3A02A

Crystal structure of aristaless homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
51
structure length
51
Chain Sequence
TFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation
molecule keywords Homeobox protein aristaless
total genus 20
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a02A00
1AKHB 2KT0A 1T56A 1Y1WJ 3A01A 2G0EA 1JKPC 3JR9A 4XRSG 2ID3A 5K7FA 2JA7J 3GTOJ 5FKNA 1ETXA 3W6VA 4ABZA 2XB5A 4B3AA 5BNGA 3ZQFA 2GM4A 1LFBA 5FKOA 1Z77A 2M8GX 2NVXJ 1ZQ3P 1H89C 1B8IB 2LP0A 3FK7A 5IP6A 2Y30A 2DA2A 2X9DA 5EGOB 3I4NJ 1NTCA 1XG1A 5HODA 3SJMA 1HCRA 4JYKA 2CJJA 1LE8A 1LFUP 1WPKA 2R5YB 1P7JA 1LE8B 3G1LA 1ITYA 5EG0B 3G1MA 4I76A 1JTXA 3BQYA 1FTTA 4A69C 3CDLA 5F04A 1MBGA 2D5VA 1MBJA 2FD5A 2Y0SN 3ZQCA 1TWCJ 4W97A 2R92J 3HOUJ 2JJ7A 2M9HA 2K9NA 2HOSA 1VFCA 3S14J 4AUXA 1TC3C 3BT9A 1U9OA 2DMTA 3MKLA 1T33A 4JX6A 1ETWA 3JRDA 1G2HA 2VI6A 4UUSB 5J1UA 4BY1J 4D7MA 2E19A 2EZHA 1RKTA 3WHBA 3HOZJ 5M3FJ 4UUTA 4A3BJ 2HOTA 1IGNA 1MH3A 2L7MP 3BR6A 3JRCA 2FJ1A 1ORKA 3A01B 2FQ4A 2XGCA 3TEDA 2O7OA 2LD5A 5EDNA 5FLVA 2QCOA 1JGGA 3IH4A 5C4XJ 2W48A 1ETVA 2XRLA 5E3LA 1BW5A 3DEWA 1MH4A 4QSHA 5JLWA 4JP0A 1MBHA 3JRHA 1ZKGA 2DMPA 3ZQGA 5K7ZA 4A3KJ 3JRFA 4DYRA 3BTLA 2Y2ZA 2EBIA 2I10A 4BY7J 4C2MJ 1JKQC 1RKWA 4MO7A 4C3IJ 2GLOA 1ZGWA 4GFBA 2VUMJ 1WI3A 5IYCJ 3K2AA 3O8HA 4EEFG 3TP3A 1RETA 1XS9A 1E3OC 1SFOJ 3Q0UA 4M3GA 3Q3SA 3BG5A 2Y31A 1RPWA 3E7LA 2XGEA 3VPRA 4L5EA 2B63J 3F0CA 3GTPJ 1WH7A 2M0CA 2DA5A 3BG9A 3MN2A 1UHSA 3BR1A 5EGOA 2LFBA 1PUFB 1QVTA 1TWFJ 2L0KA 3A03A 4W1UA 5C44J 1P7IA 2JN6A 3HGYA 4A3EJ 2JA8J 3ZQLA 2DJNA 1BW6A 2GBYA 4XK4A 4DZPA 2Y9YA 5E3MA 3S1NJ 2P81A 3GTQJ 2DMUA 1OFCX 4DYCA 4A3LJ 5EZGA 4MFEA 4XRMA 3FIWA 1W0TA 1IDYA 3M3YJ 2DA4A 4BBRJ 1FIAA 1AKHA 3S2DJ 2CQXA 2X6OA 5IOYA 3HOYJ 2MSYA 3IH2A 2DN0A 1JJ8C 3GTMJ 5EZHA 4NDLA 1PUFA 5IOZA 2DMQA 4I6ZA 2R7ZJ 2NS7A 3OIOA 3Q0VA 2WAQN 2K9QA 2WV1A 5J1YA 1R9TJ 2HYJA 5EYRA 1O4XA 5JLXA 2ZB9A 2O9LA 2EZIA 1B72A 3HM5A 2HQ5A 2EQRA 2JWTA 4V2FA 2XPWA 1FEXA 3PO2J 1ZR4A 3BQZA 4A3GJ 3GBGA 2DA7A 2AHQA 5IP7J 5M3MJ 5F1JA 1TWAJ 5EF6A 3FK6A 4X1EA 1H8AC 2E1OA 4CYCB 1JT0A 2N8GA 3JRBA 4QTRA 2L7ZA 4A3DJ 1JKOC 3JRAA 1JUPA 2HI3A 4LOCA 5C3EJ 3BTCA 1EF4A 1B8IA 9ANTA 1F36A 5GP9A 3FKIJ 2KDZA 1X58A 1DU6A 3BR2A 3PM1A 1Z0XA 3FISA 2JMWA 3TW7A 1TWHJ 2HXIA 5J1RA 5K7HA 1AU7A 3LSPA 4A3IJ 2IAIA 1HLVA 1IRZA 3QPSA 2NVQJ 3OSFA 2R5ZB 2E2JJ 5FKKA 2FX0A 2Y9ZA 2VKEA 4D7NA 2XPUA 2NS8A 2NOGA 3NARA 4IHVA 4IHXA 2M2EA 3BG3A 5C4JJ 1QRYA 4HNVA 3LNQA 4M3FA 3ZOBA 2EZLA 3Q0WA 2DA6A 2MGQA 2R5ZA 2ECCA 2K9SA 3I4MJ 5E3OA 2LY9A 3H0GJ 1JKRC 3OOUA 4Y7NJ 2XGDA 3CCYA 1GT0C 2DMNA 2H8RA 4XIDA 1QVUA 1BL0A 2LK2A 2WB1N 3JREA 1FIPA 2CUEA 2YS9A 3ZQHA 2L9RA 1UG2A 2DA1A 4UUSA 3GTLJ 3NAUA 2TCTA 4FTHA 3HOVJ 3QPLA 3LSGA 5EG0A 3S16J 1GVDA 4FE7A 1ETYA 1GV5A 1HF0A 3S15J 2ECBA 4A93J 2XPVA 3S17J 1F43A 1I3QJ 2H1KA 1A6IA 2DTZA 4M6VA 5F27A 4M3EA 1JJ6C 1IDZA 3RZDJ 3QQAA 1MSFC 3BR5A 1MBFA 4DW6A 3G1OA 2R5YA 4MIMA 1D5YA 5F0HA 3UKGA 1JUMA 2VPRA 4IEJA 4V2GA 3HOXJ 5EEAA 4BKXA 3C2BA 5M5XJ 4Y52J 1H88C 1ZTRA 2ME6A 2CRGA 2JA6J 1Y1VJ 1IJWC 1OJLA 1JT6A 2TRTA 2RAEA 2EH3A 4D5CA 1BJZA 3BR0A 3JRIA 1Q1VA 1NK3P 2L7FP 3S1MJ 1HOMA 4AC0A 2COBA 2HOAA 4AYBN 1RR7A 2QF7A 4FCYA 2HDDA 2NVYJ 3S1QJ 4RDUA 3HEFA 5IYDJ 2OPTA 1VI0A 5M5WJ 1U9NA 3HBLA 3JRGA 1U78A 4B4CA 4A3JJ 4JX4A 2LVSA 1FJLA 1A5JA 4DZJA 3HGGA 3GTGJ 2IEKA 1ETOA 3CMYA 4QIWN 3TP0A 3DCFA 2XSDC 3RKQA 3BR3A 1MBKA 2XB0X 1ETQA 1K61A 3HOWJ 4M3BA 4DYQA 2LTPA 3S2HJ 1AHDP 1RESA 3O8GA 1BA5A 1APLC 4CYCA 2R93J 2DA3A 1OCPA 2R0QC 3GTJJ 3RQIA 1MNMC 1WCMJ 3SDGA 2YUSA 3TW6A 2LLKA 4G12A 4BXXJ 5GPAA 2PMZN 4B1RA 1IV6A 2MW8A 4D5FA 3B6AA 5F0FA 5E3NA 1HDDC 3B6CA 1ETKA 4XICA 3LSRA 2LR8A 5F0CA 4RBOA 3HKZN 3RZOJ 5FLMJ 1U8BA 1VF9A 3LSJA 1SANA 1GV2A 5GPCA 1I50J 3CQZJ 1IG7A 1TWGJ 4S0HB 2JA5J 2IBDA 1FTZA 1ZK8A 1OCTC 5FKMA 2LKXA 4A3MJ 2ID6A 2OF7A 3D1NI 1WGXA 3MVPA 2JK3A 5IPAA 3LOCA 1K83J 4A3FJ 4X6AJ 3A02A 5J3LA 2VKVA 5M5YJ 4XRSA 1W0UA 3HDDA 1X2MA 3ZQIA 5DS9A 2E2HJ 1YRNA 2MG4A 1CQTA 2NVTJ 1WH5A 4C3HJ 2ME0A 3OSGA 2YU9J 1JUSA 3IH3A 1POGA 3K7AJ 1UMQA 1GDTA 3PO3J 3L1PA 4JX5A 5IP9J 1VNDA 3S1RJ 3M4OJ 5FKLA 1IC8A 3H3VK 2AO9A 1HDPA 1XC5A 2O8KA 2CQQA 2X48A 4FISA 4MLOA 1I6HJ 4BBSJ 2EZKA 1X2NA 5FJ8J 1ENHA 1YRNB 1IUFA 3BTJA 1JTYA 4FE4A 2K40A 4IHWA 5F08A 1B72B 3SFIA 2CUFA 4MFDA 4J19A 3GTKJ 3HB9A 2HXOA 3IV5A 3BTIA 2ELKA 4IHYA 1MBEA 1QPIA 1MSEC 1NK2P 2E2IJ 4C3JJ 1ZR2A 1DU0A 5DTDA 2CU7A 4M3DA 1S7EA 3WHCA 4A3CJ 5IYBJ 1GUUA 2M34A
chains in the Genus database with same CATH superfamily
2G0EA 5DV5A 3CP2A 2F5VA 4AVPA 3KLNA 4XRSG 3GX4X 4ESJA 3W2AA 2ZNYA 3FMRA 2KP6A 4BDZA 3W6VA 2DT7B 4ABZA 2XB5A 2XVCA 2V26A 3EQLF 3MFKA 3TMOA 2EFNA 1Z77A 2F4IA 4Y3OA 3CO6C 3DBRB 4N0BA 4UB8C 1TQIA 1F4KA 1B8IB 1FOYA 3ABTA 5IP6A 2BHZA 4HX8A 2M4GA 5EGOB 3GXOA 1FBUA 2K4BA 4RAFA 1NTCA 2VJJA 5HODA 3SJMA 4ZH4F 4QLCU 1LUJB 2MFZA 3DKWA 4J00A 2R5YB 1P7JA 1AA7A 1BJAA 3KYCB 2Z9OA 2MLGA 1ITYA 5EG0B 2PJPA 2JVHA 4OAYA 3CCLI 5F04A 3BG7A 1VQNI 3U9GA 1MBJA 5HNFA 4FQGA 2BBYA 3ZQCA 1YLFA 1QBJA 2K9NA 4IOAF 1O3TA 3MKLA 1T33A 1EH7A 2L54A 4BY1J 1H9TA 1U5TC 5CVRA 3T0YA 3LAPA 3K2ZA 3WHBA 2ZNZA 3HOZJ 3K6GA 3JSPA 1SD4A 2O5RA 3KEQA 4PZJA 3SQNA 3V7RA 3HHHA 2X0LA 3PUBA 2YX4A 4RLQA 4UUTA 4BE1A 3VYUB 3KPHA 1REPC 1HXDA 2L7MP 3M1CA 2IS1A 3CLQA 2F4MB 3KP2A 3JRCA 1RIOH 1Z9CA 3RYRA 1CF7A 3A01B 4K2EA 4I02A 3K4MA 4LFUA 1MDMA 4IPAA 2A5WA 3TEDA 1OCOH 4UVCA 2O7OA 4BE2A 2IGKA 3FXKA 4PK4A 4HX4A 1ZG1A 2KIQA 3I0TA 3IKVA 5EDNA 4GDFA 2ZXIA 2DLLA 3PSIA 3FXUA 1JGGA 3IH4A 5C4XJ 5J4YA 1FP2A 1UJ8A 1ETVA 3J7AO 2XRLA 1BW5A 2JPCA 1QGPA 3CCJI 3BPXA 2LMDA 5JLWA 3JRHA 2DMPA 2OTJI 1Z3XA 3NQOA 2PG4A 3BTLA 2Y2ZA 3SDBA 2I10A 1OQYA 1SVMA 4G7OF 2XAJA 3A0BC 2EFQA 1DP7P 2GLOA 1TT5B 2DFIA 1WI3A 1IXCA 3I59A 5IYCJ 1XS9A 1RETA 2L7KA 4L5EA 4HA8A 2RDPA 1WH7A 5LLQA 4BACA 2DA5A 4EJVA 3ASOH 2BVMA 2JUGA 1PUFB 2Q0OA 2COMA 2IXSA 2RQQA 3I56I 1QVTA 1FMWA 2J5PA 3I58A 1TWFJ 4M6XA 1BIAA 2HYFA 2L0KA 4E7SA 2P6TA 5FB2A 4YRVA 5KHDA 4G94A 3ZQLA 4HSTA 2F6CA 2DJNA 1K6YA 5K1YA 4MTEA 2P81A 1MMSA 1MZBA 4DBRA 1XX5A 3GZ5A 2MABA 3M8JA 3R61A 2R7SA 3KE2A 5EZGA 4EMSA 1OCCH 5GTIC 3M3YJ 2WB1A 2X85A 2DA4A 2FRHA 5DYMA 1C0WA 2HVRA 1KQ0A 1T0FC 1YE9A 2EFPA 2CQXA 3K1MA 5IOYA 4M9XA 5HS9A 2DN0A 2CS3A 4OMYA 1U8RA 1R00A 1V55H 1W5CC 2DQLA 2DMQA 4Z6YA 2V6CA 3G4SI 3MAJA 2OJED 4YIIA 5J1YA 1LB2A 3FDYA 2HGCA 5H20A 4AIHA 4CYDA 5JLXA 1B72A 3HM5A 2JQ7A 1DUXC 3HTUA 3Q5FA 3PL8A 1IXRC 2JWTA 4P1WA 1D8JA 5ICCA 2K4JA 4V2FA 1FEXA 3BQZA 2PJRB 2RV8A 2DA7A 3CCEI 2ZO4A 1BI1A 2AHQA 5CLSA 2BXZA 2XKOA 4XKBA 2LREA 1FZPB 4MEYF 3LSKA 3WTZA 4CCOA 4G6QA 5ICGA 1JT0A 3SYTA 5IT9Z 2L7ZA 4B09A 4ZYGA 4LOCA 3KZIC 1F36A 1VQ5I 3FKIJ 1Y8RB 1YJWI 1DU6A 1W7PB 1VTNC 3RQ4A 4WXCA 2IRFG 2Z33A 1CF7B 3ZRGA 2HXIA 2HPIA 3HUGA 4LMYA 5J1RA 4RB1A 1AU7A 1HLVA 5LEJA 3TOAA 3QPSA 3OSFA 5FKKA 4S05A 2V9KA 3G6EI 5ICFA 2VKEA 1UELB 3REOA 2NS8A 2NOGA 3JAMZ 1G3SA 3IAS2 2BEOA 2V1NA 1MDMB 4M3FA 3AAFA 1S29A 2DA6A 4PDKA 1TLHB 4MHGA 2ECCA 1KZHA 2K9SA 4B8XA 3I4MJ 5KVRA 4E7LA 3CUQC 4Y7NJ 4BEHA 2A5YB 3GO5A 1V5GA 3LFKA 1V3FA 5D5UB 2K7LA 1E3HA 3DKYA 3DF8A 4C2TA 1FIPA 6PAXA 5FLXK 3OYBA 1I27A 1WJFA 3ZQHA 5DM7F 1UG2A 1E17A 4N9HA 3OYEA 1S9HA 2DA1A 4UUSA 4KN7X 3CCMI 5KCMA 2VKHA 3A4CA 1W1WE 1MJBA 2XRNA 4C2UA 3JSOA 2BV6A 4G9YA 1DP3A 2HFHA 4UHTA 2IW5A 3OS1A 1ETYA 2ECBA 4A93J 5D8LB 5B1AH 1I3QJ 3JW4A 4E7JA 2H1KA 3KZYA 4R1HA 1YS6A 3SZGA 4CUGA 1JXSA 3OYDA 1USTA 3J81K 3VSLA 4DJAA 1MSFC 1G3TA 2H09A 1MBFA 3BZCA 4ZDPA 1D5YA 1SMTA 4V2GA 3HZJA 4Y52J 5FFXA 1QZZA 4EM0B 1ZTRA 1J75A 2NRAC 2JA6J 2LBFA 1R1VA 4EQQA 4ENMA 4II2A 3WU2C 2V6EA 1I6XA 1JT6A 2TRTA 2XAUA 2CV1A 2RAEA 2EH3A 3AG3H 5TGTA 2XROA 3L2WA 4YFKF 4LG3A 2IS6A 3ZMSA 4KITB 2R3SA 5B66C 2AQEA 1XCBA 1RR7A 4DOZA 4FCYA 1OCZH 4P9UA 3DKXA 2E35A 3BJ6A 3KX2A 2WY7Q 3HEFA 4XN0A 1ZLKA 3CO7C 1VI0A 5M5WJ 1U9NA 2QBYA 1BM9A 4BNCA 3KP5A 3JRGA 2HDCA 2CW0F 2X6YA 1YX5A 4B4CA 2EK5A 4RM2A 2EA2A 2KIFA 4M71A 4ENKA 2FNAA 1A5JA 3DPUA 4QIWN 4LB5A 2QENA 4IXAA 2H8WA 3RKQA 3C3WA 1W7PA 3CDIA 2XB0X 4BYYA 1K61A 2VE8A 5CVJA 3ROUA 3RPUD 4ZYEA 4ZTJA 1KYWA 2XF5A 4BH9A 4IRIA 1AHDP 2BVLA 1OCPA 2EFOA 1S8NA 2KFDA 4UV9A 3BJAA 1J2XA 2HQAA 1OKRA 3H9JA 2QLZA 3RPUA 2DPUA 1WCMJ 3TGNA 2VT3A 3CUQA 2V1XA 2LLKA 4HDVA 4BXXJ 1SAUA 5GPAA 2HU9A 2MC4A 4HF2A 2FBIA 1R4NB 3DBLB 2KDOA 4BAYA 2XIGA 5F0FA 2HVSA 2BHYA 2Y69H 2UWMA 1ETKA 2Q8KA 4HQMA 3U1DA 5HDNA 3LSRA 1LPQA 3U2RA 2NVUB 1FYLA 3LSJA 4BHCA 3WTXC 1F1ZA 3DLLF 3GF2A 5D5XB 1IG7A 2WADA 4D1QA 1DDNA 2QQAA 2JA5J 4RA2A 2IBDA 3GFJA 1A36A 3GMEA 1Z7UA 2QKLB 1OCTC 2RC4A 5HOOA 1PDNC 4HOBA 2A6EF 2IVMA 1S72I 5GADJ 3VFZA 4EJOA 3HSEA 2IGNA 4N4OB 2KZVA 3R4KA 3MZHA 2LOOA 2PBIA 2DK5A 