36X 3NCEB 4RX4D 5GRUH 3HPJB 4LVHB 3G9VA 4QKXB 2R2HB 3DO7B 5GRXG 3BPNB 1G84A 1JZ4A 3ULVE 4PB0H 1TPXC 3FKUS 4LQFL 1AR1C 1KELL 2R0WL 3CH1B 4BH8B 1I1AA 3S4SB 1XEDA 3F5WA 1S9XA 4Y4FC 4MQSB 1XF1A 5HGHB 5T33H 5H2BA 3TA3D 2ADGB 4I77L 1YC8A 1GZPB 1VSCA 3VXRE 1TZGH 3KHQA 4IIQA 4G43B 1M71B 3H42H 4I2XB 4GMSL 1IGFH 1MCBA 1LEKB 3GBMH 4Y1AA 3VA6A 5F9JB 4M4RA 4E41A 4ISVB 4M93C 4ZS6D 2DJSA 1NBVL 1ZT1B 5TF1H 2PYEB 2OBGA 3MODL 1V5JA 4ZPTA 1CDHA 4H0HB 3L9RA 5MP6H 5HGAB 5A2LH 5GGTA 4ONFL 4BH7A 3K1KC 3MFGB 2Z4QA 4NZTL 1JWUB 4JEGB 1KCVL 3DVGB 4HZLB 4QLRA 3D3VA 1JGEB 4OD2A 3DOSA 4JFPA 5F21B 4K7PL 1KCSH 2FD6H 1KLGA 2P42B 2IADA 5J7CC 1BAFL 3TC9A 3VWJC 2YZ8A 3FFCB 4KUCF 2ATPA 3RUGB 1WIPA 2ADGA 4HPYL 1IGIH 2FO4B 4O4YH 5FF6B 2FX9L 2NMSA 1QRNE 1UWGL 2VUOA 1KJVA 1M7DB 4S2SA 3NCMA 4GS7B 2BNQD 3HE6A 1RFDH 3I6LE 5AAWA 1YEKH 4I3GA 1HSBB 3IAQA 3H7LA 2VLKA 1LK3L 1MFEL 3O6FC 1WCBB 1B4JH 3T04D 1X5YA 1XGQB 3FT3A 1Z9MA 3SDYL 3U4AA 3U36A 1SY6A 3JTTA 4HPYH 5BXFA 4G8GE 4U0RB 5DSCA 1IGIL 1PFCA 4JFQA 5E95B 6CGTA 3S36H 3IKCA 3QWQB 4PTTA 5HHMB 1ZA3A 3T2NH 4ZTPL 3BH9A 2FIRT 5D1XD 2VDRH 3D48R 1R6VA 4W4NA 4WHDA 4PJFE 4LASH 5F7MC 3AY4A 4P49A 4ELMB 5AD0A 2Y7QB 3EJZC 1NKOA 3EO0B 1KUMA 3WKNA 5E00A 4KH2A 5EZIH 4Z5RA 1XZ0B 4TUJB 3X17A 5CZVH 3MUJA 5EOCL 5FUZH 3T2OA 4TPRL 5D96C 2D7NA 3MYJB 4HWBH 5IBLC 2IALB 2EYRA 3TYFA 1T5XB 2QQKH 1WF5A 1TVHA 1WTGT 1CQYA 4Y5VA 4KJQC 4HBCH 1G9MC 4YDJA 2XTJB 1HXMA 2XFXA 3HC3L 4Z0XB 2P48B 4Z7WA 4APQD 3DWTA 3OXRB 4UUJA 3T2PA 4C55A 5DRXA 2DOCA 3H9HA 1WWCA 1FH5L 4KRNA 3Q6GL 4Z0BL 3QI9C 3RY5A 5TE4L 4PRPA 4OM0H 2QHRH 1EMTH 1MCQA 1IQDB 1X5LA 5ICYA 2NNAA 4NWTL 4GG6B 5INCA 3EYUH 3UTPD 3F62A 4CU6A 5TJWK 4L3EB 4LL9A 4MD4A 1FNGA 4EI5C 1ZAGA 1QBAA 2B4CH 4I18A 5HHVL 3VI3F 4Y4KB 2BRRL 3MLXL 1IAKB 2BMKB 2P46B 5LG1A 2QSVA 1PX3A 3I50L 3B5GA 4KVNL 3ZE1F 1YPZF 2C1PB 2XTJE 2BJMH 4LHUA 1HKLL 1DVFB 2LE9A 4KMLB 5D7LA 3ES6B 2AEPH 2WLZA 2YWYA 4EBQH 1XT5A 1YEFL 5HI5D 2VQ1A 1CFTA 5DZNA 4R4BA 3FOLA 3FZUC 4HCRA 2VAAA 1JNJA 4GSDH 2OX5A 4MD5A 5C9JA 3CFIC 3MGOA 4RIRA 1AE6H 5JUEH 4P46D 2XZAL 4X5LA 4Y16B 1J5OH 1E4WL 3MRHB 3BGAA 1XGTB 4U7KA 3W0WE 3V5HB 4HJJH 3EYQC 3UJTL 3V95A 4RGOL 3LVEA 3L3OA 2CDFA 5K9OB 4BQBA 1LO4L 1M05B 2FATH 3K2UH 5CEYB 4LLMA 1IM9B 4MCZA 5ESAB 1FIGH 2VDNL 5JHDA 2QSCH 3H9SE 2EDBA 4OKVA 5C09B 4OCRL 3DVNA 5IIEB 4S0TD 1A6VL 1ORSB 3PWJA 4URTB 5KOMC 1A6AA 2DM2A 5E7FA 4U1NB 3RBGA 1PVHA 3MACL 3ZTNL 4Y4FD 1SYSA 3OPZL 3C8HA 2PTVA 1K4DB 2B0SL 3AAZB 4OV6F 5L6YL 1CDYA 2NY5C 4JN2A 1FIGL 2VDNH 4JRXE 4NHCL 1HILA 3C5ZC 1IEBA 1P1ZB 4XBPB 3QEGL 