3A04A

Crystal structure of tryptophanyl-trna synthetase from hyperthermophilic archaeon, aeropyrum pernix k1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
367
structure length
367
Chain Sequence
LDPWGAVEIKDYDRLLRTFGIRPFSEVLPLLRKAGMEPSFLMRRGIIFGHRDFDKILEAKARGERVAVLTGFMPSGKFHFGHKLTVDQLIYLQKNGFKVFVAIADAEAFAVRRIGREEAVRIAVEEYIANMIALGLDPKDTEFYFQTNRGTPYFRLIQLFSGKVTAAEMEAIYGELTPAKMMASLTQAADILHVQLDEYGGYRHVVVPVGADQDPHLRLTRDLADRMAGVVELERPASTYHKLQPGLDGRKMSSSRPDSTIFLTDPPEVARNKLFRALTGGRATAEEQRRLGGVPEVCSVYHMDLYHLMPDDGEVKHIYTSCRLGKILCGECKQIAWEKLERFLAEHQSRLEKAKTIAWKLVEPPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1
rcsb
source organism Aeropyrum pernix
molecule tags Ligase
total genus 140
structure length 367
sequence length 367
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3a04A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3a04A01
1JIIA 5K0TA 3H99A 2CSXA 4HJXA 3K9WA 3FOCA 2WB2A 4MW0A 3PRHA 1RQGA 3ZXSA 3D6UA 1NP7A 1Q19A 3VGJA 1SURA 3SZ3A 1COZA 2D5BA 3LCJA 2X1LA 1F4LA 3RHSA 3ND7A 3KT0A 3AG5A 3P52A 4UZFA 3FH0A 4PBTA 1M8GA 1HYBA 3X1MA 3IUEA 1J1ZA 1U7DA 5DB4A 4NATA 4NAHA 3CLTC 1XNJA 5J58A 4DDHA 1EE1A 1YUMA 2A86A 4MAFA 3ZUGA 3FHJA 3SP1A 1FYDA 1I6LA 3D6VA 3GUZA 3RK0A 1PFWA 2DETA 3N2YA 2BYTA 2EJCA 1EFVA 3G59A 2D13A 1JECA 1JEDA 4KPUA 1X8XA 2E18A 4PBRA 4MUNA 2HMAA 1MAUA 1ZH6A 3SEQA 3A4IA 1VBMA 1TEZA 1TYCA 2X3FA 3IODA 4MW1A 2A88A 4PBSA 5J59A 3PNBA 2H29A 1NSYA 2DR2A 4MLPA 2O8VA 4BWVA 1U7XA 1N2GA 5IJXA 4K03A 3ZXIA 4MW4A 3AG6A 4MWDA 5J5AA 2WSIA 1K92A 2G36A 1O94C 1YUNA 1TFUA 1PFUA 1GLNA 3SYTA 5BNZA 4FZJA 3G6KA 3AKZA 2GM3A 2JANA 3NV7A 3H05A 5TS2A 2NZ2A 4L2IA 4TS1A 1T6YA 1UFVA 4MUIA 1R6TA 5TEWA 2PZ8A 4MWCA 3TQOA 1J09A 3DLAA 3ND5A 4AQ7A 1JILA 1CT9A 2AZXA 1P7PA 1J20A 4MW2A 3IDFA 5DK4A 1KQPA 1WXEA 4RUKA 1EUQA 3U1VA 4YBRA 5FO1A 1KR2A 5DASA 2RE8A 4MUFA 4EG8A 4HK4A 1TYAE 2J08A 2ZP1A 2C5SA 1NUQA 4ZCPA 2TS1A 2IELA 3M5WA 4CT0A 1J21A 4CDNA 1R6UA 4ARCA 1WJGA 1EXDA 4DDMA 3ZJVA 3KT3A 1Y42X 2WQ6A 4DE5A 2J4DA 2Z08A 2PZBA 3CR8A 4E1AA 4H3SA 3LOQA 4ZCTA 4KR7A 1WOYA 3TZEA 3CLRC 2CV2A 1NUSA 1Q77A 5HG0A 2QUIA 3MUEA 1QRUA 3ND6A 1GN8A 4G5YA 1KQOA 1GTRA 4ND6A 2A84A 1Q15A 1MBZA 2O5RA 1G59A 1N2EA 1NI5A 4MUEA 4A91A 1QNFA 3NBKA 3CLUD 4MVYA 2D54A 1IQRA 1NZJA 2BTEA 1OWNA 3H97A 1T6XA 4MUGA 2WQ7A 4F3RA 2AG6A 1ILEA 4EG4A 4MVWA 1NUUA 4AS1A 3SZGA 3BL5A 4EG5A 3CVVA 1XNHA 1N2JA 2H2AA 