3A04A

Crystal structure of tryptophanyl-trna synthetase from hyperthermophilic archaeon, aeropyrum pernix k1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
367
structure length
367
Chain Sequence
LDPWGAVEIKDYDRLLRTFGIRPFSEVLPLLRKAGMEPSFLMRRGIIFGHRDFDKILEAKARGERVAVLTGFMPSGKFHFGHKLTVDQLIYLQKNGFKVFVAIADAEAFAVRRIGREEAVRIAVEEYIANMIALGLDPKDTEFYFQTNRGTPYFRLIQLFSGKVTAAEMEAIYGELTPAKMMASLTQAADILHVQLDEYGGYRHVVVPVGADQDPHLRLTRDLADRMAGVVELERPASTYHKLQPGLDGRKMSSSRPDSTIFLTDPPEVARNKLFRALTGGRATAEEQRRLGGVPEVCSVYHMDLYHLMPDDGEVKHIYTSCRLGKILCGECKQIAWEKLERFLAEHQSRLEKAKTIAWKLVEPPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1
rcsb
source organism Aeropyrum pernix
total genus 140
structure length 367
sequence length 367
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3a04A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3a04A01
3FIUA 1WZ2A 1EXDA 1SURA 1GLNA 2BTEA 1RQGA 3CLSC 3TS1A 3A4IA 3RK1A 4EG3A 2YY5A 3MUEA 1WXEA 3UY4A 1I6LA 4YP5A 1JZSA 1VLHA 4EG8A 3MLAA 1JIKA 1X6VA 3CLSD 4F4HA 1J21A 3TNJA 1COZA 2VTBB 3N8HA 3RFFA 3KT0A 3HL4A 1QNFA 1N78A 3F3MA 3DLAA 3FOCA 2AG6A 3NBKA 1H3EA 1M8PA 3ZXSA 1QU2A 3M5WA 4ZT4A 1KKUA 3ELBA 4G5YA 2DPLA 2EL7A 2J09A 3K32A 1J1UA 2YXNA 1OWNA 4G5FA 1JEDA 4MQ6A 4EG1A 3FH0A 1EFPA 2CV0A 4FZJA 4ZT7A 1EFVA 5TEWA 1M8KA 3IDFA 1I6KA 2DXIA 1TYCA 2A4MA 3P0JA 4S1OA 2AKEA 3CVUA 3FNRA 2A1UA 4WNYA 2X3FA 1O95C 3IVXA 2J5BA 1KR2A 1WXGA 4MW4A 5BNZA 3HZRA 1N1DA 4CDMA 2CYAA 5FO0A 1WOYA 1B6TA 3G6KA 3KFLA 1O95D 1PFUA 2QUIA 5HG0A 2PZ8A 4ARCA 1KQNA 3I05A 1MBZA 4PBRA 3SEZA 1BS2A 1M8GA 1KQPA 2J07A 5AHWA 2TS1A 4HK4A 2DLCX 2E21A 3GMIA 1LW7A 2I1LA 3Q4GA 3RHSA 3IUEA 2CV1A 2J08A 3COWA 4MUJA 2VTBA 4NDAA 3SEQA 3CA8A 1OWLA 2A84A 1IHOA 1ULHA 3G5AA 1N2HA 2AZXA 3CVYA 4QRDA 3COZA 2PFSA 2PZBA 5LM3A 4MVWA 3PRHA 4YP7A 1YUNA 1QU3A 3ZJUA 1JGTA 1V47A 1OBHA 4ZCRA 4TS1A 3SZGA 2D13A 2EJCA 1EJ2A 2PG3A 1GPMA 1GZUA 4JXZA 1H3FA 1A8HA 1N2IA 3UOWA 1MB9A 4EG6A 1TYDE 1WJGA 4MW2A 2PXHA 4UZEA 4RPIA 3CVWA 2OQ2A 4DDHA 5KWVA 4KR7A 5TGTA 3SZ3A 3AG5A 2QJOA 4QREA 2Z09A 1O96B 1NYLA 4DNXA 1WXFA 2ZUFA 3Q10A 1WQ4A 4R0NA 4HPWA 1OWMA 1T9GR 3ND5A 1J70A 5J5AA 4EG4A 3IOCA 1NZJA 5KHAA 1KP2A 3UK2A 2Z3VA 3K9WA 5KCMA 3AL0C 1Q11A 2BYTA 5TS2A 2GOYA 2DERA 2OV4A 2D54A 4MW9A 1ZH6A 3MMXA 4MUKA 1NURA 2XRZA 2X1MA 4MAFA 3CLUD 3CR8A 4MVCA 1VBKA 1M8FA 1WXIA 2IELA 4EF6A 3N9IA 1IFXA 2PZAA 1EUQA 3NBAA 4ARIA 4MW0A 1IVSA 2QTRA 3PNBA 2WB2A 1NUPA 1O94C 3ZIUA 3RK0A 4MW7A 5H16A 1O94D 4U7JA 3RJZA 4OUDB 1LI5A 1HYBA 3AFHA 3LCJA 4XFDA 3H05A 3HMQA 5JBNA 1KH1A 4JFAA 3G59A 3UC5A 2QTNA 2Z08A 1S4MA 3Q12A 1O96A 2QTMA 1KH2A 1NUQA 2D5BA 3HFJA 2QJTA 1ZJWA 3IH5A 4H3SA 1NUTA 3H99A 4MUIA 4U63A 2RE8A 4MUNA 1NSYA 1MJHA 3H9CA 4R2LA 1IQRA 1IQUA 3KT3A 2O5RA 1H3NA 1KQOA 4AQ7A 3ZXIA 2X1LA 4QBTA 1K4MA 1U3DA 3MXTA 4HJXA 2E0IA 1Y42X 4UZFA 1G59A 2R5WA 1OWOA 2NSYA 1TYAE 1N75A 4ND6A 4I6JA 4WSOA 2JANA 5J58A 1MB2A 1XJQA 4ZCTA 1CT9A 2JAXA 2IP1A 3TQOA 4K03A 1F9AA 4RUKA 1FYDA 1J20A 1N2GA 2QUJA 2X0KA 4Q93A 1O97C 3PNVA 3X1JA 3IMCA 1WKBA 3CVVA 2A1TR 3IOEA 3IUBA 4DE5A 1F7VA 1GTSA 1O97D 4OUDA 1N2BA 3RBAA 1OBCA 1XNHA 2DETA 2YWBA 5TEVA 1TEZA 3VGJA 1V8FA 2VXOA 4U8HA 4MVXA 1KH3A 1PFWA 2DEUA 1JHDA 3C8ZA 1K4KA 2QUKA 1M1ZA 2A88A 1N3LA 3E27A 3FETA 2CYBA 1KAMA 1MOPA 2J4DA 5J59A 4HJRA 1NUUA 3SDBA 4PBSA 4PBTA 1O0CA 1EUYA 1NP7A 2JA2A 3AIIA 4JZYA 1D2RA 1JIIA 1N2JA 3OP1A 4DJAA 4ZCPA 4I6GA 3MLBA 3AG6A 1LI7A 5DB4A 4MW5A 3SP1A 4XFJA 3SYTA 1EE1A 1G8GA 1MAWA 3TQIA 3FWKA 4ZT6A 3KT6A 3CLUC 4CQNA 1QJCA 2ZUEA 1YIAA 3COYA 3FDXA 1GAXA 1KAQA 1OD6A 2CT8A 3ND6A 5F23A 4NAHA 3BL5A 4JYZA 1R6TA 4L2IB 4YP6A 2C5SA 1ZH0A 1G8FA 4MUGA 1NUSA 4GRIA 3ZJTA 3P0HA 2E89A 5LFAA 3DPIA 2IJGX 2ZP1A 1IRXA 1YI8A 1M8JA 2A86A 2HZ7A 3CLTC 4KR9A 3ZUGA 3FY4A 1QRUA 3JXEA 3INNA 4EG7A 2NZ2A 1PG0A 5DK4A 1TFUA 4MUEA 3N05A 1ILEA 1QRTA 3CLTD 4MUHA 4KR6A 4G6ZA 4KPUB 4EG5A 4ZT3A 4NZPA 1N2OA 2G36A 1Q15A 1T6YA 1Q19A 3PNYA 1I6MA 1M83A 1VBMA 1R6XA 3QE4A 3TZLA 4ZT2A 4CDNA 4AS1A 1P7PA 3QTBA 1UFVA 1T9GS 3DV2A 1T6ZA 1U3CA 3A04A 1K97A 5H7XA 1QQTA 3H97A 1VL2A 2CV2A 1N77A 1Q77A 2WSIA 1JECA 3LE8A 3ND7A 5DASA 1R6UA 1NI5A 1OWPA 1GTRA 1DNPA 2HGZA 1GN8A 2GM3A 1J1ZA 1K92A 2QJFA 3FG9A 1IH8A 2H2AA 3D6UA 4P2BA 2RD2A 3L93A 2PIDA 4MW6A 1U7DA 3IOBA 3NV7A 2V0GA 1F4LA 3GUZA 3OTWA 5DEOA 4ZCSA 4BWVA 4L2IA 2CFOA 3KT8A 1JEEA 4DDKA 1XNJA 3VU8A 3DO8A 1QTQA 1FFYA 3FHJA 4GU5A 5K0TA 1T6XA 4J75A 3IVGA 4OJMX 3IODA 1WXHA 3CVXA 5EKDA 4PY2A 4MLPA 4MUFA 3AKZA 3H9BA 3ZJVA 4X0EA 1VBNA 4A91A 1F7UA 1MC1A 3QTTA 2WQ6A 4KKVA 5LLTA 1PG2A 1O0BA 4MVYA 1JMVA 4J76A 1I2DA 3D6VA 3GLVA 4KPUA 2O8VA 4DLPA 1JILA 3HV0A 1H1TA 2GKSA 4NAUA 1X8XA 4ZCQA 2E18A 4NATA 1YIDA 1J09A 1O6BA 3X1MA 3L92A 2A7XA 4E1AA 5FNZA 1IQ0A 3HGMA 2CSXA 2YWCA 4NX2A 2V0CA 3PXUA 2CUZA 4R2MA 1JZQA 3P52A 1TQ8A 1QRSA 3ILVA 1ZUNA 1U7XA 4MWEA 3FI0A 5IJXA 1MAUA 4YMIA 4EFKA 1G8HA 1N2EA 4MWCA 3X1KA 4MWBA 3VRHA 4Q16A 3COVA 4ND7A 3ISJA 1O5TA 1MRZA 2WQ7A 3A05A 2CYCA 4EGAA 1TYBE 5HUHA 3TZEA 1WY5A 4MWDA 1PFVA 3IVCA 2HMAA 3CLRC 3N2YA 3S3TA 4ZT5A 1EFPB 4MW1A 4MULA 3ZGZA 1YULA 1KP3A 3UMVA 2QUHA 1EFVB 1KORA 3A2KA 3LOQA 4XSVA 4JXXA 2DUMA 1YUMA 1PFYA 4I6EA 2DR2A 5K0SA 3CLRD 1U0BB 1JIJA 5HUJA 2A1UB 1WQ3A 4DDMA 2B7LA 1XNGA 2XRYA 3U1VA 5IHXA 4F3RA 4CT0A 3P0IA 2A1TS 4K0RA 3IMEA 4YBRA 3IMGA 2H29A 5FO1A