1I8IA 1ONQB 1Z6JT 3DUSA 4MMXC 4XI5D 3NZHH 3KPLA 1A9EB 1M71A 3QDGA 3RY6C 1FL6A 1UB5B 1A7OH 3GSNL 2DQCL 3LRSB 5IGXL 1NL0H 4LSVH 1S9WA 3IJSA 2JIXD 1SEQH 1HYSD 3B9DA 4S1RH 3RA7H 1FIEA 1RULH 3WS3A 2AKRB 3QEQA 3F7PC 5KAQF 2WW8A 2P5WA 4P46A 4M7JL 4J4PC 1K2DA 4LK4A 3W2DL 3HMXH 3D85B 5CBAB 2EH7H 4HK0A 3QISA 3MLUH 5F1NB 3ALWA 4PJHB 4BQ6A 4ZQKA 3KJ4C 3F12A 4P3DB 3ARGD 2X4TA 4P2QE 4X7TB 5SWZE 4S1RL 3EO0A 4OF5A 3TZVC 4PRDA 4F58L 1JZ7A 1SBSH 4G3YH 3WIFA 3D25B 4WVRA 5F3BA 4PRHE 3BP4A 5KZCB 2BSRB 2JIXB 2RQ8A 4PUBL 5HHPA 2DKMA 4ZOEA 5HYSB 3VI4E 2R0LH 3IFOB 3QDJD 3QUZB 2Z8WC 3LKRA 2V9TA 5ENWA 1UM5H 5AZEH 3GSNB 4XCYA 3QIUB 3E0GA 4EDWH 1I1AC 1BVKB 4RWYH 5DUMH 2MKLC 3VFRB 5FGCE 3MV9A 4XNUL 5F7DA 3CVIH 1YEIH 2VWEE 4ESKA 1GC1L 4U6TA 4GT7A 1QFWI 5D7KD 1T2JA 5TH2A 5IT2L 4PRNA 3P9MA 1AKJA 2CKBH 5ALCL 1NLBH 4TRPL 3OAYH 1B3JA 3LPWA 1CFVL 3PWUA 3FZUD 1NSNL 1XGPA 5IOPB 3MOBL 4PJIF 1ULVA 1FL3A 1QVOB 5HDOA 4Z77A 2XZAH 5M95B 1J5OL 4LDOB 4J3SA 1AY1H 5HDBE 1F4YL 2D3VA 2HT3C 2B39A 5HHOD 2XRAH 1M7IB 1P7KA 4PJEF 3NFSH 1ZGLB 3QIUD 4RGOH 4KDVA 4GRLA 1ACYL 1IC7L 4NIKB 4KHXL 1A6ZB 1MREH 4MXVE 1YUHA 1OSZB 4ERSH 2CJUL 4HDIB 1ZS8B 2FH6A 4DW2H 1S7RB 2JTDA 5FCSH 1D6VL 1M7DA 4S2SB 3RNQA 4YLQT 1GOHA 1P4BL 3WFBH 1RZKC 4Z7WB 2CLVA 1T1YA 3W9DB 5D2NB 3TT1H 2E9BA 3QNXA 3GZKA 1ZT4B 2I07B 2XRAL 4FFVC 5CJXC 5LAXA 1MUJB 3RJQB 2X4PB 3GNMH 3MACH 1XF2A 4JDVB 5K9KB 2PO6B 3VFTA 4YE4H 2ICEB 3L95A 5I1KL 1JHLL 1SVZA 3BUYA 4HH9A 2ESVD 5DDHA 1XGPB 4ZS7H 3TJEH 1U8MB 1CXHA 4ZOBA 5FGRA 3TBTA 1HSAA 4MDJA 1ZA3B 5EUOE 3FB7B 1CK0H 1EO7A 5TPWL 1NL0L 3BZEA 3H2WA 4RDQG 1EPFA 1YN6B 3BKJL 1NMAH 4LRIA 3WHE1 3H6JA 4FQCH 1XR9B 4JO1H 3LHPH 4F7TA 1IE5A 3P4LA 2H1PH 4UNUA 1KPRB 1QLEH 1S7XA 4RFNC 1DDHA 1LO0H 4P4RB 4YHZL 4YK4B 5EPMA 2MTPA 1OAYL 3DMMD 4PD4K 2DRUA 5EB9A 4JKMA 1L9MA 1RJLA 2GCYA 4OD3H 4RAUB 1JMZA 4PJXF 4GW4B 5CP7A 2HP4A 3JV4B 1UZ8B 4UT7H 2Y23A 4UTBH 3GJFA 4LF3B 4LHJB 3CZJA 4KTDH 2EICA 2WK2A 5T5FH 5I1JL 1WC7B 3SGEI 3EYSH 3OXRA 2XICA 4K2UH 4M02A 4NN6C 3GMQB 2EDLA 1DFBH 2OL3B 1MJ7H 1FC1A 4L9DA 3ZT5A 2VLLB 1SBSL 2WUCH 4JO4L 5LXGH 1U2CA 3UC0H 4N0CC 1DQQB 4XVTL 2ITCA 3GSWA 4KKLC 1J0HA 3K0WA 3UJJL 3QFDA 1A14H 2WP3T 4CU7A 4MX7A 2LTQC 2B2XH 4TUOA 4QNPE 5GSRA 1REIA 3HI5L 3WNPA 2X6MA 3UP1A 5A2KH 3BVNB 4LCYB 4HAGA 3O4OB 2BY1A 3BSZL 4BFBD 5SWSE 4XPHH 5I75C 4HUNB 3NN8B 3IRPX 1I1AD 3RWGA 5CWSB 4Y19B 3P11L 1IL1A 3LKNA 4XH2A 4RMVA 3RAJL 3HNSL 1G1CA 1MCKA 3B6SB 3GMNB 3RY4A 1CU4L 5IHZB 4NNYA 32C2B 4CADA 2HVKB 3KGRA 5DR5L 5T3XD 1NMCC 4I9WD 1NBZA 4MHHI 2GAZA 5FCUL 3I9GL 5C0CB 