3A04A

Crystal structure of tryptophanyl-trna synthetase from hyperthermophilic archaeon, aeropyrum pernix k1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
367
structure length
367
Chain Sequence
LDPWGAVEIKDYDRLLRTFGIRPFSEVLPLLRKAGMEPSFLMRRGIIFGHRDFDKILEAKARGERVAVLTGFMPSGKFHFGHKLTVDQLIYLQKNGFKVFVAIADAEAFAVRRIGREEAVRIAVEEYIANMIALGLDPKDTEFYFQTNRGTPYFRLIQLFSGKVTAAEMEAIYGELTPAKMMASLTQAADILHVQLDEYGGYRHVVVPVGADQDPHLRLTRDLADRMAGVVELERPASTYHKLQPGLDGRKMSSSRPDSTIFLTDPPEVARNKLFRALTGGRATAEEQRRLGGVPEVCSVYHMDLYHLMPDDGEVKHIYTSCRLGKILCGECKQIAWEKLERFLAEHQSRLEKAKTIAWKLVEPPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1
rcsb
source organism Aeropyrum pernix
molecule tags Ligase
total genus 140
structure length 367
sequence length 367
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3a04A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3a04A01
4HJRA 4DLPA 3BL5A 1IRXA 3ZGZA 1R6TA 4Q93A 1EE1A 1TQ8A 3IMCA 1BS2A 4MUGA 3IOCA 2X0KA 1J20A 1OWPA 4ZT4A 4NAUA 2J5BA 1KP2A 4MLPA 4CDMA 3COVA 3P0HA 4ARCA 4JXXA 4MUFA 1PFVA 1J1ZA 4MQ6A 2C5SA 3ZJTA 1YIAA 1V8FA 2CV2A 1KORA 1WOYA 3S3TA 2GM3A 3MLAA 3DPIA 3RK0A 4DDHA 1T9GR 5LM3A 5HG0A 4JYZA 1U0BB 3KT8A 3CLRC 3HMQA 2J07A 2QUIA 1KQNA 2GKSA 2JAXA 1VBKA 3G5AA 1I2DA 1NSYA 4MUKA 4EG4A 3ND6A 2CSXA 2HZ7A 1OWMA 1QU3A 1O5TA 5IJXA 3CR8A 4UZFA 3H9CA 2CYBA 4MWDA 2YXNA 1JZQA 1NYLA 1M8JA 2PFSA 3ZXSA 3ISJA 4MVWA 4CT0A 4MW0A 1FFYA 2Z09A 1JZSA 4OUDA 1F9AA 1G8HA 3AKZA 4JFAA 2BYTA 1UFVA 1U3DA 3K9WA 4DJAA 1EFVA 2NSYA 3CLUC 3COYA 5J5AA 4QREA 1MC1A 4I6EA 1QJCA 2A84A 2A7XA 1NUSA 1G59A 4RUKA 2DPLA 1KP3A 4OUDB 1WXGA 4MW7A 1NP7A 2I1LA 1IQ0A 1MOPA 1VLHA 3TS1A 1M8GA 4Q16A 2QTNA 4MW2A 1T6XA 1N2OA 1KQPA 1EJ2A 2HGZA 5JBNA 1NUTA 3DO8A 1JEEA 2RD2A 3G6KA 1XNJA 1Q19A 1O95D 1LW7A 1O6BA 2E0IA 1Q77A 1ZJWA 1WXHA 4NX2A 5TEVA 3FY4A 3FG9A 3L92A 4FZJA 4ZCRA 3F3MA 3GMIA 1N3LA 2D5BA 1WZ2A 2D13A 2E18A 1EUYA 4GRIA 5H16A 1ZUNA 2PXHA 4K03A 1EXDA 5IHXA 4MW1A 3IUEA 2H29A 1OBCA 2QJTA 4TS1A 2H2AA 3ILVA 4G6ZA 2JANA 4EG3A 4XFJA 2ZUFA 1OD6A 4U8HA 2G36A 1GN8A 2XRYA 4MW6A 1JHDA 3OP1A 4QRDA 5FO1A 4EF6A 5LLTA 1SURA 5KCMA 1QRSA 3PXUA 1IVSA 2QJOA 2A1UB 1N2HA 1O94D 3C8ZA 2V0GA 4L2IA 5K0TA 1QTQA 1H3NA 3TQIA 3IH5A 1IH8A 1XJQA 1D2RA 1F4LA 1CT9A 4ND7A 4EG1A 1H3EA 4ZT2A 1N2BA 3IVCA 1TYBE 4HPWA 1EFPA 4ZCPA 4MUHA 1IFXA 5EKDA 2WQ7A 3QTTA 3UK2A 2CYAA 4I6JA 3RHSA 1ILEA 3CLTC 4L2IB 1N2JA 4ZT7A 4EG6A 3FI0A 4DDKA 2E21A 3Q10A 3RJZA 3D6UA 2DEUA 4PBSA 3FOCA 3FNRA 1EFPB 2OV4A 1O0CA 3H97A 1WXFA 2PZBA 1IQUA 2QUHA 1KAQA 1QRTA 2Z08A 2DETA 3GLVA 2CV0A 1G8FA 3VRHA 3A2KA 1GTSA 4EG8A 2PG3A 3CLSD 5HUJA 1NZJA 1JIJA 2A86A 4DE5A 4EG5A 3CVYA 4I6GA 3A4IA 3IVGA 4YBRA 3E27A 2QTRA 3X1KA 1TYDE 2J09A 2A4MA 5HUHA 3SP1A 4P2BA 2ZUEA 3SEQA 3Q4GA 3D6VA 4ZT6A 4YP7A 1JGTA 2AKEA 3M5WA 1PFUA 3HGMA 1I6LA 5FO0A 3IUBA 3SZGA 3ZJUA 1T6YA 1O94C 2A1TR 1ULHA 2PIDA 4NDAA 4PBTA 4MVXA 2DUMA 1KH2A 3COZA 1XNHA 4ZCTA 1KH1A 2QUJA 4EGAA 1TYCA 1JILA 3PNBA 4YP5A 1LI5A 4ND6A 1GLNA 1O96A 4U63A 1WQ3A 2GOYA 2VTBA 1PFWA 4MW4A 3LOQA 3KT3A 3FIUA 4MW9A 4MW5A 4KR6A 1MB9A 1OBHA 3ZUGA 4G5FA 1JIKA 3IMGA 4QBTA 4ARIA 3CVUA 2B7LA 3Q12A 4KPUB 1GPMA 4ZT5A 1Q11A 5K0SA 1ZH6A 1RQGA 1O96B 2AG6A 5DEOA 3ZIUA 1GZUA 1M83A 2D54A 3INNA 3P52A 4MUNA 2X1MA 2VTBB 1YIDA 5DB4A 2CUZA 3FWKA 1FYDA 3UMVA 1OWLA 3CLSC 2X3FA 3FDXA 3H05A 3CVWA 1VBNA 3SEZA 1LI7A 4AQ7A 3ZJVA 3P0JA 2A1UA 1M8FA 2J08A 1J1UA 1QNFA 3I05A 1P7PA 2IELA 2QJFA 1ZH0A 3VU8A 3RBAA 2O5RA 1B6TA 1TYAE 3TZEA 1JEDA 1R6UA 1NUPA 2WB2A 2ZP1A 3LE8A 4BWVA 1X8XA 5H7XA 4MUEA 3AL0C 1COZA 1TEZA 2YY5A 1J21A 3FHJA 3QE4A 1Q15A 1IQRA 2DERA 3IMEA 1G8GA 2E89A 1JMVA 1KKUA 4F4HA 2YWCA 3DLAA 1N2IA 1N78A 4R2MA 3NV7A 4ZCQA 1YUMA 1N1DA 2WSIA 1MB2A 4WSOA 2IP1A 3HFJA 3ZXIA 1VL2A 3AFHA 1MRZA 2QUKA 1N75A 1M8KA 4GU5A 1F7UA 1WKBA 2AZXA 4J75A 3U1VA 1WQ4A 1O95C 1H1TA 4YP6A 4MWEA 1PFYA 1QRUA 1NUUA 3HV0A 3OTWA 1J09A 3SDBA 1GTRA 1PG2A 1YUNA 5TGTA 3KFLA 1JECA 4MVYA 2JA2A 4HJXA 4ZT3A 1O0BA 1J70A 3K32A 3CA8A 5DK4A 3H9BA 3UY4A 3P0IA 1MAUA 2DXIA 4JXZA 3MUEA 1PG0A 3IDFA 3IVXA 3NBAA 5KWVA 1N2GA 2R5WA 1KH3A 4MUJA 3SYTA 4H3SA 4OJMX 2DR2A 3MLBA 4XFDA 1VBMA 2WQ6A 5DASA 4KKVA 1MJHA 4MVCA 5FNZA 3IOEA 4WNYA 3AIIA 1XNGA 2A88A 4S1OA 4R2LA 1TFUA 1A8HA 1YULA 1F7VA 3UOWA 3ND5A 3IODA 4K0RA 4KPUA 2QTMA 2EJCA 2PZAA 2CYCA 3MMXA 3FH0A 4EFKA 3TQOA 2RE8A 3CVVA 1I6MA 3PNYA 4U7JA 3N8HA 3UC5A 3TZLA 3ND7A 3LCJA 4JZYA 4XSVA 4A91A 4HK4A 3IOBA 4UZEA 4EG7A 3QTBA 3N05A 3PNVA 3FETA 3MXTA 1T9GS 1S4MA 1O97D 5LFAA 1K92A 2XRZA 4J76A 1U7XA 1N2EA 1QQTA 1V47A 4R0NA 4AS1A 1KAMA 1NI5A 2OQ2A 2TS1A 5BNZA 2BTEA 3DV2A 1OWOA 2X1LA 4PY2A 1X6VA 3AG6A 4RPIA 1K4MA 1EFVB 4X0EA 4CQNA 4MWBA 3RK1A 1R6XA 3CVXA 1MAWA 2DLCX 3CLTD 3COWA 1M8PA 2A1TS 4DNXA 3A04A 3HZRA 3N9IA 1OWNA 1WXIA 3A05A 4PBRA 3N2YA 3AG5A 1U3CA 2Z3VA 3KT6A 1NURA 5TEWA 1HYBA 1NUQA 3HL4A 3X1MA 1K97A 2J4DA 5F23A 1WY5A 1K4KA 3NBKA 3X1JA 3CLRD 3G59A 4E1AA 1M1ZA 1Y42X 2EL7A 3VGJA 3ELBA 4MULA 1EUQA 1QU2A 3L93A 3JXEA 3H99A 1YI8A 1JIIA 1GAXA 2NZ2A 2O8VA 4F3RA 2CT8A 3KT0A 3PRHA 3RFFA 4NAHA 5J58A 4KR7A 2CV1A 1DNPA 1H3FA 5AHWA 4MWCA 4MAFA 1N77A 2CFOA 4NATA 3SZ3A 4ZCSA 4NZPA 5KHAA 2VXOA 4DDMA 4KR9A 1I6KA 1O97C 1KQOA 1WJGA 4MUIA 1KR2A 2V0CA 2IJGX 1MBZA 1IHOA 2PZ8A 1T6ZA 2YWBA 1WXEA 1U7DA 3TNJA 4CDNA 2HMAA 4YMIA 4G5YA 5J59A 5TS2A 3CLUD 3GUZA