chains in the Genus database with same CATH superfamily
4M1ZA 3K9CA 1SURA 4CF7A 2BSAA 2O0HA 1DWPA 3D8SA 3CM0A 2NSDA 3M2PA 2RIPA 3BREA 1Z4OA 3OO1A 1WXEA 2H7XA 5HSGA 4HAVA 3ESQA 3G7UA 5TF4A 1QIIA 1BDJA 2YV5A 2O20A 4FFLA 5K1ZA 3GHYA 3GVXA 1XZCA 2PV0A 3OQ1A 5FL7A 1OHHA 2F62A 5K20A 4CQMD 4AKTA 2WMNB 3N74A 4DV3B 4NARA 5IRCD 3W2TA 3LI2A 1YXMA 1I4LD 3ZK7A 1G5FA 3IAHA 1Q3HA 4AKIA 3SJ7A 2GYVA 2UYHA 4H2DA 5AOVA 1IDOA 1SXHA 4UM7A 1LSOA 1B23P 2C7PA 2UXBB 4EFNA 1I30A 2NVWA 3WRVA 4DVGA 4ARUA 2VBIA 3FTNA 4FQ7A 4OQPA 4CEJB 1HDRA 1YVPA 3H5WA 1M8PA 1N2CE 1VJ5A 3ORSA 3M5WA 1GQSA 1KAHA 3E9RA 3EFHA 1KKUA 4KRYA 4OFBA 1S2GA 4TZKA 5ALQA 2D2EA 1J1UA 1FXWA 2WD9A 4E5DA 1V7QA 3QA9A 5JCJA 2NMVA 1JEDA 5ICGA 4L4RA 3FH0A 4FXPA 1EK1A 2C5EA 3DTYA 5AVQA 3UK7A 3BTOA 2YOGA 2G7MC 4TYQA 4Z0HO 4CQLB 4YRPA 5H9WA 3UMMA 2DXIA 4UREA 1UFOA 2ATIA 2B25A 4OP2A 1YB2A 1SKYE 1M1NA 1IJKA 3DZ8A 4ZOAA 1KOLA 4EB8A 5DNEA 1JFVA 1E3SA 1OIWA 4LFAB 4TLLB 1V95A 3GP3A 4II7A 3FMPB 3PG5A 3C1AA 4DXDA 1M34B 1N1DA 2GAFA 2PX8A 4E2YA 3G9UA 1SVLA 4HLNA 4M1MA 4Q1CA 3NXSA 3EXEA 4JLUA 4MINA 2XECA 5EMNA 3R5KA 5CCXA 5JNTA 2GYYA 3VX4A 1XTUA 1UC8A 1O95D 1OA0A 5DI3B 4UDXX 5CGQB 2P1ZA 1JWBB 1VSUA 1DOAA 1ZD5A 1DHRA 2HDWA 4LTDA 5JS6A 4QXPA 1RKUA 4MDFA 3KSMA 4MYRA 2G9VA 1M8GA 3QOYA 3SJBA 2VRWA 1PJ2A 1ENOA 5REQB 2V5UA 5FOWA 3DVAA 1KVUA 3IDOA 2JH8A 4TKMA 4WBSA 4WLEA 1ORIA 4DIKA 3TUZC 2HBYA 3EZNA 2GM9A 3CKYA 3VAYA 3I2IA 2QV7A 1SOWA 1Y1PA 2CHVA 2J08A 4Q02A 3R9XA 3NNNA 3R7AA 5LSAA 2YICA 1JE0A 4YAEA 2VYFA 1Q83A 3PQCA 1G7RA 1SHKA 3H8WA 3IAEA 4Y9DA 2YVUA 2C4MA 3E9DA 3V9PA 1LBEA 2DGDA 4DR2B 2FSVC 2J41A 2WJYA 3BKWA 2IS4A 5FWXB 4PGGA 1JEAA 3K1YA 4ZOLF 3LX8A 4KQHA 4EJ6A 3TSAA 1U0RA 2B1QA 2Z8XA 4AVYA 4GBJA 5D85A 3QQPA 4BV8A 1OI4A 3GLKA 4BECA 5LQCA 621PA 1N2HA 4H35A 4D4KA 3I6MA 4C07A 4AUMA 4GLLA 4CM3A 1LBHA 4YJ2B 1GAQA 2BKUA 2I2XB 1H2EA 4JA2A 1Z2PX 4DJDC 3HO1A 3R7LA 4B8WA 4D43A 3ENWA 1RMQA 3O9MA 1Z5PA 2V7UA 4NJMB 5HIIA 4E5KA 2H1IA 2EJCA 1EJ2A 4G1UC 2C4UA 3EPKA 1XSEA 3MSXA 3E05A 1SUFA 2FPWA 4DUPA 2OYSA 1Z4PX 3BIOA 5KYWB 4B76A 1WV0A 4BP3A 4AY4A 2FPPA 5K8CA 2G63A 4WY5A 2HFJA 3UBMA 4CNBA 3LLCA 1FRNA 4CDGA 1NMZA 1KSGA 2XB9A 3H9EO 2P4HX 2XDWA 3LLMA 1FMLA 4QREA 1AGYA 1XEWY 2Z09A 1TMGE 1A71A 5CIQA 1UK6A 2VF2A 2VT7A 3EZFA 4EW1A 1I2MA 2Q3FA 3HP1A 4LC9A 3NBYC 3HJGA 4QQFA 4MGYR 4BKQA 1XRNA 2WR8A 4BTVA 2ZUFA 1IY8A 1QFSA 2A59A 3HA2A 1CUWA 4KWEA 4ND2A 2ZB4A 3ROKA 3WDMA 1X14A 3IOCA 3PYLA 5EKSA 4F11A 2AV6A 2JVKA 2W22A 2Z3VA 2O54A 3PHCA 4UVGA 3R8CA 2ACWA 3OJFA 5JASA 5C5DA 2BMAA 2F2TA 3F3SA 2HK9A 1N3BA 3RSQA 1H1LA 5CEJA 1E59A 2FQQA 3NDBB 1XZAA 3SSMA 3MMXA 3TG2A 2Q3EA 1CUGA 1K0FA 2BGMA 1JPVA 1R2QA 2JD1A 2BHRA 3A1NA 5L3ZA 3L0CA 4NNJA 3PJRA 1O58A 1YOBA 2QR2A 3IT1A 4V3CA 1GZ6A 4MVCA 1QMPA 4MR9B 1B26A 1QKKA 3BC1A 4EZIA 3ONNA 1GEGA 1V71A 3ROGA 1U63A 3V8RA 1SKUA 1Y6QA 4E4TA 2GEDA 1KFBB 3C8DA 4U1RA 3PGLA 4HXYA 4NG4A 5ECWA 4OI1A 2OYCA 2VBCA 1EEXB 3FFBA 3NBAA 5BOSA 2FLVA 1ZN7A 3CF6R 4IXDA 5HBRA 4EAAA 2MINA 4OAQA 3RI3A 3DGEC 3F2IA 4LGMA 4G3XA 2IA5A 1UR5A 5BVHB 2B4RO 4OB7A 3H9QA 1ZK2A 3PRJA 4CN8A 5AD1A 4PYRA 3EASA 3B60A 1O5OA 5ALRA 3H6KA 3TTYA 1RWBA 2QPOA 1FLAA 4LZWA 4TTRA 5THKA 5I8PA 4IEFB 2UYQA 2CNBA 1P7VA 1A2KC 1IIRA 2OP1A 1F12A 4JB3A 1JLMA 5EQFA 3U48A 2CBGA 4CMAA 5ICMA 2AE1A 4L76A 2LBPA 1KXJA 3ESZA 4GMHA 3EOBI 2MYNA 2XA1A 3H1BA 4LYYA 2HMYB 3ZHBA 1Z6ZA 1RWPA 4MHTA 1TVEA 3DCNA 1C7ZA 2QXYA 3NPAA 1M2WA 1H4QA 2OVFA 3D6JA 3NGLA 2PX0A 4KITB 3E03A 3KJHA 1N0IA 1UZLA 3S55A 4D4LA 3KUDA 1ZJWA 4JJAA 1E9RA 4EB0A 4HRAA 1OVMA 1BXZA 5GINE 4RMIA 1DG1G 1M34E 4U63A 1CCWA 5EP3A 2Z6QA 5HVNA 1GV0A 4L0MA 3OBIA 4E6PA 4K87A 1W7AA 2WB4A 3BJIC 1MXFA 1IQRA 5A7HA 4X20B 4OSOA 2CK3D 3KB8A 5SYMA 1Q7RA 5T7BA 1OXVA 2VSFA 2R00C 4MYTA 2CZGA 4JQCA 3EF1A 1S2LA 3CBQA 4N6NA 2PKRA 2JDIA 4XOUA 1Y42X 1GQYA 1QH9A 4UZFA 4BO2A 2C7BA 1Y80A 3ORFA 2PS3A 5DBOA 2ON6A 3KKQA 3EVEA 3PDUA 4JLAA 5K0CA 4UMVA 1OFIA 3BFJA 3ZBTA 2WBLC 4G0NA 4KIUA 4E30A 4H6VA 1JEJA 3G2LA 2QTBA 1EDOA 1YKGA 3TSOA 4FNOA 4JVMA 1Y3DE 4RUKA 4Y0NA 3BXFA 4BMZA 4Q6BA 3J81A 1NDUA 3TCXB 3HJAA 3VNRA 5JSUA 2X0KA 4FD3A 2OC9A 1KFJB 2PTGA 2Y6UA 4C4YA 1DEKA 3TRIA 3IKTA 3SD7A 2RHOA 3DLPX 3SZOA 4C04A 3OIGA 3S6JA 1JA9A 2GN8A 3E7DA 2A1TR 3IUBA 4BOYA 1F7VA 3NC1C 1YS1X 2P9TA 1OYVA 2AVNA 4JI4B 1C7QA 2BBWA 1GQOA 5JFTA 2DBVO 4PQRA 5E38A 2XQJA 5KWEA 4NENA 2QTCA 3NH9A 5DNYB 4YRMA 1DFGA 4GEGA 1XRLA 3FAZA 5AK4A 4YRKA 2LVBA 1DO2A 4BMDA 4PE5B 1D7AA 1UDCA 4YROA 1TOAA 3TMYA 2DUJA 1KDZA 4YUWA 3EZGA 2Z2XA 5TMEA 4K9LA 3MJVA 4BJ3A 3ROZA 2A88A 4IIFA 4RTSA 1TU4A 1WKCA 2ZQZA 9ATCA 1RBQA 2NZXA 1MGPA 4R8MA 1LBQA 2GD1O 4KHZA 2AG5A 2Q5IA 4O4LA 1Y6RA 4CFYA 4YCNA 3OOHA 4PBSA 3FTPA 1VL1A 3PK0A 3A11A 5C8YF 4DMFA 4YUAA 5G41A 1AXEA 2P2CA 4Y2XA 4ZAVA 2J9FA 2ZG6A 1NC3A 2M98A 1ZS9A 2V7QD 4KO1S 4EGCB 4FGLA 2VJAA 3U7GA 1ZUWA 521PA 1HDOA 1TIPA 2AN4A 2BE7A 2IEYA 2J6BA 1D9ZA 1RPTA 1U28A 1VB5A 3HKEB 3O3MB 2HPVA 3BVPA 4N6GA 4R2HA 2DBRA 5P21A 1VJTA 4AL4A 5KOJB 1XNQB 1C0IA 