4UV8A 2LH9A 3S2WA 3E6DA 2HEOA 2CYYA 3OYLA 1W36C 4L9NA 3A02A 1I3AA 1WJ5A 2PMUA 5M5YJ 4BL0B 4CA0A 4XRSA 5J6XA 5JVTA 1X2MA 3WTTC 1BIBA 3ZQIA 4LK1F 5DS9A 2E2HJ 1YRNA 3BROA 1WH5A 1GXPA 2Y75A 1OR7C 3OSGA 2X6WA 3IH3A 3WGIA 2DAOA 4PSWA 3OR2C 5IP9J 2W7NA 1VNDA 2BGCA 3S1RJ 4KDPA 5FKLA 3K4CA 2MH2A 2DBBA 2XSJC 5LRSA 5DD4A 4HNUA 1VQOI 3L2QA 2AXLA 1Z91A 2O8XA 4RB3C 3QU3A 1I6HJ 1YRNB 4BQAA 3VODA 1ZRFA 4FE4A 2JUCA 3JTHA 2VODA 2R7TA 3ZCOA 2PN6A 3H5AA 3H9QA 1FMVA 1RC9A 4IJAA 4AD9A 2ELKA 3CCUI 3F3XA 2PEXA 1P4WA 5HLIA 1DU0A 4B48A 5DTDA 4LJZF 2ISZA 1S7EA 1P4AA 1SD5A 4XLEA 1BOAA 3ELKA 1I1GA 3K1PA 5JHUA 2A05A 4E7HA 3GYHX 1AKHB 1Y1WJ 2V9PA 1JKPC 4KT6A 2R7VA 3N4MA 4UUVA 1RUNA 4XL9A 3FHNA 3DU6A 3GTOJ 1Y56A 2P0WA 1XMKA 1Z67A 3G2BA 3FMSA 3CD6I 3M1EA 2GM4A 1LFBA 5FKOA 5CVUA 1E3PA 1IAWA 4KNYA 4LG0B 3L2VA 4KIFA 4RB0A 3OY9A 3HPHA 1H89C 2F48A 2O0YA 3I4NJ 3TO9A 1Z05A 1WZ2A 3J7AY 2W82A 5E79C 5HDGA 1YJ9I 4HW0A 1XDSA 4KIGA 1HCRA 4JYKA 3HL2A 1OYWA 5IT9K 1LE8A 1LFUP 4MEXF 2NS0A 3VDXA 4O3MA 3G1LA 2RQPA 2PJRA 5AIQA 4CH7A 2R7RA 4I76A 1JTXA 5D5WB 2ACJA 4GGGA 3M7GA 2IT0A 2OTLI 2X51A 4A69C 3H0DA 3A2KA 2OV7A 2WV0A 4ZYDA 1MBGA 3ABLH 2BY0A 2JZYA 4L0YB 2D2WA 1FSEA 2FD5A 2Y0SN 1YW9A 3L2RA 3D5SC 2R92J 1CGPA 5E1XA 3X2QH 1JHFA 3HSFA 2M9HA 4P9FA 3ONQA 1VFCA 2G7HA 1TC3C 3BT9A 5EEGA 3W3CA 1EJ9A 2DMTA 3S8PA 1E0EA 1ETWA 2OZ6A 2F4OB 1G2HA 1B4AA 3ZMDA 5J1UA 5DD8A 1VQLI 2M45A 4D7MA 2EV5A 3SFZA 2E19A 1UHMA 4XLAA 3FKJA 4EJWA 2FEZA 1BI2A 2DXIA 4HEA2 2IP2A 2L01A 1EH8A 2ZCWA 4A12A 4A3BJ 3R0JA 2HOTA 1MJAA 1TW3A 3CF2A 2HOEA 3H3UA 1IGNA 1MH3A 3O6BB 1IRFA 3MKZA 1SFUA 3C1DA 3BLYA 2WAQA 2WWYA 3AG2H 3F8MA 1J7KA 5JI6A 1J0RA 5HLTA 1TZLA 3IHUA 2LD5A 1FOXA 2OC6A 2M1BA 1YOVB 2V9VA 2W48A 2WY8Q 2P5LC 2QSHX 3DEWA 4QSHA 2DCEA 1MBHA 1L0OC 3ZQGA 1IN7A 4M9ZA 3FXQA 4C2MJ 3PQKA 1EV7A 1T0FA 2EILH 3CMMA 2VJ5A 2XAHA 5DCFA 3ECOA 1YFHA 1E3OC 2KJCA 4BQQA 1BC8C 2L9NA 3AL0B 1T95A 4B43A 1T2KA 3BG5A 1QZYA 2Y31A 3VPRA 4EJUA 2Z99A 1BR4A 4IQ4A 4L0ZB 1B59A 3TO7A 3F0CA 4HZFA 3HC7A 1R22A 3KZZA 2W84A 1VZ0A 1ODDA 5BPDA 2FOWA 5BQTA 2E34A 3A0HC 5HS8A 3OYNA 3FXRA 3QWLA 3QU6A 1WSUA 1P7IA 2JN6A 2JA8J 2R7OA 4CZZA 2GBYA 4DZPA 1KGSA 3S1NJ 4F52A 1WJCA 4G6DA 4XMYA 1OFCX 1Q1HA 3K70C 4A3LJ 3ZP5A 3N05A 2EWNA 2K9LA 1YW7A 5ILUA 4MFEA 3HOTA 3FIWA 1W0TA 3JAMK 1AKHA 1NG6A 1RUOA 2X6OA 4D0PA 1U5TB 4WX9A 3JTGA 1JJ8C 4XKCA 3KIOA 1GVJA 4P5OA 3KP6A 2ZSHB 2Y0SA 3K9TA 2DI3A 2BW3B 2KQRA 3G73A 1VQPI 5IY5H 1F9NA 2VOPA 3Q0VA 3DEUA 2F5DA 1XSVA 2K9QA 1R9TJ 1B9MA 3SZTA 1O4XA 1N78A 4JQFA 3MCZA 4M73A 1LDJA 4I98B 2EQRA 3TKYA 2JVGA 4G7ZF 2Z5UA 2FE3A 2VQHA 2XPWA 2H27A 4A3GJ 3V8JA 4ZYHA 1S7AA 1IRXA 2GIVA 2VC1A 1ZHFA 3H5NA 4ANJA 4CCJA 1UZCA 4Y33A 2HVQA 4NBQA 1NHAA 1SD7A 2OCEA 4PCQA 2CV0A 4FT8A 2LY2A 3GW2A 1BR1A 2L2OA 2NNYA 2W57A 3CC2I 1XDUA 4ZC3A 1JKOC 3HXLA 3JRAA 1JUPA 3IKTA 5BOXA 3BTCA 4S04A 2Y48A 1B8IA 1LDKB 9ANTA 1EH6A 3GUDA 3ZMUA 5J4VA 2BZTA 2KDZA 2ZMEA 1KQ8A 1Z0XA 2JMWA 3BDDA 4E6KG 1TWHJ 4ZJZA 5K7HA 1TQPA 3CF5F 3PNTA 4A3IJ 2IAIA 1IRZA 2HS5A 2NVQJ 2R5ZB 3S3OA 2FX0A 2ZBKA 4G6TB 5DEQA 3NARA 2M2EA 4L9JA 2VC0A 3WTVC 3BG3A 3LNQA 3L00A 1IUYA 4HQEA 3ERED 3ZOBA 3IAM2 3OIQA 1ZG5A 1DQUA 3Q0WA 1KQ9A 3KFWX 2R5ZA 2QEXI 2B9SA 2O6GE 2LY9A 5LHHA 1J09A 2XGDA 3CCYA 5H2FC 2UV1A 2QGUA 4GRIA 3B73A 4XIDA 1QVUA 1BL0A 2ZMEB 2WB1N 3WTWC 4BHBA 4KA4A 2L9RA 2XAGA 4BJTA 2X4HA 5E1WA 3WODF 3QPLA 3PIPF 3F72A 4BU2A 1KYZA 4E7ZA 2FQ3A 3CUQB 2WTEA 4MNUA 4NQWB 3RKXA 2XF6A 2R7XA 3O2PE 1HF0A 1GV5A 1ZG3A 2P7VB 4EVIA 3S15J 1LKXA 1T38A 1KU7A 5D5VB 4HG2A 5F27A 4NC8A 2IA0A 1PP8F 4M3EA 1IDZA 4ESFA 3U21A 2OD5A 2H6CA 2E1MC 4LIUA 3KYLA 2L9VA 4Z2YA 3BR5A 3G1OA 4RGXA 2QKMB 1R1TA 2CG4A 1EKEA 3PIOF 5K5QA 4YG2F 2ME6A 2VQCA 3M9AA 2EV6A 2STWA 1OJLA 4FX4A 4XRFA 2QBYB 3WTSC 4BGDA 3FM3A 2EB7A 2EFWA 1R58A 4LIVA 1ZREA 2BY1A 3M8EA 3BR0A 4RS8A 3JRIA 3E97A 3S1MJ 2L7FP 4AIJA 4AC0A 3DTEA 5FFZA 4AYBN 1XGMA 5FROA 3V7CA 3ESWB 3V8KA 3I55I 2HDDA 2ZMEC 5CQGA 2PQ8A 2A3SA 2NVYJ 2VOOA 1T08B 2QZ8A 2M4KA 1D0XA 5FGMA 4RB2C 1IRGA 2J5OA 2WA0A 2MBFA 4O6JA 3HBLA 5ED4A 2R7UA 2CUZA 3E5QA 1U78A 4A3JJ 1Y39A 4ZZLA 4EJTA 1KU2A 3GTGJ 3FXJA 3CMYA 3VYRB 2L4AA 3TP0A 1ZELA 2QSFX 1SVOA 4KUMA 1Y8QB 3K10A 4M3BA 4LLNA 1FC3A 4AIKA 4ITVA 2E1CA 1YIJI 3RDIA 1I5ZA 2LTPA 1R5ID 1SAXA 3WE3A 1K4TA 2ADUA 3LSHA 3O8GA 2M7AA 3KCCA 1KU3A 2XDVA 5GAEJ 2BE5F 2QWWA 3GTJJ 2R0QC 2EV0A 4NB5A 2CUJA 4RAGA 4A2UA 2XAQA 3SDGA 1D5VA 2R7FA 3VOEA 5BPIA 3LA3A 1W7PD 5H6RA 4G12A 2M3AA 5ILVA 2K3FA 3WG7H 4EATA 2FSWA 2I5UA 4NUBA 1LVKA 1X4OA 2PMZN 5HS7A 3EUKL 1R36A 2MW8A 3PNVA 3B6AA 5J8FA 3B6CA 4Q48A 4GO1A 2LR8A 4RBOA 3MZYA 3RZOJ 5FLMJ 2ZXJA 1TWGJ 4S0HB 5JR3A 1IN5A 1QHHD 1FTZA 4HDUA 3HHGA 4JK1X 2LKXA 4KN4X 3ZN1A 1J5YA 5JVGF 3D1NI 2L9SA 1WGXA 2X1DA 3MVPA 1HC8A 2FA5A 3HTSB 2JK3A 4EV0A 4ESBA 5IPAA 2XAFA 5LHGA 2VL8A 3DEEA 4X6AJ 3KLOA 1UCRA 1S7OA 1JE8A 4DIQA 3ZPLA 2LG4A 2GXAA 3EYIA 1X1CA 4Y17A 1OLTA 5LD2C 1W0UA 3UNGC 3DQVC 4BQNA 3WE2A 2V1DA 1YW8A 4C3HJ 2XUBA 1VQKI 5B1BH 2YU9J 1JUSA 4HV6A 3QODA 2VXDA 3J7YJ 2A6HF 5F6FA 4AYBA 3M4OJ 5D8KB 1IC8A 1XC5A 4ASNA 4XLFA 1MGTA 4FISA 2XF7A 4RGSA 2X6XA 4R79A 2W1OA 4GXOA 2PFBA 3OYFA 2QA4I 3IRRA 1R1UA 5F08A 4U0WA 1XGNA 3GTKJ 1RI7A 2HXOA 2PMHA 3BJOA 3OR1C 4M9SA 2Z3YA 1NK2P 2E2IJ 4L9VA 3ZMZA 3CCSI 1X19A 3VWBA 3ERMA 3H9GA 4A3CJ 4ZZDA 5IYBJ 2JRTA 5FO5A 4F91B 1GUUA 1M1EB 1UB9A 2EIKH 1IF1A 2M34A 2R4GA 3ABUA 1D0ZA 1T56A 2KT0A 3PFYA 2R7WA 4ETSA 3QOEA 1HSJA 5K5RA 4X0GA 2ID3A 5ILSA 1LEBA 1FBQA 1ETXA 2L5QA 5DCMA 3TL4X 2A07F 5BNGA 2KMUA 3N97A 3HYIA 1U3EM 1X3WB 3KETA 1ZQ3P 4BQOA 2GA2A 5B3SH 4AIDA 1HW5A 2ICWG 3FK7A 2NAZA 3TDUC 3CMEI 2B0LA 4A6EA 2IA1A 4IRHA 2V4JC 2CJJA 1UFMA 3B02A 1YG2A 2A69F 5L3EA 2QM3A 4F55A 1IN4A 3SXYA 3Q9VA 3RIRA 1XB4A 1XPXA 1Z7LA 1SMYF 2ZFWA 3P9KA 3G1MA 1FTTA 3MWMA 5AONA 1BR2A 2GZWA 1K7AA 1FOWA 4W97A 1U6GA 3HSRA 3HOUJ 4OINF 3PQJA 2JJ7A 4H4KC 4OAZA 3S14J 4AUXA 2ETHA 2UXXA 4XKVA 2DJIA 4AWXB 2CFOA 2JSCA 4IF4A 3JRDA 2VI6A 4UUSB 2HKXA 3WTYC 1WRJA 5KAIC 4F3QA 2E5ZA 1A35A 3HJEA 1UAAA 1DGRM 4ON0A 4QWQA 1R6RA 3CJRB 3RKWA 1FYMA 3RYPA 1T98A 5M3FJ 3OYGA 1BC7C 4I99C 2AQFA 3HRTA 4P55A 4Y15A 3BC8A 1ZLJA 3BR6A 4U0VA 1N77A 1IN6A 5CPRB 4IVNA 2FJ1A 3KEOA 1ORKA 5GAHJ 1GXQA 3CJNA 5BMZA 2FQ4A 3E3VA 4CXFA 4XORA 1SEUA 2XGCA 2HTJA 1QO0D 5KAFC 1VQ7I 1ZRDA 1FWZA 2RN7A 3PFIA 1NG7A 3M8FA 5FLVA 4KICA 3C2GA 3F6OA 3PSFA 3FXMA 3V8LA 2CH0A 2DU9A 4HLYA 4DGWB 1MH4A 4B3XA 3T8RA 4JP0A 1K78A 4C9YA 2EA4A 5K7ZA 1XMXA 4DYRA 4GCVA 2EBIA 3VEPA 2K3PA 2K02A 1JKQC 4MGRA 1RKWA 2W25A 2XASA 2WAFA 1ZGWA 4CO8A 2VUMJ 2NYXA 1RRJA 3TP3A 1SC7A 5LRRA 1Y0NA 3Q0UA 3CCRI 4M3GA 3Q3SA 4FX0A 1RPWA 4A0XA 4QPQA 2E1NA 4O5VA 3SEQA 2L4MA 4HLXA 3DFGA 2M0CA 4MTDA 3BG9A 1IZ1A 3BR1A 2LFBA 3V7SA 5EGOA 1JI8A 1BOBA 1ON2A 2CWEA 3FXLA 3A03A 4W1UA 1VQMI 1O57A 2GIZA 1MIJA 1IW7F 3HGYA 4N9IA 3IUOA 4A3EJ 4Q5SF 3QYBA 1D1BA 1BW6A 5E3MA 3EDPA 2IJLA 3QYFA 3GTQJ 3T1BA 4XLCA 2ZJ2A 3FF5A 3TO6A 1PYVA 1FP1D 4XRMA 4OU0A 4KFCA 2LNBA 1XMAA 4BXFA 3NWTA 1FIAA 1WVRA 2HR3A 3CDHA 3S32A 2AXTC 2M8EA 2DTRA 3HOYJ 1LNWA 2IS2A 5ICEA 3KP7A 2ZXWH 3GTMJ 4NDLA 3LQRA 5D6EA 1PUFA 2BXYA 3E1SA 3ZGKA 2JTVA 1O3RA 1TTYA 2HZTA 4RGRA 2KZGA 4I6ZA 1VQ8I 2R7ZJ 1ZGJA 1R71A 2HYJA 2QYOA 5LGNA 3OYJA 2O9LA 3QAHA 4A5NA 4A5MA 2DOEA 2JA2A 2R7DA 3IRQA 4HX7A 1AOYA 3I64A 2HPMA 1K79A 2RGVA 1ZR4A 3R6SA 3PO2J 3GBGA 3C2HA 2EPFA 1N75A 4HNTA 5IP7J 5M3MJ 5F1JA 1MMDA 2BYVE 2JSPA 4X1EA 5E20A 5K5OA 4CYCB 1H8AC 3I59B 4CDGA 2N8GA 3JRBA 4UB6C 3L7WA 1MMNA 2HI3A 3A1YA 1EF4A 3BCAA 4IRGA 1TT0A 5GP9A 4QPOA 4YFNF 2E1MB 4NNJA 3BR2A 3PM1A 1R7JA 3LL7A 3FISA 3TW7A 4LGWA 3LSPA 1FY7A 4II3A 4EM2A 2E71A 2Y9ZA 2H1LA 4OMZA 4D7NA 2VQLA 2CQ7A 1G6NA 4IHXA 4IHVA 5C4JJ 3DTKA 2DK8A 1QQIA 2O3FA 3T5XA 1E2XA 2E5NA 3E5UA 1X3ZB 4GYIA 1P9QC 1V4RA 5E3OA 3OOUA 3CUOA 1ERDA 3J80K 4I09A 1GT0C 4RLFA 2M7BA 3AG4H 5IT3A 3JREA 1IN8A 2KRFA 2ZFUA 3CP8A 2DDAA 2YS9A 4HYEA 1P2FA 3F8BA 3OYKA 3GTLJ 4RAYA 2Q1ZB 4FTHA 1WFXA 3LSGA 5EG0A 3I53A 3S16J 1G3WA 3GFIA 5D4RA 4EGZA 4H0EA 3L09A 1GVDA 4LK0F 1UHWA 3CJTB 2H6BA 1OCRH 1TW2A 4FE7A 2OA4A 4NQWA 5HLGA 3IWZA 2WAEA 3FBIB 3L2CA 1G4DA 4OIPF 4YIFA 4M6VA 3COAC 4A0YA 2VT2A 2LC2A 1G8XA 3ASNH 3P5JA 2GXGA 3LSTA 1TBXA 3H36A 4B47A 3RZDJ 1K4SA 3QQAA 4A0ZA 2YSRA 1X1BA 3H3ZA 5DUKA 4KIBA 2R5YA 1YI2I 4MIMA 2RNGA 5F0HA 2LF7A 3RCOA 3IWFA 3HOXJ 1HKQA 1W5SA 5EEAA 5CVVA 4BKXA 2YPRA 4CGZA 3W6JB 1MW7A 2CRGA 4I2OA 4F93B 4GYGA 1LFPA 1IXSB 2CMPA 3QYEA 4MQ9F 4RGUA 3G71I 2VE9A 3IC7A 1BJZA 1HOMA 5FLXZ 4PGHA 5DCMB 4JBAA 2COBA 2HOAA 5HLHA 1IV8A 2QF7A 2QUFA 2CQNA 4RDUA 3H1CA 2OPTA 2VN2A 2BY2A 3BZ6A 5B5EC 3AKZA 3NWSA 5KK1A 3BY6A 3HG9A 1MMGA 1LEAA 3F6VA 4WK8F 2O03A 3ZXSA 4JX4A 2LVSA 2PI0A 4DZJA 1YHQI 2IEKA 4U7BA 1ONVA 