chains in the Genus database with same CATH superfamily
1FP7A 2HNAA 3S1AA 1CLUA 3OUTA 4GMHA 3G2HA 5IANA 4Q7LA 1XNQB 3VJRA 1BS2A 4OFZA 3UCEA 3LUHA 5K7SA 3JQDA 4FGUA 4G1UC 4XTCS 2JGKA 1OWPA 3SBOA 4QYXA 1YD7A 3WFJA 2CHEA 2F9FA 3BXEA 2HLPA 4HH1A 3EYWA 1E1CA 1I0LA 3K96A 3NAZA 4H18A 1VECA 4LHSA 4BZQA 3MHTA 4WJZA 1WPGA 5IG2A 2FK7A 4JJFA 4R6WA 5LXTA 2CXPA 2IEAA 4UFPA 2JVIA 1KY5A 2WJWA 2NO4A 1EA7A 2IZ6A 2YC4C 3CJRA 4JJ4A 4JLJA 1KI7A 4DRXB 1EDZA 2BZ0A 4FCTA 5K99A 3CB2A 5DHTA 2PO7A 2VAVA 4UE6A 3U26A 3M5PA 1WAMA 4HDNA 4Y6GB 1L5YA 3GJRA 4DVJA 5IABA 3D4OA 4EJSB 1E0SA 1X1BA 3GLSA 4MYHA 4F9EA 5CFQA 3BWDD 1HTBA 3NVMB 3VR6A 2Y1WA 1DXYA 1ESDA 2J07A 4JROA 3ZN2A 5JALA 3IO5A 2YXPX 5E4FA 4BX0A 3LPAA 4M36A 4E1VA 3ILHA 4EFNA 1L4BA 2JJ1A 3ETCA 2VT7A 4X8MA 5LBTA 3SZMA 4IILA 4JKYA 4E2XA 3NTRA 5T6BA 1SVMA 1Q1NA 3A9UA 4L15A 4G4GA 1RXCA 4KIFA 5AM1A 3LDUA 4ESEA 4BUZA 2O1WA 5HFAA 4ZIRA 2GD1O 5ICEA 3SDSA 4WASA 3B3JA 4S12A 4YS6A 2V7XA 4AJ4A 4K6GA 5FULA 5KHLB 3KXIA 1ZHOA 1M8JA 2BFCA 4LZZA 1AN0A 1KXJA 3ZQ4A 1V5EA 1F2DA 2R00C 3ISJA 4JBLA 1GL3A 4MVWA 4RF3A 3E81A 3MGCA 4F72A 5C8XA 4PC3A 1X9HA 3P97A 4TSRA 3ROGA 2WUGA 5F9HA 1CVRA 1CJCA 2DKFA 3U4QA 4KNWA 1D2NA 3L43A 1CR6A 2GF9A 4PXSA 4HQRA 4OF4A 5LP6C 2P9YA 3BIFA 2OGUA 1H2YA 1XV5A 4JUDX 1KI2A 3JRWA 5CNMA 3M5CA 4QREA 2FJ0A 1JEYB 2CNKA 1ZOSA 2ZIZA 3KWFA 4FFWA 2IYTA 3ITDA 1YVUA 3MHPA 3FVVA 5D3KA 1E5DA 5CG2A 3FFXA 2B3TA 2O2SA 4O8ZA 1Y0BA 1XZIA 4TMZA 2QKYA 2ZWIA 3PKZA 1WBBA 2W7TA 5I47A 4HUQA 2MYNA 1BROA 4FUTA 4KW7A 4HG2A 4JB8A 3E84A 4D8WA 4ZEMA 1X1RA 3UJ3X 1QRRA 2ZYVX 2WZDA 4MMZB 4TL8A 4Z5XA 1TJ3A 1Z4MA 1LDNA 5EJ2A 4XI9A 1Z5ZA 3IMFA 4UNRA 3B12A 1I01A 2EG5A 3FOZA 3OWXA 3AWIA 4QXMA 4WDRA 5EMNA 5JC1A 1KR5A 1EJ2A 1ESMA 2HSGA 3E5MA 5IXJA 5EIWA 4AK9A 1L5FA 4PVDA 1U7OA 4EEZA 1G7RA 3IHTA 1RLUA 4JT9A 3EXIB 4G9GA 2N42A 2UYQA 4BWYA 4F71A 2AVDA 2YV4A 1LVGA 1MEOA 1W2HA 1WTCA 3A9WA 1KJ9A 2C04A 3GU3A 5CU7A 1G0OA 4LJ5A 3JQBA 1KMIY 4MVJM 2IUYA 3UWSA 5HFJA 1A1SA 4A0HA 4R1UA 4P81A 2JAQA 2ZYTX 3IQXA 2GESA 2J6HA 2YXEA 3F96A 4HFJA 4N3GA 1K63A 4X8LA 3WK7A 3O8OB 3ELUA 4JOSA 4KQ1A 1M6VB 3UT0A 1YZVA 3MPOA 4G6ZA 4TTTS 1G64A 5KYVA 3PD0A 5EIXA 2MU1A 2IC5A 3IPCA 4F38A 4BX2A 3KYIB 2EKQA 1EINA 1W73A 2HV8A 2IOFA 3OD5A 3VZPA 2IEIA 3U3KA 3FSRA 3VSAA 3N5CA 4UMEA 4K9KA 4LE2A 3FMIA 3H9GA 5H5JA 1MT3A 3GFQA 2I4IA 3KR1A 4XGIA 3LP8A 3UATA 3WYFA 4UBJA 2DE0X 4DCMA 2J59A 1QRSA 1U04A 3Q0EA 3OHPA 2CUNA 1T15A 4RDCA 4Q1BA 1NVKA 5F5NA 3TB6A 2O8CA 4GO1A 1MAAA 1HM5A 2GYWA 3GGOA 3IH5A 3W9SA 3ANSA 1MB3A 2H31A 1F4LA 1LEHA 1NKVA 4A27A 5L3QA 1MABB 3LF2A 2ZXUA 4ZT2A 5TQJA 3DLCA 5DRYA 4ZCPA 2GBLA 1BRMA 1U2QA 4MUHA 4PG7A 3E9NA 2F7SA 2CYAA 2JFVA 5DM1A 2XWBF 2AN4A 4WZBB 2K5UA 2JIQA 2IS1A 3K53A 1AUXA 3PF8A 1JDZA 1U2RA 2AHRA 4Z9YA 3NTUA 5ALXA 3GMSA 5I3CA 2ANCA 4YREA 3QWHA 3L9WA 2VHTA 2BFPA 2VP2A 3DDCA 4YAJA 2VRWA 3VKWA 2DU8A 1CHDA 2Z95A 3GEGA 1JFTA 1RYYA 3I6IA 3SC2A 4F3CA 4G9EA 3UHFA 4WX2B 2R4QA 3HBNA 2QRKA 2WJIA 3GFRA 3KKMA 1GVHA 4WOKA 1Y8AA 3GLHA 2PSFA 3R5XA 4ZOQI 1HEYA 3GEBA 3KQNA 2QYSA 4KZKA 3R7WA 4D96A 3NS7A 5F7ZA 4LE1A 3WYGA 5CP8A 2D00A 1NM5A 2PXCA 2OGSA 5DWDA 1COWA 1UR5A 1CQJB 1WMFA 2IS6A 1XNRB 4MNTA 1AU9A 4BLPA 3DCNA 3P45A 1JQ5A 4LRUA 1NUAA 4QVKA 2C8LA 5KNBD 4ZDJA 3LQ4A 2HB6A 2MHCA 4CLOB 1SUEA 2DX7A 4E14A 1JU4A 4YBRA 1JXMA 2Q3EA 4MI9A 1KTVA 2XNCA 2JRLA 1C3VA 1X7WB 1LV7A 3DEHA 1OYVA 2GILA 2N9UA 5CHEA 2YJGA 5GV7A 2X5XA 4ND8A 4DIFA 4EPVA 3JASA 2QGZA 1P3Y1 3E5NA 4WA7A 2G1JA 5LUBA 2REQA 4GRDA 4J0EA 2J9FB 4ZAYA 3W06A 2ZBDA 1ZH8A 2FWPA 3S2UA 3RWOA 3LHKA 5IUKC 3AEYA 3PCTA 2A8YA 4HI0E 4J6EA 4DKJA 2XNDA 2PX0A 5BYBA 1C7QA 2GMWA 1TLLA 2W2LD 2FU5C 4EGAA 2RB5A 1MB0A 1TYCA 5KKAA 2ZIXB 4CVNA 5E9QA 1IN4A 4GE3A 1N6OA 3FYCA 1ZRHA 3R7FA 4CM3A 1GPH1 1BWRA 1DRKA 4L4RA 4I50B 3ZHQA 5C1OA 3L6OO 1D2CA 5A9SA 3VVBA 2ID9A 5BVGA 4WKCA 3IGFA 3L0IB 1CUYA 2I3ZA 1M0WA 1S6YA 1FFXA 2OYSA 3VR4D 5K8IA 4IZOA 3P2KA 1QMPA 1NV9A 4GPIB 4CMBA 3WWPA 5D3MB 2KI5A 2QP4A 4QLBA 2J9RA 2RCNA 1Z2DA 4CLXA 2AQ8A 3DLIA 3LI2A 4OOFA 2EATA 2GA8A 4BLRA 4JXJA 1NLMA 3ZIAA 1C3LA 3PVZA 4FCCA 3KLMX 4OH7A 2V6GA 2BFNA 5AHOA 2R4TA 3WZ2A 3BCUA 1MEEA 3CW2A 3KWJA 2FQWA 1NQ5A 5U9CA 3FWKA 3LUGA 1IAVA 5FWNA 4JLVA 3T3IA 3UMVA 3ZCUA 2ZJ8A 2UVQA 2I03A 2DBRA 3OBIA 1WR8A 5TF0A 4C0KA 2XCSB 3AR8A 2PO5A 4KNVA 1I33A 2LWIA 2VJKA 3FPFA 3NXSA 4MV1A 1I7QB 4RJLA 1GL9B 2YJ3A 4IUBS 4FS8A 5L3SA 1LA2A 1D1SA 4UVEA 5JWRA 4GSKA 2W6IA 2A57A 4ZZ0A 3G7NA 1PBNA 4QBKA 1KOGA 2UVDA 2HH9A 5FB3A 1A9XA 2IHKA 3HA5A 1CP2A 1ZH0A 1XOIA 1KGSA 4RABA 5HXAA 1SD2A 3VI4B 5BV2P 4Q3EA 2EG9A 3CC8A 2EP7A 1XTJA 3Q0IA 4FU0A 5ALHA 1NUPA 1PL7A 1ODSA 3ZBQA 1KY4A 2O48X 3AUFA 1JX6A 4FOTA 2HIMA 4I1UA 1PE0A 4ILEA 3G5MA 2G5PA 5IBRA 8AT1A 3VU9B 2QROA 1DBSA 4C89A 3AL3A 2XMZA 4YJDA 5BWOA 3C48A 1HDXA 4M6WA 3V2HA 1GADO 3O4FA 4B32A 2JBHA 3SIPA 2YQ4A 2H2HA 2BZSA 1N2ZA 3HP1A 3LWNA 4Y7CA 2VYND 3OAAA 4PQRA 5G0VA 2XUFA 3B6EA 5GOZA 1V3UA 3UMBA 4A15A 1G66A 5K6AA 2I3AA 2B7BA 3BE5A 1GYPA 