4UM8B 5C7YA 1D09A 3WLKX 3BIWA 2V9CA 1V8OA 3GZJA 5EP1A 4EELA 2ZUEA 2ZR8A 2WSYB 3FDXA 2I6FA 3T15A 1WP4A 3AHFA 3BXXA 4MKHA 4FFDA 2F7SA 2Q5JA 2ZU0C 4X1KA 5FD8A 3CRQA 1E7WA 4TMXA 5ULLA 4D9CA 4EVIA 4MUGA 1RXCA 1UEJA 5HKKD 5IK2A 3AXSA 3AEQB 4V0KA 2O3TA 5AOAA 2FKAA 1EWTA 1YQTA 2V7GA 3SLGA 1QOQB 5E7IA 2GZSA 4HNQA 2VPTA 2WJVA 3DPIA 3OMXA 4BMCA 2V1XA 1DGQA 2A33A 1T8UA 4EVRA 1X9IA 4DANA 1KPGA 1LX7A 3ADOA 1VYUA 2WF7A 2Y9PB 5ARDA 5CFMA 1U4SA 4RXTA 9LDTA 5GJWC 3KPYA 4EBFA 2BFDB 1M5RA 2Y71A 4MKRA 1CIVA 4WLVA 1Q0RA 1ILEA 2YZMA 4U5XA 1NW4A 2YVKA 4P1ZA 3O95A 2ADFA 3K6JA 2VL7A 4X6UA 3G88A 2PH7A 3PX3A 1NFQA 3IX7A 4HWSA 4MUHA 1N3IA 3UH0A 2GZDA 4FYWA 1UMDB 2H1SA 3FSGD 3N86A 4N3GA 4AJPA 1U0OC 3DBIA 5C9ZA 3GJSA 4ZAZA 2VLIA 1IPFA 3G5MA 4R69A 3WRYA 1KC1A 4POOA 4BQPA 2M1XA 2NU9A 4TV9A 4AJ9A 1OI7A 3MK31 2NX2A 4R9SA 1AQIA 2GJ4A 1XPJA 2YVAA 1RYBA 1AUXA 4G0OA 3OHSX 3HDHA 1ISFA 3CS3A 3L0DA 3SX4A 1NI4A 1THGA 1R9NA 1U8FO 2WP8J 4LXUA 4L5IA 4BV3A 2OHVA 2GA8A 4MRAA 4QDTA 4ACAA 4F5ZA 4O25A 1U3GA 3DFUA 3ZDFA 1AB6A 1C9DB 2EYUA 1KO8A 5C7OO 2CV2A 1G4AE 4I1YA 2O8BB 1ZD9A 3CNEA 3O38A 2PSHA 4F7WA 3V34A 3PQFA 1OWPA 1P62B 3BAZA 1DNPA 1M7GA 4TLAA 4R7GA 1DIRA 4WOKA 1KEPA 4D98A 1KI7A 2ZRAA 1E2MA 3L93A 5ECGC 1M0TA 1XP8A 5BSWA 5LR6A 3MCUA 1DAKA 1L8QA 2HLDA 2YWJA 3OURA 2QL5A 4LRWA 3VJKA 5ECDA 4PG6A 4XD7D 5AM1A 1T1GA 2POCA 1T8PA 4PFKA 1ODKA 3EPRA 5DYYA 4JVLA 4GDFA 3QWIA 1SKMA 1GGJA 3KL2A 3OJLA 1RACA 2BE9A 2V74B 5I7FA 2IYVA 1IJBA 2W2LD 2R68A 2P3OA 2QM8A 3WVNA 4JGIA 5IT9A 5AVJA 5B58C 5K0TA 2ARKA 3K1JA 3N0RA 3ES9A 3VR3D 2QVXX 3B85A 4N8SA 4WRRA 4CU2A 3VU0A 2QY9A 2UYCA 3KELA 2H54A 3JASA 3JD2A 2W6ID 3DGFC 3KPUA 4NMWA 3DDNA 3BD8A 3HCOA 3KQSA 3ZJVA 1GFSA 2Q5QA 5AHKA 4A91A 4RKYA 4LSWA 3EFBA 3IP8A 2FUG6 3QTTA 2P3QA 1MAVA 2B2NA 1RWMA 2KLBA 2QP3A 2VYVA 3B6IA 1XZ8A 4GXTA 1OH6A 2UVPB 5IT5A 3VBCA 4JLOA 4O2AA 1L3IA 3GF4A 4XDZA 4BNVA 3TECE 1NFRA 5AQ1A 2WC1A 2O7RA 1JR3E 3S2UA 5EESA 1JILA 1ORWA 3TBFA 3T1YB 1MO3A 4A36A 2ERCA 2DHCA 3SQWA 2C7QA 3KSRA 2IH5A 3KQHA 4X95A 1KI9A 1GSOA 3G8CA 4FHZA 2QN6A 5KNDA 2CNDA 2DY0A 4ECEA 1T5OA 2QGFA 3CG4A 3FTDA 1EM8B 4FLMA 4NABA 5CLJA 2OCGA 5I3ZA 5LP1A 2FPGA 2O3QA 3RAEC 4CMBA 4X90A 2NV6A 5CYOA 1DRUA 2F1RA 5BVGB 3ILVA 2B8TA 3GIWA 1QHFA 2GUWA 2BGKA 5B30A 3Q3VA 1SUDA 1JL3A 4A0FA 1PQWA 4AP6A 5FBZA 4EYEA 3HCBA 3OQ6A 1K6XA 2VSQA 3THYA 1E3DA 1K8YB 2C8JA 4PC6A 4WDRA 1XVAA 4U6NA 3WYAA 5AKYA 2ID8A 3PRYA 3HDVA 3SIXA 3VNAA 3VR6A 2FB9A 5HUHA 2X5OA 1BXGB 1V1MA 3NRJA 5EPEA 5ESDA 4YRZA 1PFVA 3RC3A 3L1VA 2ZITA 2JI4A 4QEKA 3JYQA 4YN3A 5LZ2A 2BMWA 4QYSA 1EFPB 4HQNA 1HOTA 2R4TA 4D2IA 4YECA 1UMBB 1C3XA 4FMCF 4HEQA 4ZJYA 1I3MA 2YZ7A 1JKJA 4HL6A 5AW6A 3LOQA 3D4NA 3EZLA 1YUMA 2ZIAA 4MQMA 4WN9A 5GV8A 1A2QA 5L45A 2IZ5A 1OX5A 1SHJA 3BE8A 3HSSA 3KOMA 5HHTA 3OPYB 3QVOA 2DMRA 2PS1A 2W70A 2DRIA 2AUNA 5HKAA 3R5FA 4MQBA 3V80A 4DCNA 4OQEA 3NFYA 1JPJA 5LP6F 3NLLA 1FTWA 2JFGA 3OIFA 2QROA 2VSNA 5HIKA 4AZVA 5ALYA 2R8RA 1IEWA 3M34A 4J0FA 4Z4HA 2P6PA 5LXTB 2AKAB 3UJBA 4BNJA 1Z82A 2ZKIA 3E9MA 2B7CA 3KM0A 3ETLA 4NG5A 1KYTA 4QDXA 5L7YA 2XF8A 5JTUA 4OB6A 4GOJA 3UJ6A 1XVLA 1Q0UA 2PKXA 3NU1A 1D8TA 2ZAOA 4H6WA 3ECCA 1UK7A 4URZR 3UEOA 4AZSA 1CR6A 3ZD8A 5C5IA 3PKIA 5FOQA 1ZHOA 3OHPA 1CZNA 3TTTA 4M22A 1HFEL 4DYHA 5IXJA 2I6XA 4WY8A 4PN7A 3TNLA 1CVRA 2FU5C 5EINA 5BSUA 2VTBB 3CUUA 1M2JA 3FYUC 2DQKA 5JE8A 4FYXA 4PCUA 3Q8LA 5BSGA 2APJA 3AR4A 4KRGA 1SVWA 1AKUA 1R9MA 3CF0A 3EFEA 2EBHX 1A7JA 1USWA 4LIPD 3VDXA 1XTZA 4JP2A 3VU9B 1Z6XA 1ZOIA 4F60A 3PNKA 3HB4X 3TDNA 4R5MA 1CJUC 4O5AA 4DWWA 2Y4OA 1KRHA 2RB4A 4YI5A 3AI3A 3JATA 2QSUA 2WYVA 5HFAA 3AOEC 2OZVA 3S2EA 1RI1A 1AXGA 2FSVA 2ZQYA 3VNUA 5HJ2A 5EXDA 1I1HA 1DKQA 3DMHA 2IH4A 2ZK7A 2H4FA 3T7TA 4FZJA 3L6BA 1XYVA 4HDMA 1JYEA 4WASA 3PWKA 5L3SA 1NVMB 1R18A 4CG1A 1I6KA 2BI7A 3LUPA 3CNNA 1LQ2A 3ZLTA 4QXAA 4UOEA 2B3DA 1EAYA 1ZXBA 3HBJA 1BX0A 1LSJA 4GX0A 5IH3A 1LV8A 4NZZA 1H2XA 1VE7A 2D7CA 4LBZA 1UOQA 1SIBE 2WM9B 3SBXA 3SC4A 2G0NA 4K6MA 5E1DA 1YS7A 4IBOA 5J2UB 1DWOA 2WIKA 2EGGA 3AF2A 2BFPA 4BB9A 2J0QA 2XWSA 5K8VA 2FEPA 3O94A 1WZNA 3NHAA 1T0HB 3VZDA 1UF9A 1K5DA 3TRHA 4BS9A 2PCLA 2YRXA 3D7SA 3IIJA 4IL5A 1T5IA 2PZLA 4JP3A 1R0RE 2HSDA 4M98A 2OWEA 1YJCA 2EL9A 4KUHA 2FEOA 1NVWQ 4Q7EA 2IS2A 5JROA 1ZAKA 3LUKA 1ISGA 4L75A 4Q1VA 1K08A 1QC5A 3GFVA 1MEOA 5DWQA 5DMXA 3WBBA 5FH9A 2B69A 5FLKA 3DVRX 4GZMA 3VVBA 1ZOLA 1E96A 1PGQA 3I6ZA 2FH5B 2HEGA 3I8XA 3WRWA 4OMFG 3FHTA 2I2FA 3H4VA 5FRDA 1SZCA 2PGNA 3GPBA 1U6JA 2FR0A 3EIXA 2OUKA 3RFCA 2I9PA 2FX3A 2E48A 2WU1A 5I7VA 2TECE 2VP9A 2OM2A 1BCRA 3AR5A 4W7IA 5DVZA 1GVNB 2DTDA 2BKEA 1IN1A 4ZMSA 3O3OB 1NVBA 2FMHA 1U0JA 2O1XA 1A77A 1E2EA 3L41A 5M3BA 2Q7XA 1HL7A 4YJ2F 2AZXA 2IYXA 2LUOA 4FBMA 2AWNA 4RIGA 3I58A 4TQAA 1JTFA 2QA5A 4FHGA 1CTQA 3FFWA 4G5QA 5AOCA 3HCFA 4BQEA 3RKUA 1AJEA 2EF0A 2ODQA 3CIOA 4R81A 1LX6A 3SZGA 3PEWA 5BR4A 1GUZA 3GT3A 4QDKA 3V9AA 4AZ0B 5FOVA 4K46A 3GZNA 2H0AA 4PM4A 3GQBA 5DHFA 3WYDA 1UZNA 3ND8A 1Z7WA 1FFGA 4K6KA 1Z0JA 2J67A 3OAAA 3P9PA 1PQUA 1RQ7A 3D6FA 2RHTA 3HE3A 5LP6C 3C3JA 3ANNA 4RPIA 4TSFD 2NP6A 1QJ4A 2Q4EA 2B61A 4H1WA 4M8NE 2GERA 4KO2S 1KEEB 2IK8A 1T2UA 3TK1A 3UUGA 5IBCA 1DJMA 