2QQ8A 3HUGB 1MNEA 1ETOA 1USSA 2OQRA 1ULYA 2P6SA 3L9FA 4Y4RA 1EA3A 4LLGF 4U7DA 3MMYB 2UUZA 4XNFA 2XSDC 1RR8C 3BR3A 1MBKA 4AM3A 3FX3A 3BZKA 3IL2A 1XSXA 3F8CA 4XSXF 4DYQA 3S2HJ 4NHJA 3D5LA 3HRMA 3QPHA 1RESA 3E6CC 1P6RA 1APLC 4CYCA 4IKFA 2DA3A 3TQNA 2R93J 1YIOA 4IX7A 5CQEA 1MKMA 3RQIA 2BY3A 2LRDA 4IHSA 1I1SA 2HTSA 1D3YA 4PJ0C 2YUSA 3TW6A 5D4SA 4L18B 5D6FA 1XTAA 1FPQA 4CCKA 1YJNI 3F8NA 4CCLA 2NXNB 4F92B 4MQVA 4B1RA 1IV6A 1UG0A 2KPMA 4PUSA 2FF4A 2W00A 2MLKA 3ABMH 4RAZA 5JFRA 3HKZN 1U8BA 3K4JA 2K27A 1GV2A 2D1VA 3Q9SA 2V79A 1I50J 2RKHA 3CQZJ 3W2WA 1R5GA 3OYIA 1ZK8A 5AIPA 2FXAA 2EIJH 2GQQA 4A3MJ 1D1AA 3TDZC 4V19K 1HKTA 2FOKA 4OWRB 3HPGA 1I39A 1WKMA 1G59A 4HRIA 4WCGA 2ESNA 3LMMA 1WJAA 3L2UA 1SFEA 3BPVA 2VPLA 2ELHA 2VKVA 1ON1A 3OL4A 1T6SA 1H9GA 4P96A 3OYCA 3OYHA 4XR6A 4KISA 4XLPF 3H92A 4CCNA 3HDDA 4XQFA 2F5CA 3W6KB 1Z21A 2MG4A 1CQTA 2DO7A 3M07A 3EPZA 2Z2SB 1HQCA 3H5RA 4CCMA 1POGA 2DFFA 1DPUA 3LQQA 5A2QK 4IL6C 1YQAA 3PO3J 2TDXA 2FU4A 3LWFA 4JX5A 1V5EA 2P5VA 1Z6RA 4YIRX 3RTRA 4HF0A 2AO9A 2LKSA 3SHFA 1QPMA 1A31A 4E7KA 4DNCA 3HIFA 5H6QA 1Z3YA 1Y6IA 1OISA 2CQQA 2ZXHA 2X48A 5LFAA 2O8KA 1K6OA 4BBSJ 2EZKA 1X2NA 2KISA 1ENHA 5FJ8J 2VLAA 4E7IA 3K4BA 4NC7A 1JTYA 2YU3A 1A6QA 2CUFA 1R23A 1LDDA 1X4PA 4MFDA 1R49A 1Y0UA 1WJEA 3HB9A 5J47A 1H0MA 3BTIA 2VBWA 4IHYA 2A6TA 1MBEA 1QPIA 2IPQX 5A2QZ 4C3JJ 1ZR2A 2H94A 2VBXA 4XOTA 3WHCA 1U5TA 3D0SA 4CHUA 2FNPA 3T8TA 2M0MA 4PJLA 2VB6A 5TISC 5L3FA 1U0JA 1J59A 2K85A 3KEYA 3CC4I 3A01A 4I0AA 1VQ9I 3RJPA 3CC7I 3GLXA 2IA2A 5HNHA 3JR9A 4HF1A 2QQBA 1WJDA 2WBMA 5K7FA 2L3DA 4I01A 2JA7J 1X3UA 5FKNA 4BS9A 2GA1A 2HZDA 1OYYA 4B3AA 3ZQFA 2VONA 2XGXA 2ZJRF 1FYKA 3U1KA 3K70D 4KMUX 1HA8A 2M8GX 2NVXJ 3EUAA 3CCQI 1FT9A 2LP0A 2LDUA 2Y30A 2DA2A 2X9DA 3J80Z 2CSOA 3BP8A 1XG1A 4KJZA 3HKZA 1WJBA 5FD5A 2BOLA 2DQRA 1WPKA 5DM6F 3S3MA 1FSHA 1LE8B 2OU2A 4IOCF 1ZGAA 1W5TA 3H35A 1S3JA 1YTYA 3BQYA 4OIOF 1WWXA 3CDLA 3CTAA 3R60A 1PJRA 3QRFF 2QVOA 3VSKA 4Q4ZF 2D5VA 1XSDA 1HSTA 1TWCJ 1F5TA 2HOSA 4IHTA 1XD7A 4LD5A 2WC2A 1U9OA 1YO5C 1QNTA 3OL3A 4XKWA 4JX6A 1TQMA 1OMIA 3C18A 2VBYA 1YITI 2ZSIB 1S6LA 2EZHA 2JT1A 3K69A 1RKTA 2HNHA 2ZJQF 2HYGD 1KU9A 1XCVA 4BHPA 1J9IA 3DPLC 4IQJA 3K4NA 4WWCA 1FOKA 2M87A 4CICA 4XSZF 2B7EA 3AG1H 1YX3A 2NOJB 3I71A 1DPRA 1KA8A 2VASA 1S5LC 4U0YA 3ZQ7A 5EEHA 4M74A 2DFHA 3S93A 3VYSB 2MC3A 3RSNA 2LBFB 2OQGA 4U87A 2EJRA 3ZMVA 1QA6A 2QCOA 3NEUA 1Z1DA 2F5EA 5E3LA 2MYSA 4CSWA 3K4KA 2DDBA 1ZKGA 4RMNA 1ZN2A 2DT6A 4A3KJ 5TJJA 3MQ0A 3JRFA 4NC6A 2LY1A 2YR2A 3EUHC 3FBNB 4BY7J 3P7NA 1NH3A 5F64A 2HWVA 2STTA 1QU3A 2EINH 5GTHC 4HAMA 4MO7A 4Q47A 5ERIA 3NRVA 4C3IJ 2I8DA 3E0JB 3HRSA 3LSMA 4GFBA 3K2AA 3O8HA 4PJNA 3ZR8X 4EEFG 3LAJA 1SFOJ 3ZN0A 4OIRF 3E7LA 2XGEA 3KYDB 2B63J 2LKPA 2IS4A 5E17F 1GLNA 3GTPJ 3DP7A 2Q2EB 3MN2A 1UHSA 2CQKA 4D9JA 2GAUA 2KIUA 2MA3A 2W85A 3ECHA 1TP4A 4PGGA 1MNDA 2LF8A 1BI0A 1JHHA 2IGOA 3V42A 5C44J 1ZRCA 2HKOA 5CVIA 4PSXA 4XK4A 2LYCA 2Y9YA 4C30A 2RREA 1SFKA 2DMUA 2BW3A 4DYCA 2FUG2 3KP4A 1X1AA 2VJIA 1IDYA 1HKSA 4BBRJ 3QPTA 3WTUC 3GEZA 3F22A 4ZTFA 2CO5A 3S2DJ 4HPQA 2OAZA 1O7FA 1QHGA 3BOQA 3I3LA 4PJJA 2KIMA 2MSYA 3IH2A 2PLYA 3IP4B 2G9WA 5EZHA 2OZUA 5IOZA 1YYVA 3GZ6A 3K4LA 1D1CA 4UVAA 2VIXA 3LFUA 2NS7A 5L3DA 2KJBA 2P4WA 3OIOA 2V1UA 2F5FA 2MH9A 2WAQN 3ABKH 3AFHA 2WV1A 5EYRA 2UXNA 3VB2A 2AS5F 2ZB9A 2EZIA 2HQ5A 3BG6A 3F8FA 2FBHA 2W4SA 2YX7A 5CJ9A 1RZ4A 2VKDA 4OOIA 4R8HA 2Q2EA 3I5UA 3HOSA 4WXHA 3GCMA 3DV8A 2MD0A 3FM5A 4FASD 3LSIA 5J8CA 3RI4A 4IZZA 3PNYA 1HW1A 4ZDLA 5DUIA 1HW2A 1TWAJ 2F2EA 3K1NA 5EF6A 4PFPA 3FK6A 2E1OA 4XBFA 1T8IA 1DGWY 1N25A 2DYRH 5JHFA 3DXJF 4QTRA 4A3DJ 3MKWB 2D45A 4HSRA 2E7XA 5C3EJ 5LEKA 3S3NA 4JOMA 4AU7A 4HBLA 2CV2A 1X58A 3DBHB 2FBKA 3TBIA 4M72A 2XC7A 2A61A 2DOFA 2VQGA 1SFXA 3PJRA 3LA2A 4M6YA 1O3QA 2O61A 2DYSH 4BJ6C 2VXZA 2DT5A 1R5HA 2E2JJ 1WHUA 1WQ2A 1A04A 2OBPA 4RM3A 2FMYA 2XPUA 3CZ6A 5E1ZB 5EJCA 3OS2A 3ISPA 4WXDA 3FWEA 3GZNB 1QRYA 4HNVA 2X1CA 3SZPA 4ZYAA 2R7QA 2EZLA 2MGQA 4J01A 4G7HF 1ZH5A 1PUEE 2KRHA 2GXBA 3H0GJ 5GAGJ 1JKRC 3WG9A 3MKYB 4XOPA 4LITA 3BCBA 3JCUC 3P9CA 2X1EA 2DMNA 2W24A 2H8RA 2RNJA 2QSGX 4CZCA 1R4MB 2LK2A 3I4PA 4DBQA 2DFEA 3ZMTA 2CUEA 1D8KA 2JRMA 3I9V2 5LBQA 3E5XA 1LVAA 4L5IA 3TOBA 2QQ9A 3OMYA 3NAUA 2C6YA 2TCTA 3HOVJ 3KP3A 4ENNA 3MZ8A 1U2WA 3DWLE 4XONA 4AVZA 2K86A 2NNNA 3FMQA 2XPVA 1AWCA 3S17J 1F43A 1FBSA 3LA7A 1XGOA 2G7UA 1RNLA 4HV5A 1IO2A 4WF2A 2OUMA 4LLLA 1QZEA 1G3YA 1A6IA 2DTZA 5L3BA 4UY8I 1JJ6C 2FMLA 4PJMA 3WU1B 2P5KA 2EIMH 4DW6A 5LGUA 5J40A 1WI9A 3OYMA 2K5CA 3VYTB 1PVEA 3CCVI 3UKGA 1JUMA 2VPRA 4IEJA 2XV4S 3C2BA 5M5XJ 2E60A 4TV7A 3OWTA 1H88C 1W4MA 4KMFA 4OIQF 2CFXA 2E36A 3GVAA 1D0YA 1Y1VJ 2P7CB 5E8GA 1X1DA 2MD5A 1IJWC 1BI3A 1O3SA 2DODA 4PFOA 4UVBA 1TL8A 4D5CA 3WGGA 3ZQQA 1NK3P 3D5RC 1Q1VA 2K9MA 1ZYRF 3GFLA 3CESA 3GWZA 3SEZA 1ZARA 4UXNA 3J7ZI 2DPDA 4KYWA 1OPCA 1YS7A 3F21A 3S1QJ 5IYDJ 5CKTA 1XGSA 4N4NB 5KNLA 1VQ6I 1FLIA 3EETA 3FZVA 5TRDA 3UR3C 2P8TA 4DQ2A 1B9NA 2ZC2A 1STZA 5L3GA 1FJLA 3QP6A 2KRCA 5DDGA 3HGGA 1VQ4I 3ULQB 3CJQB 1P92A 4E70A 3HRUA 4YFXF 3C7JA 4KT5C 1B6AA 1P4XA 3DCFA 3OIPA 3GFMA 4G8XA 3K0LA 4Y13A 1ETQA 1X1PA 1XN7A 2V7FA 3HOWJ 4XLNF 2PMZA 3DTIA 1ACIA 3QP5A 2ZKZA 2ISYA 1BA5A 2GOXB 5CYVA 3R0AA 3ML6A 3AL0C 1MNMC 2KL4A 4UNOA 2KKOA 2Z1DA 5FD6A 1T39A 5HVQC 4ZDOA 5BS6A 1OR7A 1GHCA 1KONA 1W36D 1JGSA 4EGYA 5E8IA 1TNTA 4EM1A 4BE0A 1HBXG 1SVLA 5HDKA 4D5FA 1HDDC 5FRNA 3E6MA 5F1RA 5E3NA 4BXUA 1LJ9A 2DOAA 4XICA 1OYIA 5F0CA 3FXOA 2Z16A 1VF9A 2UZKA 3QOPA 5L3CA 1SANA 2PX9A 4BEHB 2LSOA 5GPCA 4I0BA 1LQ1A 1MMAA 2OCCH 5LGTA 3OOPA 1TNSA 4B44A 3W2VA 3OV8A 5FRMA 5FKMA 2HQRA 4ENJA 2ESHA 3RKYA 2ID6A 4FETA 4FHTA 4U88A 2OF7A 1Z6TA 1SD6A 3MD2A 4XLHA 3WU0A 4XN3A 4YELA 2IGMA 2JPBA 3LOCA 1K83J 4BUPA 4A3FJ 1FNNA 3E6BA 4A6DA 5J3LA 1B1BA 2CW7A 3I54A 4F7ZA 4LB6B 4L9TA 2ELJA 4XM3A 2ZJPF 5LHIA 4IO9F 1BBYA 2CW8A 2RVCA 3CLOA 2NVTJ 3EUHA 3DPTA 1V5FA 2ME0A 3O3KA 2D1HA 3DLAA 2KLOA 3F9KA 3K7AJ 2M30A 1UMQA 1GDTA 1PP7U 3V4GA 3L1PA 3P9IA 2A68F 1BN5A 1K78B 4YEJA 2XKPA 2XHKA 4L5JA 3H3VK 3G3ZA 5E18F 1HDPA 4BDYA 2Y0MA 4I7HA 3PUFA 2KHMA 3RPQA 3FHZA 4MLOA 1V54H 3CMAI 2GOMA 2DW4A 1IUFA 3BTJA 2VBZA 2K40A 4IHWA 1O7LA 1B72B 3SFIA 1FX7A 3BWGA 4J19A 4E4HA 2HQNA 4LG0A 3DU5A 3IV5A 2E7WA 2CGPA 1MD0A 3OS0A 1MSEC 3J81Z 2L02A 3GLLA 2M5WA 1MJ9A 2CU7A 4M3DA 2GWRA 2HDWA 1ZAOA 1L3LA 3EYYA 3MEXA 2VJ4A 3OYAA 3F23A 4BJ5C 3WGHA
chains in the Genus database with same CATH topology
1AKHB 2KT0A 1T56A 1Y1WJ 3A01A 2G0EA 1JKPC 3JR9A 4XRSG 2ID3A 5K7FA 2JA7J 3GTOJ 5FKNA 1ETXA 3W6VA 4ABZA 2XB5A 4B3AA 5BNGA 3ZQFA 2GM4A 1LFBA 5FKOA 1Z77A 2M8GX 2NVXJ 1ZQ3P 1H89C 1B8IB 2LP0A 3FK7A 5IP6A 2Y30A 2DA2A 2X9DA 5EGOB 3I4NJ 1NTCA 1XG1A 5HODA 3SJMA 1HCRA 4JYKA 2CJJA 1LE8A 1LFUP 1WPKA 2R5YB 1P7JA 1LE8B 3G1LA 1ITYA 5EG0B 3G1MA 4I76A 1JTXA 3BQYA 1FTTA 4A69C 3CDLA 5F04A 1MBGA 2D5VA 1MBJA 2FD5A 2Y0SN 3ZQCA 1TWCJ 4W97A 2R92J 3HOUJ 2JJ7A 2M9HA 2K9NA 2HOSA 1VFCA 3S14J 4AUXA 1TC3C 3BT9A 1U9OA 2DMTA 3MKLA 1T33A 4JX6A 1ETWA 3JRDA 1G2HA 2VI6A 4UUSB 5J1UA 4BY1J 4D7MA 2E19A 2EZHA 1RKTA 3WHBA 3HOZJ 5M3FJ 4UUTA 4A3BJ 2HOTA 1IGNA 1MH3A 2L7MP 3BR6A 3JRCA 2FJ1A 1ORKA 3A01B 2FQ4A 2XGCA 3TEDA 2O7OA 2LD5A 5EDNA 5FLVA 2QCOA 1JGGA 3IH4A 5C4XJ 2W48A 1ETVA 2XRLA 5E3LA 1BW5A 3DEWA 1MH4A 4QSHA 5JLWA 4JP0A 1MBHA 3JRHA 1ZKGA 2DMPA 3ZQGA 5K7ZA 4A3KJ 3JRFA 4DYRA 3BTLA 2Y2ZA 2EBIA 2I10A 4BY7J 4C2MJ 1JKQC 1RKWA 4MO7A 4C3IJ 2GLOA 1ZGWA 4GFBA 2VUMJ 1WI3A 5IYCJ 3K2AA 3O8HA 4EEFG 3TP3A 1RETA 1XS9A 1E3OC 1SFOJ 3Q0UA 4M3GA 3Q3SA 3BG5A 2Y31A 1RPWA 3E7LA 2XGEA 3VPRA 4L5EA 2B63J 3F0CA 3GTPJ 1WH7A 2M0CA 2DA5A 3BG9A 3MN2A 1UHSA 3BR1A 5EGOA 2LFBA 1PUFB 1QVTA 1TWFJ 2L0KA 3A03A 4W1UA 5C44J 1P7IA 2JN6A 3HGYA 4A3EJ 2JA8J 3ZQLA 2DJNA 1BW6A 2GBYA 4XK4A 4DZPA 2Y9YA 5E3MA 3S1NJ 2P81A 3GTQJ 2DMUA 1OFCX 4DYCA 4A3LJ 5EZGA 4MFEA 4XRMA 3FIWA 1W0TA 1IDYA 3M3YJ 2DA4A 4BBRJ 1FIAA 1AKHA 3S2DJ 2CQXA 2X6OA 5IOYA 3HOYJ 2MSYA 3IH2A 2DN0A 1JJ8C 3GTMJ 5EZHA 4NDLA 1PUFA 5IOZA 2DMQA 4I6ZA 2R7ZJ 2NS7A 3OIOA 3Q0VA 2WAQN 2K9QA 2WV1A 5J1YA 1R9TJ 2HYJA 5EYRA 1O4XA 5JLXA 2ZB9A 2O9LA 2EZIA 1B72A 3HM5A 2HQ5A 2EQRA 2JWTA 4V2FA 2XPWA 1FEXA 3PO2J 1ZR4A 3BQZA 4A3GJ 3GBGA 2DA7A 2AHQA 5IP7J 5M3MJ 5F1JA 1TWAJ 5EF6A 3FK6A 4X1EA 1H8AC 2E1OA 4CYCB 1JT0A 2N8GA 3JRBA 4QTRA 2L7ZA 4A3DJ 1JKOC 3JRAA 1JUPA 2HI3A 4LOCA 5C3EJ 3BTCA 1EF4A 1B8IA 9ANTA 1F36A 5GP9A 3FKIJ 2KDZA 1X58A 1DU6A 3BR2A 3PM1A 1Z0XA 3FISA 2JMWA 3TW7A 1TWHJ 2HXIA 5J1RA 5K7HA 1AU7A 3LSPA 4A3IJ 2IAIA 1HLVA 1IRZA 3QPSA 2NVQJ 3OSFA 2R5ZB 2E2JJ 5FKKA 2FX0A 2Y9ZA 2VKEA 4D7NA 2XPUA 2NS8A 2NOGA 3NARA 4IHVA 4IHXA 2M2EA 3BG3A 5C4JJ 1QRYA 4HNVA 3LNQA 4M3FA 3ZOBA 2EZLA 3Q0WA 2DA6A 2MGQA 2R5ZA 2ECCA 2K9SA 3I4MJ 