5EU4A 4Z7VF 4OCNC 5C0BD 1GL4B 2AK4B 3FQWB 4FFWD 1EFXB 1R24B 1JWMB 3F8UB 1YPZB 4NFDA 3MLRH 4JHWL 3UPAA 1IAOA 1K5NA 4ZDHB 3RGVD 4Z78B 4WUUD 2KBGA 1I7ZB 4RGNE 1RUKH 4MXVF 4ERSL 2CR6A 2VL5A 3BMWA 3QDGD 5TQ0L 1U0QA 2VITB 3SKJL 2R0KH 5IVZA 4NP4H 4I3RH 1HIMH 3QYCA 3GIZL 1TPXB 3ARYA 3DBXA 3DTXA 1BOGA 2GJ6B 4X80L 1IARB 4O2FB 4OUUA 3D69A 4H5SB 4MJ5A 4NQXA 4FQLH 3HR5A 1FYTA 4UV4L 1GVIA 1DUZB 4YBQD 5D2LE 3CK0H 2YRLA 3LZFL 2AEWA 2C3WA 2YPLA 1RJYB 2JIXA 4GAFB 5L2KD 3AB0B 1MY7A 4DN4L 2DLGA 3VG9B 3IFOA 3LH2H 4FQHA 2QKIB 1KJVB 4NZUL 3SDXA 3MRGA 1CZ8L 4RFEB 5EU3A 1C12B 3NACH 5HI4D 2HVJA 3VD7A 4LSPL 1UXSB 2BC4A 2FYYA 5MEOA 3QPXL 1G7IA 4JB9L 4O9HH 4KUZH 3BRGC 1CTOA 3ARBC 3VRJB 2CDGB 2D7PA 3E1F1 2VZSA 3TJHC 2XKSA 3FRUA 1I7ZA 4YBHA 4KV5F 5FDYA 1X5IA 4ELMF 2DQJL 2IANB 3BMVA 3QNYB 4YHNB 1Q0YL 2ZUSA 3RDTC 3VI4F 2BX5A 1T89C 1QHPA 1NANH 3CSGA 1N8ZB 1EEYA 4OV5A 1Q9OB 4HK3J 4IDJH 3U0TA 8FABA 3AUVA 3OB0H 1KENL 3V6FB 4NDMA 2Y72A 2R2BA 2UWEE 2WLYA 1JTTA 1QR1B 4OLZH 4AEIL 3A6BL 3PV6B 4CKVX 3VW3L 4CMHB 7CGTA 4YPGA 3DHMA 5GGTL 1MLBB 2R23A 1QPXA 2VUYA 2A38A 3VXSE 3EZJB 43CAB 4Y5VB 1J8HA 3ZLQC 3QXVA 5KANG 3C2AL 3IYLW 4QWWC 1JI1A 4Y1AB 4KI1A 5CINL 1IEAB 4LVOB 4NUJB 4WFGD 3C8KA 3H0TB 4BKLB 2VB5A 5LWYL 5HXMA 2C1OA 5HHQA 1BF2A 1Z5LB 5T5NG 4ODTL 4L9LB 5DJCA 5F7DB 4ZO6A 4HLZH 2HH0L 2ICEA 2J4WH 1B6UA 4UOW0 3MRQA 4NKQB 2XKUA 1JPTL 4QF1A 4BQCA 2HRLA 5EZLA 1MCPH 2DBLL 1GHFH 5C0ND 4RGMC 5C0JB 3TT3H 4W4OA 3PWVA 5KVGL 3PNWA 3B3IB 1MCWW 4MAYB 2QADD 3PHQB 5DT1L 2VKWA 4N0FB 4P2OA 5IQ7H 4BYHA 1P69B 4QOKE 4Y4KD 5LGKA 1NAKH 5EZOL 1A3RH 2ZNXA 3EOTL 1FZOA 4HUXB 1PAMA 2DTMH 5IT2H 3PQYB 2ARJB 2J8UE 4BA8A 4KK8C 2VTFA 1E27A 4XPGL 1KCKA 1N3NA 3DX8B 1DBAH 2VYRE 3MBEA 2VLJB 4N0YL 3MOAL 3GIZH 3VRIA 2FRGP 4BKLA 4X99B 1CICD 5CUSL 3SKUD 2AI0L 2IH1A 2X9YA 2CRZA 5GGVH 4WV1B 2BVOA 2OTUB 2F53A 3LEYH 2NZIA 1A21A 4MAYD 3FO9A 4OZIA 5K9KA 1QNZH 2BVTA 3MR9A 4QGTA 1CWVA 2W07A 2YKLH 3BH9B 3U1SH 1HNGA 3BD4A 2BDNL 1IKNC 1T2QH 1A22B 4AIOA 4JGJA 2EDWA 4GKSA 1G9MH 3JUZA 3R8BB 5T1KA 4DN4H 4NSKB 3BH8A 3QPXH 5HGBB 5C08E 2FH8A 3CCHA 4X6DB 3BN9D 2C4FU 2VL5B 4NQEB 2OJZL 3AXLB 3VXMA 1JYXA 2VXTH 3KWWB 2QHRL 3P30L 3ZE1E 1T5XA 3OX8A 1HZHH 4YE4L 4QHKI 3IS0X 4NKDB 4AY0A 2XZZA 4RWHA 5J4MA 1T7ZA 1PKQB 2Z31A 4NCC2 1HOCB 4JRXA 5DQJA 3QUZC 1MRCH 1Z0MA 2W60A 1MWAH 4HF5L 5KSBB 1PY9A 3PP4L 5D2NC 3EIFA 1H9VA 4ZUWA 4YHOH 3VXRA 4P23C 4U7MA 1G0DA 1LQSR 4IEFB 1RJCA 1R3JB 1WIOA 4UT6H 4ZFOL 2GFBA 4G6FB 3C60A 2CDFB 4X6DE 1HHGB 3V6BR 3CPLB 1UXSA 4KJQD 5IEHB 3IF1A 5KVMC 1DBML 3T3MF 2R2EA 4KQ3H 