3UMCA 4ABYA 1R15A 1TGYA 1GWNA 5G53C 1KFKB 3BGDA 3JR7A 3Q10A 1F51E 2GCGA 4KQJA 1YNSA 2I4IA 4PLZA 3OZBA 4R98A 2GHRA 3FWNA 3TOVA 2X0IA 5HTOA 4C2TA 5HWSA 4F3TA 1DWQA 1O03A 4J7CA 4OYHA 2R3SA 4WOBA 2OXIA 1U2QA 2RH4A 2W43A 3GGDA 1FP4B 3D9QX 1PCXA 4OKIA 1L1FA 3I34X 3GR6A 4M89A 2XDQB 2J6HA 10MHA 4F21A 4AN0A 2PVCA 5I6DA 4W5NA 4C20A 4D57A 1JV2B 5BO5A 5DNUA 1YZYA 3SJUA 5C1DA 2RFLA 3JD0A 2G88A 5JC1A 1ESNA 4C7OB 5JISA 2R6AA 5IFLA 1WS6A 3E3OA 3MG9A 3SY8A 2IHKA 3QX7A 4MCAA 2IELA 4ON9A 1GARA 5E6SA 3ZVKA 1JLLA 2XTNA 5IUJC 1F38A 3IE0A 2R00A 3M8KA 3S8EA 3HKDA 4AUKA 3BMXA 1Z0AA 3LRXA 4ZOLA 3H2KA 1E4EB 1NONA 4EVQA 1XWWA 3PNBA 1M2FA 1PUIA 1SB9A 2BCJQ 4FIDA 3KD3A 4HYQA 1U1FA 4ZI5A 2GK7A 2WB2A 4BLTA 4GBGA 2FW7A 3Q9LA 3KZVA 4P34A 3NS7A 3RK0A 3W7VA 1CEXA 1OC2A 3DWFA 4R8VA 1QHYA 2YYAA 1YZKA 3J81k 4QJBA 3R8XA 2NO9A 1JJIA 3QHPA 3E9ZA 1J0XO 4YJFB 1TU0A 3EG5A 2WYOA 3ACDA 3ENNA 2Q1TA 1MENA 4PYQA 4BO0A 7YASA 2VH1A 1KH1A 2Y6VA 4OQFA 4J9VA 4O0MA 4QDOA 1TM5E 2HK6A 1MU0A 3TLMA 1ZMXA 4G0PA 3RAFC 1XVTA 4BZPA 5KUTA 4H1HA 1YMQA 3K0AA 5JC8A 4PU0A 1YS6A 3L6EA 4DF3A 2ENWA 3HVJA 4G0YA 3OHMA 1YASA 4RSMA 5BPHA 3AWIA 4M6WB 4E2FA 2VHJA 3DV0B 4UOQA 3RFUA 3UYKA 4C5CA 3SJAA 2QN1A 1GFIA 2G77B 3QXCA 2QY6A 4YMVA 1YRYE 2XCOA 1YZVA 2UUCB 2ZWVA 4WEOA 3F5SA 4QGSA 4FDTA 1LDEA 3EVFA 3UPDA 3W4IA 4MJ7A 1BW9B 4PC1A 3QELA 3STWA 2WFZA 4RA9B 2HYIC 3OLXA 4KIGA 4LK3A 2G0TA 2ZIGA 5K3AA 2E0IA 1II8B 2J85A 3GRAA 1C14A 3AEXA 5ALSA 1L5WA 1XP5A 3ZDYB 4AMBA 1F06A 2WNIA 4P5EA 2JD2A 4A1OA 3SJCA 3TXAA 1L4KA 1OIXA 2UYGA 2Y66A 1VKNA 4TXJA 4TWBA 5FQNA 3QWFA 3UGKA 5ES4B 1BKSB 3WGIA 2AKYA 3WWDA 4CKEB 1RM0A 1ECJA 1HYQA 4BXOA 4ZCTA 2FDCA 1CR4A 4G07A 1R0YA 1SBYA 4JUIA 4YDQA 2EF1A 1L4BA 3PD7A 4MARA 3IVAA 4TQUS 3SM9A 2QMHA 1KY5A 1NM5C 4QVGA 1XDBA 4DADA 1NYTA 2GEBA 1SXJD 5I7RA 1OH7A 5JJIA 3O1LA 3N2EA 1ZK0A 1NUAA 1WVGA 3KQWA 4BQNA 4QWMA 3H2GA 4Z54A 2HA3A 1YGYA 3CVVA 1ZR4A 3A4TA 3OF2A 1US8A 2WEKA 3WDLA 2IYYA 3FTQA 4Q1BA 2JIRA 4XPIB 1T3SA 4REQB 3T7EA 5CBPA 3I5MA 1GNVA 1T3ZA 1ZN9A 3HPQA 2E82A 4N12A 5K3FB 5C8VA 1UJ2A 2PX6A 2WMOB 3FPCA 4EM6A 5IXYA 1TEZA 4LJRA 1HURA 4D99A 4KZPA 1IE3A 4ID3A 2YJNA 3GEBA 5C3UA 5J23A 4LXHA 3WE7A 1YSCA 1JHRA 1HDIA 1LJLA 1QV7A 2FXVA 2GQ0A 3BFPA 4OHWA 5LIRA 1Y7TA 4ANFA 2LTAA 5BUCA 3CW8X 4A0RA 4HQFA 2IUTA 3ILYA 2RH5A 1W85B 2VJCA 2OBMA 1E4OA 1K89A 1JA1A 1POXA 3N28A 3O91A 3VO1A 2HXGA 3UV7A 1MQ9A 3T1TA 3SE7A 2Z5LA 2FLWA 3BD7A 3QWBA 1D1SA 2AFVA 3HXOA 2W71A 5JG7A 3TRFA 1KVQA 2PMDA 4CM9A 1V9LA 3IOMA 1N5RA 2ISSD 2VPXA 4JK3A 5AI6A 3TZ6A 2C2XA 1B7GO 2Z5VA 4MZXA 1R4NA 1XELA 3B7WA 3O6VA 4DPMA 1KZGB 2WKPA 1V3TA 1RJDA 1X9GA 3R5SA 3GFPA 2O05A 3IUMA 3KT6A 4BNDB 1C7EA 2H57A 1MH1A 4LV5B 2WWVD 1DJOA 4H3HB 1B1CA 4P58A 2DU8A 3H1EA 3U7QA 1GAXA 4HDNA 1KAQA 2P68A 5L6MB 1W1UA 2CT8A 1EVJA 3BT7A 3C8MA 3S5UA 4JYMA 4UUAA 3RSOA 5LZ5A 3KEFA 1C1DA 2I78A 5I9MA 4YYZA 1Y81A 1ZC3A 2XD9A 3P71T 3R7SA 1AUPA 2GETA 5DPMA 5JO0A 1EBFA 1DDOA 1VFPA 3MMSA 3AY3A 3WIDA 4IDPA 3M49A 2X4DA 5JATA 3LUGA 1BS9A 5CNIA 1Z25A 4RE6A 2JGAA 4FW9A 4FYPA 2QM3A 3BMNB 3L8GA 4DN6A 1RHUA 4JROA 1VA4A 1TW3A 5AHRA 2QZZA 3MMPA 3F6EX 4IFIA 3S4YA 3WTCA 4M53A 2Q2NA 4AO7A 3C43A 3AI7A 4P3KA 3RVDA 2JFNA 2PUVA 3A7DA 4HX2A 2O8CA 1BGWA 2AT1A 2XUKA 4AKSA 1RZ3A 1P74A 3VJMA 3C3PA 2QU7A 3EGVA 1TT5A 2ADMA 4GVXA 4JBNA 5E4YA 2R87A 3TL6A 3WMXA 2G17A 2ZRIA 5AI0A 1G17A 3HCAA 3ELYA 4FCWA 3K0BA 1G6Q1 2B9EA 1JHMA 1WVIA 3R9KA 2XPCA 1F4VA 3JWEA 1AQUA 4UCQA 4BJ5A 2E5WA 3FUUA 3PUWA 1ODIA 1Y8AA 1EFHA 1T1EA 3WB1A 4ZDKA 3MUOA 5BSFA 2OHHA 4CVNA 1BVHA 1G3IA 2X5KO 3QENA 4L8LA 4XGKA 4YCMA 1WWKA 4CM8B 5BWCA 5COAA 3L02A 3F6PA 1KEKA 4X6LA 1U3CA 1Z8HA 2OCLA 1XWFA 4BN5A 1ZUNB 5E2AA 2PL1A 4BU1A 3QFFA 2ONZA 5AICA 1N3YA 4M36A 3BORA 3H97A 3GGPA 5BPFA 3A9UA 1F20A 1VL2A 2D06A 1B15A 2WSIA 1HH4A 2HTEA 1MAHA 5C8YA 1JIXA 3UCFA 2ZJZA 3JQ9C 2PS9A 4OL0A 4RIFA 4F71A 4TMTA 4O8CA 5KNBD 3AR7A 2QXUA 1OXSC 3KRTA 3MTQA 1TMKA 4FJ2A 2KX7A 3JQGA 4OD0A 4WESA 1IH8A 3K31A 1SR8A 1ISRA 2BEVB 2C2OA 3B38A 3LCUA 3LQRA 1M74A 3GNTA 3EQ6A 2ZR7A 1SIWA 4LW8A 3LWDA 5IVIA 2DWUA 4PWYA 2W93A 5FIUA 4DLWA 5LQKA 4JI1B 1R0LA 1REQA 2CFOA 3PV0A 3U9SA 4CFZA 3GL9A 2YOHA 3IQDB 3MVEA 2JIPA 5JCOC 2VO1A 3IT2A 3TM5A 1G5TA 1N6IA 3DO5A 3HEBA 4NY1A 3SX0A 2QLJA 3E1SA 3H04A 2JGDA 4L72A 3O8BA 4FKZA 2CHQA 4I8DA 2UZIR 4B3FX 1G38A 2AQHA 2XY4A 5AK6A 4ZK2A 1HBJA 2II6A 3WQSB 4F06A 5AJWA 3VNBA 3N1UA 1MC1A 2A9RA 2GPWA 1YK1A 3NIDB 3A1UA 3L1UA 4NONA 4NNPA 5LYYA 2AGVA 3ZGOA 4MVYA 1C8VB 4H7KA 1NR5A 2J7KA 1ISJA 3HP7A 3DLTA 2QRVB 2Y8EA 4ILEA 3E81A 3HV0A 1H1TA 3C7DB 4RPHA 1V37A 2ZE6A 2C03A 1CC1S 1UXIA 2JBWA 3TW6A 4JDUA 4G9EA 4XQEA 1IOLA 4PZLA 4CWAA 1W36C 1EX7A 4FW8A 1AF7A 3OE7D 2HU8A 4O1MA 3AVTA 3FHLA 3GDGA 2FZVA 1Y98A 4Z49A 4CJXA 3UXYA 3RYHA 3OZFA 3VTKA 4QBKA 2WV7A 3PJFA 1GKYA 3SVTA 3K9LA 4ZCMA 1XMOB 1IRIA 4ZVOA 1N2CA 1VE3A 1LC3A 4OHPA 4LHZA 1ZVQA 1FJHA 2VRCD 1KHTA 4MAMA 2B5WA 4N18A 3VRHA 2F00A 1Z5ZA 4BFWA 2PJDA 1CQIA 1RHJA 1W0KD 4XQ0A 4NRDA 1DSSG 4ZEOA 1KZ9A 3EXIA 1P1CA 5IW8A 1HA3A 3TO5A 1SK9A 2XYRA 3V00A 2EVWX 3AZPA 3ET4A 4FZRA 4UXIA 3UXEA 1I8TA 2ZW9A 4MS1B 4B47A 1VCNA 2QL7A 5IN5A 4KXUA 2HMAA 2ORVA 3WG9A 4C89A 