5E3OA 2LY9A 3H0GJ 1JKRC 3OOUA 4Y7NJ 2XGDA 3CCYA 1GT0C 2DMNA 2H8RA 4XIDA 1QVUA 1BL0A 2LK2A 2WB1N 3JREA 1FIPA 2CUEA 2YS9A 3ZQHA 2L9RA 1UG2A 2DA1A 4UUSA 3GTLJ 3NAUA 2TCTA 4FTHA 3HOVJ 3QPLA 3LSGA 5EG0A 3S16J 1GVDA 4FE7A 1ETYA 1GV5A 1HF0A 3S15J 2ECBA 4A93J 2XPVA 3S17J 1F43A 1I3QJ 2H1KA 1A6IA 2DTZA 4M6VA 5F27A 4M3EA 1JJ6C 1IDZA 3RZDJ 3QQAA 1MSFC 3BR5A 1MBFA 4DW6A 3G1OA 2R5YA 4MIMA 1D5YA 5F0HA 3UKGA 1JUMA 2VPRA 4IEJA 4V2GA 3HOXJ 5EEAA 4BKXA 3C2BA 5M5XJ 4Y52J 1H88C 1ZTRA 2ME6A 2CRGA 2JA6J 1Y1VJ 1IJWC 1OJLA 1JT6A 2TRTA 2RAEA 2EH3A 4D5CA 1BJZA 3BR0A 3JRIA 1Q1VA 1NK3P 2L7FP 3S1MJ 1HOMA 4AC0A 2COBA 2HOAA 4AYBN 1RR7A 2QF7A 4FCYA 2HDDA 2NVYJ 3S1QJ 4RDUA 3HEFA 5IYDJ 2OPTA 1VI0A 5M5WJ 1U9NA 3HBLA 3JRGA 1U78A 4B4CA 4A3JJ 4JX4A 2LVSA 1FJLA 1A5JA 4DZJA 3HGGA 3GTGJ 2IEKA 1ETOA 3CMYA 4QIWN 3TP0A 3DCFA 2XSDC 3RKQA 3BR3A 1MBKA 2XB0X 1ETQA 1K61A 3HOWJ 4M3BA 4DYQA 2LTPA 3S2HJ 1AHDP 1RESA 3O8GA 1BA5A 1APLC 4CYCA 2R93J 2DA3A 1OCPA 2R0QC 3GTJJ 3RQIA 1MNMC 1WCMJ 3SDGA 2YUSA 3TW6A 2LLKA 4G12A 4BXXJ 5GPAA 2PMZN 4B1RA 1IV6A 2MW8A 4D5FA 3B6AA 5F0FA 5E3NA 1HDDC 3B6CA 1ETKA 4XICA 3LSRA 2LR8A 5F0CA 4RBOA 3HKZN 3RZOJ 5FLMJ 1U8BA 1VF9A 3LSJA 1SANA 1GV2A 5GPCA 1I50J 3CQZJ 1IG7A 1TWGJ 4S0HB 2JA5J 2IBDA 1FTZA 1ZK8A 1OCTC 5FKMA 2LKXA 4A3MJ 2ID6A 2OF7A 3D1NI 1WGXA 3MVPA 2JK3A 5IPAA 3LOCA 1K83J 4A3FJ 4X6AJ 3A02A 5J3LA 2VKVA 5M5YJ 4XRSA 1W0UA 3HDDA 1X2MA 3ZQIA 5DS9A 2E2HJ 1YRNA 2MG4A 1CQTA 2NVTJ 1WH5A 4C3HJ 2ME0A 3OSGA 2YU9J 1JUSA 3IH3A 1POGA 3K7AJ 1UMQA 1GDTA 3PO3J 3L1PA 4JX5A 5IP9J 1VNDA 3S1RJ 3M4OJ 5FKLA 1IC8A 3H3VK 2AO9A 1HDPA 1XC5A 2O8KA 2CQQA 2X48A 4FISA 4MLOA 1I6HJ 4BBSJ 2EZKA 1X2NA 5FJ8J 1ENHA 1YRNB 1IUFA 3BTJA 1JTYA 4FE4A 2K40A 4IHWA 5F08A 1B72B 3SFIA 2CUFA 4MFDA 4J19A 3GTKJ 3HB9A 2HXOA 3IV5A 3BTIA 2ELKA 4IHYA 1MBEA 1QPIA 1MSEC 1NK2P 2E2IJ 4C3JJ 1ZR2A 1DU0A 5DTDA 2CU7A 4M3DA 1S7EA 3WHCA 4A3CJ 5IYBJ 1GUUA 2M34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKH B;  2KT0 A;  1T56 A;  1Y1W J;  3A01 A;  2G0E A;  1JKP C;  3JR9 A;  4XRS G;  2ID3 A;  5K7F A;  2JA7 J;  3GTO J;  5FKN A;  1ETX A;  3W6V A;  4ABZ A;  2XB5 A;  4B3A A;  5BNG A;  3ZQF A;  2GM4 A;  1LFB A;  5FKO A;  1Z77 A;  2M8G X;  2NVX J;  1ZQ3 P;  1H89 C;  1B8I B;  2LP0 A;  3FK7 A;  5IP6 A;  2Y30 A;  2DA2 A;  2X9D A;  5EGO B;  3I4N J;  1NTC A;  1XG1 A;  5HOD A;  3SJM A;  1HCR A;  4JYK A;  2CJJ A;  1LE8 A;  1LFU P;  1WPK A;  2R5Y B;  1P7J A;  1LE8 B;  3G1L A;  1ITY A;  5EG0 B;  3G1M A;  4I76 A;  1JTX A;  3BQY A;  1FTT A;  4A69 C;  3CDL A;  5F04 A;  1MBG A;  2D5V A;  1MBJ A;  2FD5 A;  2Y0S N;  3ZQC A;  1TWC J;  4W97 A;  2R92 J;  3HOU J;  2JJ7 A;  2M9H A;  2K9N A;  2HOS A;  1VFC A;  3S14 J;  4AUX A;  1TC3 C;  3BT9 A;  1U9O A;  2DMT A;  3MKL A;  1T33 A;  4JX6 A;  1ETW A;  3JRD A;  1G2H A;  2VI6 A;  4UUS B;  5J1U A;  4BY1 J;  4D7M A;  2E19 A;  2EZH A;  1RKT A;  3WHB A;  3HOZ J;  5M3F J;  4UUT A;  4A3B J;  2HOT A;  1IGN A;  1MH3 A;  2L7M P;  3BR6 A;  3JRC A;  2FJ1 A;  1ORK A;  3A01 B;  2FQ4 A;  2XGC A;  3TED A;  2O7O A;  2LD5 A;  5EDN A;  5FLV A;  2QCO A;  1JGG A;  3IH4 A;  5C4X J;  2W48 A;  1ETV A;  2XRL A;  5E3L A;  1BW5 A;  3DEW A;  1MH4 A;  4QSH A;  5JLW A;  4JP0 A;  1MBH A;  3JRH A;  1ZKG A;  2DMP A;  3ZQG A;  5K7Z A;  4A3K J;  3JRF A;  4DYR A;  3BTL A;  2Y2Z A;  2EBI A;  2I10 A;  4BY7 J;  4C2M J;  1JKQ C;  1RKW A;  4MO7 A;  4C3I J;  2GLO A;  1ZGW A;  4GFB A;  2VUM J;  1WI3 A;  5IYC J;  3K2A A;  3O8H A;  4EEF G;  3TP3 A;  1RET A;  1XS9 A;  1E3O C;  1SFO J;  3Q0U A;  4M3G A;  3Q3S A;  3BG5 A;  2Y31 A;  1RPW A;  3E7L A;  2XGE A;  3VPR A;  4L5E A;  2B63 J;  3F0C A;  3GTP J;  1WH7 A;  2M0C A;  2DA5 A;  3BG9 A;  3MN2 A;  1UHS A;  3BR1 A;  5EGO A;  2LFB A;  1PUF B;  1QVT A;  1TWF J;  2L0K A;  3A03 A;  4W1U A;  5C44 J;  1P7I A;  2JN6 A;  3HGY A;  4A3E J;  2JA8 J;  3ZQL A;  2DJN A;  1BW6 A;  2GBY A;  4XK4 A;  4DZP A;  2Y9Y A;  5E3M A;  3S1N J;  2P81 A;  3GTQ J;  2DMU A;  1OFC X;  4DYC A;  4A3L J;  5EZG A;  4MFE A;  4XRM A;  3FIW A;  1W0T A;  1IDY A;  3M3Y J;  2DA4 A;  4BBR J;  1FIA A;  1AKH A;  3S2D J;  2CQX A;  2X6O A;  5IOY A;  3HOY J;  2MSY A;  3IH2 A;  2DN0 A;  1JJ8 C;  3GTM J;  5EZH A;  4NDL A;  1PUF A;  5IOZ A;  2DMQ A;  4I6Z A;  2R7Z J;  2NS7 A;  3OIO A;  3Q0V A;  2WAQ N;  2K9Q A;  2WV1 A;  5J1Y A;  1R9T J;  2HYJ A;  5EYR A;  1O4X A;  5JLX A;  2ZB9 A;  2O9L A;  2EZI A;  1B72 A;  3HM5 A;  2HQ5 A;  2EQR A;  2JWT A;  4V2F A;  2XPW A;  1FEX A;  3PO2 J;  1ZR4 A;  3BQZ A;  4A3G J;  3GBG A;  2DA7 A;  2AHQ A;  5IP7 J;  5M3M J;  5F1J A;  1TWA J;  5EF6 A;  3FK6 A;  4X1E A;  1H8A C;  2E1O A;  4CYC B;  1JT0 A;  2N8G A;  3JRB A;  4QTR A;  2L7Z A;  4A3D J;  1JKO C;  3JRA A;  1JUP A;  2HI3 A;  4LOC A;  5C3E J;  3BTC A;  1EF4 A;  1B8I A;  9ANT A;  1F36 A;  5GP9 A;  3FKI J;  2KDZ A;  1X58 A;  1DU6 A;  3BR2 A;  3PM1 A;  1Z0X A;  3FIS A;  2JMW A;  3TW7 A;  1TWH J;  2HXI A;  5J1R A;  5K7H A;  1AU7 A;  3LSP A;  4A3I J;  2IAI A;  1HLV A;  1IRZ A;  3QPS A;  2NVQ J;  3OSF A;  2R5Z B;  2E2J J;  5FKK A;  2FX0 A;  2Y9Z A;  2VKE A;  4D7N A;  2XPU A;  2NS8 A;  2NOG A;  3NAR A;  4IHV A;  4IHX A;  2M2E A;  3BG3 A;  5C4J J;  1QRY A;  4HNV A;  3LNQ A;  4M3F A;  3ZOB A;  2EZL A;  3Q0W A;  2DA6 A;  2MGQ A;  2R5Z A;  2ECC A;  2K9S A;  3I4M J;  5E3O A;  2LY9 A;  3H0G J;  1JKR C;  3OOU A;  4Y7N J;  2XGD A;  3CCY A;  1GT0 C;  2DMN A;  2H8R A;  4XID A;  1QVU A;  1BL0 A;  2LK2 A;  2WB1 N;  3JRE A;  1FIP A;  2CUE A;  2YS9 A;  3ZQH A;  2L9R A;  1UG2 A;  2DA1 A;  4UUS A;  3GTL J;  3NAU A;  2TCT A;  4FTH A;  3HOV J;  3QPL A;  3LSG A;  5EG0 A;  3S16 J;  1GVD A;  4FE7 A;  1ETY A;  1GV5 A;  1HF0 A;  3S15 J;  2ECB A;  4A93 J;  2XPV A;  3S17 J;  1F43 A;  1I3Q J;  2H1K A;  1A6I A;  2DTZ A;  4M6V A;  5F27 A;  4M3E A;  1JJ6 C;  1IDZ A;  3RZD J;  3QQA A;  1MSF C;  3BR5 A;  1MBF A;  4DW6 A;  3G1O A;  2R5Y A;  4MIM A;  1D5Y A;  5F0H A;  3UKG A;  1JUM A;  2VPR A;  4IEJ A;  4V2G A;  3HOX J;  5EEA A;  4BKX A;  3C2B A;  5M5X J;  4Y52 J;  1H88 C;  1ZTR A;  2ME6 A;  2CRG A;  2JA6 J;  1Y1V J;  1IJW C;  1OJL A;  1JT6 A;  2TRT A;  2RAE A;  2EH3 A;  4D5C A;  1BJZ A;  3BR0 A;  3JRI A;  1Q1V A;  1NK3 P;  2L7F P;  3S1M J;  1HOM A;  4AC0 A;  2COB A;  2HOA A;  4AYB N;  1RR7 A;  2QF7 A;  4FCY A;  2HDD A;  2NVY J;  3S1Q J;  4RDU A;  3HEF A;  5IYD J;  2OPT A;  1VI0 A;  5M5W J;  1U9N A;  3HBL A;  3JRG A;  1U78 A;  4B4C A;  4A3J J;  4JX4 A;  2LVS A;  1FJL A;  1A5J A;  4DZJ A;  3HGG A;  3GTG J;  2IEK A;  1ETO A;  3CMY A;  4QIW N;  3TP0 A;  3DCF A;  2XSD C;  3RKQ A;  3BR3 A;  1MBK A;  2XB0 X;  1ETQ A;  1K61 A;  3HOW J;  4M3B A;  4DYQ A;  2LTP A;  3S2H J;  1AHD P;  1RES A;  3O8G A;  1BA5 A;  1APL C;  4CYC A;  2R93 J;  2DA3 A;  1OCP A;  2R0Q C;  3GTJ J;  3RQI A;  1MNM C;  1WCM J;  3SDG A;  2YUS A;  3TW6 A;  2LLK A;  4G12 A;  4BXX J;  5GPA A;  2PMZ N;  4B1R A;  1IV6 A;  2MW8 A;  4D5F A;  3B6A A;  5F0F A;  5E3N A;  1HDD C;  3B6C A;  1ETK A;  4XIC A;  3LSR A;  2LR8 A;  5F0C A;  4RBO A;  3HKZ N;  3RZO J;  5FLM J;  1U8B A;  1VF9 A;  3LSJ A;  1SAN A;  1GV2 A;  5GPC A;  1I50 J;  3CQZ J;  1IG7 A;  1TWG J;  4S0H B;  2JA5 J;  2IBD A;  1FTZ A;  1ZK8 A;  1OCT C;  5FKM A;  2LKX A;  4A3M J;  2ID6 A;  2OF7 A;  3D1N I;  1WGX A;  3MVP A;  2JK3 A;  5IPA A;  3LOC A;  1K83 J;  4A3F J;  4X6A J;  3A02 A;  5J3L A;  2VKV A;  5M5Y J;  4XRS A;  1W0U A;  3HDD A;  1X2M A;  3ZQI A;  5DS9 A;  2E2H J;  1YRN A;  2MG4 A;  1CQT A;  2NVT J;  1WH5 A;  4C3H J;  2ME0 A;  3OSG A;  2YU9 J;  1JUS A;  3IH3 A;  1POG A;  3K7A J;  1UMQ A;  1GDT A;  3PO3 J;  3L1P A;  4JX5 A;  5IP9 J;  1VND A;  3S1R J;  3M4O J;  5FKL A;  1IC8 A;  3H3V K;  2AO9 A;  1HDP A;  1XC5 A;  2O8K A;  2CQQ A;  2X48 A;  4FIS A;  4MLO A;  1I6H J;  4BBS J;  2EZK A;  1X2N A;  5FJ8 J;  1ENH A;  1YRN B;  1IUF A;  3BTJ A;  1JTY A;  4FE4 A;  2K40 A;  4IHW A;  5F08 A;  1B72 B;  3SFI A;  2CUF A;  4MFD A;  4J19 A;  3GTK J;  3HB9 A;  2HXO A;  3IV5 A;  3BTI A;  2ELK A;  4IHY A;  1MBE A;  1QPI A;  1MSE C;  1NK2 P;  2E2I J;  4C3J J;  1ZR2 A;  1DU0 A;  5DTD A;  2CU7 A;  4M3D A;  1S7E A;  3WHC A;  4A3C J;  5IYB J;  1GUU A;  2M34 A; 
#chains in the Genus database with same CATH topology