5BS0B 2P5WB 4PJ5E 4HCRL 3WO4B 1A1NB 4NSKA 3TP4A 1P2CB 3GHEL 1WISA 4FQ2L 1OARL 4KRPD 4ZO7A 4HWZA 1QBML 1RU9L 5DFTA 2PTTA 3IETA 2A73B 3P4OA 1X6NA 4OFYD 3O3DA 3N85H 3LKSA 3CLFL 1DR9A 4R4BB 4PG9B 3D69B 3HRPA 4DKFH 2X89A 2ICWB 2Z31B 1AC6A 4FZEL 4MD5B 4R4FL 1F4XH 5IMLA 3VD9A 1JNHA 1KC5H 5E2TL 3C5ZD 2ED9A 1FNSL 3EFDH 4OF7A 3SDXB 2DM4A 4NM4L 3TIDB 5E6IA 2ICES 2CUMA 3SO3C 3UTOA 4WHTB 4U1MA 4KRPB 2NX5D 1L7IH 4WJ5B 5KVGH 3WJJA 1V3KA 1GRWA 5F6HJ 3ARDC 4L8SC 4LIQL 1WITA 4PS4H 4YXKL 3MFFA 2YD9A 1I9RH 3MBXL 3HN3A 5K33A 1A3RL 1RIHH 3F6IA 2FLBT 4OFKA 1FVDA 2EXYC 3GMMB 2BRQA 3SE4C 1MFBH 4QF1B 3IXAB 2D4DA 5E8OA 4WEBL 4YNYB 1WCQA 4LDEB 2HYMA 3VFMB 5KW9H 5I8CA 1NFKA 4HIIB 5EOTA 5AAMA 1YYLH 2NX5A 2HWZL 3P73A 4PJXA 4YHLH 4HX1A 1QSFA 1NCWL 3KXFD 4R6UA 4F7EA 4RAVB 3M8OH 2DQIH 2BHUA 4JM4L 4Y8AA 1KB5H 1KPUB 2O5XL 3IFNL 3X12B 4JRYE 3HR6A 3W2DH 2QKIA 5KSBF 3LEXA 4JDTH 5FEBA 1AXTH 3PQYA 1GGUA 1JWSA 5F7KC 3BHBB 3LIZH 3V5KA 3WLWC 4QRRE 1IT9L 2HN7B 1MY5A 5TQ2H 1A4KB 5DK3A 4X6CB 2DWEB 1HZHL 5GIRB 3WE6B 4HC1H 1Y18A 5I2IB 2Y07L 3KPOB 3PXJA 1I1CA 1KCLA 2YD6A 4L3CB 1ETZA 3REVB 2OR9L 4WI7A 4HBCL 3ULUE 2PKDA 4J7RA 4WHYH 4WUKH 1GOFA 1MQ8A 1A6WH 4HEPG 2CLZA 1ITBB 4I77H 4JANB 5I1LB 1GPOH 2UY7A 1BD2E 3QO0A 5FUCC 5HD8D 3FMGL 3OKMB 1AGDA 4AEHH 3HC3H 1CLZL 2V5YA 3SE8L 3VXUE 4NQDA 1H3WM 1U8LA 3HCVA 4GQPH 4P2RB 4D0DB 4AT6B 4BSVA 1HQ4A 1S7WB 3ARPA 2AK1H 2MWCA 4OZFB 5FYLE 2NYYD 1XGUA 1FBIL 1N59A 1AGCB 3DYOA 3QNZA 3P9LA 4BK5A 1DN0A 1SJHB 1UXWB 4TVSa 4JZNA 4PJBB 4OZIE 1CE6A 2W0KA 2B1AH 1ZHKA 2O5YH 5HJ3B 3PHSA 3VXOA 4NUJA 2IBBA 3GMPB 5L0QC 3PWPB 1YYML 4WU7A 2OTUA 4KKAC 3WV0A 3V7MA 1R3JA 2AXHA 4GSDL 4TULH 4G7YH 3WIIH 4G8GA 3KYKH 5CP3H 1B0WA 2ITCB 1JPFA 3MR9B 3TV3H 1CL7H 2IWGA 3O2WH 4DKFL 3QO0B 3S5LB 1JE6A 1N5YH 4XAKD 2C3HA 4XXCC 5DHVB 4LSVL 4M9OA 2FX7L 2EE6A 3OR7A 4NN7C 3HPJA 4KKCD 1E4WH 1SJVA 4IMKC 2DD8L 3PWJB 4CNIA 3C5JA 1T80A 1RJZA 3B9EA 4IOFD 4RDQF 4D0BB 1EXUB 2GI7A 3GB7B 3MXWL 3TYFB 1U8KA 5C0IB 3RWGB 3KLDA 4OAWB 1FL5B 2UWEA 3LKNB 4OF0A 4XH2B 1AGBA 3PWPD 5DD1H 1T7WA 2GYSA 2JB6B 5GS2H 1S7UA 2EH7L 3TNMB 4F7PA 1ZHNB 5J8OA 1SMOA 3ESUF 5HYJE 2V5SA 32C2A 3KPTA 4ETQB 3VXRD 1YN7B 5DI8B 4MQTB 1RK0B 4RGND 2I5YL 3TBVB 1UB6B 2VXSL 1YJDC 3IKKA 4L8DA 3QDGE 5IB1A 2N4IA 1QQDB 3DIFB 3B9KB 3KAAA 3V6ZB 5DYOB 3WCYA 3VE0A 2A1WH 1PGRB 5BMFH 1OD9A 5H35A 3ZE0E 3EKCA 2DKSA 3VFNA 2AJYL 1UQSA 3KVQA 1JGUL 1NGWB 2AK4D 4JZJA 1M6OB 3AREA 5ABDE 4KTDL 4M62L 4P99A 3HE6C 4G9FD 1OTTC 3QEHB 4M03A 4R0LC 4NO3A 3SE9H 2XY2A 4HUUA 1N0LA 5EU6E 4HULB 4P4KC 5TDNA 2FECL 4I0PA 