1ODCA 1V6AA 2OD7A 3F4KA 2DQZA 3OLXA 3O83A 1T43A 2VEDA 4NZNA 1H93A 1XVAA 2NVUA 3CLHA 4DNPA 5KQPA 3DP9A 4EYOA 1Z62A 4Q3AA 1Y7HA 3BGDA 3NG1A 1Z36A 1XRNA 4AWXA 3DJYA 1UKCA 4DUYB 1EDBA 2WLSA 4K9NA 3O90A 3G88A 4DZRA 1R5OA 3D3QA 3HVHA 4YP6A 4B6OA 1PFYA 5JPDA 2C88A 1PJZA 1BDJA 1ISFA 1S1MA 2AG0A 3QKIA 2PUAA 5IVPA 3VR4H 1DBIA 1M2JA 2PSDA 1YUNA 6GPBA 2G5CA 3GT4A 5BWMA 3NHMA 4PCLA 1RWBA 3QA3E 3UYLA 1Q1ZA 3CUEF 5HS6A 2RK4A 4X1IB 2HWKA 3K32A 1QQ5A 1NP3A 1Q0LA 1WRBA 4YMTA 1OROA 1W44A 4OJTA 3PDHA 4WUVA 4BP3A 2PD4A 3Q5EA 3B5EA 2DXIA 2VP0A 5C37A 4Z51A 5GGXA 3U3MA 5JXJA 4E1BA 1VHDA 3N76A 3U4DA 2ZJ0A 1DG1G 3ANNA 2XVMA 3IVXA 2XMRA 1OXUA 3WKBA 4D9BA 5K8TA 5TV2A 1XTZA 1L3CA 5DNAA 2CE7A 3AOEC 4BQIA 5IARA 2D3TA 3A11A 3ONDA 3U3ZA 2G7ZA 1M7HA 2ZJFA 4ER7A 1VBMA 4AC9A 3JATB 4H4EA 8ATCA 4ZJPA 1UQTA 2IPMA 1AB6A 3W1WA 2ATIA 1D4ZA 2QTTA 3HM2A 2VDVE 1CR2A 4W6ZA 2HJHA 3A7EA 4E5VA 1DIGA 3ACDA 3M4NA 1TFUA 1O4WA 3TQFA 5CCEA 4QNNA 5EL0A 3WFZA 1SD1A 3ZDAA 2QTMA 2O2DA 5H4HA 1NJ2A 1Q74A 4LNAA 5EFZA 4F3KA 1WHTA 4QX6A 4U9UA 1SCJA 8OHMA 1KOJA 3N2LA 3D4BA 4M89A 3DZKA 4ON9A 4EQ6A 4KITB 3EFEA 3KQMA 1Y37A 3I04A 1FDIA 2GLUA 3L7DA 1QV7A 2MOKA 5ARDA 3TMKA 3V34A 3BORA 3PIDA 5J43A 4ISCA 1W47A 1PJBA 1V39A 3UGTA 3KJEA 4ETMA 3PCXA 4YHHB 4IZ6A 1XD9A 2J0SA 4CM5A 1QQ7A 1E4OA 1RE1A 3PUIA 3DWGA 5KVVA 2F43A 2WJJA 3KJHA 1VLJA 1DKRA 1DBWA 4C0WA 1XCJA 3GXBA 2H9AA 1YFJA 1PS8A 1NT2A 1JG1A 4MCJA 4A0FA 2Q7OE 3GUHA 1ID1A 4YJ2F 2GCIA 1JR6A 1Q3TA 1JF8A 1E79A 1ZYUA 2Q6KA 3AEQB 4H2DA 3TG8A 1ZD1A 5ECGC 1U8EA 4J1QA 1CEXA 3EZ9A 2PL9A 3TSAA 2XSZA 1VKHA 4GZMA 4MWBA 3BC1A 4EAQA 3L7YA 4LHXA 1OR8A 2OFXA 2AC4A 3C6ZA 3GDOA 3LA8A 3T1NA 3CVXA 2ZBUA 4B84A 2HO5A 4B73A 4LGYA 3A04A 3HZRA 1E0DA 3HFRA 1U3CA 2ESRA 4RZ3A 4G3XA 3V1KA 1RAEA 1UWKA 3FLEA 4MRVA 4HDKA 3ZQ6A 3ECCA 5K20A 3BHNA 4RA9B 5K03A 3FF4A 1F38A 1QTRA 1ZCFA 1KPGA 3C7DB 4OB7A 4E2FA 4ZVOA 1WY5A 1XAGA 5ESDA 2R751 4YR9A 3UA3A 3IPAA 1ZVMA 3TDMA 2FCRA 2FPIB 5AOVA 1Y1TA 1G8KA 1ZD5A 2ZITA 1SXJA 1ZCJA 5EJ8A 2AYXA 1E9VA 2OCXA 2IF2A 4LTMA 4W1QA 3RU3A 4IO1A 3N6RA 2JAOA 3TAXA 2ZPTX 1NQXA 2YWHA 3E53A 2HF8A 3WNQA 5DHSA 2CT8A 1CG6A 1MVNA 1R0KA 4KODA 1C7ZA 4JUAA 1Z12A 4TXNA 3B6KA 1LSUA 3FWHA 1NQVA 4KR0A 2E6KA 8MHTA 4L5CA 1Q0ZA 3IUJA 5ITSA 3FOFC 3T7IA 4QQFA 3D7MA 2RKBA 1XCOA 3VNRA 1DOHA 4KPFC 1L5WA 3BL8A 3IAS6 5KKCA 2BGTA 2Q0HA 2P1DA 3FMOB 3R3HA 3EXEB 5HR5A 5BSVA 3SHFA 4CFZA 2O07A 3D1VA 1SBHA 1Z74A 3PFKA 3DBRB 4D45A 3TNJA 5J4KA 5G02A 1NSTA 3AI2A 1ZR2A 3D2CA 1GNVA 3ZIUA 2Q5CA 2QTFA 1P3JA 3K09C 2WAOA 4V0SA 2OV1A 5C8YF 1P2VA 1PGOA 1Z6XA 3IMCA 2TECE 4HDOB 1RAHA 5E8RA 5F78A 3P9IA 2XUJA 1XVUA 1U9CA 3GJSA 1T24A 2G40A 2V7QA 3P2EA 1KP2A 1V5WA 3QP9A 2O8NA 4MR8A 3AXSA 3CNLA 1XHLA 3H8JA 4MDEA 1F2UB 2EKDA 3NJ4A 2PUHA 1LQUA 2H3HA 1XC7A 4RSMA 3ZXUB 5HFNA 5LPNA 4MV5A 3QKUA 2WDZA 5E6SB 3ZHOA 1N6HA 3ORSA 4MUAA 3GFBA 2H2WA 4G5SA 1NV8A 1ZM7A 1DKMA 1GDDA 3SXJA 4YRNA 2W6PA 4ZAGA 4BTLA 5DNDA 2VPZA 1PQPA 3O8DA 2O6LA 4DKXA 2WA2A 1ZN8A 3KVOA 2YIMA 1IBCA 2ZU0C 3FZEA 1OFVA 2J5KA 1YR1A 1EVIA 3BHJA 4FB5A 2FPWA 2IIVA 1ZJ5A 2HI0A 5B1YA 2YYZA 5LZ5A 2AFIE 2P6RA 2E87A 4DWJA 5EGSA 4BASA 4LUCA 4KN9S 4EY8A 1G20E 1KJZA 3GDGA 2CK3D 3MCVA 4G37A 3WNCA 3VAZA 1GPBA 5CA0A 4C6RA 5DYYA 3RYFA 1P4JA 1AHNA 2WUWE 2QG6A 2CJWA 2ZJZA 1ZJZA 1FX0A 3AFIA 2QD2A 1VIDA 4J1TC 4BEVA 4HNRA 1JS1X 3ENZA 1D7AA 3QU9A 4EUHA 1QUFA 2YWDA 4TSFA 5KQMA 3QU7A 2GB4A 3D2AA 3TZKA 1XALA 3Q85A 3MJDA 4HEHA 1AGNA 1PK9A 4DR3B 2FEAA 3IXQA 1GKYA 4MQEA 1T4CB 3VISA 3HGTA 3LT1A 1FFYA 2IZ0A 4C2AA 1TAGA 4KIGA 3WLJA 4IDEA 1KDZA 3FFAA 1J39A 1XDWA 3WJ7A 2QX9A 1Y80A 2ZDHA 2BYTA 3E7FA 3FPGA 4RK6A 1WZCA 2CCGA 2FOLA 3K9WA 1YZHA 1U2GA 4EY7A 1EFTA 1JYFA 1T2NA 4BFLA 1TNDA 4GZ6A 2QMYA 3WR5A 1US8B 3B8HA 4KUHA 2Y0BA 3HNPA 5I7OA 3TBHA 1CZUA 1NONA 3B3QA 5ENVA 3GLGB 2POCA 4A0QA 1OE0A 4QOSA 2BBSA 1E4EA 3NH9A 4CMEA 2DPLA 2ZYUX 1IJKA 2R87A 4R2XA 3RC2A 4A9AA 3F73A 1DHTA 1EE9A 4FQ5A 2Y68A 3E9YA 5ALRA 3VBCA 3QUCA 4ENUA 2JK0A 4M1KA 1OA0A 2C5HA 3VR3A 1EP1B 4U7DA 2EYQA 1WLYA 1KSGA 2QTNA 2M98A 2R8OA 4G2NA 4H7EA 3C6KA 3BMNA 3KNZA 3KQQA 3SM3A 3TRIA 4D4GA 2UXBB 1E2MA 2IZZA 2NO7A 2XBLA 3SHWA 4BVFA 3RJ9A 1PKXA 1IZ9A 3M6AA 3KUCA 4U2CA 3F6SA 3EZLA 5ALMA 1P60A 3I5UA 2XVAA 2IUFA 3JAMA 1O95D 1ENYA 1HEIA 3CISA 5TPZD 2XQVA 4XSHA 1P5HA 4A6PA 1GSOA 4JAVC 3JV7A 2Q27A 3M3PA 3N8NA 3NOVA 3OMXA 3W6PA 1K7YA 3OFSA 3C24A 4FD3A 1RKUA 5CIQA 1RYFA 3CF0A 5C5CA 5CDSA 1KZGB 2XGGA 4BAUA 2J41A 4HQ6A 2NUAA 1TFRA 1EFAA 3GEEA 2PXHA 2QSZA 4LKRA 3ENQA 1TF5A 4DA4A 1VBFA 1QHSA 1LLQA 4EKDA 5C46F 1Q7EA 1VE5A 1S4QA 4JBYA 1JKXA 2XXAB 5BT8A 3UHOA 4M8NE 5FAXA 1OI2A 2F00A 2ZRIA 3G9UA 5BVHA 1AMUA 4P82A 3FNQA 1E6EA 5ALJA 5F7JA 4BQPA 2ZUWA 3DCYA 3OM0A 4D9MA 5IDVA 1P33A 3ZDEA 1RWVA 1M6YA 3OP1A 1Z16A 1T0JB 2CMFA 1RNLA 4IFEA 3PC2A 5FBLB 1TRHA 2H7CA 1V4BA 3OCJA 3LPCA 1O8CA 3W3AA 4WLEA 2BISA 4O33A 2ZPAA 3AV0B 1GIAA 3CZRA 2QVGA 1FQWA 2AGVA 2CJPA 4RO0A 2AMYA 4WBSA 3D6FA 4TYNA 4FN5A 3Q15C 3Q7PA 3J7AC 4NG4A 1CUWA 1ORTA 4C04A 4BV3A 2AOWA 1G291 1E3EA 3K9LA 2QRVB 4ZVMA 4D9FA 5CLQA 4OP2A 4BE9A 1WPQA 1OT3A 2NW6A 4CL2A 1WZNA 5I7EA 1MFZA 2CDBA 2RHCA 4NJMB 2AEJA 2WZCA 1P44A 1UK6A 3OU6A 4BLWA 