 2G0E A;  5DV5 A;  3CP2 A;  2F5V A;  4AVP A;  3KLN A;  4XRS G;  3GX4 X;  4ESJ A;  3W2A A;  2ZNY A;  3FMR A;  2KP6 A;  4BDZ A;  3W6V A;  2DT7 B;  4ABZ A;  2XB5 A;  2XVC A;  2V26 A;  3EQL F;  3MFK A;  3TMO A;  2EFN A;  1Z77 A;  2F4I A;  4Y3O A;  3CO6 C;  3DBR B;  4N0B A;  4UB8 C;  1TQI A;  1F4K A;  1B8I B;  1FOY A;  3ABT A;  5IP6 A;  2BHZ A;  4HX8 A;  2M4G A;  5EGO B;  3GXO A;  1FBU A;  2K4B A;  4RAF A;  1NTC A;  2VJJ A;  5HOD A;  3SJM A;  4ZH4 F;  4QLC U;  1LUJ B;  2MFZ A;  3DKW A;  4J00 A;  2R5Y B;  1P7J A;  1AA7 A;  1BJA A;  3KYC B;  2Z9O A;  2MLG A;  1ITY A;  5EG0 B;  2PJP A;  2JVH A;  4OAY A;  3CCL I;  5F04 A;  3BG7 A;  1VQN I;  3U9G A;  1MBJ A;  5HNF A;  4FQG A;  2BBY A;  3ZQC A;  1YLF A;  1QBJ A;  2K9N A;  4IOA F;  1O3T A;  3MKL A;  1T33 A;  1EH7 A;  2L54 A;  4BY1 J;  1H9T A;  1U5T C;  5CVR A;  3T0Y A;  3LAP A;  3K2Z A;  3WHB A;  2ZNZ A;  3HOZ J;  3K6G A;  3JSP A;  1SD4 A;  2O5R A;  3KEQ A;  4PZJ A;  3SQN A;  3V7R A;  3HHH A;  2X0L A;  3PUB A;  2YX4 A;  4RLQ A;  4UUT A;  4BE1 A;  3VYU B;  3KPH A;  1REP C;  1HXD A;  2L7M P;  3M1C A;  2IS1 A;  3CLQ A;  2F4M B;  3KP2 A;  3JRC A;  1RIO H;  1Z9C A;  3RYR A;  1CF7 A;  3A01 B;  4K2E A;  4I02 A;  3K4M A;  4LFU A;  1MDM A;  4IPA A;  2A5W A;  3TED A;  1OCO H;  4UVC A;  2O7O A;  4BE2 A;  2IGK A;  3FXK A;  4PK4 A;  4HX4 A;  1ZG1 A;  2KIQ A;  3I0T A;  3IKV A;  5EDN A;  4GDF A;  2ZXI A;  2DLL A;  3PSI A;  3FXU A;  1JGG A;  3IH4 A;  5C4X J;  5J4Y A;  1FP2 A;  1UJ8 A;  1ETV A;  3J7A O;  2XRL A;  1BW5 A;  2JPC A;  1QGP A;  3CCJ I;  3BPX A;  2LMD A;  5JLW A;  3JRH A;  2DMP A;  2OTJ I;  1Z3X A;  3NQO A;  2PG4 A;  3BTL A;  2Y2Z A;  3SDB A;  2I10 A;  1OQY A;  1SVM A;  4G7O F;  2XAJ A;  3A0B C;  2EFQ A;  1DP7 P;  2GLO A;  1TT5 B;  2DFI A;  1WI3 A;  1IXC A;  3I59 A;  5IYC J;  1XS9 A;  1RET A;  2L7K A;  4L5E A;  4HA8 A;  2RDP A;  1WH7 A;  5LLQ A;  4BAC A;  2DA5 A;  4EJV A;  3ASO H;  2BVM A;  2JUG A;  1PUF B;  2Q0O A;  2COM A;  2IXS A;  2RQQ A;  3I56 I;  1QVT A;  1FMW A;  2J5P A;  3I58 A;  1TWF J;  4M6X A;  1BIA A;  2HYF A;  2L0K A;  4E7S A;  2P6T A;  5FB2 A;  4YRV A;  5KHD A;  4G94 A;  3ZQL A;  4HST A;  2F6C A;  2DJN A;  1K6Y A;  5K1Y A;  4MTE A;  2P81 A;  1MMS A;  1MZB A;  4DBR A;  1XX5 A;  3GZ5 A;  2MAB A;  3M8J A;  3R61 A;  2R7S A;  3KE2 A;  5EZG A;  4EMS A;  1OCC H;  5GTI C;  3M3Y J;  2WB1 A;  2X85 A;  2DA4 A;  2FRH A;  5DYM A;  1C0W A;  2HVR A;  1KQ0 A;  1T0F C;  1YE9 A;  2EFP A;  2CQX A;  3K1M A;  5IOY A;  4M9X A;  5HS9 A;  2DN0 A;  2CS3 A;  4OMY A;  1U8R A;  1R00 A;  1V55 H;  1W5C C;  2DQL A;  2DMQ A;  4Z6Y A;  2V6C A;  3G4S I;  3MAJ A;  2OJE D;  4YII A;  5J1Y A;  1LB2 A;  3FDY A;  2HGC A;  5H20 A;  4AIH A;  4CYD A;  5JLX A;  1B72 A;  3HM5 A;  2JQ7 A;  1DUX C;  3HTU A;  3Q5F A;  3PL8 A;  1IXR C;  2JWT A;  4P1W A;  1D8J A;  5ICC A;  2K4J A;  4V2F A;  1FEX A;  3BQZ A;  2PJR B;  2RV8 A;  2DA7 A;  3CCE I;  2ZO4 A;  1BI1 A;  2AHQ A;  5CLS A;  2BXZ A;  2XKO A;  4XKB A;  2LRE A;  1FZP B;  4MEY F;  3LSK A;  3WTZ A;  4CCO A;  4G6Q A;  5ICG A;  1JT0 A;  3SYT A;  5IT9 Z;  2L7Z A;  4B09 A;  4ZYG A;  4LOC A;  3KZI C;  1F36 A;  1VQ5 I;  3FKI J;  1Y8R B;  1YJW I;  1DU6 A;  1W7P B;  1VTN C;  3RQ4 A;  4WXC A;  2IRF G;  2Z33 A;  1CF7 B;  3ZRG A;  2HXI A;  2HPI A;  3HUG A;  4LMY A;  5J1R A;  4RB1 A;  1AU7 A;  1HLV A;  5LEJ A;  3TOA A;  3QPS A;  3OSF A;  5FKK A;  4S05 A;  2V9K A;  3G6E I;  5ICF A;  2VKE A;  1UEL B;  3REO A;  2NS8 A;  2NOG A;  3JAM Z;  1G3S A;  3IAS 2;  2BEO A;  2V1N A;  1MDM B;  4M3F A;  3AAF A;  1S29 A;  2DA6 A;  4PDK A;  1TLH B;  4MHG A;  2ECC A;  1KZH A;  2K9S A;  4B8X A;  3I4M J;  5KVR A;  4E7L A;  3CUQ C;  4Y7N J;  4BEH A;  2A5Y B;  3GO5 A;  1V5G A;  3LFK A;  1V3F A;  5D5U B;  2K7L A;  1E3H A;  3DKY A;  3DF8 A;  4C2T A;  1FIP A;  6PAX A;  5FLX K;  3OYB A;  1I27 A;  1WJF A;  3ZQH A;  5DM7 F;  1UG2 A;  1E17 A;  4N9H A;  3OYE A;  1S9H A;  2DA1 A;  4UUS A;  4KN7 X;  3CCM I;  5KCM A;  2VKH A;  3A4C A;  1W1W E;  1MJB A;  2XRN A;  4C2U A;  3JSO A;  2BV6 A;  4G9Y A;  1DP3 A;  2HFH A;  4UHT A;  2IW5 A;  3OS1 A;  1ETY A;  2ECB A;  4A93 J;  5D8L B;  5B1A H;  1I3Q J;  3JW4 A;  4E7J A;  2H1K A;  3KZY A;  4R1H A;  1YS6 A;  3SZG A;  4CUG A;  1JXS A;  3OYD A;  1UST A;  3J81 K;  3VSL A;  4DJA A;  1MSF C;  1G3T A;  2H09 A;  1MBF A;  3BZC A;  4ZDP A;  1D5Y A;  1SMT A;  4V2G A;  3HZJ A;  4Y52 J;  5FFX A;  1QZZ A;  4EM0 B;  1ZTR A;  1J75 A;  2NRA C;  2JA6 J;  2LBF A;  1R1V A;  4EQQ A;  4ENM A;  4II2 A;  3WU2 C;  2V6E A;  1I6X A;  1JT6 A;  2TRT A;  2XAU A;  2CV1 A;  2RAE A;  2EH3 A;  3AG3 H;  5TGT A;  2XRO A;  3L2W A;  4YFK F;  4LG3 A;  2IS6 A;  3ZMS A;  4KIT B;  2R3S A;  5B66 C;  2AQE A;  1XCB A;  1RR7 A;  4DOZ A;  4FCY A;  1OCZ H;  4P9U A;  3DKX A;  2E35 A;  3BJ6 A;  3KX2 A;  2WY7 Q;  3HEF A;  4XN0 A;  1ZLK A;  3CO7 C;  1VI0 A;  5M5W J;  1U9N A;  2QBY A;  1BM9 A;  4BNC A;  3KP5 A;  3JRG A;  2HDC A;  2CW0 F;  2X6Y A;  1YX5 A;  4B4C A;  2EK5 A;  4RM2 A;  2EA2 A;  2KIF A;  4M71 A;  4ENK A;  2FNA A;  1A5J A;  3DPU A;  4QIW N;  4LB5 A;  2QEN A;  4IXA A;  2H8W A;  3RKQ A;  3C3W A;  1W7P A;  3CDI A;  2XB0 X;  4BYY A;  1K61 A;  2VE8 A;  5CVJ A;  3ROU A;  3RPU D;  4ZYE A;  4ZTJ A;  1KYW A;  2XF5 A;  4BH9 A;  4IRI A;  1AHD P;  2BVL A;  1OCP A;  2EFO A;  1S8N A;  2KFD A;  4UV9 A;  3BJA A;  1J2X A;  2HQA A;  1OKR A;  3H9J A;  2QLZ A;  3RPU A;  2DPU A;  1WCM J;  3TGN A;  2VT3 A;  3CUQ A;  2V1X A;  2LLK A;  4HDV A;  4BXX J;  1SAU A;  5GPA A;  2HU9 A;  2MC4 A;  4HF2 A;  2FBI A;  1R4N B;  3DBL B;  2KDO A;  4BAY A;  2XIG A;  5F0F A;  2HVS A;  2BHY A;  2Y69 H;  2UWM A;  1ETK A;  2Q8K A;  4HQM A;  3U1D A;  5HDN A;  3LSR A;  1LPQ A;  3U2R A;  2NVU B;  1FYL A;  3LSJ A;  4BHC A;  3WTX C;  1F1Z A;  3DLL F;  3GF2 A;  5D5X B;  1IG7 A;  2WAD A;  4D1Q A;  1DDN A;  2QQA A;  2JA5 J;  4RA2 A;  2IBD A;  3GFJ A;  1A36 A;  3GME A;  1Z7U A;  2QKL B;  1OCT C;  2RC4 A;  5HOO A;  1PDN C;  4HOB A;  2A6E F;  2IVM A;  1S72 I;  5GAD J;  3VFZ A;  4EJO A;  3HSE A;  2IGN A;  4N4O B;  2KZV A;  3R4K A;  3MZH A;  2LOO A;  2PBI A;  2DK5 A;  4UV8 A;  2LH9 A;  3S2W A;  3E6D A;  2HEO A;  2CYY A;  3OYL A;  1W36 C;  4L9N A;  3A02 A;  1I3A A;  1WJ5 A;  2PMU A;  5M5Y J;  4BL0 B;  4CA0 A;  4XRS A;  5J6X A;  5JVT A;  1X2M A;  3WTT C;  1BIB A;  3ZQI A;  4LK1 F;  5DS9 A;  2E2H J;  1YRN A;  3BRO A;  1WH5 A;  1GXP A;  2Y75 A;  1OR7 C;  3OSG A;  2X6W A;  3IH3 A;  3WGI A;  2DAO A;  4PSW A;  3OR2 C;  5IP9 J;  2W7N A;  1VND A;  2BGC A;  3S1R J;  4KDP A;  5FKL A;  3K4C A;  2MH2 A;  2DBB A;  2XSJ C;  5LRS A;  5DD4 A;  4HNU A;  1VQO I;  3L2Q A;  2AXL A;  1Z91 A;  2O8X A;  4RB3 C;  3QU3 A;  1I6H J;  1YRN B;  4BQA A;  3VOD A;  1ZRF A;  4FE4 A;  2JUC A;  3JTH A;  2VOD A;  2R7T A;  3ZCO A;  2PN6 A;  3H5A A;  3H9Q A;  1FMV A;  1RC9 A;  4IJA A;  4AD9 A;  2ELK A;  3CCU I;  3F3X A;  2PEX A;  1P4W A;  5HLI A;  1DU0 A;  4B48 A;  5DTD A;  4LJZ F;  2ISZ A;  1S7E A;  1P4A A;  1SD5 A;  4XLE A;  1BOA A;  3ELK A;  1I1G A;  3K1P A;  5JHU A;  2A05 A;  4E7H A;  3GYH X;  1AKH B;  1Y1W J;  2V9P A;  1JKP C;  4KT6 A;  2R7V A;  3N4M A;  4UUV A;  1RUN A;  4XL9 A;  3FHN A;  3DU6 A;  3GTO J;  1Y56 A;  2P0W A;  1XMK A;  1Z67 A;  3G2B A;  3FMS A;  3CD6 I;  3M1E A;  2GM4 A;  1LFB A;  5FKO A;  5CVU A;  1E3P A;  1IAW A;  4KNY A;  4LG0 B;  3L2V A;  4KIF A;  4RB0 A;  3OY9 A;  3HPH A;  1H89 C;  2F48 A;  2O0Y A;  3I4N J;  3TO9 A;  1Z05 A;  1WZ2 A;  3J7A Y;  2W82 A;  5E79 C;  5HDG A;  1YJ9 I;  4HW0 A;  1XDS A;  4KIG A;  1HCR A;  4JYK A;  3HL2 A;  1OYW A;  5IT9 K;  1LE8 A;  1LFU P;  4MEX F;  2NS0 A;  3VDX A;  4O3M A;  3G1L A;  2RQP A;  2PJR A;  5AIQ A;  4CH7 A;  2R7R A;  4I76 A;  1JTX A;  5D5W B;  2ACJ A;  4GGG A;  3M7G A;  2IT0 A;  2OTL I;  2X51 A;  4A69 C;  3H0D A;  3A2K A;  2OV7 A;  2WV0 A;  4ZYD A;  1MBG A;  3ABL H;  2BY0 A;  2JZY A;  4L0Y B;  2D2W A;  1FSE A;  2FD5 A;  2Y0S N;  1YW9 A;  3L2R A;  3D5S C;  2R92 J;  1CGP A;  5E1X A;  3X2Q H;  1JHF A;  3HSF A;  2M9H A;  4P9F A;  3ONQ A;  1VFC A;  2G7H A;  1TC3 C;  3BT9 A;  5EEG A;  3W3C A;  1EJ9 A;  2DMT A;  3S8P A;  1E0E A;  1ETW A;  2OZ6 A;  2F4O B;  1G2H A;  1B4A A;  3ZMD A;  5J1U A;  5DD8 A;  1VQL I;  2M45 A;  4D7M A;  2EV5 A;  3SFZ A;  2E19 A;  1UHM A;  4XLA A;  3FKJ A;  4EJW A;  2FEZ A;  1BI2 A;  2DXI A;  4HEA 2;  2IP2 A;  2L01 A;  1EH8 A;  2ZCW A;  4A12 A;  4A3B J;  3R0J A;  2HOT A;  1MJA A;  1TW3 A;  3CF2 A;  2HOE A;  3H3U A;  1IGN A;  1MH3 A;  3O6B B;  1IRF A;  3MKZ A;  1SFU A;  3C1D A;  3BLY A;  2WAQ A;  2WWY A;  3AG2 H;  3F8M A;  1J7K A;  5JI6 A;  1J0R A;  5HLT A;  1TZL A;  3IHU A;  2LD5 A;  1FOX A;  2OC6 A;  2M1B A;  1YOV B;  2V9V A;  2W48 A;  2WY8 Q;  2P5L C;  2QSH X;  3DEW A;  4QSH A;  2DCE A;  1MBH A;  1L0O C;  3ZQG A;  1IN7 A;  4M9Z A;  3FXQ A;  4C2M J;  3PQK A;  1EV7 A;  1T0F A;  2EIL H;  3CMM A;  2VJ5 A;  2XAH A;  5DCF A;  3ECO A;  1YFH A;  1E3O C;  2KJC A;  4BQQ A;  1BC8 C;  2L9N A;  3AL0 B;  1T95 A;  4B43 