2NSLA 3Q7SA 4RY0A 4II3A 1KP3A 3UMVA 1NGSA 2ES4A 2QUHA 4E5VA 4KWHA 1XZEA 1J5EB 3K2IA 2BM1A 3ZGNA 1XQ6A 2JEOA 2DUMA 3HNOA 1Q14A 4KK3A 3PLAE 4RZQA 3LSTA 1G55A 3W78A 4DL9A 2B7LA 5BW8A 2IYQA 3M9WA 3R0IA 2QLMA 5B2ZA 1KJYA 4BRSA 3KDSE 4CR8A 5EHZA 1VC2A 1VCOA 2VKTA 2GK3A 3WKEA 1AMOA 2CC2A 2FRXA 1UEXC 4F4FA 2VHCA 2A9PA 3N2LA 2EX4A 4YJGB 3VZCA 4AFNA 4DV5B 4YV7A 1DWUA 1MDBA 2ACVA 2BFFB 1X8KA 3SHFA 2AW3A 1DAGA 3VDNB 4EQ6B 4MO9A 1CDDA 2A0KA 4K05A 2GT1A 1JXAA 1RQGA 3OPYI 5JZSA 1BDIA 3TLJA 1K9SA 4LY9A 3DMRA 4H1UA 3UY4A 1AKTA 3ACBA 3AVOA 4JEIA 4CXMA 3IE1A 4PX9A 3K0CC 2NN3C 4NAVA 1FMFA 4XVQA 2WHYA 3RC9A 2HRCA 5KNBH 5DWVA 1EFKA 1WOMA 2Z98A 3WGQA 5COQA 3STUA 4D3FA 4MB0A 4CGZA 1EPUA 1HWYA 4KO3S 4YRCA 4J0IA 2WP0A 1NXXA 3FZQA 4BFXA 3TKAA 4E5MA 3DULA 4LNUB 3QU2A 5IULC 4B1FA 2F48A 2XKBA 3HR4A 4MJ3A 4YASA 2Z3ZA 3R6GA 1TRKA 5MN5A 4XWTA 4BLWA 1NHGA 4HZIA 3GGJA 3DZDA 1PG5A 1RLOA 4WKBA 1DJLA 1SH7A 2P4UA 1KAEA 2PSSA 5EKXA 1CHNA 1XI2A 2P6NA 3DBLA 3G23A 3GD7A 3OT1B 2ZAIA 3UV3A 4YMHA 5HXAA 4B3GA 1BEEA 4R8SA 1ID1A 4A8TA 4RCVA 3T3IA 1JG6A 2R7NA 2YCLA 4Y6OA 4E1VA 5EERA 4IKOA 3AT1A 1QDUA 2QAGA 3M5CA 4X60A 2VG8A 4ZT7A 4ZREA 3NAGA 3HHEA 3A3YA 4AXBA 4KDRA 3IPCA 1J8YF 4TT3A 1G2QA 3LDAA 3PNOA 1MMFB 3B1KA 3JD3A 1SZPA 3Q3CA 4KOEC 3FNRA 1FDVA 2A1UA 1KE2A 5BQ5A 2X3FA 3GUHA 5CCEA 5J2UF 2WUEA 3EXHB 3LPMA 4FJ0A 4GBMA 4R6XA 4V38A 1CEEA 3C1OA 2JLRA 2V65A 2XLBA 1XR3A 3N5CA 3C5VA 1N6PA 5MHTA 3KU1A 2ZJ7A 3KZKA 3RF6A 3ZVMA 1JYFA 1PUXA 2RKWA 1LPSA 4CLRA 1XMVA 1JQKA 3DD1A 1HE8B 3IGFA 4G81A 5JWHA 2PUFA 4BLSA 4Z9AA 2AQ8A 3MRVA 3E2MA 3JRXA 2QX8A 4LYEA 5LP6A 4Z0PA 3CZRA 3F0TA 3UWMA 1CUDA 2BFOA 5AVZA 2Q3BA 1ZIOA 1WY7A 4JQYA 1UK9A 3CB2A 4E4RA 2FYTA 4MGKR 4NULA 1Y4UA 4XTCS 1P7YA 1SC9A 2DOKA 2FSHA 1YA8A 3ILSA 3JR3A 3PNMA 1P7WA 4KAFA 5DMHA 4A27A 2DLCX 1R0ZA 4DAOA 1D2GA 2V97A 3GMSA 4ZVSA 1YKFA 3B6KA 3GLQA 3VHQA 2AA3A 5BV1A 3COWA 1OXBB 4GNKA 5EHIA 2Y1XA 4I1SA 4B6RA 2ATEA 2R8PA 3FBWA 3VC7A 4BFVA 3RS8A 2AK3A 1I0IA 1WP9A 1VIAA 1BROA 4DWVA 4ID9A 3I3SR 3F8TA 5G0TA 3H1FA 4R1NA 2XB6A 4OHOA 3K70D 3UO8B 3UHPA 1PJRA 4U2GA 4JNCA 1RPAA 3BIXA 4TRJA 3KTFA 1JQ3A 2IHYA 4CEJA 4TMYA 5BQPA 2PZBA 4M9QA 3ZU2A 4PR0A 1XA0A 3HDTA 4C3VA 1GILA 1PUJA 2A7QA 1Y7PA 4BQQA 4C4ZA 1J0CA 3QY9A 4QO8A 4OREX 1VPWA 3R76A 4YB8A 2JGEA 3G13A 1Z2EA 2RGUA 4HOYA 4DA9A 1E2KA 3GA0A 4HQOA 1P6QA 4BJHB 2YWEA 1RLJA 1DEHA 1RYHA 2Y67A 5IC6A 3DKKA 4P5DA 3RHTA 3U3RA 4HQ6A 4JLJA 3CH4B 4IX9A 1LTQA 1T3LA 1M34A 2GEUA 2ZPAA 3NBFA 1P45A 1ZD8A 4H17A 3VPXA 3NVKI 4DUGD 3RRBA 1LRJA 4XIYA 5EIWA 2NZJA 5HCIA 1MO6A 1WQ4A 3CY6A 3ED1A 3OX4A 4G41A 5DI3A 5HCNA 1SUAA 4EA6A 3SYMA 1C9MA 1N1MA 3U80A 5F12A 5F21A 5K4HA 2Y4NA 4E94A 4BPBA 1Y1KE 1E8DA 2CHGA 3MBIA 1D6NA 4L8FA 5REQA 2DERA 1GCIA 4PV7A 2TMGA 4PZ0A 1ZYUA 1BKDR 1MJGA 4OG2A 1U0FA 1LPBB 3TR0A 4YP1A 3ZDDA 1ELOA 1KYQA 3QG5A 4A2WA 2ZWIA 4MAFA 5DN9A 2KS6A 1DOHA 1Y1LA 2ZBDA 4GQBA 2HSZA 4KXNA 5F4BA 1LKZA 1LPNA 1PR5A 2G6BA 3X1ZA 1CUFA 4LJSA 3A6JA 2JLWA 4A5OA 1RKVA 2CD9A 3C45A 3LH5A 1E5XA 2FN4A 2NTNA 5FWXA 3E7FA 1OYWA 3N9IA 2R1VB 4DIMA 4EF6A 5LNK1 1QGUB 1P4JA 1ZIDA 3RC7A 2X7JA 4GYKA 4EY3A 1UH5A 2OGUA 2IE8A 4W5TA 3DC2A 4FQ5A 3R7DA 3EZ2A 4PPQA 2NYAA 2H52A 2HJRA 2FN8A 4FCVA 4L51A 5FLEX 4YJ2A 2A9OA 4D9HA 4DCCA 4LZZA 4L0QA 5JNSA 3O1HB 4MGEA 2BDEA 4NJMA 1KJNA 3V5NA 4WFQA 3RV3A 5BYAA 4KQKA 4Q7LA 1I5EA 4PSUA 1O94D 4BN0A 2J9XB 2AN5A 1N5IA 4Q47A 3ZIAA 3O4VA 5CTAA 3ZDAA 3V1YA 3C6ZA 3LCJA 1I1QB 3H05A 2ZREA 1BE0A 2G04A 1NP6A 5EMHA 3UAXA 4O0LA 1BOFA 3HPRA 4AAYA 4DYDA 4E15A 2QTNA 5BR7A 5EWLB 3CSDA 3PPVA 1DG3A 3BA6A 5DHSA 3ZCQA 2IHTA 4LVOA 4JL6A 1WU8A 3QPUA 1XV5A 4FGZA 5IYZB 1GA4A 1PGNA 3Q5GA 2BF7A 4HDCA 3TTWA 4GYJA 1MHPA 3M83A 2FPIB 3HEMA 3OUZA 4JVOA 4K1XA 4QYMA 3JYPA 4BCCA 1Z07A 1U3VA 3AO0B 1MJHA 221PA 1K6IA 1MFZA 2PIAA 2WKQA 3OJOA 2R5NA 5FHRA 1IQUA 1CJBA 1V9CA 1QDLB 2QM0A 1YZGA 3I9V6 2XCLA 5JSQA 3NFRA 1EUCB 1GPBA 2BN4A 2C54A 2JFHA 3OJXA 4PZEA 2JBAB 4U02A 5D3MB 4E7OA 1QBGA 4GX5A 4KPYA 4QBTA 1BHJA 4TKLA 2C0PA 3R5XA 2JJ2D 4D74A 5KCZA 3OEYA 5A5FA 1G59A 2HT1A 4MI1A 3CUEF 5DJ5A 1KMIY 4D0GA 5DI9A 1P0PA 1Z83A 2BGJA 5K0EA 2A0WA 4Q4AB 5MN6A 1UFQA 4MR9A 2XQGA 4JMPA 4ENPA 2ZM5A 1ZJYA 1P1RA 4M37A 5EOVA 5EIBC 5GZ6A 3TLXA 1PTJA 2QZ9A 2VJLA 1SCUB 3MILA 4L5JA 4RL4A 1P4SA 1SULA 1V4BA 3C5WP 3UFXB 1OXUA 5AVVA 5WRFA 5SZIA 4NV1A 2WTNA 1CP3A 4CI0B 3PU6A 5JH7B 2IQ5A 4PSAA 2ZWAA 4DNQA 1QS0B 1ZICA 2AL7A 4F86A 1KTVA 5BVHA 1DBWA 3CSUA 1QIKA 3R1IA 4Y7CA 1KZ4A 2WD8A 2OBLA 2ONKA 3KQQA 2C20A 4J6EA 5JCJD 3S99A 1E3EA 1MZPA 2G9UA 3VR5D 5BXQC 4KFRA 5E2BA 3NI2A 1Y9JA 4CCYB 3IV6A 1GTSA 2QUAA 2C1XA 3B5EA 1SUSA 2QJRA 2V6BA 3GN2A 3QU5A 4X91A 1YFLA 2V7TA 3C24A 2OCPA 1YCDA 3T3OA 4MV8A 3PTLA 4AJ4A 3TCNA 1L5SA 1BSVA 5HKLA 1JH8A 4MVXA 5HDQA 5B6IA 3T7SA 2W9XA 3PJEA 2UU9B 1XLWA 4QT0A 4EHJA 1WMBA 4KH1A 3LP8A 1W36D 4LFBB 3GYGA 2R60A 3G0DA 3P9RA 4YAKA 3N87A 2JFBA 2XE4A 1PLKA 1BQ3A 4DLAA 1N0UA 1AU9A 4A6XA 2JA2A 3AIIA 3MWEB 4ILKA 1JIIA 3IAS6 4X20A 3TUIC 3ESDA 4UNPA 2UKDA 4I6GA 3R8FA 4WK0B 4CI9A 5EI5A 5EMMA 2EW2A 1PBTA 3EA4A 2VJBA 1XJCA 2RHGB 4N65A 2XDYA 5A6SB 4XM2A 4KQXA 2Q2VA 4R31A 4RLSA 3IPAA 4M1YA 1YHZA 1SVKA 2EJWA 4PHFA 