1Q22A 4TSKA 2BKAA 2FEMA 3L46A 4X84A 1Q44A 1WDLA 5IT4A 1QCYA 1CB7A 2Z8YA 4G9BA 4UXJA 5FUYA 5TS3A 2E21A 4K9PA 3BF7A 2V1XA 3NIBA 2XJ9A 1V1MB 1W30A 1ZBQA 3Q3HA 4MB0A 3SF0A 1U0RA 2WU1A 5A3VA 1E61A 3PUWA 4DTIA 1JWLA 2DTEA 2C20A 1SKQA 2Z8ZA 4OMDA 5F51A 3W9UA 3M9XA 4NCNA 3ZY4A 4A03A 4X66B 1LS6A 1XMXA 2FWIA 4D9CA 2R00A 3S55A 4LWOA 4S04A 1SY7A 1WUJS 1HSOA 5EXTA 3OQMA 2GPTA 1VYTA 2Q41A 3EHEA 3CVYA 3K8ZA 2JFFA 3Q9NA 1HE1C 4LXTA 5DBIA 5EWLB 3RHTA 1UJ4A 4YJFA 3GNTA 4HRAA 1Z2NX 1W34A 4AMZA 4ZAFA 1B8UA 2IYWA 3HUDA 4LC0A 4P2BA 4RFSB 1OFHA 1NN5A 1KBQA 1DC6A 3P2MA 4LA4A 4AULA 5AW7A 1M10A 2G0NA 4FGKA 2ZUEA 1X7YA 1ZW1A 1EM8A 2XW6A 2YR0A 4GBMA 2HSEA 4E7PA 5A5GA 1E98A 3VSBA 1ZA1A 4BQNA 3QMWA 2PIDA 4DM7A 3HTXA 1AG9A 1KFCB 3H5NA 3ZDYB 4EP1A 2ZJ4A 2ZQZA 2H1OA 1YSCA 1FRNA 1XELA 3DMDA 5JZBA 1UMBB 2CHGA 4LZWA 2CLHB 2B36A 2XMGA 4OPMA 4XYMA 3IP3A 3OZBA 3U7GA 1P45A 2FW0A 4Q1CA 1SIWA 1TM2A 2WHPA 1NJ5A 1T91A 3KK0A 3MRVA 1YQQA 3AHEA 4NHOA 2D62A 3T6KA 3GQBB 1K27A 5B58T 3TOVA 1W2GA 2Q99A 2JD2A 1B26A 2QI9C 3BXOA 4LEIA 4AD8A 3OLCX 1ZOOA 3GVHA 5DNVA 5DISB 3BE4A 2HLDD 3LOQA 1AKUA 3D4PA 3HZZA 2JS7A 4P8RA 4DMFA 1DFHA 4W99A 5WRFA 1UJCA 5A3SA 5EJFA 9ATCA 2I66A 4X63A 1FRFS 1UC9A 3W4IA 2VK2A 1RACA 1P5ZB 1DCMA 1P80A 4NABA 1ZCAA 2QB5A 2XUAA 4OLHA 1JQJC 5EXSA 4LDPA 1SUAA 4K6MA 2JCXA 3RYCA 4MYUA 2B7LA 2IYAA 3RUIA 4F85A 5KMGB 1RADA 3D6HA 4QO7A 5IH7A 1P73A 3O7WA 1VM6A 4JI3B 5JCPA 4LVUA 4WWHA 3Q0TA 3KALA 1ZH6A 1JHZA 4FGLA 4LI3X 2RGWA 1WUTA 4XYEA 4DCNA 4TV8B 3EJWA 1CWUA 1JJBA 3O21A 1JIQA 5IYZF 1WVGA 2CUZA 5CLLA 5EP4A 5JCJA 2MWMA 3I0NA 5PGMA 1DKOA 4WESB 3WIVA 2J30A 1ABBA 5KSPA 2PJRA 1OWLA 4ADSG 4UU8A 1XEAA 3EVZA 3NBFA 3OJXA 5DZSA 3AHJA 2OHIA 4DSZA 4CEHA 1ZMBA 4G0UA 2F1IA 3Q1KA 3ZPXA 1KO7A 4N6OA 3HY4A 4XGKA 4UOQA 4KIWA 1XGKA 4BFUA 2PX6A 4G86A 2ZGVA 4W4TA 5TY0A 1CS0A 3FHOA 4EPRA 3T9CA 3MJSA 1DMRA 4G97A 2VATA 3DLTA 5KOJA 1A4XA 1Q14A 1Q0HA 2QJFA 2V5AA 3MS4A 4AYWA 5E3HA 5BSKA 1NVDA 1PZHA 3G3EA 1V43A 3IBGA 4MVJA 4P7BA 2V9ZA 3DB2A 2O7VA 2P3OA 4QA9A 3UV7A 1PJTA 5D2CA 1R6UA 4BWVA 2ERYA 4Z4CA 1V1RB 4V2UA 3TL2A 5AQ1A 4MUEA 5LQDA 1ATIA 4QT4A 5M34A 1RWKA 4C7BA 3BD9A 1G4UR 1CD5A 3X1WA 2CBXA 2WM3A 1P1CA 4M0LA 2AG1A 4Y0VA 2H0AA 5D85A 1R66A 4AY6A 2ZBVA 4GSYA 3N75A 5EIEA 3AW9A 2P9BA 4ZQCB 1A2BA 2ZJ7A 5E9JA 4DXDA 3NPMA 2B25A 1T9AA 2V7WA 3BFPA 4URHA 1XZGA 5CYPA 1Z0SA 5GY7A 4DPMA 3RF6A 1NGSA 2I55A 4QDZA 2BVNA 3NV9A 1SB9A 2PGOA 2IPLA 1G21B 1XFDA 4LMAA 5DHUA 3W5DA 2HMSA 3CRVA 4HB3A 1FRVA 3QXXA 4KO8A 4OHVA 1UMCB 5LQMA 1QTIA 3IV7A 1GTG1 3I1IA 3MMNA 3OSUA 3G85A 2I22A 4PPNA 1GUDA 3NC4A 2HREA 4IIXA 3WWEA 1VJTA 2JK1A 4QOHA 1RI3A 1PQWA 1W8IA 4M54A 2ZSDA 3DV9A 1R88A 2GK3A 3BJZA 3JVEA 3FPEA 1FTNA 4AJLA 1EVYA 1GAQA 3I8OA 2W6QA 2D7CA 1PG2A 2FUKA 2P5YA 3I32A 5ECYA 4JY7A 3JZFA 1X0VA 2ZWAA 4E7OA 4OLAA 3CGWA 4CEIA 4ZOAA 4IMRA 5FA6A 5A6VA 1IY0A 4CNQA 5JHHB 2CLLB 4AUMA 1FP4A 3CA8A 1X7DA 4RMIA 3IEIA 1G3IA 4B85A 4ZKDA 2HHHB 4OK6A 3M1IA 2A58A 2FNAA 3OE7A 3C0KA 5DGCA 4YPFA 4H0NA 3TZHA 3KLPX 1RRVA 4YRDA 3ASUA 4P3KA 4TKVB 5KWVA 1LB1B 3M6LA 4IHKA 3D3KA 4M99A 4TTQA 4ZKEA 2OUKA 4EK9A 1QQ6A 2CHFA 4MUJA 2C7PA 1SXIA 4H0FA 3DMYA 4WCFC 3N0RA 4MKHA 3PPIA 4MI3A 4EL5A 5BT9A 2RK3A 4LCJA 4LG1A 3EGDB 1A2KC 1PQ4A 1FBNA 1VG0B 2E5FA 4LRYA 1A2OA 3H1EA 3ZU3A 3O4RA 2YFYA 2EJBA 3IOEA 1SQ6A 7MHTA 1JLHA 1EJ6A 2YJ4A 3GRVA 3OEYA 1EQAA 2YWGA 1SU8A 4B6RA 1MORA 3ZQUA 3RIXA 4DSAA 4B17A 2I6FA 2VNKA 3PRJA 3K0FB 5CM2Z 3SVTA 4L8GA 1JJIA 1EIZA 2NXEA 1ZDMA 3RC1A 2Q3JA 4TWRA 2D0IA 2CYCA 4Q03A 4WGFA 1LTHR 3TQOA 4ZEVA 2MIIA 3C3CA 2XCLA 5IKPA 1HR0B 2D6FA 1I6MA 2HDNB 3NBZC 7YASA 4C21A 1XE3A 1LCIA 1DIHA 1TU0A 3GJ0A 4GVLA 4LFBB 5I9BA 4MYDA 4BLOA 5K0BA 4KQGA 3LY7A 4N7JA 2W8ZA 2OCYC 3OCWA 4JENA 4QGHA 1MZPA 4HRVA 1M1UA 4IH4A 4QFDA 2XBMA 1ZINA 3LS2A 5B3KA 3M89A 2ZQYA 1LLCA 4O3FA 2PQ2A 2E7ZA 1V6SA 2CVZA 3MJVA 2DECA 2ENUA 3R9KA 1K75A 4B0PA 1ZK4A 3H0CA 1JKIA 1PR3A 3DEIA 4B3RB 1P6XA 4HLUA 1F9EA 2RAUA 3PIRA 3MTQA 3I2IA 4PW0A 3QGMA 3ULKA 3TR0A 4NU8X 2YCLA 1YMVA 1MAHA 2W2PA 2D4HA 3RUAA 3NHSA 1CRPA 3Q8XB 1N5KA 3IIIA 5TR9A 3VDRA 2I2CA 4JI5B 4CQMD 1D4OA 3BH6A 4QU9A 4DFDA 4S1NA 5DM60 2J46A 3G2OA 3I28A 2O2IA 1N6KA 4JT8A 3I6BA 3E3MA 4UM8B 1JPVA 2QTCA 4ZZ3A 2JAWA 2VJAA 4CQNA 1MOQA 1U3FA 1V3VA 3N2KA 3ZU2A 4DCSA 4KXYA 1T1JA 4RKQA 1RS0A 4AJJA 4PC1A 3RFCA 2OZVA 2GLXA 2VPWA 2Z2KA 1B15A 1YMUA 1ZI9A 2JGNA 1XTTA 1KYIA 3I6ZA 3LQRA 3TX6A 3EWIA 4TTAA 3A05A 1GSAA 1G8AA 1OI4A 3AF0A 4U5XA 1XZDA 4IIGA 4YRLA 1C30B 3EDQA 3FZNA 2I6GA 3G9ZA 4LZPA 3B1XA 4TXJA 3ZU6A 3X1MA 3O2SB 4FZ5A 2J4DA 3KEQA 4PQGA 3DL2A 4BZWA 1RLOA 2AXQA 2OCPA 1P0FA 4X41A 1NN0A 5DN9A 4FI3C 1BS1A 1PL6A 3K1AB 3WGLA 2FG5A 1RMTA 3V3KA 1MV5A 1BE8A 3IMKA 3ORHA 3Q7EA 1RHKA 1Z0IA 1V5GA 4KP7A 5KWEA 2DT8A 3JXEA 2VDUE 5T8KC 3IURA 4BRSA 1QR2A 3FTDA 2GJKA 1KK3A 3V2IA 2KE5A 3GB9A 3GC6A 4GXTA 3WLIA 4D46A 5KNCH 1ECBA 1YZQA 4QOEA 3RVRA 1FVXA 2CHVA 3O9MA 1QFYA 3EG9B 4JLMA 3FTNA 3V4RA 4LHWA 2EFHB 2XI4A 3ABOB 2HJWA 3RC7A 4D80A 1N1MA 1DNPA 1M2VB 3NTQA 4RW0A 2E5WA 3P9ZA 2I99A 2X6QA 3CUWA 3EVGA 3HKDA 4WFKA 5E6RA 2QQ0A 1SHTX 2XUPA 3AVTA 3LOUA 4PF1A 3V48A 1E6MA 1FS4A 2I62A 3RREA 3JQ8B 3FCXA 5KOYA 