A;  1T2K A;  3BG5 A;  1QZY A;  2Y31 A;  3VPR A;  4EJU A;  2Z99 A;  1BR4 A;  4IQ4 A;  4L0Z B;  1B59 A;  3TO7 A;  3F0C A;  4HZF A;  3HC7 A;  1R22 A;  3KZZ A;  2W84 A;  1VZ0 A;  1ODD A;  5BPD A;  2FOW A;  5BQT A;  2E34 A;  3A0H C;  5HS8 A;  3OYN A;  3FXR A;  3QWL A;  3QU6 A;  1WSU A;  1P7I A;  2JN6 A;  2JA8 J;  2R7O A;  4CZZ A;  2GBY A;  4DZP A;  1KGS A;  3S1N J;  4F52 A;  1WJC A;  4G6D A;  4XMY A;  1OFC X;  1Q1H A;  3K70 C;  4A3L J;  3ZP5 A;  3N05 A;  2EWN A;  2K9L A;  1YW7 A;  5ILU A;  4MFE A;  3HOT A;  3FIW A;  1W0T A;  3JAM K;  1AKH A;  1NG6 A;  1RUO A;  2X6O A;  4D0P A;  1U5T B;  4WX9 A;  3JTG A;  1JJ8 C;  4XKC A;  3KIO A;  1GVJ A;  4P5O A;  3KP6 A;  2ZSH B;  2Y0S A;  3K9T A;  2DI3 A;  2BW3 B;  2KQR A;  3G73 A;  1VQP I;  5IY5 H;  1F9N A;  2VOP A;  3Q0V A;  3DEU A;  2F5D A;  1XSV A;  2K9Q A;  1R9T J;  1B9M A;  3SZT A;  1O4X A;  1N78 A;  4JQF A;  3MCZ A;  4M73 A;  1LDJ A;  4I98 B;  2EQR A;  3TKY A;  2JVG A;  4G7Z F;  2Z5U A;  2FE3 A;  2VQH A;  2XPW A;  2H27 A;  4A3G J;  3V8J A;  4ZYH A;  1S7A A;  1IRX A;  2GIV A;  2VC1 A;  1ZHF A;  3H5N A;  4ANJ A;  4CCJ A;  1UZC A;  4Y33 A;  2HVQ A;  4NBQ A;  1NHA A;  1SD7 A;  2OCE A;  4PCQ A;  2CV0 A;  4FT8 A;  2LY2 A;  3GW2 A;  1BR1 A;  2L2O A;  2NNY A;  2W57 A;  3CC2 I;  1XDU A;  4ZC3 A;  1JKO C;  3HXL A;  3JRA A;  1JUP A;  3IKT A;  5BOX A;  3BTC A;  4S04 A;  2Y48 A;  1B8I A;  1LDK B;  9ANT A;  1EH6 A;  3GUD A;  3ZMU A;  5J4V A;  2BZT A;  2KDZ A;  2ZME A;  1KQ8 A;  1Z0X A;  2JMW A;  3BDD A;  4E6K G;  1TWH J;  4ZJZ A;  5K7H A;  1TQP A;  3CF5 F;  3PNT A;  4A3I J;  2IAI A;  1IRZ A;  2HS5 A;  2NVQ J;  2R5Z B;  3S3O A;  2FX0 A;  2ZBK A;  4G6T B;  5DEQ A;  3NAR A;  2M2E A;  4L9J A;  2VC0 A;  3WTV C;  3BG3 A;  3LNQ A;  3L00 A;  1IUY A;  4HQE A;  3ERE D;  3ZOB A;  3IAM 2;  3OIQ A;  1ZG5 A;  1DQU A;  3Q0W A;  1KQ9 A;  3KFW X;  2R5Z A;  2QEX I;  2B9S A;  2O6G E;  2LY9 A;  5LHH A;  1J09 A;  2XGD A;  3CCY A;  5H2F C;  2UV1 A;  2QGU A;  4GRI A;  3B73 A;  4XID A;  1QVU A;  1BL0 A;  2ZME B;  2WB1 N;  3WTW C;  4BHB A;  4KA4 A;  2L9R A;  2XAG A;  4BJT A;  2X4H A;  5E1W A;  3WOD F;  3QPL A;  3PIP F;  3F72 A;  4BU2 A;  1KYZ A;  4E7Z A;  2FQ3 A;  3CUQ B;  2WTE A;  4MNU A;  4NQW B;  3RKX A;  2XF6 A;  2R7X A;  3O2P E;  1HF0 A;  1GV5 A;  1ZG3 A;  2P7V B;  4EVI A;  3S15 J;  1LKX A;  1T38 A;  1KU7 A;  5D5V B;  4HG2 A;  5F27 A;  4NC8 A;  2IA0 A;  1PP8 F;  4M3E A;  1IDZ A;  4ESF A;  3U21 A;  2OD5 A;  2H6C A;  2E1M C;  4LIU A;  3KYL A;  2L9V A;  4Z2Y A;  3BR5 A;  3G1O A;  4RGX A;  2QKM B;  1R1T A;  2CG4 A;  1EKE A;  3PIO F;  5K5Q A;  4YG2 F;  2ME6 A;  2VQC A;  3M9A A;  2EV6 A;  2STW A;  1OJL A;  4FX4 A;  4XRF A;  2QBY B;  3WTS C;  4BGD A;  3FM3 A;  2EB7 A;  2EFW A;  1R58 A;  4LIV A;  1ZRE A;  2BY1 A;  3M8E A;  3BR0 A;  4RS8 A;  3JRI A;  3E97 A;  3S1M J;  2L7F P;  4AIJ A;  4AC0 A;  3DTE A;  5FFZ A;  4AYB N;  1XGM A;  5FRO A;  3V7C A;  3ESW B;  3V8K A;  3I55 I;  2HDD A;  2ZME C;  5CQG A;  2PQ8 A;  2A3S A;  2NVY J;  2VOO A;  1T08 B;  2QZ8 A;  2M4K A;  1D0X A;  5FGM A;  4RB2 C;  1IRG A;  2J5O A;  2WA0 A;  2MBF A;  4O6J A;  3HBL A;  5ED4 A;  2R7U A;  2CUZ A;  3E5Q A;  1U78 A;  4A3J J;  1Y39 A;  4ZZL A;  4EJT A;  1KU2 A;  3GTG J;  3FXJ A;  3CMY A;  3VYR B;  2L4A A;  3TP0 A;  1ZEL A;  2QSF X;  1SVO A;  4KUM A;  1Y8Q B;  3K10 A;  4M3B A;  4LLN A;  1FC3 A;  4AIK A;  4ITV A;  2E1C A;  1YIJ I;  3RDI A;  1I5Z A;  2LTP A;  1R5I D;  1SAX A;  3WE3 A;  1K4T A;  2ADU A;  3LSH A;  3O8G A;  2M7A A;  3KCC A;  1KU3 A;  2XDV A;  5GAE J;  2BE5 F;  2QWW A;  3GTJ J;  2R0Q C;  2EV0 A;  4NB5 A;  2CUJ A;  4RAG A;  4A2U A;  2XAQ A;  3SDG A;  1D5V A;  2R7F A;  3VOE A;  5BPI A;  3LA3 A;  1W7P D;  5H6R A;  4G12 A;  2M3A A;  5ILV A;  2K3F A;  3WG7 H;  4EAT A;  2FSW A;  2I5U A;  4NUB A;  1LVK A;  1X4O A;  2PMZ N;  5HS7 A;  3EUK L;  1R36 A;  2MW8 A;  3PNV A;  3B6A A;  5J8F A;  3B6C A;  4Q48 A;  4GO1 A;  2LR8 A;  4RBO A;  3MZY A;  3RZO J;  5FLM J;  2ZXJ A;  1TWG J;  4S0H B;  5JR3 A;  1IN5 A;  1QHH D;  1FTZ A;  4HDU A;  3HHG A;  4JK1 X;  2LKX A;  4KN4 X;  3ZN1 A;  1J5Y A;  5JVG F;  3D1N I;  2L9S A;  1WGX A;  2X1D A;  3MVP A;  1HC8 A;  2FA5 A;  3HTS B;  2JK3 A;  4EV0 A;  4ESB A;  5IPA A;  2XAF A;  5LHG A;  2VL8 A;  3DEE A;  4X6A J;  3KLO A;  1UCR A;  1S7O A;  1JE8 A;  4DIQ A;  3ZPL A;  2LG4 A;  2GXA A;  3EYI A;  1X1C A;  4Y17 A;  1OLT A;  5LD2 C;  1W0U A;  3UNG C;  3DQV C;  4BQN A;  3WE2 A;  2V1D A;  1YW8 A;  4C3H J;  2XUB A;  1VQK I;  5B1B H;  2YU9 J;  1JUS A;  4HV6 A;  3QOD A;  2VXD A;  3J7Y J;  2A6H F;  5F6F A;  4AYB A;  3M4O J;  5D8K B;  1IC8 A;  1XC5 A;  4ASN A;  4XLF A;  1MGT A;  4FIS A;  2XF7 A;  4RGS A;  2X6X A;  4R79 A;  2W1O A;  4GXO A;  2PFB A;  3OYF A;  2QA4 I;  3IRR A;  1R1U A;  5F08 A;  4U0W A;  1XGN A;  3GTK J;  1RI7 A;  2HXO A;  2PMH A;  3BJO A;  3OR1 C;  4M9S A;  2Z3Y A;  1NK2 P;  2E2I J;  4L9V A;  3ZMZ A;  3CCS I;  1X19 A;  3VWB A;  3ERM A;  3H9G A;  4A3C J;  4ZZD A;  5IYB J;  2JRT A;  5FO5 A;  4F91 B;  1GUU A;  1M1E B;  1UB9 A;  2EIK H;  1IF1 A;  2M34 A;  2R4G A;  3ABU A;  1D0Z A;  1T56 A;  2KT0 A;  3PFY A;  2R7W A;  4ETS A;  3QOE A;  1HSJ A;  5K5R A;  4X0G A;  2ID3 A;  5ILS A;  1LEB A;  1FBQ A;  1ETX A;  2L5Q A;  5DCM A;  3TL4 X;  2A07 F;  5BNG A;  2KMU A;  3N97 A;  3HYI A;  1U3E M;  1X3W B;  3KET A;  1ZQ3 P;  4BQO A;  2GA2 A;  5B3S H;  4AID A;  1HW5 A;  2ICW G;  3FK7 A;  2NAZ A;  3TDU C;  3CME I;  2B0L A;  4A6E A;  2IA1 A;  4IRH A;  2V4J C;  2CJJ A;  1UFM A;  3B02 A;  1YG2 A;  2A69 F;  5L3E A;  2QM3 A;  4F55 A;  1IN4 A;  3SXY A;  3Q9V A;  3RIR A;  1XB4 A;  1XPX A;  1Z7L A;  1SMY F;  2ZFW A;  3P9K A;  3G1M A;  1FTT A;  3MWM A;  5AON A;  1BR2 A;  2GZW A;  1K7A A;  1FOW A;  4W97 A;  1U6G A;  3HSR A;  3HOU J;  4OIN F;  3PQJ A;  2JJ7 A;  4H4K C;  4OAZ A;  3S14 J;  4AUX A;  2ETH A;  2UXX A;  4XKV A;  2DJI A;  4AWX B;  2CFO A;  2JSC A;  4IF4 A;  3JRD A;  2VI6 A;  4UUS B;  2HKX A;  3WTY C;  1WRJ A;  5KAI C;  4F3Q A;  2E5Z A;  1A35 A;  3HJE A;  1UAA A;  1DGR M;  4ON0 A;  4QWQ A;  1R6R A;  3CJR B;  3RKW A;  1FYM A;  3RYP A;  1T98 A;  5M3F J;  3OYG A;  1BC7 C;  4I99 C;  2AQF A;  3HRT A;  4P55 A;  4Y15 A;  3BC8 A;  1ZLJ A;  3BR6 A;  4U0V A;  1N77 A;  1IN6 A;  5CPR B;  4IVN A;  2FJ1 A;  3KEO A;  1ORK A;  5GAH J;  1GXQ A;  3CJN A;  5BMZ A;  2FQ4 A;  3E3V A;  4CXF A;  4XOR A;  1SEU A;  2XGC A;  2HTJ A;  1QO0 D;  5KAF C;  1VQ7 I;  1ZRD A;  1FWZ A;  2RN7 A;  3PFI A;  1NG7 A;  3M8F A;  5FLV A;  4KIC A;  3C2G A;  3F6O A;  3PSF A;  3FXM A;  3V8L A;  2CH0 A;  2DU9 A;  4HLY A;  4DGW B;  1MH4 A;  4B3X A;  3T8R A;  4JP0 A;  1K78 A;  4C9Y A;  2EA4 A;  5K7Z A;  1XMX A;  4DYR A;  4GCV A;  2EBI A;  3VEP A;  2K3P A;  2K02 A;  1JKQ C;  4MGR A;  1RKW A;  2W25 A;  2XAS A;  2WAF A;  1ZGW A;  4CO8 A;  2VUM J;  2NYX A;  1RRJ A;  3TP3 A;  1SC7 A;  5LRR A;  1Y0N A;  3Q0U A;  3CCR I;  4M3G A;  3Q3S A;  4FX0 A;  1RPW A;  4A0X A;  4QPQ A;  2E1N A;  4O5V A;  3SEQ A;  2L4M A;  4HLX A;  3DFG A;  2M0C A;  4MTD A;  3BG9 A;  1IZ1 A;  3BR1 A;  2LFB A;  3V7S A;  5EGO A;  1JI8 A;  1BOB A;  1ON2 A;  2CWE A;  3FXL A;  3A03 A;  4W1U A;  1VQM I;  1O57 A;  2GIZ A;  1MIJ A;  1IW7 F;  3HGY A;  4N9I A;  3IUO A;  4A3E J;  4Q5S F;  3QYB A;  1D1B A;  1BW6 A;  5E3M A;  3EDP A;  2IJL A;  3QYF A;  3GTQ J;  3T1B A;  4XLC A;  2ZJ2 A;  3FF5 A;  3TO6 A;  1PYV A;  1FP1 D;  4XRM A;  4OU0 A;  4KFC A;  2LNB A;  1XMA A;  4BXF A;  3NWT A;  1FIA A;  1WVR A;  2HR3 A;  3CDH A;  3S32 A;  2AXT C;  2M8E A;  2DTR A;  3HOY J;  1LNW A;  2IS2 A;  5ICE A;  3KP7 A;  2ZXW H;  3GTM J;  4NDL A;  3LQR A;  5D6E A;  1PUF A;  2BXY A;  3E1S A;  3ZGK A;  2JTV A;  1O3R A;  1TTY A;  2HZT A;  4RGR A;  2KZG A;  4I6Z A;  1VQ8 I;  2R7Z J;  1ZGJ A;  1R71 A;  2HYJ A;  2QYO A;  5LGN A;  3OYJ A;  2O9L A;  3QAH A;  4A5N A;  4A5M A;  2DOE A;  2JA2 A;  2R7D A;  3IRQ A;  4HX7 A;  1AOY A;  3I64 A;  2HPM A;  1K79 A;  2RGV A;  1ZR4 A;  3R6S A;  3PO2 J;  3GBG A;  3C2H A;  2EPF A;  1N75 A;  4HNT A;  5IP7 J;  5M3M J;  5F1J A;  1MMD A;  2BYV E;  2JSP A;  4X1E A;  5E20 A;  5K5O A;  4CYC B;  1H8A C;  3I59 B;  4CDG A;  2N8G A;  3JRB A;  4UB6 C;  3L7W A;  1MMN A;  2HI3 A;  3A1Y A;  1EF4 A;  3BCA A;  4IRG A;  1TT0 A;  5GP9 A;  4QPO A;  4YFN F;  2E1M B;  4NNJ A;  3BR2 A;  3PM1 A;  1R7J A;  3LL7 A;  3FIS A;  3TW7 A;  4LGW A;  3LSP A;  1FY7 A;  4II3 A;  4EM2 A;  2E71 A;  2Y9Z A;  2H1L A;  4OMZ A;  4D7N A;  2VQL A;  2CQ7 A;  1G6N A;  4IHX A;  4IHV A;  5C4J J;  3DTK A;  2DK8 A;  1QQI A;  2O3F A;  3T5X A;  1E2X A;  2E5N A;  3E5U A;  1X3Z B;  