3K8KA 3QUXA 5ID0B 3H8NA 1UFUA 3B9KD 3EO9L 2HLFC 4Y19A 1MCRA 1I85A 2GJ6D 2P8MB 1NGZB 3KPNA 3GM0A 4XXDA 3X3FL 1B90A 3QFJD 4NUGL 4Y5YC 5CJQL 4HMCA 2XI9A 5DQJB 1MVUA 1T2QL 5KSBA 1U8HB 4MA8L 4ZXBB 4OT1L 4H1LH 5EORH 3GMQA 1OAQH 5IK3A 5I76B 3DARA 1IMHC 1K6QH 1NMCB 5DD5L 3SQOL 5E8EA 2CRIA 3GIVB 4NO0A 4BSWB 4U1IB 5HY9B 4ORZC 2NY1C 1CICA 5D7JD 1G9NL 1BVLA 4LLAA 4XC1L 2OTPA 1NGWA 4HIEB 5BS0A 2IANA 4AEFA 1AXSB 4HHAA 4F57L 4Y88A 5JNYA 4QTIH 2B20A 4DAGL 3V8CA 2FO1A 4YGVA 4Y5YB 1ZEAL 3O81A 3RVWD 1UM4H 4N8VG 5IB2A 2O5YL 2PYEE 3TVMD 3F7RA 5E08L 5JORA 4HFWA 3WMSA 4AZ8A 3PWUB 4XBGA 3VGFA 4N8VB 4XVUD 1SYSB 3KR3H 4XNUH 1KN2H 1RI8A 3IFPB 4TULL 3WIIL 4TSAL 4OFIA 2F74A 4Z7VB 1QR1A 2NY6D 5CAYB 1T7VA 5JLZB 4O2FA 4ODVL 4HX1B 5F3HA 4PGZA 3VXMD 4LCIL 4OM1H 4YPGB 2Y25A 2WUBL 3M07A 4OLWL 4JE4B 4JHWH 1RJYA 5IHZA 1YEIL 4ZXBA 3OHXB 1BZQK 2W9DH 1XGUB 4LLVA 3O9WB 3FT4B 3MZTA 3CFEB 3QIWB 1U3YA 3VXPA 5JXAL 3ZKMC 4U1IA 1NFIA 1NLBL 4XI5C 2BRRH 1OGAD 1QBMH 2HN7A 4OZHB 5FYKH 1N6UA 5CIPA 1HXMB 3SGEH 3BIBX 4R7NA 3MXWH 4NN7B 3SPVA 2OXGA 1AGEA 1XF4B 2QR0B 4ODVH 3WSQL 1NDMB 1WV7T 1BHGA 4ZAKA 4ZUVA 5I17A 1AY1L 3BP6B 2XQYK 3MUGA 1GAFH 3FQTA 3QJFB 3WEXB 1G7MA 1NBYB 4JR9H 3BGMB 5E99H 5GISH 5BVJB 3HTLX 4FFYH 4OLVH 4L4VB 3INUH 4WTZG 4HZLA 2EDTA 1U6AL 4U1JA 4PJ8D 5FB8A 3SOBL 3W9EB 2YXFA 3GEWB 4ELMA 1UM6H 2Q87A 1VKXA 4IMKA 1CFSA 4M61B 2XTJD 4RA0C 5SWZA 3VFSA 4U1KA 2AQ1A 1CLOL 1RUPL 2N7BA 1DQDL 2HFGL 5C3TA 1J1PL 1PEWA 1H3XA 3ES6A 1NAML 1UJ3B 4GAYB 5KN5B 1AO7E 5CGMA 4X6DF 5JOFB 2DQJH 4MVBC 3LRGA 4X9FA 4G8EA 5F1IA 3UZEA 2X4RA 3DX8A 3VG9C 3DX6A 4GW4A 2GITA 2JB6A 4IRSC 1HHIA 3UZQA 5DMIL 3RTQA 2IF7A 1GGIL 4MAUH 1PG7W 1VFBB 4KJWD 1A64A 2OK0H 4ZAKB 4NRXA 3MROB 4K3GA 1J0ZA 4OQ1A 2ADJB 2PW2B 3C6LC 2HFGH 2JKXA 4DOHE 3SDCB 3U0WH 4PRNB 2JJSA 1RHHA 3D9AL 2PR4L 2F54D 1QSFE 4K8RD 3RWIB 1RZ7H 5CD5D 5L2KA 4JAMB 4LAJH 4R8WL 3IDNA 5I74B 3O2VH 1J86A 5DGQA 1DANT 1T89A 1WBXB 1YY8A 3BH8B 3JV6A 3L3JA 5LGJB 5SWQB 2FB4H 5FA3B 4GG6E 2Y7QA 3RL1B 3R1GH 4XAWH 3C60C 5EO9B 3S5LG 4RZCA 5HYQB 4HC1L 1Q1JL 4LGPB 5DQ9B 1U8OB 1T21A 1OM3H 5IV2B 5T1LA 5MI0B 3RNQB 3QUXD 4B5EA 4MNQB 3B9AA 1X5JA 2FBJH 3KDMB 2HKFH 1KB9J 4KMTH 3RWDB 2DBLH 4X5XB 4E41E 1VGEH 1XGRB 1FYHB 1AHWB 2F54B 2Q86B 3VRIB 2QHLA 5ISZA 4KK6C 1HCFX 1E4JA 2CMRH 2WBJD 3WNOA 1CFNA 4IMLA 2YMXH 5EU7E 3OJVC 3NIDE 3L1OH 1U8MA 3CFKB 2J6EA 3W11D 4Q7DA 1MQKH 2X1QA 2NNAB 2DM3A 4MJIB 4NQVA 2PYFA 4PRIB 1LE5B 4MXWL 1U58B 5C71A 5AUMB 4ZSOA 2F5BL 3PNWB 2GTZA 4WO4A 1VFOA 1KJ2L 3GMOA 4NQSA 1Q0XL 4JHAL 3H3BC 1A6AB 3GBML 2F8XC 1SJEB 