2AFRA 5FRDA 4HQ0A 3QXCA 4NJEA 4PHHA 3ZHYA 3ZR4B 4E09A 3P9RA 2GEKA 2CNDA 1Q3HA 3PHBE 1JEQA 4G5YA 5HOQA 5HS4A 3CLUD 1CUIA 2QEQA 3ZTTA 4F84A 1TQ8A 5F12A 3T7EA 1JYEA 1L1RA 3EXFB 3G1UA 3OH8A 4W5HA 4W8HA 4ZEWA 1I2AA 1Q0RA 3C3DA 1SXGA 5FWXA 3WIBA 4NTZA 3GRYA 2VHVA 1ZVJA 2PRSA 3DE4X 4EA6A 1KHTA 4JVMA 5GM1A 1OTXA 1GA6A 1XF9A 1ZGAA 1YVDA 3G79A 4UU0A 2B30A 1GITA 1ZWLA 3DL4A 2P67A 4AQDA 4M0UA 4M9SA 2XLCA 3E3OA 1RQRA 1GTMA 3GWZA 3KPYA 5C0OE 2Q2OA 5EJ4A 2R6DA 2BEUB 3MD9A 5IHPA 3TW6A 3DPIA 1M9NA 1E9BA 1X1SA 2D1QA 3C5WP 3CTMA 4G25A 3TUIC 4CIDA 4FXPA 5J47A 3VO2A 5B4TA 1U02A 2I3GA 2VP5A 4BQSA 4MQFA 2YBDA 5LM3A 3SOPA 3THRA 5FIUA 4BBPA 1NJ8A 1E3LA 1JDVA 1Y1QA 3R6GA 3RSQA 3U1TA 2I34A 4MPPA 3J81A 1N5DA 5F1PA 2Z3ZA 4NYMR 3N07A 4BMPB 5BSMA 4BNUA 3QYFA 1TOAA 1E9AA 1HE3A 1V8DA 1NPTO 1Z0UA 4R7TA 4UBOA 1QVVA 2NXWA 2B83A 1NXSA 1G18A 1HGXA 2A0WA 2HJVA 3LV8A 2HZ7A 4DQUA 1R64A 1W6UA 3WRYA 2FSPA 4M1EA 4WBNF 3H4TA 4KGDA 3C3YA 3O84A 4MWDA 3RR2A 2HF2A 5G0TA 1WSDA 4U6SA 3LXXA 4JVNA 1C1XB 1O5IA 4GOND 3U4GA 4BDTA 4C5BA 4EABA 4M98A 3VJLA 2QR5A 5HKBA 1NATA 3D7LA 3LBNA 1DO0A 3QLVC 4PZUA 4YWHA 4AX4A 1JALA 1T4MA 3L8CA 1YE3A 4LQDA 3W8FA 1F9AA 1ZK1A 2WSBA 3R7BA 3MM4A 4HPJB 4TL9A 4IIBA 4D4JA 1P17A 2NO5A 3KYBA 2J3KA 5AWFC 1J00A 5DNYB 4C2TA 2ZRHA 2HEIA 1O7JA 1BD4A 4UTOA 4JLPA 3MG9A 2IGTA 2ZRKA 5CCDA 4R9VA 3TK1A 4YN3A 3OG9A 4P84A 1Z6ZA 5KDDA 1RCTE 2DUJA 2OBLA 4IIJB 1G59A 1G7SA 4QXRA 1SIBE 2ZQ5A 2QN2A 3AU8A 2AXNA 2IF0A 1RQLA 1MOSA 1X9GA 1DJMA 4D9GA 4H77A 2M1ZA 1DAIA 1Z18A 2P35A 2UAGA 5IK2A 2JGJA 3EXHB 4M7RA 3UB2A 2PNFA 4EY4A 2IH2A 5BN4A 4FCVA 2EWMA 4R3UC 3GZNA 4HZUA 4AG6A 1XDUA 4PC2A 3V1LA 4D2IA 3M6WA 4D8VA 4IJ5A 3HRIA 3VGPA 2O2HA 3EWAA 3OLYA 4FYIA 3RLIA 1D6SA 2WEKA 3FNEA 3C14C 2RHHA 3R3ZA 4PRKA 1QIGA 5HBRA 3L1KA 1QSGA 5GJVC 3T4EA 5JC8A 2Q5HA 3IEXA 4TQAA 1L5QA 2GM5A 2PX2A 3HDHA 4FKMA 3TBFA 2X8WA 4AY3A 1DRUA 3KZMA 4Y8VA 1QKJA 2R1ZA 4PGAA 4RJJA 3U9TA 4LSGA 4JKOA 1N3LA 5FBRB 5A3QA 1C0LA 4YDSA 2R84A 3I5MA 1Z88A 3BMOB 3WWOA 2HCJB 4H7FA 1RFLA 3IUEA 2QJTA 4TS1A 4WL0A 4U7WA 2JANA 2YFQA 4EG3A 2WG2A 4ENPA 3FM9A 4C3ZA 1YA4A 3L8EA 4QPPA 4RE5A 1OXKB 1FPQA 1NE7A 1S8AA 2IQIA 3LUKA 1OREA 2PMKA 2Z58A 3L1JA 4B74A 1SELA 4BJ5A 1OU0A 1YI1A 4JYPA 3CVJA 2FP3A 3HCFA 4WFQA 3JZIA 3OVMA 1VYHA 1M2WA 2ZKIA 3QU2A 2GAIA 1H0RA 4XLZA 5ALNA 4KTVE 4ZQEA 3R8XA 4R7ZA 4A8JC 1HQDA 1O94D 2QX6A 3C8ZA 5I51A 4R2HA 5HNKA 1YDMA 2QL7A 3LLUA 1X3LA 1Q17A 2G83A 4ABTA 5ED0A 1NJGA 1XDGA 5T4EA 3KQHA 5TC4A 3G2JA 1JSCA 1LGYA 3B6ZA 4K40A 2QORA 2I6QA 2Z6QA 1UBRS 2R7AA 4IUDS 5I7UA 3IL2A 5AW2A 1OH5A 1IXSB 4I4IA 3UK2A 5AJWA 2JJMA 4G5XA 5U1PA 1U1FA 1Z4PX 4FGWA 2ZIVB 5IF3A 2AN1A 1H5QA 1MJ5A 4F2DA 2G04A 3AI7A 3L8MA 3DEKA 4ZPXA 2XTNA 3KZVA 4A1OA 1A9OA 2WWIA 5EXXA 1SHKA 2EX0A 3WP0A 2AMJA 2WFMA 3IUSA 4R3NA 3ZGOA 3ZJ5A 4CHGA 2Y1LA 2DEUA 3UENA 4FT2A 3EISA 3C2QA 3WYEA 4LX8A 1XAJA 4Q4JA 3L1IA 4JYMA 3ENWA 3V9PA 2RGEA 3FYUB 2ZR8A 5CGZA 5K3OA 4LPKA 3HPRA 3KE9A 4LJAA 2X0DA 2C61A 1CNMA 4NG5A 2RCYA 4BV2A 3L6BA 2R4UA 3OZWA 2BGWA 1VYUA 3FHTA 1C2TA 1O8BA 4ND1A 1ZK3A 2HIAA 4YTEA 4YCLA 1EUDB 1C41A 1YZKA 3RT7A 4Z53A 3R6WA 5JNTA 1RHQA 2QRNA 1D5WA 4K3VA 4C7VA 1HORA 2OV6A 5D5PA 4N5LA 2MYTA 4AG5A 3E27A 3GGGA 5BV8A 2P77A 5DP1A 5T4BA 5K45A 5FH9A 4YPOA 2EGGA 1FFCA 1TYDE 5EAIA 5F3RA 4PLZA 1NBME 2VHCA 3RS8A 2HWUA 4D81A 3KB1A 4MGIR 4DM4A 3BDAA 1BXRB 1EWRA 3IQHX 4JCCA 2C2WA 4K6OA 4C6TB 3W2IA 4A2PA 2IS2A 2R6AA 5KPJA 3L79A 2ZWVA 3HGMA 1XVVA 2V45A 4YNBA 3UKDA 3KIPA 3FWNA 3SZGA 3IAM1 1D2AA 3OOHA 3ZKWB 3CE6A 4DCOA 2IW3A 2PZGA 7REQA 2Z8XA 3I9FA 1CJKC 3NU1A 4D9EA 2YV5A 1S2LA 4CIXA 4I7EA 3X1ZA 4CCYA 3L6CA 2PZMA 2X6RA 4KK3A 1IY9A 2JI8A 2BFWA 2J9ZB 3L9XA 1E3JA 1QOQB 2OSVA 3NORA 5JAUA 5FWDA 1L4HA 5FDFA 1WSAA 3KYCA 3A1DA 2HSWA 1WL8A 4M9UA 3OY2A 3EA5A 1Z2EA 1RYEA 1H2ZA 3QU5A 1WW3A 3KFXA 4WJLA 1TADA 1KQFA 3ROPA 5SYMA 3B9RA 4PFSA 4IJVA 1XKXA 4FSDA 1FLNA 5KS2A 3O7MA 3V8RA 1AN9A 4QT0A 1T9ZA 2JCSA 3CH4B 5IAEA 1HDCA 5LQNA 3ZUGA 5CT8A 4JC5A 3FJ1A 4GP7A 3QX7A 3IMGA 3WGTA 4MICA 1CUXA 2FX2A 4XOIA 3TQHA 4CQLB 4OJKA 4II7A 4AF7A 3RWBA 3JTMA 4Z7NB 2PA3A 3H5IA 3FWYA 2SECE 4I99A 5BRJA 1O96B 4QRIA 4BC0A 4CG3A 4LI0A 1E8NA 1QO9A 2H1RA 3UG7A 3HKBA 4QTZA 1DBPA 1QV9A 5AXCA 3D5TA 2NZYA 2ZK7A 3LVQE 3PHLA 4RV4A 3IP9A 4ARZB 1W4ZA 3R0JA 1J7JA 2F1RA 4Q7JB 3CLSC 4IOMA 1J8VA 2XMBA 4DCGA 1AO3A 4PO1A 1LRJA 1RI2A 4TTIA 1N33B 4MZDA 1MVLA 4EW1A 1M2KA 1UDWA 2W11A 2EJUA 3H5WA 5SYNA 3AB7A 1N2XA 4JMLA 3U3JA 3EEFA 2ZTUA 2YRFA 1W0CA 1CSEE 5JNLA 1ABEA 1XN4A 4HP8A 3KWLA 3PWTA 5JY6A 5DMHA 3MWLA 4KDRA 3ASZA 3HFSA 3SQDA 1WLSA 5HKLA 1XJ5A 1SC1A 2GN1A 3D0OA 4D3XA 1NBWB 3VR5D 5HRCA 2D2IA 2H5JA 2YWXA 4RHEA 1GY8A 2XWSA 3P0EA 1AQIA 4L0DA 1YKFA 2NYVA 4E5UA 4XDYA 2O5RA 3OIFA 4OG2A 1T1SA 4ZA2A 3KLOA 3RSCA 3F8TA 3N74A 3JALB 4TKMA 4GMDA 3STYA 1S96A 3OEHA 3DVRX 3C1UA 2ZR7A 4FOOA 4NOLA 4QGSA 2Q5OA 3PHCA 1X86B 2C0CA 2FYTA 2NT3A 1Q7RA 3TD2A 2YY5A 2GJ9A 1SG9A 2OXFA 5DGXA 1YK1A 3S28A 2QYHA 3GRPA 4N1AA 4CLRA 3I1JA 1L5GB 1JMVA 1KKUA 2QK4A 4Y3UA 4ZCLA 3VZRA 1TZJA 4FNOA 1ORWA 3HVJA 1U6JA 1IWOA 4GLOA 4TYYA 4OL0A 4BE4A 5KNDH 1ORIA 1U8YA 3O4GA 5AXBA 4ZCQA 2GEDA 3F98A 1T3GA 3QKWA 1AUVA 4Q4CA 