4GYI A;  1P9Q C;  1V4R A;  5E3O A;  3OOU A;  3CUO A;  1ERD A;  3J80 K;  4I09 A;  1GT0 C;  4RLF A;  2M7B A;  3AG4 H;  5IT3 A;  3JRE A;  1IN8 A;  2KRF A;  2ZFU A;  3CP8 A;  2DDA A;  2YS9 A;  4HYE A;  1P2F A;  3F8B A;  3OYK A;  3GTL J;  4RAY A;  2Q1Z B;  4FTH A;  1WFX A;  3LSG A;  5EG0 A;  3I53 A;  3S16 J;  1G3W A;  3GFI A;  5D4R A;  4EGZ A;  4H0E A;  3L09 A;  1GVD A;  4LK0 F;  1UHW A;  3CJT B;  2H6B A;  1OCR H;  1TW2 A;  4FE7 A;  2OA4 A;  4NQW A;  5HLG A;  3IWZ A;  2WAE A;  3FBI B;  3L2C A;  1G4D A;  4OIP F;  4YIF A;  4M6V A;  3COA C;  4A0Y A;  2VT2 A;  2LC2 A;  1G8X A;  3ASN H;  3P5J A;  2GXG A;  3LST A;  1TBX A;  3H36 A;  4B47 A;  3RZD J;  1K4S A;  3QQA A;  4A0Z A;  2YSR A;  1X1B A;  3H3Z A;  5DUK A;  4KIB A;  2R5Y A;  1YI2 I;  4MIM A;  2RNG A;  5F0H A;  2LF7 A;  3RCO A;  3IWF A;  3HOX J;  1HKQ A;  1W5S A;  5EEA A;  5CVV A;  4BKX A;  2YPR A;  4CGZ A;  3W6J B;  1MW7 A;  2CRG A;  4I2O A;  4F93 B;  4GYG A;  1LFP A;  1IXS B;  2CMP A;  3QYE A;  4MQ9 F;  4RGU A;  3G71 I;  2VE9 A;  3IC7 A;  1BJZ A;  1HOM A;  5FLX Z;  4PGH A;  5DCM B;  4JBA A;  2COB A;  2HOA A;  5HLH A;  1IV8 A;  2QF7 A;  2QUF A;  2CQN A;  4RDU A;  3H1C A;  2OPT A;  2VN2 A;  2BY2 A;  3BZ6 A;  5B5E C;  3AKZ A;  3NWS A;  5KK1 A;  3BY6 A;  3HG9 A;  1MMG A;  1LEA A;  3F6V A;  4WK8 F;  2O03 A;  3ZXS A;  4JX4 A;  2LVS A;  2PI0 A;  4DZJ A;  1YHQ I;  2IEK A;  4U7B A;  1ONV A;  2QQ8 A;  3HUG B;  1MNE A;  1ETO A;  1USS A;  2OQR A;  1ULY A;  2P6S A;  3L9F A;  4Y4R A;  1EA3 A;  4LLG F;  4U7D A;  3MMY B;  2UUZ A;  4XNF A;  2XSD C;  1RR8 C;  3BR3 A;  1MBK A;  4AM3 A;  3FX3 A;  3BZK A;  3IL2 A;  1XSX A;  3F8C A;  4XSX F;  4DYQ A;  3S2H J;  4NHJ A;  3D5L A;  3HRM A;  3QPH A;  1RES A;  3E6C C;  1P6R A;  1APL C;  4CYC A;  4IKF A;  2DA3 A;  3TQN A;  2R93 J;  1YIO A;  4IX7 A;  5CQE A;  1MKM A;  3RQI A;  2BY3 A;  2LRD A;  4IHS A;  1I1S A;  2HTS A;  1D3Y A;  4PJ0 C;  2YUS A;  3TW6 A;  5D4S A;  4L18 B;  5D6F A;  1XTA A;  1FPQ A;  4CCK A;  1YJN I;  3F8N A;  4CCL A;  2NXN B;  4F92 B;  4MQV A;  4B1R A;  1IV6 A;  1UG0 A;  2KPM A;  4PUS A;  2FF4 A;  2W00 A;  2MLK A;  3ABM H;  4RAZ A;  5JFR A;  3HKZ N;  1U8B A;  3K4J A;  2K27 A;  1GV2 A;  2D1V A;  3Q9S A;  2V79 A;  1I50 J;  2RKH A;  3CQZ J;  3W2W A;  1R5G A;  3OYI A;  1ZK8 A;  5AIP A;  2FXA A;  2EIJ H;  2GQQ A;  4A3M J;  1D1A A;  3TDZ C;  4V19 K;  1HKT A;  2FOK A;  4OWR B;  3HPG A;  1I39 A;  1WKM A;  1G59 A;  4HRI A;  4WCG A;  2ESN A;  3LMM A;  1WJA A;  3L2U A;  1SFE A;  3BPV A;  2VPL A;  2ELH A;  2VKV A;  1ON1 A;  3OL4 A;  1T6S A;  1H9G A;  4P96 A;  3OYC A;  3OYH A;  4XR6 A;  4KIS A;  4XLP F;  3H92 A;  4CCN A;  3HDD A;  4XQF A;  2F5C A;  3W6K B;  1Z21 A;  2MG4 A;  1CQT A;  2DO7 A;  3M07 A;  3EPZ A;  2Z2S B;  1HQC A;  3H5R A;  4CCM A;  1POG A;  2DFF A;  1DPU A;  3LQQ A;  5A2Q K;  4IL6 C;  1YQA A;  3PO3 J;  2TDX A;  2FU4 A;  3LWF A;  4JX5 A;  1V5E A;  2P5V A;  1Z6R A;  4YIR X;  3RTR A;  4HF0 A;  2AO9 A;  2LKS A;  3SHF A;  1QPM A;  1A31 A;  4E7K A;  4DNC A;  3HIF A;  5H6Q A;  1Z3Y A;  1Y6I A;  1OIS A;  2CQQ A;  2ZXH A;  2X48 A;  5LFA A;  2O8K A;  1K6O A;  4BBS J;  2EZK A;  1X2N A;  2KIS A;  1ENH A;  5FJ8 J;  2VLA A;  4E7I A;  3K4B A;  4NC7 A;  1JTY A;  2YU3 A;  1A6Q A;  2CUF A;  1R23 A;  1LDD A;  1X4P A;  4MFD A;  1R49 A;  1Y0U A;  1WJE A;  3HB9 A;  5J47 A;  1H0M A;  3BTI A;  2VBW A;  4IHY A;  2A6T A;  1MBE A;  1QPI A;  2IPQ X;  5A2Q Z;  4C3J J;  1ZR2 A;  2H94 A;  2VBX A;  4XOT A;  3WHC A;  1U5T A;  3D0S A;  4CHU A;  2FNP A;  3T8T A;  2M0M A;  4PJL A;  2VB6 A;  5TIS C;  5L3F A;  1U0J A;  1J59 A;  2K85 A;  3KEY A;  3CC4 I;  3A01 A;  4I0A A;  1VQ9 I;  3RJP A;  3CC7 I;  3GLX A;  2IA2 A;  5HNH A;  3JR9 A;  4HF1 A;  2QQB A;  1WJD A;  2WBM A;  5K7F A;  2L3D A;  4I01 A;  2JA7 J;  1X3U A;  5FKN A;  4BS9 A;  2GA1 A;  2HZD A;  1OYY A;  4B3A A;  3ZQF A;  2VON A;  2XGX A;  2ZJR F;  1FYK A;  3U1K A;  3K70 D;  4KMU X;  1HA8 A;  2M8G X;  2NVX J;  3EUA A;  3CCQ I;  1FT9 A;  2LP0 A;  2LDU A;  2Y30 A;  2DA2 A;  2X9D A;  3J80 Z;  2CSO A;  3BP8 A;  1XG1 A;  4KJZ A;  3HKZ A;  1WJB A;  5FD5 A;  2BOL A;  2DQR A;  1WPK A;  5DM6 F;  3S3M A;  1FSH A;  1LE8 B;  2OU2 A;  4IOC F;  1ZGA A;  1W5T A;  3H35 A;  1S3J A;  1YTY A;  3BQY A;  4OIO F;  1WWX A;  3CDL A;  3CTA A;  3R60 A;  1PJR A;  3QRF F;  2QVO A;  3VSK A;  4Q4Z F;  2D5V A;  1XSD A;  1HST A;  1TWC J;  1F5T A;  2HOS A;  4IHT A;  1XD7 A;  4LD5 A;  2WC2 A;  1U9O A;  1YO5 C;  1QNT A;  3OL3 A;  4XKW A;  4JX6 A;  1TQM A;  1OMI A;  3C18 A;  2VBY A;  1YIT I;  2ZSI B;  1S6L A;  2EZH A;  2JT1 A;  3K69 A;  1RKT A;  2HNH A;  2ZJQ F;  2HYG D;  1KU9 A;  1XCV A;  4BHP A;  1J9I A;  3DPL C;  4IQJ A;  3K4N A;  4WWC A;  1FOK A;  2M87 A;  4CIC A;  4XSZ F;  2B7E A;  3AG1 H;  1YX3 A;  2NOJ B;  3I71 A;  1DPR A;  1KA8 A;  2VAS A;  1S5L C;  4U0Y A;  3ZQ7 A;  5EEH A;  4M74 A;  2DFH A;  3S93 A;  3VYS B;  2MC3 A;  3RSN A;  2LBF B;  2OQG A;  4U87 A;  2EJR A;  3ZMV A;  1QA6 A;  2QCO A;  3NEU A;  1Z1D A;  2F5E A;  5E3L A;  2MYS A;  4CSW A;  3K4K A;  2DDB A;  1ZKG A;  4RMN A;  1ZN2 A;  2DT6 A;  4A3K J;  5TJJ A;  3MQ0 A;  3JRF A;  4NC6 A;  2LY1 A;  2YR2 A;  3EUH C;  3FBN B;  4BY7 J;  3P7N A;  1NH3 A;  5F64 A;  2HWV A;  2STT A;  1QU3 A;  2EIN H;  5GTH C;  4HAM A;  4MO7 A;  4Q47 A;  5ERI A;  3NRV A;  4C3I J;  2I8D A;  3E0J B;  3HRS A;  3LSM A;  4GFB A;  3K2A A;  3O8H A;  4PJN A;  3ZR8 X;  4EEF G;  3LAJ A;  1SFO J;  3ZN0 A;  4OIR F;  3E7L A;  2XGE A;  3KYD B;  2B63 J;  2LKP A;  2IS4 A;  5E17 F;  1GLN A;  3GTP J;  3DP7 A;  2Q2E B;  3MN2 A;  1UHS A;  2CQK A;  4D9J A;  2GAU A;  2KIU A;  2MA3 A;  2W85 A;  3ECH A;  1TP4 A;  4PGG A;  1MND A;  2LF8 A;  1BI0 A;  1JHH A;  2IGO A;  3V42 A;  5C44 J;  1ZRC A;  2HKO A;  5CVI A;  4PSX A;  4XK4 A;  2LYC A;  2Y9Y A;  4C30 A;  2RRE A;  1SFK A;  2DMU A;  2BW3 A;  4DYC A;  2FUG 2;  3KP4 A;  1X1A A;  2VJI A;  1IDY A;  1HKS A;  4BBR J;  3QPT A;  3WTU C;  3GEZ A;  3F22 A;  4ZTF A;  2CO5 A;  3S2D J;  4HPQ A;  2OAZ A;  1O7F A;  1QHG A;  3BOQ A;  3I3L A;  4PJJ A;  2KIM A;  2MSY A;  3IH2 A;  2PLY A;  3IP4 B;  2G9W A;  5EZH A;  2OZU A;  5IOZ A;  1YYV A;  3GZ6 A;  3K4L A;  1D1C A;  4UVA A;  2VIX A;  3LFU A;  2NS7 A;  5L3D A;  2KJB A;  2P4W A;  3OIO A;  2V1U A;  2F5F A;  2MH9 A;  2WAQ N;  3ABK H;  3AFH A;  2WV1 A;  5EYR A;  2UXN A;  3VB2 A;  2AS5 F;  2ZB9 A;  2EZI A;  2HQ5 A;  3BG6 A;  3F8F A;  2FBH A;  2W4S A;  2YX7 A;  5CJ9 A;  1RZ4 A;  2VKD A;  4OOI A;  4R8H A;  2Q2E A;  3I5U A;  3HOS A;  4WXH A;  3GCM A;  3DV8 A;  2MD0 A;  3FM5 A;  4FAS D;  3LSI A;  5J8C A;  3RI4 A;  4IZZ A;  3PNY A;  1HW1 A;  4ZDL A;  5DUI A;  1HW2 A;  1TWA J;  2F2E A;  3K1N A;  5EF6 A;  4PFP A;  3FK6 A;  2E1O A;  4XBF A;  1T8I A;  1DGW Y;  1N25 A;  2DYR H;  5JHF A;  3DXJ F;  4QTR A;  4A3D J;  3MKW B;  2D45 A;  4HSR A;  2E7X A;  5C3E J;  5LEK A;  3S3N A;  4JOM A;  4AU7 A;  4HBL A;  2CV2 A;  1X58 A;  3DBH B;  2FBK A;  3TBI A;  4M72 A;  2XC7 A;  2A61 A;  2DOF A;  2VQG A;  1SFX A;  3PJR A;  3LA2 A;  4M6Y A;  1O3Q A;  2O61 A;  2DYS H;  4BJ6 C;  2VXZ A;  2DT5 A;  1R5H A;  2E2J J;  1WHU A;  1WQ2 A;  1A04 A;  2OBP A;  4RM3 A;  2FMY A;  2XPU A;  3CZ6 A;  5E1Z B;  5EJC A;  3OS2 A;  3ISP A;  4WXD A;  3FWE A;  3GZN B;  1QRY A;  4HNV A;  2X1C A;  3SZP A;  4ZYA A;  2R7Q A;  2EZL A;  2MGQ A;  4J01 A;  4G7H F;  1ZH5 A;  1PUE E;  2KRH A;  2GXB A;  3H0G J;  5GAG J;  1JKR C;  3WG9 A;  3MKY B;  4XOP A;  4LIT A;  3BCB A;  3JCU C;  3P9C A;  2X1E A;  2DMN A;  2W24 A;  2H8R A;  2RNJ A;  2QSG X;  4CZC A;  1R4M B;  2LK2 A;  3I4P A;  4DBQ A;  2DFE A;  3ZMT A;  2CUE A;  1D8K A;  2JRM A;  3I9V 2;  5LBQ A;  3E5X A;  1LVA A;  4L5I A;  3TOB A;  2QQ9 A;  3OMY A;  3NAU A;  2C6Y A;  2TCT A;  3HOV J;  3KP3 A;  4ENN A;  3MZ8 A;  1U2W A;  3DWL E;  4XON A;  4AVZ A;  2K86 A;  2NNN A;  3FMQ A;  2XPV A;  1AWC A;  3S17 J;  1F43 A;  1FBS A;  3LA7 A;  1XGO A;  2G7U A;  1RNL A;  4HV5 A;  1IO2 A;  4WF2 A;  2OUM A;  4LLL A;  1QZE A;  1G3Y A;  1A6I A;  2DTZ A;  5L3B A;  4UY8 I;  1JJ6 C;  2FML A;  4PJM A;  3WU1 B;  2P5K A;  2EIM H;  4DW6 A;  5LGU A;  5J40 A;  1WI9 A;  3OYM A;  2K5C A;  3VYT B;  1PVE A;  3CCV I;  3UKG A;  1JUM A;  2VPR A;  4IEJ A;  2XV4 S;  3C2B A;  5M5X J;  2E60 A;  4TV7 A;  3OWT A;  1H88 C;  1W4M A;  4KMF A;  4OIQ F;  2CFX A;  2E36 A;  3GVA A;  1D0Y A;  1Y1V J;  2P7C B;  5E8G A;  1X1D A;  2MD5 A;  1IJW C;  1BI3 A;  1O3S A;  2DOD A;  4PFO A;  4UVB A;  1TL8 A;  4D5C A;  3WGG A;  3ZQQ A;  1NK3 P;  3D5R C;  1Q1V A;  2K9M A;  1ZYR F;  3GFL A;  3CES A;  3GWZ A;  3SEZ A;  1ZAR A;  4UXN A;  