3IP7A 3VC1A 4RD3A 2I1WA 3KHUA 1DTSA 2PNFA 3A06A 1R6TA 3LGAA 1ZH0A 4BGIA 2HKIA 3F7TA 1NE2A 2JPDA 3MTEA 4PRLA 4LJ8A 3L0BA 2XADA 3C6YA 4KV9A 3GCXA 3DOJA 3GT0A 3K4HA 4CM1A 3FNHA 1TK2A 1J2TA 4A8JB 1VRCA 5IC4A 2DTEA 3TXXA 1SEVA 4IJVA 2PGOA 5TVKA 2ESRA 3R4VA 3F46A 4Q1AA 4QA9A 4KR9A 2D0OB 3K4QA 2QW1A 5DXAA 1L5KA 1RPZA 4HVTA 5IAGA 1BQEA 4TLMB 4ER3A 1G64A 3KPJA 1JVSA 4FILA 1JR3A 4Q34A 4ZTZB 1RI3A 4G4JA 4X7PA 5JCOA 1U2GA 1U7ZA 3KUUA 4A15A 2I9KA 4F7DA 1I10A 3IOYA 3PYXA 4QGAA 3GLIE 1YAJA 1MCZA 3RU7A 3MHTA 1JVBA 1HETA 2D3WA 2K2WA 1HE3A 3ZKAA 3TOXA 4DJJA 4MCHA 1XZPA 4MR8B 4CM5A 4OHYA 2OUIA 1O9HA 4PANA 5HJEA 2DWPA 3PPIA 2BCEA 3KNZA 3PQ6A 2MTBA 1P7PA 1RW4A 4H7FA 1TD9A 3GBSA 3CSSA 4R6WA 3R74A 3U4HA 1AO0A 2GBPA 1CLUA 5EE9A 1F2DA 1UK8A 4AJLA 3DV2A 5C52B 1VBFA 3BWEA 1OGYA 1NR7A 3WP0A 3CC8A 3MBKA 1G8JA 1OKKD 4ZKEA 2BGGA 3HKCA 1F8GA 1KPHA 1O54A 1WDMA 3KKOA 3LCMA 3I92A 4ESOA 4R7ZA 4TL6A 5DBEX 1NMEA 4YWJA 2JHCA 5KQSA 1H23A 5CMLA 1WHTB 1WF3A 2HNKA 4C29A 3C7TA 1WPQA 1BJRE 1SBTA 1CLEA 3DAGA 1OAOC 1K92A 2M32A 3HKEA 3HY6A 3UXMA 1G7TA 3L9WA 1DC6A 4TL7A 5KOJA 3IAM6 1DC4A 4Z9XA 1GZDA 1HZZA 4ZTBA 1FDWA 4ZCIA 1G8AA 1MABB 2GF9A 1F4LA 3GUZA 4BWYA 1EKXA 1P44A 2B92A 3ZNOA 3RG2A 2JGIA 1D6JA 3CX7A 1EMDA 4MDYA 5B5SA 1Z5VA 2GAAA 2GWHA 4OOFA 1YQUA 3LT0A 2WICA 3VO8A 3PJGA 1AXRA 2I6TA 4YCDA 3VR5H 2JLBA 3LWBA 3VU8A 3KSDO 3RJMA 1EAMA 1G7SA 3GU3A 1FU4A 1ISIA 1XTTA 3K09C 4M55A 4OXQA 4ZC8A 1J2EA 1O2DA 3JQRA 5ED4A 4J0CA 4OJMX 1YDMA 4RQAA 1QF7A 4G1EB 5I9BA 3ZWMA 1EI9A 5TIIA 2F8TA 2N46A 1V2HE 4IIHA 2I4TA 3G1UA 1EWRA 1EVKA 3MT9A 3OBBA 4RK1A 4FEYA 5GV7A 4A03A 4DVJA 1OFTA 2BFDA 5K3DA 4I99A 4QYIB 4MDHA 4BO5A 1MTOA 4GG1A 1W4BA 2AOUA 5LLTA 3SWWA 1V5IA 4IV5A 4UTRA 3CX4A 3UHAA 1I2DA 4C4SA 4DMUB 2QYOA 3HN7A 3V4SA 2JFZA 4YPOA 1HK7A 1KI8A 1UMDA 4JP1A 1Q44A 2GKSA 4KN9S 5D84A 4BNHA 4DLPA 1KK3A 4X66B 4GPTA 2QDXA 1XUOA 2VP3A 4NI5A 4D3SA 4FVTA 5EHGA 2A7XA 2Z5GA 1IQ0A 4F97A 2V8OA 4JHXA 3O31A 1Y3HA 4FOPA 4N3CA 1GUDA 5DTJA 4NL4H 1BOOA 2XW6A 1A5SB 1DRKA 3P2EA 4OXKA 3TMKA 2ZJ4A 4OBWA 1G42A 1TQ8A 4ZXFA 3AP2A 1P0MA 3R5HA 3RIHA 5CRIA 1G5QA 1L4UA 1QCDA 3BD6A 4KVAA 4BQIA 3A31A 4B7AA 3TLGB 2ZTHA 3DAHA 4BMSA 4QYTA 1R66A 2O8BA 4CEIB 3BK1A 2P77A 2W4MA 1SQFA 3K0CA 4Y67A 4ND7A 4GI2A 3MGBA 4GOND 3U56A 2G4CA 4LE2A 1I51A 2GARA 5JAMA 1YB1A 1UJ6A 3L7MA 3BQ9A 5JDIC 1H85A 1K5HA 2JIMA 4X00A 3ZCXA 2GWRA 2CXQA 1ZBDA 3UATA 2EP7A 7REQB 1H69A 3AUTA 2BM8A 4H6PA 2H92A 2WTEA 3WY9A 4M38A 1MT3A 3B51X 1KZYC 5AYVA 1B14A 3VTZA 4OHBA 1RSZA 1LQTA 2X15A 3K6RA 3WOVA 3ZI0A 4RVHA 5HP4A 3QFHA 2IEBA 2YR0A 1P7ZA 2RI1A 1UT5A 3KKMA 1FF9A 2FWIA 1PS8A 1IXKA 4XXHA 3URKA 3WYGA 5ADUS 3W5AA 4XSVA 4EK9A 4B9EA 1NXPA 1G21B 1PFGA 4M8KA 3X0DA 2QMZA 4LOHA 2LZ0A 2ZIVB 2JVIA 3RIMA 1SG6A 3EWIA 2NUTB 2OZPA 3COPA 4FOLA 1YTLA 1QP0A 2C2ZA 3I1FA 4OYYA 1JUDA 2JK0A 1DELA 4A2PA 3LTNC 2RHMA 1N5KA 2V03A 3KYCB 4RX1A 2AFHB 2FFBA 3KB6A 2ORWA 2V7VA 2UVPA 3FIUA 4XQCA 3KB2A 2JEZA 3WLRA 2AXQA 2BI4A 3F97A 2XA2A 4C7MA 2Q0SA 5FBVB 2QRJA 1VXRA 4WJZA 1GNQA 5LVAA 1ZSNA 2I99A 4ML3A 2G0AA 2PH5A 1RAAA 4KLAA 3P2IA 1R8JA 2H2GA 3DTVD 3FOAA 1KDTA 2HA0A 2R6ZA 4UCWA 3MWFA 3CLSD 2QT1A 4O4HB 1J21A 3SI7A 2ZRDA 1EM8A 1PEYA 1XKQA 1PT7A 1PJ4A 3ASYA 3UGTA 2B21A 4HWTA 1Y37A 3ZQ6A 1JKIA 1B3BA 1PT5A 5FWYB 1EQUA 3ZPXA 2Z2IA 3MT0A 3QMPA 3CLVA 4HEJA 3OKCA 3ANYB 5H4HA 3ZOZA 1N6LA 3E7PA 4ZOBA 3L82B 5BVGA 5C7IO 3KT0A 1YRBA 1E98A 1QUFA 4GR9A 2O7SA 3UA3A 1ETHA 1ONSA 1N78A 5BMVB 1FFHA 2UUOA 1HGXA 4HYEA 1OT3A 3ZYZA 1A7KA 4DUZB 2ZYWX 2VZ8A 2G08A 1H42A 3RBXA 2ZULA 1PR0A 3ONDA 1HC7A 2NTYC 1RMYA 2B37A 2Z6UA 1K88A 1ENPA 2IPLA 2OB2A 2EL7A 2J09A 1BXGA 3QVLA 4G5FA 1AKVA 1JDSA 4N3AA 3LXXA 2Q6VA 3T0IA 1GKLA 4KG7A 2VLBA 3LC1O 3QE9Y 1YZFA 1AV6A 1SBIA 4JR2A 4WJKB 1EFPA 3V8MA 2CV0A 3MD9A 5L4NA 1VYTA 1UMBA 3ZNQA 1HZJA 2FSGA 1VLMA 4YXFA 4MLCA 4MEBA 121PA 3TQCA 5AKHA 1A2OA 3AW9A 4EHNA 4W5OA 1LBSA 3RHFA 4FGKA 4TKUB 1CQXA 1L7VC 5DF1A 4RPJA 1N7IA 2GNAA 1AN0A 3IP1A 4HBGA 3HZHA 1B6GA 2WJAA 4Q3LA 5G02A 4B2IA 2WDZA 4PYLA 1Q21A 4RMNA 1PR4A 1HRKA 2AMJA 4RA6B 1HLDA 2VAMA 5TS3A 2ZJ8A 4INJA 2DWOA 2ICAA 2YN0A 1W4LA 1P4RA 2XWQA 1ATZA 2PZ8A 2GK4A 4XVHA 4ARCA 3HCPA 3AYXB 4LTNA 5LXTA 3T9BA 2ZRFA 3QYJA 1IUKA 3OIWA 4AP5A 4DDUA 4UNQA 1JHVA 3OEED 3LFUA 4R83A 1NC1A 4DLSA 3OZVA 1A1SA 1KQPA 2P90A 4HMPA 3BE4A 3JY6A 1SUPA 2XJ9A 5B1SA 3EUAA 1DUIA 4UU8A 3F8WA 3AY6A 2G1AA 2VHXA 4HH3C 4CIBA 2HO4A 2VS1A 3G89A 1ETUA 4MUJA 4IUCS 1HEIA 4Y2RA 4ZXPA 4YREA 2VTBA 1FK8A 1K7CA 1FLDA 2DY1A 1QHNA 2J3MA 2R8BA 1E5DA 1HNWB 3I64A 3IVMA 5I9SA 2FZ5A 1ECLA 1OI2A 4MRSA 2PSDA 3EBLA 3KB1A 4MVJE 3VU9A 2H6EA 3GCWA 1UBHS 3X1YA 1WV1A 3C6QA 1DPFA 2CFRA 1U5AA 2ZRJA 4Y98A 3AWDA 3IULA 4R51A 4CIXA 1AS0A 1R0SA 1V47A 4ZC1A 3CWCA 4ER6A 3AVWA 3PUYA 1YBFA 3QV2A 2INGX 2WVJA 3L0IB 5IMSA 1TZCA 3UWOA 3UJCA 4Y2HA 1H3FA 1GG5A 4FFOA 4AIRA 4RESA 3WYCA 4AJJA 1N2IA 1T4MA 5AH0A 1Y89A 3NM5A 4XRGA 3WJ7A 3V7YA 2ZRKA 3FUTA 2PWYA 3FHCB 1QXSA 4ZA2A 4L4XA 3TW0A 4CL2A 3PZBA 5E9WA 1GJRA 1Q17A 2PU5A 3AUSA 1Q3TA 2JJMA 1N6KA 2EHJA 3S2IA 4AB1A 3QOFA 5HRCA 2VZ9A 4ER0A 1U0LA 1ADGA 1RQ2A 2XUQA 3RFVA 3QY0A 5CU7A 5J2UA 3V1UA 1G21E 3HA5A 1G3RA 1UC9A 2VYVD 