2N47A 3OC6A 1KNXA 2G9UA 1CQJA 3QE0A 2QUKA 1T36A 4NC9A 2XT0A 2VT3A 3QEMB 3KLBA 1GCGA 4P08A 4FFPA 1YKSA 3MCUA 4GSLA 5ALVA 3EPHA 2A9VA 1WB5A 1BMFA 1N7HA 1YA8A 3GJQA 2YNMA 1D2EA 4CFYA 4OATA 1X7WA 3NHKA 1YZYA 2O52A 3QF4A 4TLLB 1CVIA 1R4MA 3AUYA 2PYZA 1KYTA 4HDMB 4JR2A 1JLLB 1XZEA 2VZ9A 3ZV7A 4GXNA 2J9FA 5AM0A 1XJCA 3BXFA 5ISMA 5G2OA 1BDMA 2C8VA 3H2IA 4PSDA 1HQYE 3H1PA 1ZGHA 2WU0A 3W6OA 5EP2A 3WDLA 4LRXA 3O4IA 1OKKA 4X3CA 3ZH9B 1DTWB 1J2JA 1E64A 2ZIXA 1DAGA 5DLPA 3EW9A 5AMXA 3DLBA 1DQRA 1QHNA 2W2OA 4L07A 2ZRJA 3REQB 3DNFA 1X19A 5SV2A 3AR6A 1YNSA 3PQ4A 4NENB 4AECA 3T9BA 4UQLA 2LW7A 4XFDA 3GIWA 3ZS8A 3HWX1 4MX8A 2JLUA 5BN1A 3ZDQA 2RMKA 4MA4A 4PQYA 3K1ZA 5FNZA 2ZUUA 3C5CA 2MSEB 2Y6VA 1ZGBA 1DC5A 2ZUBA 3CZ9A 3LM8A 4U8GA 1KTIA 5D3MA 1A5SB 2BRUC 3VR5H 4I1RA 3IODA 4MYCA 4C2UA 1QRDA 1SA0B 4KI0A 4MVJP 3FRHA 4B83A 1YB5A 4TZ0A 2E6UX 5AW5A 3N8HA 2IXDA 1U4NA 4MV9A 3OZEA 2AHOA 4V0ME 4UMDA 3ONNA 3AKYA 3PC6A 3SEAA 3U7QB 3JAWB 3KJIA 2GPWA 2VS1A 1KO8A 4BV8A 1WMDA 2WVAA 3OKPA 4Z0TA 3TJZA 4URVR 2FDCA 2D8MA 1HFJA 2HLNA 1UAAA 2DHCA 4OXIA 3K8QA 4OI2A 3WNDA 1JZTA 4H27A 2Q6OA 1BA2A 2WF6A 3E6AA 3K1YA 3FTPA 4HDQB 4K9LA 4P58A 5B4VA 1O97D 2H54A 2MMGA 4N5NA 2FJUA 4J76A 5FTKA 1EB9A 1TT5A 1RM5A 3CPEA 4P3OA 1NXQA 1RP1A 5EMJA 2OQ2A 3BWXA 4K9DA 1QCDA 1GGNA 2JDID 3SY8A 4BVGA 3DHWC 2VN8A 2O0KA 1MC5A 1A5TA 2OHVA 2QX7A 2WZQA 4JGBA 3M81A 4NAVA 5CLFA 5BMVF 2VJNA 2DH5A 3KPUA 2P68A 2TMYA 3AG6A 4UVDA 3D0RA 3DXYA 5LSAA 3D81A 3RK1A 2X22A 3RG2A 3WY9A 2ZIGA 4L27A 3TEMA 3VU9A 2YMMA 2XOKD 4PXAA 2VPXA 3WMGA 1BIFA 4EW3A 1PX2A 3V9AA 1CUAA 3DHEA 4TL6A 2CB0A 4AJIA 5CLGA 4NWIA 2A14A 2G1KA 3QZUA 4KCGA 4DAOA 1RQ2A 3KKNA 2QXUA 2FCAA 1NUQA 3E9EA 3H7AA 2NSLA 2PPLA 2QTLA 2QY6A 4URYR 5F23A 3OQOA 1A8PA 5L8VA 3PPYA 4DW8A 2OQVA 3JARA 3D4NA 1KRHA 1NMYA 4G85A 1A8UA 1J2EA 3TJMA 4NH4A 4JQSA 1UFOA 2ZM6B 4X97A 3HCWA 3W04A 2HHLA 1CUSA 2WTEA 4O5OA 3EZFA 2B1RA 3NYRA 4NOKA 4YK7A 4CV3A 4OA8A 1KGDA 3L3BA 4YCJA 2NZJA 1ZWKA 3Q6IA 1X94A 3RRYA 1ULAA 4PO9A 4WEOA 4C03A 3U17A 1XQ6A 3GCWA 1W5FA 4C05A 4NPAA 4ZAVA 3KXKA 5LLDA 4Q1AA 2QNRA 2SICE 1KZ1A 1NMEA 2CFOA 1CJUC 3UAOA 4LYYA 4BEBA 1ZJ4A 5KHAA 4RH3A 5LBIA 1Q2XA 2BFDA 4E4TA 1U0JA 1I6KA 1PR4A 3S7ZA 1WJGA 3SQMA 4IDPA 3ZZ0A 4EO4A 2H85A 4RM2A 1R1DA 3DZ8A 4X1IA 4DMHA 2PZ8A 1EIWA 1Z9BA 5LMNB 2DPMA 1NDQA 4JXKA 1MN6A 5T67A 3AFOA 3VJMA 4ZFNA 4UM9D 2HQOA 1G2QA 1AE1A 1ZCZA 3ASYA 3EH2A 2QW0X 3BL5A 1IRXA 4L7VA 4D25A 1EE1A 3VDNB 1TVEA 3PHJA 5ENDA 3N0TA 5AJUA 3JD0A 1NX6A 2X0KA 4YMLA 4I1OA 3R41A 4NAUA 2J5BA 4CF7A 3OIDA 4CDMA 1V4VA 5HQTA 3COVA 3S1LA 1XQXA 2I71A 4PC6A 5F5XA 2D5CA 2NYRA 3LUPA 5KEIA 1CQPA 1PNQA 1XL1A 1E1QA 4HH0A 5HIKA 3ZJTA 2FPLA 2WU3A 1Z26A 1G4HA 4YYZA 3N2ZB 1GYRA 2HA5A 4TRNA 4BX8A 3IKJA 1BGXT 2GM3A 1QJ4A 4F6RA 3EQ6A 1X9IA 4C3OB 2MSWA 3B1ZA 4HGOA 1YJ8A 1Q1EA 3M6XA 3P26A 4NNOA 2NTVA 2XUDA 1T9GR 1R9NA 1SCKA 2RFLA 4HLQB 1X14A 4RMGA 3KT8A 1NU8A 4EA9A 4IV8A 1NVXQ 1VZ3A 4PSUA 4QTXA 4KOEC 5A9RA 3A9RA 4RQBA 4ZVVA 3BXPA 2FOXA 4V1CA 5JSHA 2XVYA 1UBJS 4JASB 3PJGA 2P9ZA 4CDGA 1NSYA 4EI7A 5B6PA 5KQRA 2DULA 2I8AA 3FWZA 4U2EA 2D4AA 5K0EA 3NBUA 2V8BA 3OMLA 3OWOA 1KI1A 4NOJA 3IJPA 6REQB 3C6QA 1IHDA 4MK4A 3FCCA 2PKYX 3W7BA 2VQ6A 1NZFA 3VU1A 1ZI6A 2FSSA 4OU4A 4S05A 1AXRA 3ZXSA 2D1SA 2I4TA 3FIJA 4YMGA 4C22A 1JHXA 3H1TA 4HH4A 4DLTA 2C1ZA 4DRZA 5H9WA 4YJ2A 4OUDA 2W00A 1QC5A 2Q49A 5K8JB 4KC0A 3NOXA 3A4YA 1NDHA 1YZTA 1RJ9B 5TT1A 2XUQA 2ZSUA 3OLVA 2CJFA 4P7KA 5DGDA 1U3DA 1YKGA 3S1SA 3FDZA 1PW5A 2DT5A 4LFAB 5L51A 5K3FA 4PANA 5AD1A 4JVOA 1UUFA 2YZNA 5ALWA 1FY2A 3QLTA 4BGUA 3DS8A 4DLWA 2JFUA 5G53C 5EKSA 4B5LA 4TGLA 2AR9A 5A06A 4HWOA 3C74A 3FVTA 4ZI5A 5LDGA 1AKRA 1BOOA 1BS9A 1ZKMA 2I2XB 3DTNA 5HMLA 3VSDA 3AU9A 2W37A 4P35A 4DR5B 1MOPA 1VLHA 5ANRB 4ALNA 1X1TA 3CEMA 4WXHA 3TS1A 4Q16A 4OMCA 1M6HA 3KKQA 1QFZA 3WV4A 1N9KA 3A32A 4Q05A 2Y8EA 1NASA 4OXNA 5HQJA 1KWKA 2F67A 4C1NA 1CIJA 2GN4A 2YZ2A 3KUUA 1E6LA 2CDAA 4YCMA 1RC0A 4FYVA 5K4GA 1KS9A 3HB9A 3G6KA 4FYYA 1GOTA 5GAJA 5T8KA 3GGSA 3NP9A 3OQ1A 1CY0A 1RU3A 4NOMA 2PWAA 3U81A 3E3LA 2J1LA 2XUHA 1Q77A 2W0MA 3RS5A 3G0HA 3H5OA 2H63A 3MUOA 1CQIA 3HXPA 4HRYA 4KVAA 3RH0A 3GMIA 7ADHA 1OFUX 1NL3A 4IDHA 3GZJA 4FDTA 2QD1A 4ER5A 3KTOA 4M87A 2E18A 3DZDA 4XVUA 5H16A 1I36A 3BDVA 4O1HA 1L7EA 1RBZA 4GUDA 4Q37A 2ZBGA 3EXEA 5KTMA 3PEWA 1B73A 3W6UA 1E63A 1E9DA 1KJQA 3DBRA 4ITVA 3SXUA 5I7HA 5F3WB 1ZC4A 9LDBA 2P90A 1TUIA 2GWHA 4JV5B 1Z17A 4DA9A 3DW3X 4GPTA 1PYGA 3KDAA 1ZOLA 4AJEA 1FBTA 1TTPB 1RWPA 2OHXA 3L05A 2OZLB 2HK8A 4I55F 3F2IA 1U2DC 2VCEA 1JHPA 2ZLBA 2NU8B 1Y48E 3H6HA 3NYQA 2BGNA 4QHTA 2X0EA 3FHLA 2QF7A 3SD7A 3TNFA 4WZZA 4N76A 1SURA 1DC3A 5KCMA 4AG3A 2AG5A 3F6RA 2FF5A 4N5IX 3ZWQA 4Z1OA 1F2UA 2V7TA 1SQFA 5J4HA 3INYA 4FQ7A 3HO1A 2AFHE 3AI3A 3GHYA 4JH0A 4WQMA 1OCEA 4MXDA 5L4LA 2G1UA 1Z7EA 3UW1A 2BCJQ 4HX2A 1NLYA 2C4VA 3ZG6A 1RTTA 3WADA 4EO7A 1QBGA 2YHIB 2W42A 4QXOA 3HEBA 1NXPA 3CF2A 4GVXA 4MGYR 3R5FA 5KWJA 2QY9A 4Q82A 1E2PA 1J24A 1RI1A 1E99A 3KPWA 2H17A 1OVMA 3LT2A 3VH3A 1HNNA 4TVOA 5BWLA 1QE5A 4DV1B 3O82A 2Q3CA 1COWD 2NNWB 2BH9A 3QVGA 4HSEA 1K0FA 1H0SA 2BHRA 3DKIA 4J9VA 1CDDA 1PS9A 1E9RA 3DF9A 3NHZA 3E18A 3WFIA 