2XKNB 4MJ6A 1X4ZA 1DEEA 3TESA 5BRZB 5DUML 2QQLH 4XNQA 1FYTD 2VO5A 2VISB 3I75A 3IDXH 2BOBB 3IJYB 3E3QC 3LN4B 4JN2B 4QHMA 2KL6A 4M5ZL 1ZA6B 3KPPB 4Z18A 3BDBA 4UQ3A 3RFZC 4Z7NF 2WQRA 3RWJB 3ULVH 2LAGB 5D6DA 5L0QB 2W0FA 4DGVL 2FR4B 1N6QL 3SN6N 1AJ7L 3NPSB 4H8WC 4OTXH 2IPUG 3L7EA 3TCXA 5BRZE 5FGCB 2CKBB 4PP1C 5JQ6L 5ELIA 4MCZB 4HHAB 5I17B 4X83A 2IAMC 1TVBA 3VFWB 4A6YA 1E4XI 4ZYKA 3X11A 5ANMA 1WFUA 1H0DB 2CK0H 3DX7B 1RUQL 5HHXL 3MLZL 2R1WA 2AP2A 4X6FB 2ZSVA 4Z0BH 5FKAB 3D39A 4LKXB 4MB3A 4MYWB 2C3GA 4K23L 3RIAK 2WIIB 2R2BB 1JPTH 1MCOH 1L0YA 1JHLH 4NCDA 1PKOA 4V2BA 1GHFL 1RULL 1WQVT 4HS3B 5ECJE 1MRFH 1XGYL 1EUTA 2KH2B 5BQ7B 1A4KA 1DBBL 3A6OA 4CJ1A 4WFEE 4HS8L 3L3DA 5I15H 4M1CD 4GRWF 5D2NE 2CKBA 2V2XB 3DROB 1UYWL 3AY4C 1C7SA 2KDGA 1BVKA 2CK2A 1OCWH 5BVPL 3C08H 5L8KB 4P9HH 5ACZA 3L9RB 2EDYA 4PFEA 1WEJL 5DJCB 4WW2B 1LK2B 1BQLH 1RAMA 4YDIH 2BHZA 3O6ML 4HFUL 4MS8C 4X6FA 2OQJB 2FBJL 4QRTA 4R2GC 4NM4H 5HYIA 3F6LA 1QHOA 4V1DD 1VGEL 3WUWB 1FO0L 4H1LB 1U93B 4AT6A 4UILL 1Z2KA 4X7TA 5JXEC 4JO4H 3B3IA 3QUMB 3I02B 1RZFH 3UTQA 2I60H 4X4ME 4IRSD 3MJ7A 2Z31C 4OCLC 3IU4H 4PBVC 1MI5D 4PLJD 1L4IA 5T3ZE 1MLCB 4WNQB 3CFJB 5GHWL 1PQZB 1MAJA 3FT4A 3JV4A 3SCMA 4QHLA 3RVVC 1DSFH 4WHTA 2XN9E 4UV7L 3OKKA 4LCWE 3UDWA 3QWOA 5BV7C 3Q5OA 2PCPA 4LCWD 5HHNB 3BP7A 3EOAB 1C1EL 2GSIA 4KFZC 1YEEH 1G7JB 3RHWF 5GIRA 1JHKL 3WE6A 4KRPC 3ARRA 4NO5A 3LDBB 4HG4K 5IQ7L 4WO4D 4Z7QF 4HPOL 5FM4A 2YPVL 2LU4A 4Q0XH 3VFTB 4JPIB 2E7CA 4OLYL 2CSPA 3D87B 1L7TH 5JW5B 1F00I 4QRPD 2E9WA 3LQAL 1IZKA 5CUSH 2PN5A 1AJ7H 1H15A 2LV4A 1B88A 4PJXB 4JPWH 3QJHB 4GKSB 4F7EB 1NC2D 3NCYP 5CLWA 4U1KB 4BZYA 4JKLA 2R69H 3G5ZA 5DD3H 5GGVL 4LMQE 5HHOA 1JZ8A 4PJDA 1U95A 2OR9H 1NEZG 2R8SL 3GNML 1JK8A 1HYSC 2G2RB 4WCYH 3VI3E 3QQ4B 4WI3A 2NR6C 4PJCA 5I1EL 5AYUH 2NY4C 4JFFD 1J0IA 4QRPB 4RQQA 4G9FE 4QTHA 3VXRB 2DDQL 2XQBL 5K9OA 4X80H 2J8UF 4M7KH 3UTTD 1OTTD 3TN0D 5CHNA 1VFAB 5HVWA 2GFBB 4E5XB 5KOVC 2GJZA 3CXHK 5C0JA 4M3JA 1ZGLM 4D3CL 5T5FL 1W2KT 4CW1A 5I1JH 4B7LA 1EZVX 3B8YA 2A9MH 1IRAY 3QFJE 1DBBH 1NC4D 4QXGH 3BZEB 4LRNL 1IGYB 3NMEA 4W6WB 1GH7A 2DDQH 1MCNA 2CKNA 1TJIH 5KSAB 1YYMH 4DGIL 5EFIB 1EJOL 3TN0A 3CFCL 1A14L 1YMHA 2AABL 3IDUA 4TTDD 1T66D 1HILB 1RJLB 2GCYB 3LB6C 1CL7L 4P57A 2YR3A 4PJIB 3TNMA 3O9WC 5IB3B 2CKBL 1MI5A 1WBZB 3DXAA 3VFUA 2HG5A 3S88L 4M7ZB 4RISL 1DUYB 4XPFH 5IMOB 2B2XL 3KPRA 3RVTD 5IB1B 3T3PE 3RUGF 4JPVL 2YPLD 1F3JA 4UNTA 3VFOB 4GG6A 4OLZL 2WQ8A 5FKPB 3KHOA 3NAAL 1Y0LB 5MEOB 1TZIA 4POZD 1OF2A 5C07D 3QCUL 4HXBL 4NC2B 5D7JB 1FLRL 3LKPA 1BP3B 2IANE 3MFFB 