3J7Z I;  2DPD A;  4KYW A;  1OPC A;  1YS7 A;  3F21 A;  3S1Q J;  5IYD J;  5CKT A;  1XGS A;  4N4N B;  5KNL A;  1VQ6 I;  1FLI A;  3EET A;  3FZV A;  5TRD A;  3UR3 C;  2P8T A;  4DQ2 A;  1B9N A;  2ZC2 A;  1STZ A;  5L3G A;  1FJL A;  3QP6 A;  2KRC A;  5DDG A;  3HGG A;  1VQ4 I;  3ULQ B;  3CJQ B;  1P92 A;  4E70 A;  3HRU A;  4YFX F;  3C7J A;  4KT5 C;  1B6A A;  1P4X A;  3DCF A;  3OIP A;  3GFM A;  4G8X A;  3K0L A;  4Y13 A;  1ETQ A;  1X1P A;  1XN7 A;  2V7F A;  3HOW J;  4XLN F;  2PMZ A;  3DTI A;  1ACI A;  3QP5 A;  2ZKZ A;  2ISY A;  1BA5 A;  2GOX B;  5CYV A;  3R0A A;  3ML6 A;  3AL0 C;  1MNM C;  2KL4 A;  4UNO A;  2KKO A;  2Z1D A;  5FD6 A;  1T39 A;  5HVQ C;  4ZDO A;  5BS6 A;  1OR7 A;  1GHC A;  1KON A;  1W36 D;  1JGS A;  4EGY A;  5E8I A;  1TNT A;  4EM1 A;  4BE0 A;  1HBX G;  1SVL A;  5HDK A;  4D5F A;  1HDD C;  5FRN A;  3E6M A;  5F1R A;  5E3N A;  4BXU A;  1LJ9 A;  2DOA A;  4XIC A;  1OYI A;  5F0C A;  3FXO A;  2Z16 A;  1VF9 A;  2UZK A;  3QOP A;  5L3C A;  1SAN A;  2PX9 A;  4BEH B;  2LSO A;  5GPC A;  4I0B A;  1LQ1 A;  1MMA A;  2OCC H;  5LGT A;  3OOP A;  1TNS A;  4B44 A;  3W2V A;  3OV8 A;  5FRM A;  5FKM A;  2HQR A;  4ENJ A;  2ESH A;  3RKY A;  2ID6 A;  4FET A;  4FHT A;  4U88 A;  2OF7 A;  1Z6T A;  1SD6 A;  3MD2 A;  4XLH A;  3WU0 A;  4XN3 A;  4YEL A;  2IGM A;  2JPB A;  3LOC A;  1K83 J;  4BUP A;  4A3F J;  1FNN A;  3E6B A;  4A6D A;  5J3L A;  1B1B A;  2CW7 A;  3I54 A;  4F7Z A;  4LB6 B;  4L9T A;  2ELJ A;  4XM3 A;  2ZJP F;  5LHI A;  4IO9 F;  1BBY A;  2CW8 A;  2RVC A;  3CLO A;  2NVT J;  3EUH A;  3DPT A;  1V5F A;  2ME0 A;  3O3K A;  2D1H A;  3DLA A;  2KLO A;  3F9K A;  3K7A J;  2M30 A;  1UMQ A;  1GDT A;  1PP7 U;  3V4G A;  3L1P A;  3P9I A;  2A68 F;  1BN5 A;  1K78 B;  4YEJ A;  2XKP A;  2XHK A;  4L5J A;  3H3V K;  3G3Z A;  5E18 F;  1HDP A;  4BDY A;  2Y0M A;  4I7H A;  3PUF A;  2KHM A;  3RPQ A;  3FHZ A;  4MLO A;  1V54 H;  3CMA I;  2GOM A;  2DW4 A;  1IUF A;  3BTJ A;  2VBZ A;  2K40 A;  4IHW A;  1O7L A;  1B72 B;  3SFI A;  1FX7 A;  3BWG A;  4J19 A;  4E4H A;  2HQN A;  4LG0 A;  3DU5 A;  3IV5 A;  2E7W A;  2CGP A;  1MD0 A;  3OS0 A;  1MSE C;  3J81 Z;  2L02 A;  3GLL A;  2M5W A;  1MJ9 A;  2CU7 A;  4M3D A;  2GWR A;  2HDW A;  1ZAO A;  1L3L A;  3EYY A;  3MEX A;  2VJ4 A;  3OYA A;  3F23 A;  4BJ5 C;  3WGH A; 
#chains in the Genus database with same CATH homology
 1AKH B;  2KT0 A;  1T56 A;  1Y1W J;  3A01 A;  2G0E A;  1JKP C;  3JR9 A;  4XRS G;  2ID3 A;  5K7F A;  2JA7 J;  3GTO J;  5FKN A;  1ETX A;  3W6V A;  4ABZ A;  2XB5 A;  4B3A A;  5BNG A;  3ZQF A;  2GM4 A;  1LFB A;  5FKO A;  1Z77 A;  2M8G X;  2NVX J;  1ZQ3 P;  1H89 C;  1B8I B;  2LP0 A;  3FK7 A;  5IP6 A;  2Y30 A;  2DA2 A;  2X9D A;  5EGO B;  3I4N J;  1NTC A;  1XG1 A;  5HOD A;  3SJM A;  1HCR A;  4JYK A;  2CJJ A;  1LE8 A;  1LFU P;  1WPK A;  2R5Y B;  1P7J A;  1LE8 B;  3G1L A;  1ITY A;  5EG0 B;  3G1M A;  4I76 A;  1JTX A;  3BQY A;  1FTT A;  4A69 C;  3CDL A;  5F04 A;  1MBG A;  2D5V A;  1MBJ A;  2FD5 A;  2Y0S N;  3ZQC A;  1TWC J;  4W97 A;  2R92 J;  3HOU J;  2JJ7 A;  2M9H A;  2K9N A;  2HOS A;  1VFC A;  3S14 J;  4AUX A;  1TC3 C;  3BT9 A;  1U9O A;  2DMT A;  3MKL A;  1T33 A;  4JX6 A;  1ETW A;  3JRD A;  1G2H A;  2VI6 A;  4UUS B;  5J1U A;  4BY1 J;  4D7M A;  2E19 A;  2EZH A;  1RKT A;  3WHB A;  3HOZ J;  5M3F J;  4UUT A;  4A3B J;  2HOT A;  1IGN A;  1MH3 A;  2L7M P;  3BR6 A;  3JRC A;  2FJ1 A;  1ORK A;  3A01 B;  2FQ4 A;  2XGC A;  3TED A;  2O7O A;  2LD5 A;  5EDN A;  5FLV A;  2QCO A;  1JGG A;  3IH4 A;  5C4X J;  2W48 A;  1ETV A;  2XRL A;  5E3L A;  1BW5 A;  3DEW A;  1MH4 A;  4QSH A;  5JLW A;  4JP0 A;  1MBH A;  3JRH A;  1ZKG A;  2DMP A;  3ZQG A;  5K7Z A;  4A3K J;  3JRF A;  4DYR A;  3BTL A;  2Y2Z A;  2EBI A;  2I10 A;  4BY7 J;  4C2M J;  1JKQ C;  1RKW A;  4MO7 A;  4C3I J;  2GLO A;  1ZGW A;  4GFB A;  2VUM J;  1WI3 A;  5IYC J;  3K2A A;  3O8H A;  4EEF G;  3TP3 A;  1RET A;  1XS9 A;  1E3O C;  1SFO J;  3Q0U A;  4M3G A;  3Q3S A;  3BG5 A;  2Y31 A;  1RPW A;  3E7L A;  2XGE A;  3VPR A;  4L5E A;  2B63 J;  3F0C A;  3GTP J;  1WH7 A;  2M0C A;  2DA5 A;  3BG9 A;  3MN2 A;  1UHS A;  3BR1 A;  5EGO A;  2LFB A;  1PUF B;  1QVT A;  1TWF J;  2L0K A;  3A03 A;  4W1U A;  5C44 J;  1P7I A;  2JN6 A;  3HGY A;  4A3E J;  2JA8 J;  3ZQL A;  2DJN A;  1BW6 A;  2GBY A;  4XK4 A;  4DZP A;  2Y9Y A;  5E3M A;  3S1N J;  2P81 A;  3GTQ J;  2DMU A;  1OFC X;  4DYC A;  4A3L J;  5EZG A;  4MFE A;  4XRM A;  3FIW A;  1W0T A;  1IDY A;  3M3Y J;  2DA4 A;  4BBR J;  1FIA A;  1AKH A;  3S2D J;  2CQX A;  2X6O A;  5IOY A;  3HOY J;  2MSY A;  3IH2 A;  2DN0 A;  1JJ8 C;  3GTM J;  5EZH A;  4NDL A;  1PUF A;  5IOZ A;  2DMQ A;  4I6Z A;  2R7Z J;  2NS7 A;  3OIO A;  3Q0V A;  2WAQ N;  2K9Q A;  2WV1 A;  5J1Y A;  1R9T J;  2HYJ A;  5EYR A;  1O4X A;  5JLX A;  2ZB9 A;  2O9L A;  2EZI A;  1B72 A;  3HM5 A;  2HQ5 A;  2EQR A;  2JWT A;  4V2F A;  2XPW A;  1FEX A;  3PO2 J;  1ZR4 A;  3BQZ A;  4A3G J;  3GBG A;  2DA7 A;  2AHQ A;  5IP7 J;  5M3M J;  5F1J A;  1TWA J;  5EF6 A;  3FK6 A;  4X1E A;  1H8A C;  2E1O A;  4CYC B;  1JT0 A;  2N8G A;  3JRB A;  4QTR A;  2L7Z A;  4A3D J;  1JKO C;  3JRA A;  1JUP A;  2HI3 A;  4LOC A;  5C3E J;  3BTC A;  1EF4 A;  1B8I A;  9ANT A;  1F36 A;  5GP9 A;  3FKI J;  2KDZ A;  1X58 A;  1DU6 A;  3BR2 A;  3PM1 A;  1Z0X A;  3FIS A;  2JMW A;  3TW7 A;  1TWH J;  2HXI A;  5J1R A;  5K7H A;  1AU7 A;  3LSP A;  4A3I J;  2IAI A;  1HLV A;  1IRZ A;  3QPS A;  2NVQ J;  3OSF A;  2R5Z B;  2E2J J;  5FKK A;  2FX0 A;  2Y9Z A;  2VKE A;  4D7N A;  2XPU A;  2NS8 A;  2NOG A;  3NAR A;  4IHV A;  4IHX A;  2M2E A;  3BG3 A;  5C4J J;  1QRY A;  4HNV A;  3LNQ A;  4M3F A;  3ZOB A;  2EZL A;  3Q0W A;  2DA6 A;  2MGQ A;  2R5Z A;  2ECC A;  2K9S A;  3I4M J;  5E3O A;  2LY9 A;  3H0G J;  1JKR C;  3OOU A;  4Y7N J;  2XGD A;  3CCY A;  1GT0 C;  2DMN A;  2H8R A;  4XID A;  1QVU A;  1BL0 A;  2LK2 A;  2WB1 N;  3JRE A;  1FIP A;  2CUE A;  2YS9 A;  3ZQH A;  2L9R A;  1UG2 A;  2DA1 A;  4UUS A;  3GTL J;  3NAU A;  2TCT A;  4FTH A;  3HOV J;  3QPL A;  3LSG A;  5EG0 A;  3S16 J;  1GVD A;  4FE7 A;  1ETY A;  1GV5 A;  1HF0 A;  3S15 J;  2ECB A;  4A93 J;  2XPV A;  3S17 J;  1F43 A;  1I3Q J;  2H1K A;  1A6I A;  2DTZ A;  4M6V A;  5F27 A;  4M3E A;  1JJ6 C;  1IDZ A;  3RZD J;  3QQA A;  1MSF C;  3BR5 A;  1MBF A;  4DW6 A;  3G1O A;  2R5Y A;  4MIM A;  1D5Y A;  5F0H A;  3UKG A;  1JUM A;  2VPR A;  4IEJ A;  4V2G A;  3HOX J;  5EEA A;  4BKX A;  3C2B A;  5M5X J;  4Y52 J;  1H88 C;  1ZTR A;  2ME6 A;  2CRG A;  2JA6 J;  1Y1V J;  1IJW C;  1OJL A;  1JT6 A;  2TRT A;  2RAE A;  2EH3 A;  4D5C A;  1BJZ A;  3BR0 A;  3JRI A;  1Q1V A;  1NK3 P;  2L7F P;  3S1M J;  1HOM A;  4AC0 A;  2COB A;  2HOA A;  4AYB N;  1RR7 A;  2QF7 A;  4FCY A;  2HDD A;  2NVY J;  3S1Q J;  4RDU A;  3HEF A;  5IYD J;  2OPT A;  1VI0 A;  5M5W J;  1U9N A;  3HBL A;  3JRG A;  1U78 A;  4B4C A;  4A3J J;  4JX4 A;  2LVS A;  1FJL A;  1A5J A;  4DZJ A;  3HGG A;  3GTG J;  2IEK A;  1ETO A;  3CMY A;  4QIW N;  3TP0 A;  3DCF A;  2XSD C;  3RKQ A;  3BR3 A;  1MBK A;  2XB0 X;  1ETQ A;  1K61 A;  3HOW J;  4M3B A;  4DYQ A;  2LTP A;  3S2H J;  1AHD P;  1RES A;  3O8G A;  1BA5 A;  1APL C;  4CYC A;  2R93 J;  2DA3 A;  1OCP A;  2R0Q C;  3GTJ J;  3RQI A;  1MNM C;  1WCM J;  3SDG A;  2YUS A;  3TW6 A;  2LLK A;  4G12 A;  4BXX J;  5GPA A;  2PMZ N;  4B1R A;  1IV6 A;  2MW8 A;  4D5F A;  3B6A A;  5F0F A;  5E3N A;  1HDD C;  3B6C A;  1ETK A;  4XIC A;  3LSR A;  2LR8 A;  5F0C A;  4RBO A;  3HKZ N;  3RZO J;  5FLM J;  1U8B A;  1VF9 A;  3LSJ A;  1SAN A;  1GV2 A;  5GPC A;  1I50 J;  3CQZ J;  1IG7 A;  1TWG J;  4S0H B;  2JA5 J;  2IBD A;  1FTZ A;  1ZK8 A;  1OCT C;  5FKM A;  2LKX A;  4A3M J;  2ID6 A;  2OF7 A;  3D1N I;  1WGX A;  3MVP A;  2JK3 A;  5IPA A;  3LOC A;  1K83 J;  4A3F J;  4X6A J;  3A02 A;  5J3L A;  2VKV A;  5M5Y J;  4XRS A;  1W0U A;  3HDD A;  1X2M A;  3ZQI A;  5DS9 A;  2E2H J;  1YRN A;  2MG4 A;  1CQT A;  2NVT J;  1WH5 A;  4C3H J;  2ME0 A;  3OSG A;  2YU9 J;  1JUS A;  3IH3 A;  1POG A;  3K7A J;  1UMQ A;  1GDT A;  3PO3 J;  3L1P A;  4JX5 A;  5IP9 J;  1VND A;  3S1R J;  3M4O J;  5FKL A;  1IC8 A;  3H3V K;  2AO9 A;  1HDP A;  1XC5 A;  2O8K A;  2CQQ A;  2X48 A;  4FIS A;  4MLO A;  1I6H J;  4BBS J;  2EZK A;  1X2N A;  5FJ8 J;  1ENH A;  1YRN B;  1IUF A;  3BTJ A;  1JTY A;  4FE4 A;  2K40 A;  4IHW A;  5F08 A;  1B72 B;  3SFI A;  2CUF A;  4MFD A;  4J19 A;  3GTK J;  3HB9 A;  2HXO A;  3IV5 A;  3BTI A;  2ELK A;  4IHY A;  1MBE A;  1QPI A;  1MSE C;  1NK2 P;  2E2I J;  4C3J J;  1ZR2 A;  1DU0 A;  5DTD A;  2CU7 A;  4M3D A;  1S7E A;  3WHC A;  4A3C J;  5IYB J;  1GUU A;  2M34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...