1MR3F 1I3CA 3LX4A 2XWPA 3NTXA 3QNUA 2JLSA 2V96A 4FFNA 2H1IA 5ALZA 4CT5A 3TTTA 2EEPA 3MS2A 4XM1A 5FFFA 1Z7WA 1MA3A 5FI5A 1XT6A 3CX6A 1I7DA 5A7HA 1EQ2A 5CEJA 1HNXB 1U0LA 2JKZA 3U4CA 5DM4A 1SG6A 5JNUA 2BI8A 2YZMA 1U0HC 1YR3A 2GD0A 2B2CA 2YVAA 1GPJA 5JNSA 1S3IA 4RU1A 1DFGA 2D0DA 1G8FA 2YVLA 2Z56A 5TSDA 3X1YA 1KDTA 2XAAA 5AH0A 1EVEA 3QLVA 3CV3A 3G8DA 2R6JA 4JBXA 4CKCB 5HUJA 2VK1A 1JT9A 2XNDD 2ZT6A 3G13A 3HHPA 3M1LA 3DAGA 4J1NA 4M0EA 4A0SA 4DMMA 3ICEA 2O1SA 4MP8A 4HLNA 4CM1A 1E5QA 2YZKA 1ARZA 3L8DA 5C32A 2PS0A 3HDVA 4AZ3B 1A9YA 2WINI 4PWYA 5DHFA 1US8A 3PS9A 2XQGA 3EVBA 3EZ6A 3RQSA 1R4NB 3PDIB 4P34A 5H9VA 4W1PA 3TVDA 4UNPA 1NLUA 2B78A 3QI2A 3ZWWA 5KTTA 3D6VA 1XXHA 4A8PA 4GGMX 3LWBA 3PTLA 3M5WA 1ZY2A 1J0XO 2R8YA 3WGYA 2DQYA 2RHBA 3T3PB 2Y05A 3NT5A 5DNWA 2IU0A 2GCPA 4NE2A 3EQZA 3ILYA 3D5EA 2PUGA 3IQGX 4ZYYA 2BFMA 3RT1A 2NT4A 3OICA 3PP8A 2QN9A 3BHMA 3Q8LA 3BKXA 2FWMX 2O8FA 3PITA 1NOIA 1F0PA 2FGJA 2H1LA 2Y4NA 4HY3A 4B80A 1ST2A 4FFBB 4YCBA 1GFWA 5F9MA 3G2PA 3T5DA 2DSNA 3ETEA 5IF9A 1L6RA 2C42A 1N0WA 1OAOC 1E2EA 3L1UA 1JA1A 2CWWA 2F3UA 2X19A 3IB3A 2J32A 4M0MA 3JZMA 2X42A 3QW4B 1F3OA 3I72A 2VXCA 1RSZA 3GG2A 3OEWA 1X3SA 1W88A 4G8BA 4TWJA 3TFQA 2F4VB 2CSUA 1U4SA 4OYYA 3WO0A 1VRVA 5DW3A 1OV4A 4L57A 2VC2B 3C4VA 5BR7A 3AO0B 3MERA 4FIZA 1SXPA 2XXAA 4CTOA 2BC9A 2XD4A 4WLNA 2DWUA 2X1MA 4DY4A 2RGRA 4OJQA 3KYDB 3CGGA 4B35A 1JFLA 3E5RA 2PUEA 3OZGA 2VTEA 4CI9A 1XLWA 4ZK2A 2V97A 1CUVA 5AM4A 2HRDA 1XRLA 1XPUA 2I6TA 4ECEA 5FHQA 1NXOA 1PI3A 2QD4A 3ZEIA 2IBMA 1LI7A 5LNK6 1BEEA 2CVFA 1Y9EA 2EIHA 3JWHA 4IJWA 4BQEA 1JHVA 4A8JA 3LU1A 5K3SA 1IOVA 1JB9A 2H5IA 2J8ZA 4Q34A 5FLYA 3IJ5A 2A5GA 4HN4B 4XARA 1QNFA 4DT1B 1P5RA 2EJWA 1PCXA 3NIGB 3VH2A 2IELA 3SZRA 1GGJA 1KPIA 2IYSA 5HBGA 3S81A 1PDWA 4JQOA 4TT3A 2AW3A 4RZIA 4OKSA 3RHZA 1TYAE 2GTIA 3NWPA 2QRVA 4N5DA 1JEDA 1RLMA 3TZ6A 4UUAA 5CVVA 3K4QA 3O8BA 4KH0A 4PN7A 1S2OA 1RPZA 1COZA 3ZY2A 4H7JA 3VKVA 3AFMA 1KMHB 1J21A 4H7KA 3FHJA 3VO8A 5BSGA 4COOA 4ROTA 3BWYA 4C4AA 4Q9KA 2H3EA 2X8JB 2KHZA 4B9EA 5AW1A 1N32B 2RHJA 3SHQA 5EXPA 4B8ZA 1JMYA 4MRNA 1YE5A 4B33A 1EFHA 4L50A 4WKBA 3H0KA 1TC1A 2EZTA 3RVJA 1J25A 1N78A 4OM8A 3ZU5A 3N3BC 3OZSA 3VHQA 4DR4B 3VU0A 3E2PA 1N1DA 3RU2A 1KJNA 3L04A 4BXOB 3U37A 3ZOKA 4HB0A 4NDNE 4ZAXA 3S7TA 3LMKA 1P9NA 5EZSA 3L7AA 3G8YA 1TO1E 2EP5A 1ZUWA 3E9QA 1UKVY 3JSAA 4GI2A 1P3DA 1O95C 1QUEA 4D41A 4DQKA 1VLQA 3UMCA 5BPFA 2PUJA 2O1EA 3E2IA 2GTHA 4G63A 3T95A 5EWLA 5C8ZA 3C15C 1QPBA 4DYDA 4LN1A 4B81A 4BJ6A 2A5LA 2HPHA 1R8YA 4WOCA 3U4HA 1AGPA 2ZW9A 4PFJA 4RL6A 3VOTA 1UKZA 1SXQA 3C70A 3PHIA 1ZONA 4MQ5A 4RFSA 3CF6R 3ETDA 5DGTA 4XLTA 3WXBA 4AXBA 1J5PA 3GEIA 3BSFA 3O95A 3VDMA 2WE8A 3CUVA 1VKJA 4GAEA 3OZUA 5F35A 3TXXA 5B1IA 2Q5QA 4N48A 3AONB 2BBOA 2GPSA 3FPBA 3VX4A 1IIBA 4E5NA 5DK4A 5IJ0B 3B53X 4FYWA 3TLZA 2EHDA 5AJYA 2JFQA 4JWTA 1MAUA 4QYSA 5KBYA 3DDUA 2GNOA 3LP5A 1UMBA 1YDFA 2WMYA 3O91A 1I9CA 1CEEA 3CBGA 2VKTA 1T0PA 3WK8A 4AZ0B 5C4IA 1N2GA 3CLVA 3HMKA 1GILA 3RSOA 3EZYA 5AI6A 3MINB 2FPGB 3FNBA 3GQBA 4P38A 2EKLA 2F8LA 5C7LO 1M75A 4MV7A 1VE3A 4UHEA 2KB0A 5IC6A 1WUYA 2AFIB 4UUOA 3H9EO 2VQFB 1NLFA 3TR5A 2PYIA 3AIIA 1TUEA 5ABPA 4KI7A 1PJ8A 4R2LA 4TXHA 3L4JA 2I4RA 2M6KA 2HXGA 2JD0A 2Q2VA 1E58A 1VQ1A 4BE7B 1SVNA 3MMXA 1X13A 1RRGA 3TDKA 4DV0B 5COBA 2QZ4A 3EMVA 3V7YA 1K7CA 4HZGA 4XSVA 1RMQA 3IVAA 1I51A 3MBOA 4RMHA 5IYZA 1F8XA 3PQEA 4EATA 1HDZA 2A33A 3L18A 4YT5A 3WB9A 1SAYA 4A10A 3A9VA 4WESA 3FETA 3EAFA 2WWXA 4X5OA 1L7VC 4AY5A 3NWOA 1S02A 2QIOA 2XSZD 1PZNA 1TK2A 4DL9A 2PX4A 2WSMA 3PUYA 4NYMQ 3W90A 1HA3A 3MAJA 2R1VB 3IOYA 4LDQA 5H82A 1XRQA 2RBEA 2F1JA 5K0CA 3DH0A 3TI7A 1TJ5A 5KOHA 4AS1A 3ESAA 5EKUA 3BQ9A 1JXAA 2EP8A 3GGDA 4NL4H 3TN7A 2LR0A 4F3TA 4L9WA 5KOIA 1KDYA 4QBIA 3ZCRA 1PHRA 5JXIA 1AY0A 2QLJA 1BFUA 3JQGA 4NP6A 1KEVA 1RXVA 1DT3A 5FPTA 4HWTA 1ODTC 5JT1A 1RZRD 1R3UA 2X8BA 3SJCA 5I6DA 1TAQA 2ZSBA 2HRZA 4PY2A 2BFBA 2DC1A 4KXXA 2E55A 1WF3A 4FBLA 4UCWA 4UE3S 1V1RA 1L7XA 3DZCA 3A1CA 3LFUA 4IQGA 1FS5A 2X15A 3OBBA 2IPNA 2P9JA 4L02A 4MIYA 4PNZA 1F14A 1MAWA 1WVMA 2F3QA 3DFIA 4CLEA 3DHNA 5CM9C 3B7WA 1NPYA 2AK2A 4U6NA 4E2WA 3VKHA 4HUJA 1L4MA 1UZUA 1YOVB 1W7AA 4REMA 1YACA 121PA 3D2BA 1GFIA 2JIDA 3QKSA 3R8CA 4EVSA 1N4DA 1SU4A 4B45A 2G09A 2E48A 2CE2X 3G8AA 1K97A 2BZGA 4G1BA 4HOYA 5DE3A 4ZEOA 5JNRA 1EVKA 2YRXA 3QMPA 1S7CA 2J6BA 3JYLA 5CURA 4F60A 3ELBA 2WWVD 2A7QA 1KEKA 3I5XA 2GCGA 1QU2A 3CEJA 1U90A 4H4DA 2L0XA 4HHEA 1YI8A 1OX6A 2ALJA 4OAQA 5I8PA 3TRKA 3SJAA 2UUCB 3MJHA 4NEQA 2NAFA 4AMBA 2O5EA 3ANTA 4OQPA 4F3RA 3R20A 4POAA 5BXYA 4U39A 4NU5A 3JVVA 3CNOA 3B6MA 2WI8A 2IEBA 3GFPA 5D51S 3TEFA 4HTFB 1YJ5A 2IHZA 1B8NA 4MQ4A 3H2SA 3EZ2A 4UHKA 1F6BA 1G1AA 1Z3IX 3FSEA 4ZMRA 3EW7A 1N5IA 4MAFA 5J40A 5FR1A 1PAUA 5IT5A 2IYEA 2GZ2A 3G9TA 1IY8A 1V4NA 3AFGA 1GRVA 2Q6TA 4Z0NA 2ZRNA 3BUSA 5NLLA 4UHDA 4ZHQF 1R0XA 3C5VA 1XP5A 3EGEA 4O1MA 3HJRA 4C20A 2VDNB 2CLFB 2F48A 3EGXA 1G9TA 1G8YA 2FXVA 1ENPA 2FN8A 1T25A 3AUKA 2HMAA 3I23A 4XSGA 4Y1FA 4CXMA 3HL0A 3GUZA 5EJIA 4EPTA 3NHUA 3AEZA 3T4XA 4G0XA 5K3CA 4IFBA 2HHJA 1RC1A 5LD2C 5CITA 3DC7A 4BWGA 4OQQA 4TKVA 3FPLA 1N2CE 5JDCC 3SLKA 2NUPB 1M2NA 3KOXA 3QK7A 