4I48B 2FCBA 4OFYA 2EIDA 1P5UA 1MJUH 2XPGA 1NUDA 3EW3B 1UWXK 2KQNA 1QG3A 4M7ZC 2MHAA 4QHNB 1KJ2A 3KYMB 4U31A 3TZVD 1JYNA 3ULSA 2RCSL 1R3LB 3RI5K 5AG8A 1QFWH 4WUKL 4G6KH 2EIZA 3QQ3A 4YC2B 4KKCC 4OGZA 3BX7C 3SDAA 5IFJB 2F5BH 3IAGC 4IOIB 3NZ8B 2X4OA 1G1YA 4YJZL 1VENA 2HVJB 2W0FB 5C7XH 1SYVA 2NXYC 1TQBC 1B9ZA 5I8KL 3QR2A 3V5KB 1J18A 1NDMA 4ZAKC 5DK0B 4L8SA 3VA2C 3AVEA 2R56H 35C8L 1UQSB 2R8SH 3SBWA 4YHLL 1Q9KB 5EUOA 5IP4A 4PB0L 4P5KB 4KHXH 5ITBL 3OJ2C 4HT1H 4PRAA 5CJXA 2J2ZA 2PXYC 5I1HL 2Z8VC 4V1DA 5DD3L 1ORSA 1A02N 5F7LB 4AQOA 1OAZH 4LCCC 3FT2B 4L3ED 4K7FA 1MEXH 5B39B 1BJ1J 5C6TH 5GSVB 3DX7A 4LSRL 1IBGH 3F58L 2H2PD 3GKWL 4X6BB 3K3QA 4UDTA 1MCCA 4Q9RL 3W0WD 1NGYB 2H9GB 4P2OB 4GRLC 4OIBA 3WL9B 1KXQE 2IH3B 2Q8AH 5I1KH 1PSKH 1JHTA 1LEGA 3E8UL 3CD4A 5JPMB 1F4WH 4OGXL 4WRLA 5GGUB 5LCVH 2IPTH 4MSWA 5J6HA 3H9SD 3EYFA 2DQUH 3IJSB 5HI5C 3O11B 4WJ5A 4U6XA 5D71L 3GSNA 5DRWB 1XH3A 2BSSB 3VFVB 2OZ4A 4HGWA 4QXGL 5IKCA 2APFA 3LS4H 1HNFA 2DQHL 4R97C 4EBQL 3BSZH 4I0PC 5DMKA 1K2DB 1G6RA 1AI1H 2Q8AL 4OZHF 4FP8H 2F53B 4JRXD 1HH9A 1NMBH 4NM8H 4Z8FH 1VFAA 1A5FH 4JO2L 3IXAA 4P2YA 4B41A 3OJDA 4GLRH 3QPQC 1MRFL 5DD0H 4H26B 5IFAH 2HLFD 5IBTL 4NZJA 5DF0A 3HPLB 4CVWA 5FYKL 5FOBA 3OKOA 4QHKJ 4MNGA 4GG8B 1UYWH 1A7RL 4G9DB 4MWFA 4H1LA 2UVEA 1CS6A 4KXZH 4GKNB 1JHTB 1LEGB 3BJ91 4XMPL 2R29L 5ACMA 4CNIB 1IGTA 2OP4L 1N7ML 4PV9A 4M62H 2D31B 4U1HB 2VQTA 2YPKA 3ZT7A 4LF3A 2DWDB 4FFZL 1LO2L 4G6AD 3SY0B 2VZVA 3RWEA 3U4EB 4EQ3A 5E03A 2YRZA 3SKJH 4EIZC 43C9A 4GG6F 2A0LD 3G5YB 3NBNA 3P4MB 4QRPA 2X41A 5DI8A 4IMLB 4L3CA 4NRZA 1NCTA 2IBGA 2IGFH 3FTGA 2EH8H 3RWHA 3UYRH 5J3HC 3KNBA 4KKLD 5BO1L 3M8OL 2JE8A 1ZE3C 2W0PA 1MNUL 2A77H 3WXVH 1YEGH 4JGMA 3WFDL 3VFPB 3UBXI 1P53A 5FYLH 3PG2A 3V6OC 3BP5A 4ZSOE 4JFEE 4M61A 2AI0H 4GG8A 1FLTX 2QQKL 5SWQA 1QFUL 4YAQA 4N5ED 2J8OA 1IGYA 4WWKC 4FQXC 1F2XK 3QJHA 4KI5F 1N6VA 3MLTB 1KPVB 4RMWA 5FA4B 1MHEB 4BQ8A 5DEFA 2HT2D 1LK3H 4YDVB 3S37H 1B4RA 1K8IB 3GMRB 4HWNA 1W0VB 4Y0GA 5C08B 5BRZD 4HUXA 1KCRL 4N1CA 4JQXA 5J13B 1UENA 4NT6B 4UU9A 2UYLA 2VLRE 4R8WH 1NC4A 3TJHD 1C5BH 5SX5H 1DLFL 5ICZB 4CDHA 3GUTB 2PW2A 1UCBL 1I1YB 4WWKB 1YMMD 1ORQB 2WBJC 2HT4D 2VR5A 5B38B 1FRGH 1MFCH 4FQLL 1KLUA 4LSTH 4ORGB 2J8HA 5IG7B 2EE2A 4LSSL 5D8JL 3W11C 1FBIH 1HHHA 4XCNB 3GBNH 2IEPA 5CP3A 5EUOB 4R90H 4HIJA 5C0EB 1U2HA 1S9VA 4M3KB 3HI1A 1QFPA 2E8ZA 4JFHE 3ULUC 2M26A 5AZEL 3P40A 2EDHA 3MLYL 1T21B 5IV2A 2P24A 2MNUA 1FRGL 5FECA 3KXFE 5FO7B 3JTSA 3KJ6L 4K3DH 2NX5B 4NQCE 4YDKL 1J8HE 1QFWM 4OSUH 3MGOB 5IMLB 4K71B 4NQCD 5E2WL 3H7BA 4IOSD 1KLFA 