1JEYB 5JRJA 1TM2A 2D1FA 2QGZA 3P32A 4ITVA 4YPFA 4HPWA 1OWMA 4IX1A 3UHOA 1SD1A 3BA1A 4L0DA 1CUUA 1G20B 3RVMA 4P4LA 1KDRA 5B1IA 1H2FA 4DEXA 4R9VA 3O83A 2O0JA 3OU7A 4UBKA 2E1PA 2AFHE 2Q5OA 4YRQA 4HZUB 4LI3X 3D0RA 4JJFA 3ZJ5A 3KS9A 5E6UB 1G3QA 3TB6A 3VAAA 3KWMA 3HBLA 1WZIA 1XOIA 2EEPA 3B89A 4JB8A 4PRKA 5TRTA 1TZ2A 2WF6A 4MW9A 4D8UA 1B0ZA 4WY2A 2KBEA 1CS0B 5GOTA 2C9MA 2J4CA 4C1BA 4S2UA 3TZCA 4QOHA 4DLXA 1ZY2A 4FJ1A 4X97A 5AM0A 4FFWA 4TYWA 4KQEA 1E92A 2QTZA 1YCGA 1SO8A 2HIAA 1U65A 3PHHA 4I5EA 4TTTS 3S1LA 3VV2A 2JLSA 4Q3AA 3DCIA 3QYPA 1F2VA 2J3LA 1TUIA 1IFXA 1N6NA 3DZIA 2ZSKA 4A0HA 4JAVC 3AR3A 2A9VA 2OHFA 3DLCA 4CL8A 3I4CA 1H2RS 2AF3C 4X7RA 3I0MA 2XMCA 1TKAA 3C2QA 4KRXA 3QLJA 5EWMB 2IODA 3ZWYA 4WBXC 5BSVA 3EXHC 1V1JA 2GAOA 4LDPA 1CULC 2X9VA 4DQUA 4Z1OA 4P8RA 3VYSB 1PDOA 2IP4A 2WIBA 1N2XA 4XWYA 2PKWA 5DHTA 1RTKA 4ESVA 1ZCJA 4KXMA 1WRBA 4HDKB 3L4BC 3D43A 4J16A 3SM3A 3FZYA 4W8HA 4RTMA 1JAYA 4MVJP 3ZHXA 3P27A 2LCIA 4TXHA 5JBNA 3MFQA 3OJ0A 3M7IA 1ULZA 5BSRA 2KPOA 3ROFA 3JARB 3BXGA 4Z86A 4TTJA 4W9MC 1KEEA 2GCOB 2Q6KA 2WG2A 4WCFB 1FJGB 3UV6A 3FOWA 1OVGA 2XMGA 1H8EA 2PKEA 1Z0UA 4N76A 3MGAA 1JHUA 3ZK8A 4NZOA 1PL8A 2RE8A 3LBHA 4IJMA 5CG2A 1CUEA 4BMVA 3HM2A 3R41A 3OG9A 1ZVJA 1A7AA 3DHNA 4IEEA 5FOTA 4PLCA 3L40A 4FLEA 4LWQA 4IOJA 4FYYA 5CCDA 3UJ7A 3QVKA 4Z4CA 1UBNA 1SUEA 2VHTA 1FP4A 5LWHA 1E9VA 2RONA 2FFHA 1A9SA 5BRAA 3WAJA 3T4UA 2XDQA 1XU4A 3AEYA 2XBMA 1MEEA 2CJPA 4B81A 5EVCA 4QFBA 1NPDA 1NR1A 1ZRNA 3DNMA 1JG1A 3EGEA 3WQBA 1KPIA 2FR8A 3CINA 2C9CA 3QGMA 4WT7A 1QP4A 3I23A 3RARA 4EABA 4C7OA 1HTWA 3MMNA 4Q82A 1C2TA 4TX1A 1SHUX 1T26A 2OFXA 1XJQA 2VH5R 3STHA 4NHEA 5JH7F 5KQGA 5AW2A 3VH4A 1RAHA 2JAXA 1O1YA 2WKRA 2BH9A 2ZPTX 3KJNA 2PAAA 3T99A 4P3OA 3VMFA 2GF0A 1E4EA 1EQAA 1TCCA 2OTCA 4GOXA 3SF0A 5EJ5A 5T64A 1M73E 4M2LA 4HS9A 3CZQA 4X45A 2OECA 1ZX1A 4D8YA 9ABPA 2LXNA 3IMCA 3PXAA 3CXUA 4FDAA 4IUYA 2G1JA 4IVRA 4B35A 1A4UA 1D5CA 3OY2A 2UDPA 1T0UA 4LYHA 4A6EA 3H2SA 2QD4A 2CEKA 1JIQA 3LPDA 2JAHA 4ZD6A 2AJBA 2EIHA 3RS7A 3RW9A 1KZ7B 3AW8A 3FPKA 1N2BA 4BMYA 3J7AC 4YJFA 1XNHA 3F4LA 3W9SA 1DLIA 4Q19A 3QKRB 4NU5A 5DTMA 4JODA 3WHPA 4C3ZA 4HLUC 2OMEA 3NHKA 3CN7A 3AJ8A 2HA5A 1U2RA 4KXLA 4GMGA 1NQAO 3KXDA 4QE3A 3AGPA 3G79A 2VDQB 3R77A 4WJLA 3QRWA 1GUFA 1M2NA 2WYWA 1VM6A 2VCEA 1AHPA 1D0VA 1JHDA 2Y1FA 2FDXA 1GZ3A 3C8ZA 3NHPA 1RI4A 2AR7A 3KG2A 4ZO8A 2O5CA 1EX9A 4C4XA 5CH8A 5IAJA 2F9MA 3T3DA 4BV9A 4IH4A 4M6WA 3DV0A 2G6TA 3OZXA 4NS1A 5UKDA 1GTZA 1SVOA 4A1FA 3FKJA 5ALWA 4ZI7B 3HXMA 1CV2A 2QRGA 4D4GA 1C7FA 4IFBA 4UD2A 2NPIA 4WKGA 4Y2QA 3DBRB 3ADCA 2HJ9A 1ILWA 3I53A 3WIUA 1G20E 1QHGA 2JFVA 4HPXB 4IQGA 5DIFA 1BW9A 4D82A 4RA9A 1N5LA 1RP1A 2WAMA 3DUFB 4FMDB 1LDMA 3TQIA 1X39A 1II8A 2G72A 4C1NA 1C9YA 1VJRA 4X71A 2Y2UA 4YV1A 1AKWA 4NQRA 3N2KB 3UHJA 3UFBA 1RWVA 3ND6A 5F23A 1S1MA 3AHJA 3PR3A 1NF9A 3HVUA 4HATA 2DR3A 1AURA 4CKEA 2JCXA 3P9SA 1LRLA 2A1IA 1DCTA 3PYMA 4FKMA 2YJGA 2G5PA 3GCZA 1PAUA 1OXMA 3HJFA 2NUPB 4KFTA 3LQKA 1MB0A 3NVMB 4LKRA 5AJZA 4Z1MA 2C94A 3W6OA 1FU7A 2PGIA 3ESAA 4E09A 4N1AA 2B34A 2WYHA 3PGVA 2QXTA 3NANA 1BRMA 3PCXA 4ZQGA 2IYSA 1BH6A 3ESYA 4H16A 1YQXA 2FSSA 1MH9A 2GDJA 4B0PA 1RRVA 2ZI6A 3B7PA 4LBVA 4XPIA 5DNAA 3AUFA 4REQA 4N7JA 1MF7A 3UAOA 4F9EA 2BFEB 1Q3KA 1Q19A 3ECSA 3FDIA 3RUAA 1FW8A 1I6MA 1XQ1A 1M83A 2J5QA 2J4FA 2YV3A 4HH1A 4KJXA 2NU7B 3GW8A 3QLEA 4N3NA 4DTIA 1ES9A 1GNRA 3LO5A 3TRJA 4M1OA 2OA0A 3WXBA 3LYHA 1BKYA 1D9XA 3U4AA 4ALKA 3WLAA 1V96A 3C4JA 2QRLA 3REFA 1YE5A 4DLZA 1S8OA 1CVLA 1KY4A 1W85A 2WG1A 4D9KA 3DFIA 3KZNA 3ZR4B 2XGMA 4OQ4A 5HPYB 3BCSA 2GUGA 2HPAA 2HTFA 2PEZA 4MO2A 4YAGA 4ZOQI 1KK2A 4KZKA 5E2IA 4DV6B 2PT6A 2EW8A 4Z4EA 2H7VA 2IPAB 4JOCA 1DQYA 2EDCA 2QJFA 4PCAA 3A9RA 2XUFA 2BSXA 3QE0A 3RJ5A 5JHHB 1OXKB 4UVDA 2W6JA 3MB5A 2HQSA 1O4VA 4BNDA 3I6IA 3GHHA 4L4YA 3NV7A 3KQLA 3INGA 1S3GA 1RAGA 2BV3A 3E48A 1NRXA 3AILA 3EEBA 3ZWXA 3KVOA 1JR6A 1YJQA 2A30A 1G2PA 2HBRA 2WW8A 5D8DA 5G40A 4RELA 1JU4A 3LHIA 5JSZB 2GEFA 3ZDRA 1Z45A 2HPZA 3KT8A 2VDJA 4DDKA 5CUQA 3RSCA 4XYEA 2QRMA 5KSPA 2G07A 2J3HA 4AX8A 2ZRGA 4AJ2A 2VYNA 2XXAB 3ESXA 5BYJA 3MXOA 2AH5A 1QCZA 4L07A 4WPGA 4BFTA 2IBMA 4ZHQB 1AQNA 2J9RA 3BMNA 2GILA 1EVIA 1B2RA 2CY0A 4IDCA 4J6FA 4R68A 5CDSA 1I6WA 1W96A 4IV8A 4BIMA 2G28A 4DV2B 1K7SN 3Q5EA 1P1KA 5JQGB 5CW1A 5ELXA 1MJGM 3BG5A 4GC9A 2PUCA 4G0VA 4RQUA 1V11B 1FEZA 2WMYA 2H48A 3EJ6A 3LLUA 5AVKA 5TARA 3Q1LA 5JYBA 4X65B 1Z17A 2QTGA 4ZYTA 2BEWB 2IIQA 5F4ZA 4E14A 1KQFA 4NBRA 1IBRA 3IYLW 1YC2A 1PJQA 3D7KA 1A1VA 3K9NA 4H7IA 3MUNA 4X94A 5TV2A 5CDGA 3HGQA 1HLFA 3AZQA 4O4JB 3UJ8A 3HGMA 4JT4A 2C4KA 2XXBA 4MVJF 1ZW6A 4BVJA 1SQ5A 1PGPA 1AQYA 3P52A 1OFUA 4CM8A 1YBVA 2JVJA 2FMKA 1ZUNA 2V6GA 4GR4A 1DC3A 1C41A 2PLNA 3FI0A 2ZYTX 1WU7A 3IEKA 1BA2A 3KZOA 4C7KA 5KO2A 3GX1A 2AZ4A 3Q3IA 1M7BA 3A1VA 3IUSA 1M0EA 3IBGA 4B17A 4DPLA 5IVHA 1PNTA 3H4IA 3PC6A 5CYFA 3ZQJA 2WLSA 2P4QA 2RK4A 5L9AA 2C2KA 4LDRA 4M0MA 2QZ4A 1TTPB 3K8QA 2BEVA 2XF2A 3LK6A 4A8JC 1XPOA 4HCJA 4QJIA 2PUEA 2Y3IA 2BY4A 3RSFA 2FGKA 3AIMA 4KJZA 4YP0A 5EJGA 5CFNA 4V1CB 3SC2A 4ZOEA 4KQ1A 3FF4A 1L5NA 2PKCA 5CB8A 1E3WB 2JG3A 3DW1X 3TVTA 3WGJA 2E4ZA 1LU9A 1NDHA 3C15C 3Q3EA 