3O2JA 4LJ7A 2CXNA 1N8NA 4YT8A 2FUG6 3ERCA 1ZXLA 4V39A 5BRAA 1M34E 2MINA 2XNHA 3GEHA 3VNSA 1JPJA 3EGDA 1V8FA 4OK3A 5ALKA 2Y76A 1NE2A 1DC4A 2EFCB 1Q1BA 3T5PA 2YOGA 1KORA 4NBVA 4L7QA 1XTQA 3ICWA 3OE4A 3MLAA 4DCPA 4HWRA 2EF1A 3K0FA 5ITWA 3ROXA 2Q4OA 2XOEA 2BRUA 3R5HA 3RAGA 2WOJA 2P6OA 3SHTA 3KL2A 4CKEA 2D74A 4MS1B 1OF1A 1IY1A 4UHJA 2C4UA 1ZGZA 2XMPA 3EIHA 1IAQA 1ZX1A 2QLMA 4GQIA 3CLRC 1DTSA 2R1TB 5AKJA 1FP6A 3D02A 1F4PA 1MQ8B 3ETLA 5BQ3A 1IN7A 2GPBA 2BDTA 4ILKA 2CL6X 4IVPA 4NYJR 2B99A 1YU9A 3DXZA 3WGJA 5KKNB 3C6MA 3RC3A 1QHFA 4B47A 2CSXA 5H81A 3NYIA 3V80A 5JMPA 3THYA 1E2KA 1E2FA 3V8QA 3LO8A 4UZFA 4KRFA 4BPRA 4PG4A 2QN1A 2ZYAA 4JEUA 3PXEA 5JJBA 1L4YA 1SU7A 4FW8A 1L9KA 5DSZA 4HC4A 3I73A 1NN3A 2Q45A 5FI3A 3LUBA 1TT7A 2YOFA 1OV6A 1S2IA 3H5RA 1CERA 3T94A 1BCRA 1PRYA 3IERA 3AERA 4YQYA 1GG2A 2PJZA 5FA8A 3WGNA 1YZUA 1AHIA 2O4CA 2Y67A 2WF9A 3B60A 4MCAA 5HA5A 4ZXFA 5BUCA 1ADFA 3AHIA 4RTMA 4IMJB 4JUFA 1IRIA 1JSLA 3RSHA 1CUZA 1SFRA 2XCUA 2YXDA 4PHFA 3EEYA 2FZWA 3TVYA 2KQUA 5FOTA 3FPSA 3SC4A 2V7BA 1IN6A 1DINA 1MIOA 4O4HB 5ITVA 4UBLA 5JV5A 4Q39A 1XDDA 3J7TA 4YEDA 4BQQA 4MW7A 1F1JA 3VNAA 4HAVA 1ZAYA 1AZTA 1G8SA 1EP9A 1E4YA 2FZCA 3IAS1 3OO0A 4R0VA 4IEFB 4GXRA 1SUSA 5DJ5A 3WGKA 1ZISA 2XZDA 3Q2IA 5GINE 1M8GA 2QZPA 5GADl 4KQHA 5AM5A 2GZRA 1QGDA 1PJ2A 3CNEA 1OGYA 2YXLA 2ZJ6A 3G2NA 3K1AA 2QUAA 4YIKA 1HYQA 3R3XA 3LC0A 2W2LA 1EWKA 2XF8A 5B2ZA 4ZARA 1YR8A 4CZ2A 5THQA 1QH8B 4A82A 2XKJE 4GOJA 4IOJA 3ZHTA 5DPMA 1WMBA 4D42A 2NM0A 4BMVA 3ZKAA 1MPTA 1AUQA 3T7CA 1T13A 5AO9A 3EG9A 1RQPA 3PQFA 3UFXA 3VR4A 1MX9A 4L74A 1V5FA 3N8GA 4OO3A 1GCIA 4YP1A 3R6TA 3PJEA 1PL0A 1M2VA 4BKQA 2EIXA 5A71A 3ETNA 3DL0A 4UUMA 10MHA 2D13A 5CPFA 4QOIA 5TMBA 4BLTA 4JKIA 4RETA 1UPTA 3V00A 1R5NA 3AJAA 3C7AA 2FSUA 2I2AA 2WYVA 2ZRAA 3CUUA 3NETA 3OKCA 4L5IA 1CRQA 4LHEA 2O8EA 2YJTD 1E6KA 3F5SA 2SBTA 1FUIA 3IA2A 3HEMA 3JQ8A 3MUFA 4RGQA 5FA5A 2GF0A 1R0ZA 1SO8A 4ZTUB 2JG3A 4GR4A 4IMIB 1A5ZA 2FUEA 1OD6A 2J67A 1HLGA 2Q1YA 3B5IA 1XU7A 3I37X 4JVSB 4L8FA 2W4MA 5L4NA 3GJ3A 1F48A 1JLRA 1MHPA 3DFZA 3ID6C 1XPJA 4I19A 4KWIA 1GN8A 2GN2A 3P19A 1GR1A 4ASUA 4EMTA 3EXFA 4Y0NA 2C97A 4Y6LA 3CO5A 2V7EA 3PQ6A 4MIEA 3R7SA 3DKVA 3R3YA 3E4CA 5IJZA 1I32A 1ZUIA 4CWAA 2XE4A 5DCWA 2ZUTA 1NVWQ 4KZPA 4NQRA 2BGIA 4TX1A 5GWXA 5IKOA 5KJ1A 1L8AA 4QQNA 4FFRA 1EXWA 4Y9RA 4E07A 4YX9A 3U5TA 1Q1AA 1D2RA 3K6RA 1WZUA 1EA5A 4MDYA 4TT8A 3TTWA 4EKEA 2V3WA 2IYPA 1JFFB 4HUTA 4OL9A 5BN5B 4LZOA 5EUMA 2B8TA 4XVHA 2ZB4A 4BNXA 1CZOA 1LX7A 3I53A 4HWPA 4Z2YA 4B3SB 2UYYA 4WLUA 5JS6A 4OOEA 2CY0A 3RYHB 1W94A 2X7JA 4MUYA 3FNGA 4WLFA 3T4PA 2I4OA 2PT9A 2F3RA 3WMRA 4MA5A 4PZAA 3STHA 2AJTA 3STWA 1A7AA 4JN6B 3V7FA 3I4CA 1Q16A 2E4XA 3QU4A 5EPEA 2HWWA 2VYNA 1ETUA 4DUZB 5C8VA 4WBNA 2X7XA 3PNSA 3WA6A 1UT8A 1SKBA 3PLNA 4G0ZA 4L6IA 5EE0A 2W83A 4KG7A 4WFIA 6CHYA 4QQKA 3QPAA 2A2ZA 1AQNA 1U28C 2WC1A 2CV0A 1C1XA 3VJKA 3SIXA 2OXTA 2WWHA 3C3PA 3FDFA 2VP9A 5LKAA 3RRNA 1Q1GA 4XGNA 4BIIA 5AW6A 1C9MA 4QOGA 1SEVA 2EFYA 3IDZA 2PQMA 4M55A 4DLBA 2AOTB 2FUCA 3IVGA 2ISSD 2UYOA 3DOOA 5JROA 1T5IA 4X94A 5F64A 4M7WA 4UFNA 4F7DA 1Z6TA 4B6JA 5CLIA 4LJ8A 3I5YA 2W58A 1T0IA 5AI4A 2UDPA 5J2UB 5J2UF 2HWXA 3Q1LA 5F4ZA 4N0DA 3ZGVA 3ADBA 3A2MA 3KUKA 4H7IA 1PFUA 3OT1B 4IRXA 2FQQA 3LCCA 3U7HB 1UDBA 3NATA 3VV2A 2PGJA 2V55B 4JLKA 1XB2A 3HYSA 2DUMA 2G25A 4G26A 4RF2A 4HWKA 3GUYA 3LLCA 4F91B 2INGX 1QVWA 4UM9B 4CNBA 1RT9A 3S8EA 3MQFA 5K51A 1SU6A 3A7DA 3BRWD 7REQB 3WKCA 5KHOC 1J06A 3KHUA 1ZK0A 3VQTA 3WWYA 5B7PA 4CR7A 3LD9A 4IYJA 2XMQA 4F5WA 3AETB 3VA7A 1ZRMA 2EFDB 2PS1A 4O0LA 5T7BA 2WPDD 3SF8B 4PZLA 3NCTA 4KAFA 3NDBB 3QYPA 2POQX 5IKXA 2Z6UA 3CVOA 3KCQA 1CUDA 1WW8A 1M6WA 4JL6A 3ZS9A 1CYEA 5K2OA 1GZDA 3NT4A 3UUEA 2GFQA 4UVHA 2C4WA 2P9CA 4NESA 3OCXA 4ZT5A 3NFRA 2OXEA 4DIKA 3FYSA 3WVNA 2P0AA 3IX7A 5JY1A 3CR7A 2BEVB 4BCBA 2D54A 3DYIA 1TZKA 4X3OA 5C1IA 3GLFE 4KXNA 1CUEA 3CT6A 1J99A 2Y1GA 3UANA 3ECAA 1A76A 2Z2XA 4O5AA 3FZYA 3R5SA 8GPBA 2WWFA 3HJNA 5BQOA 2EW8A 3DBHA 5KVCA 5JJKA 3DZHA 1PYOA 3BS4A 1XYGA 1QVRA 2WIJA 4N39A 4YACA 5JO0A 4FGJA 1QHEA 4QJIA 4KAAA 4DLLA 1TW2A 5A7GA 1TX4B 3I30X 1PJSA 5ALDA 4ZI3A 5KYXA 1CPYA 1XBTA 5EG5A 5JWHA 3OTIA 3BERA 3OMWA 4PAGA 4XPIB 3SQNA 3Q3EA 3A4MA 1Q7GA 2J6CA 3LC7O 2AXEA 4NRDA 5FOUA 2C78A 1NIJA 4CMHA 5CVDA 5LQAA 2DFNA 3JQAB 3UAXA 4UUBA 5F3DA 4C4TA 3VVCA 1SBQA 1U0OC 1VHLA 2FFBA 4QVGA 3AQ4A 3UJPA 5F2EA 1E2IA 1GV1A 4B76A 1NRWA 2OO7A 5KSOA 3MJFA 1I3LA 3AY3A 4FBMA 5JIBA 1W581 3QE4A 3MTEA 3ZZMA 1D1PA 1SVKA 3EPRA 2VWHA 3E7DA 3QWFA 2Q1WA 5CFMA 4I4CA 1G8GA 4Z3DA 4XDHA 4B8WA 2RK6A 3QBVA 3L7CA 2IX3A 4F4IA 4YRBA 1FSPA 3TW4A 3HCEA 5B2EA 1TF2A 4FWIB 4R2MA 3VZBA 1K8ZB 4WXYB 2ZCVA 5I3ZA 4RIHA 1EP2B 1GN9A 2B4RO 2WSIA 3V42A 2ODNA 2H52A 3DQPA 2HCFA 3SYLA 1Y6JA 1TAUA 1N75A 1RCUA 2I9PA 2O7RA 3LYLA 3KKEA 5HVNA 1EUDA 2IPXA 2R5FA 3U1VA 4PLFA 1WQ4A 4BNWA 4EPYA 4D56A 5IS2A 1CB0A 1II0A 2WWRA 4EHJA 1T4DA 1Y8QB 5CW1A 1MLDA 1DXQA 1NUUA 1OAKA 4LWQA 4Q1EA 5AVQA 1ZG3A 1J09A 2PL1A 3KX2A 3B51X 4YT2A 4I4TB 4M1SA 1BXRA 1CF2O 4I4TF 1K7SN 5LB2A 2QDXA 2ZSIA 2JLQA 3LC2O 4MVYA 4Y2UA 5KVAA 2ZS9A 1Q21A 2ZTVA 2XLBA 1VCOA 3AC0A 3CO0S 1AF4A 4IDBA 4AMVA 3A9SA 5K3EA