1CR9H 2Z8RA 4Y5XC 3L7FA 1QO3B 3L3GB 1QUNA 4XHJD 3WXWL 1EBPA 2A9ML 1NANI 4JRYB 4K3JL 2OM5A 5I0ZA 1JF6A 4R26H 3WLWD 1JV5B 1NDGB 4OCRH 1EERB 1K4CB 2D0FA 3QDME 3QUXC 1MIMH 4XC3L 3VXPB 2PNDA 4QRRB 3KS0J 2YA2A 3P0YL 2ED8A 2R0WH 1AFVL 4EKXA 2APTA 3MMEA 4J2XA 3BIKA 4K7PY 1ZSDB 1OF2B 4PYGA 3L3IB 4P46C 3U9PH 4FFZH 1QEWB 3RDTD 5IF0A 1QA9B 3VFWA 4A6YB 1TZGL 3CVHH 4NO3B 1T20B 1IJ9A 2YEZB 3NFPA 4FTVB 2UUDH 4WHYG 3DXAE 1B0GA 4MDIA 4CVZA 2DL9A 3UDWC 1U92B 1WFNA 1URLA 1S5HA 5FYLD 2B1HH 1F13A 3TWCL 2FIKA 3TCLB 5I66A 3DPBA 4YEFA 5DJYB 3OXSA 1PQZA 5IFJA 4LAQH 1MJJB 1RHFA 3E3QE 3LN5A 3N1QC 1QRKA 1XIWD 2IQAB 4G43A 2DQEH 5DC0A 4KJYA 4PRHA 4PJBE 4HS6A 1H3PL 2BC4B 4XCFH 3VH8B 1YDPA 4KY1H 1VESA 2NW2A 1NAKL 2VC2H 5SWSD 1ZXQA 2A6DA 2G9HA 4PBWD 4L9LC 4X6CF 1YPZE 1QEWA 3QXAB 3T08A 1EVTC 3ZE0F 3EJYC 2VN7A 4C56E 3MCLL 5CJBA 3FN0L 4YHKH 1RFDL 1NCBH 1RUAH 5F7FA 1DL7L 3RVWC 2CMRL 4YUEL 3R0NA 3HPLA 5FYKU 4N8PA 3U0WL 1AD0B 4KGLA 3JUYA 5F3BB 3GSNH 3TO4B 2AJZB 1ZLSL 2Z93B 2EDQA 3DETC 4CUCA 3N1GC 3UTTE 1DVFA 5D7LB 1U95B 1O7VA 4GMTH 3DHJA 1I8MA 5KSUB 1DBMH 1PZUB 3MRGB 1FJ1B 5C0BE 2Z92A 1JGVL 3B9VA 5SWSB 4WUUE 3CZFA 1MIEH 3VXUB 4DKEL 2QJDA 3CFBA 2OYPA 2OLDA 1G9NC 1ZEAH 4YDIL 4U1GC 3L3DB 4HEME 5E56A 3SE8H 5E6YA 5TE6H 3TPUA 3OG4B 1ZHKB 3FO0L 2EXWD 1HWHB 2ZUWA 1R5IA 1YN7A 4MA7H 1OM3L 1KN2L 5IFHL 1NSNH 2O93L 3FMGH 5IHLB 4G7VH 1QQDA 4GAGL 3R1GL 3ARBB 3CVHB 2XWTA 1MF2H 5DYOA 4DZ8A 4EXPX 5T33L 3S9DB 4M6NH 2IAMA 2H32H 1NFDA 2P5ED 4OGYH 3MRIB 5D7LE 2VAJA 1UVQB 1N64H 3W9EA 4Y4HD 1G9EA 1MWAL 2AK4E 3GK8H 1OLLA 3MA9L 3SDXF 1FQ9C 3MRKB 3FO1B 5D96B 4CVXA 4I18B 5J6GA 5DMJB 5JIPA 3BW9A 4WUUB 1LP9E 3X3GL 1T1XB 4FFWC 4X6DA 5E1HB 4NJAL 4HJJL 3MRFB 3SJVD 4F7MA 3GMOB 4NQSB 3MJ8A 1TMCB 3RGHA 1EXUA 1BFVL 4MS8D 1KYOK 4O02L 2QL1A 5CJ8A 4G8EB 5F1IB 4TVPH 4G80A 2HTKD 5JZ7D 2NTFB 4J3WA 1YEDB 3VXSB 4AL8L 2H26B 1XAUA 4NNPH 3QUMH 4OLYH 2OL3L 2G2RA 2AV1A 5E94A 5I74C 4RMUA 1I3GH 1MPAH 5K9JH 3KPPA 1JYVA 2KZWA 1P7QA 3BP7B 3K74B 1MVUB 4NJAH 1UM6L 3ARBA 3L3HA 3BPOB 3IGAB 5I1IH 5MHSE 2B4CC 2BVOB 5C0AB 5FKPA 2EXYD 4UOJA 3TBWB 4BSWA 5FYJD 5C8JB 5MERA 1DBJL 4FHBD 5DD1L 5DDHB 4JO1L 4MNGE 3MX0A 3VWJD 5IJKC 1LO0L 5K59E 3RZCA 2DM7A 3IDXL 3D0VB 4CW1B 3VXSD 4PJGE 5EO9A 2E5EA 5HDQL 1X5FA 2DQCH 5C6PB 4PJCE 3EO1B 4QOKB 4XMKH 5FYJU 1RJZB 2ILLA 3QQNA 2NXZD 1CDBA 2WM0A 5HVHC 1OAXH 3D25A 1T22A 4TVPD 5JIHA 5FGSA 3THML 1FV1A 4WDIB 5ISZE 2YD1A 5I1HH 5D72H 1ZHBA 4LARH 5E6IB 2X70B 3KPRB 5E9DB 1HWGB 3MNWA 3MXVL 5D1XC 2YUZA 2YXMA 2APBA 3CMOH 1TJIL 1Q1JH 1V8HA 3QUYC 4Y2OA 3UBXB 3ULVF