4JT8A 5ENZA 3U37A 4RY2A 1UJNA 1NVGA 1PFYA 4JBIA 4M46A 4L9SA 2HB6A 3KVYA 4DWJA 3HYCA 4CGYA 1P9WA 3O90A 4PYKA 4DDMA 1ZXXA 2HWYA 4UDYX 3ZEIA 5HF9A 3WISA 4C0JA 5ABPA 2HADA 1T29A 3LNCA 3PE4A 5JXHA 4RJLA 1Z35A 4D42A 4JBLA 3DL2A 3OWOA 1FQOA 5FI0B 2TMDA 1THZA 3ZY2A 2RI6A 1K06A 3FJYA 2JGJA 3B1ZA 5BN5B 2PL9A 3OQVA 4GWKA 1GLNA 2RGNC 4QUKA 3TEFA 2XWJI 2I7CA 2QOEA 5ILOA 2HDNB 5JLJA 2VAPA 3TM4A 2QRVA 1JDZA 3V8NA 1DB3A 2RGWA 2CL5A 1CK4A 2UAGA 3C6BA 3KAQA 4P54A 4O4HF 1A4RA 2FW6A 4TM7A 4F85A 5BRNA 1M6HA 5L8VA 2H07A 3SAJA 1U1GA 3E23A 1AZWA 1ZBQA 1UPTA 3L8CA 2OHOA 4JC4A 3BHMA 3DE0X 1XLVA 5BMVF 1UFRA 3RAGA 3S2SA 2MSWA 5CB4F 4KVZA 3FCEA 4XIFA 3SSNA 4XI9A 3LVQE 1ULBA 3FOCA 4K86A 3T54A 1DEXA 1TVKB 1RZRA 1P9LA 2B20A 1H3EA 2EJBA 4BEVA 3ZDCA 1KI1A 2EXXA 4JUCA 1CKEA 2CLKB 5H81A 4C7BA 2Y76A 1LJ8A 2XOEA 2IU6A 4MS1A 4HDOB 1T2CA 4JC5A 4UHBA 3V7UA 1KDOA 1DVRA 4KDCA 3ZVNA 1VSBA 3BTSA 1I4OA 5EPOA 3K35A 5DX1A 4R2KA 1I2ZA 3K4PA 3O84A 1VPLA 2RGXA 2YYYA 1TYCA 1IAQA 3PENA 1GDTA 4AU1A 4ZZ1A 1RJWA 3B5IA 4M0EA 2E5FA 3HCRA 3LCVB 4QUBA 3VR4H 1FRZA 4B09A 2YX1A 1EP3B 1E1MA 1F1BA 2WZQA 2V6JA 4FCTA 5BWBA 3QTLA 5CBKA 2IOFK 1MA0A 1FP6A 5C81A 5CX1B 1NI3A 4M0CA 4YJKA 3FJOA 1R50A 3G0CA 1T0IA 4Z9BA 3DBOB 5H1YA 5CVUA 5T4FA 4Q4JB 3U44B 4RYLA 1MD9A 3EPLA 4KH0A 5HG0A 1L5QA 4LRSB 1GO2A 2BFFA 1GEEA 2GN0A 1L7DA 2VUSA 4EQ6A 1OZAA 1NJSA 5B3AA 3U3KA 1ISSA 1F4PA 4CCAA 1W94A 2WVHA 3KYIB 1NN1A 5IVDA 4UDNA 3K9BA 1E0SA 1IVNA 4J91A 4JX8A 3AGQA 5AHWA 1DQNA 1HE5A 3PITA 1W46A 1QAQA 2IY9A 2CV1A 4NK5A 3ETGA 3L8DA 4J43A 2H8GA 4RD6A 1Q0SA 2QBYB 5KYVA 1EZZA 2REOA 4TLCA 2AN1A 4ODIA 1GT91 2BGTA 4TN5A 3NM6B 4WW0A 5BV7A 2ZBEA 1RFLA 3V3TA 1M1XB 2DZDA 3TRKA 2BUAA 1HNZB 2FHSA 2M6SA 1GSHA 3HADA 4KXWA 1ZWKA 2BUCA 2EZUA 4DCTA 4PR3A 4KQFA 1IOWA 1NV8A 1ULHA 5B7NA 1S8AA 2K4MA 3BBLA 3B3GA 5LB2A 4LY0A 4YC7A 5JXGA 3V8VA 1VPTA 1SBHA 3N3AC 3RRZA 3RUEA 1Z3IX 5CX4A 1YR9A 3OT1A 3W77A 4YRFA 2OLEA 3ABZA 3EGOA 4WZBB 1JGTA 3L0YA 3QBTA 4V02A 2FG5A 1H0KA 1PR3A 4ZCRA 1MVOA 5EAIA 1R1DA 4JVSB 5TVGA 3BMCB 3I72A 1Q22A 3MLEA 4E46A 4M1WA 5A5EA 1T10A 3D7LA 4YMLA 3R7BA 1O0BA 4WCDA 1B2LA 3QWAA 3ANLA 4EGJA 4AO6A 4EX7A 4EG0A 3HY4A 3A9TA 3EXFB 3UOWA 1RPNA 1BDHA 3L8EA 5FV7A 1BXKA 1S89A 3VHXB 1QYRA 3LD9A 1PHRA 3QUQA 3UW1A 2QTVB 3DJYA 3H11B 2CW5A 3KWJA 5CVCA 3GGOA 1I0LA 3DMNA 2OQ2A 1C8LA 2WHEA 3AG5A 1FTQA 3EXHA 2J1LA 2DT5A 4LCBA 2ERXA 5EE1A 5EZ5A 2WTUA 3FUCA 3W2HA 5MFZA 3JALB 5I7SA 4MPPA 3CPEA 4EUKA 4MRMB 5G3YA 4PSCA 4LXXA 5FPPA 4FKBA 2ASVA 3LA6A 1TGVA 2CMDA 2CKMA 4JBYA 4OQZA 4FYKA 2H5LA 2F17A 5G2OA 3DA8A 3E58A 1I0ZA 4H77A 4C0AC 2IEIA 3O9ZA 1D2CA 1VCMA 5KAMA 1P1HA 4EG4A 5HJ7A 4G0QA 4K6CA 3QPBA 2B4KA 4P08A 4RFVA 3GAMA 5K2MA 4L7QA 3A14A 1BX1A 1IIBA 3LYLA 3A36A 3R0JA 5BORA 5C8XA 1Q11A 3AL0C 1HORA 4AI6A 1W88B 1JWAB 2BD0A 4ZU3A 3RK4A 3EXG2 3VU3A 1KKMA 1X80B 2V5AA 2ILVA 2RAFA 2IEDA 3RYCB 1IMJA 1J39A 4QPJC 2XRZA 3BSWA 3DJFA 4HFMA 3ENKA 2JZNA 2XUPA 3X43A 1SBCA 1ZMOA 4D9NA 4EPRA 1YBHA 1GNSA 1YZ3A 5J40A 3F74A 4RAOA 3RAPR 2RHDA 2ZQ5A 5EXSA 2QNRA 4P86A 4BE9A 1JPNA 1Y8QB 3NEYA 1Z2DA 3E9QA 3WLTA 4F92B 5JZOA 3T3GA 1ODJA 3DD5A 1I3LA 3HO8A 3MGCA 4KVFA 4L8GA 5HGJA 4JBGA 1WUTA 2TYSB 1YNOA 1EGMB 5J47A 4BP9A 3Q2IA 2JGFA 2MSNA 2X23A 2AHRA 4UTXA 4WFKA 4DIFA 2C96A 2CN1A 1ACJA 1NVFA 2MDTA 4E2WA 4WH0A 1CY1A 2YWXA 3G17A 5E9JA 1MAAA 2B1IA 3HDQA 1Z68A 4DSUA 1HOXA 1AKQA 1IHUA 2UVDA 3T1QA 3DHYA 2WTMA 1D4FA 4G23A 4O4IB 4NOMA 1DFIA 3OOSA 5ITSA 2C04A 3WIBA 1E7RA 2FV8A 1H0HA 3LFTA 3P0EA 4NFHA 1PJTA 1YJXA 3EMKA 1USVA 1S4MA 4M87A 2C9OA 4KPEC 2HY7A 2A0FA 3SZLA 1TM7E 3PUIA 2QSZA 1PQ4A 5EJAA 2H4YA 3BMQB 2D5BA 3FTCA 3IELA 4TWRA 1CRLA 3TFQA 4ALMA 3Q2KA 5LKRA 3H0CA 3LPCA 5FR1A 4DA4A 2GPSA 2PM8A 2GEJA 3RJ9A 3FGOA 1NMYA 4Q39A 2HWWA 3VH3A 4HLUA 4TMFA 3WMGA 4D41A 4WQMA 1Y1RA 4IVPA 5H80A 1JXQA 2RHBA 3DAPA 2AMVA 1GPKA 3ZE7A 1NNEA 3NALA 4Q03A 1H3NA 3SHTA 4F2PA 5K8LA 3ANMA 3LQQA 4ZJZA 2J0UB 1XVIA 2QPAA 2PPLA 2ZUBA 2EKPA 2IYEA 2MMCA 1Z9BA 2OPBA 4C05A 1EP1B 4RTNA 4EPXA 2ZRBA 4FR0A 1RTTA 3RUIA 3FDZB 4I4IA 5E0KB 1Z6PA 1T5SA 3ND9A 3CQ9A 2IXGA 3VNSA 3INYA 4WXMA 2O2YA 5J58A 4CKZA 4FONA 2VBGA 2JKZA 4RPCA 4TWJA 1N6HA 2R1VA 1Z4MA 4R1TA 5FJIA 3EDQA 3RYIB 1CT9A 3QW4B 4JMLA 1QGUA 2IP1A 2QN3A 3HVIA 4IDEA 4FEAA 1N6OA 1NMSA 2P5TB 4BB5A 1QGDA 3G3EA 3DYBA 3O4HA 1YZQA 3FTFA 5EZQA 1U0SY 2BMVA 4WNAB 5I4KA 4Q7MB 2ID9A 1D1PA 2HQRA 1O97C 2XR1A 4MQ5A 3NDJA 1CDEA 4QU5A 3PT9A 4FUQA 4Y0VA 1PWYE 4B7UA 2RGBA 5EJ8A 3HJBA 1PVVA 2C61A 5EGNA 1OB2A 1U2DC 1AZLA 2D1RA 2M6LA 4R1QA 2OAQ1 3MRSA 5JUWA 3PPYA 3TLBA 4QBGB 4ES6A 4WZBE 1XZIA 4F96A 2YCBA 4IDDA 1UBRS 2BLNA 4D8VA 4N7MA 3N8DA 2CUNA 4B44A 5AKIA 5H59A 2C2YA 3PNSA 4REMA 4EZBA 1OBVA 5JXIA 4DR7B 4PXAA 2JFUA 1CDZA 4JZKA 4FT2A 4N0MA 5EWLA 4W8OA 1Z29A 4HDAA 4INOA 4COOA 1K4KA 5HOEA 5JYEA 4ZMBA 4ZYZA 3BGVA 4I46A 1OY1A 3WIEA 4DM4A 4QT4A 1KY3A 4ZI7F 4OQXA 2R751 5FFMA 1U0HC 5JZ9A 3HBFA 4ZAFA 1MX1A 1YJAA 2FPIA 2PXXA 4EHHA 1YBMA 1PQYA 1AKYA 2VJNA 4HB3A 4I8IA 1EUYA 5LL6P 2Q62A 3QFTA 4FMDF 4JV5B 3SQNA 1EUCA 5CT6A 4RANA 4MV1A 5D3MA 2JBAA 1OR8A 4IF6A 3VSEA 5DSTA 3EQ2A 4X64B 3IQXA 5JS2A 1WCIB 3TIIA 1P9OA 5BUSA 3U09A 1PVDA 4P3PA 4B4UA