1O95C 3UY4A 4MWBA 1KH3A 1F7UA 1D2RA 2JAXA 4MUKA 2A1TS 4MUHA 2V0CA 3H9CA 3RBAA 2J5BA 3MLAA 4G6ZA 2CT8A 1MOPA 4J76A 4Q16A 1IRXA 4QBTA 3KT8A 2ZUEA 2CYAA 2GKSA 2J07A 1OWMA 2CYBA 1KAMA 3IMEA 2A1TR 1T9GS 3FETA 1EFPA 2EL7A 4I6JA 4MW7A 1PG0A 4ZCQA 5LM3A 1WXGA 4U63A 1JIJA 4OUDB 3FG9A 3H9BA 5KCMA 1KQNA 1N2IA 3OP1A 2E89A 5HUHA 1N3LA 2V0GA 1QQTA 1T9GR 4ZT3A 3AL0C 4UZEA 1NUPA 3CVYA 1H3EA 1EFPB 1ZJWA 3COZA 3HL4A 3N05A 4R2LA 3IVXA 4PY2A 2XRZA 4G5FA 2QUJA 3QTTA 1WQ4A 3Q10A 3COWA 3F3MA 2VTBA 1O97C 3UC5A 1J70A 1IH8A 2Z09A 4P2BA 1FFYA 5IHXA 1WKBA 1ZH0A 2QTNA 3CLSC 1MC1A 1K4KA 3ZGZA 2HGZA 4XFJA 4MQ6A 4MW9A 4XSVA 3AIIA 1K97A 1B6TA 2VTBB 3CLTD 1O96B 1DNPA 1QRSA 3TZLA 1WY5A 3P0JA 1H1TA 1N78A 5AHWA 1I6KA 2QJTA 2A1UA 3HMQA 1K4MA 3LE8A 4MUJA 1I6MA 4K0RA 4WSOA 1JIKA 4DLPA 3RK1A 1N2OA 3CVUA 4MVXA 1JGTA 1QRTA 3DV2A 1MJHA 4JFAA 2DLCX 1LI5A 4EF6A 5LFAA 1A8HA 1BS2A 1N75A 4U8HA 3UMVA 2A1UB 5K0SA 1VLHA 3IMCA 4YP5A 3ELBA 1V47A 1M8FA 5H7XA 1MB9A 1JEEA 3ZIUA 1KP2A 1M8JA 2OQ2A 1OBHA 3IH5A 3HV0A 1G8GA 1JHDA 3INNA 1H3NA 5KHAA 5TEVA 2HZ7A 1LI7A 3ZJTA 3IVGA 1O94D 2DERA 2AKEA 3FWKA 1GAXA 4ARIA 1G8HA 3CVXA 1KH2A 4NX2A 4JZYA 3QE4A 4GU5A 1N2BA 5DEOA 1N77A 2YWBA 3HZRA 1JZQA 1IQ0A 3IVCA 1LW7A 3RFFA 3DO8A 4CQNA 2CUZA 1OWOA 1I2DA 1KP3A 3FIUA 1IFXA 4HPWA 3OTWA 4MVCA 4JXZA 1PFYA 3FI0A 4YP7A 3I05A 4I6EA 4KR9A 4U7JA 3HGMA 1KAQA 1KH1A 4F4HA 4QREA 2PZAA 3VRHA 4HJRA 1IVSA 1T6ZA 1U0BB 3RJZA 4ZT2A 2YXNA 2YY5A 1JMVA 3CA8A 1KKUA 1TYBE 4XFDA 3G5AA 4OUDA 2QUKA 4MWEA 4ZCRA 2XRYA 2X1MA 3SDBA 1MAWA 3ZJUA 1F9AA 4NAUA 1YI8A 3P0HA 1MRZA 2DXIA 1YIDA 4WNYA 1PG2A 3Q4GA 1O0CA 3CLRD 5HUJA 4NZPA 2QJOA 3IOCA 3PXUA 1M8PA 1VBNA 3NBAA 4CDMA 2B7LA 4JYZA 3C8ZA 3PNYA 1JZSA 2A7XA 3PNVA 3JXEA 1QU2A 3ISJA 3N9IA 4MW6A 1G8FA 1IHOA 1WXIA 3X1KA 1OWPA 1XNGA 3TS1A 2QTRA 1Q11A 1J1UA 1NYLA 1GTSA 1O0BA 4S1OA 1O96A 2PFSA 1YIAA 1R6XA 4ZT5A 3KFLA 4YMIA 2CV0A 1M8KA 1EFVB 1OWLA 1WXFA 3N8HA 1ULHA 3MXTA 3X1JA 1V8FA 4KPUB 3QTBA 4R0NA 1U3DA 2R5WA 1WQ3A 2PG3A 3TNJA 3FDXA 3A04A 2QJFA 4NDAA 3COYA 2CYCA 1EJ2A 4Q93A 4DNXA 4KR6A 4J75A 2PXHA 3E27A 1O95D 4EG6A 3L92A 1N2HA 1O6BA 1ZUNA 4ZT4A 4EG3A 3P0IA 4EGAA 4EFKA 1GZUA 3HFJA 4OJMX 3COVA 1MB2A 2QTMA 3UOWA 5F23A 1O5TA 1U3CA 1XJQA 1QU3A 1VL2A 5JBNA 1PFVA 2OV4A 3KT6A 1IQUA 4R2MA 3CLUC 1F7VA 1QTQA 1WXHA 4ZT7A 2DUMA 3Q12A 4EG7A 3S3TA 5KWVA 2CV1A 4JXXA 5H16A 4MULA 3IUBA 3IOEA 4ZCSA 3FNRA 4DJAA 2DEUA 3GLVA 3IOBA 4I6GA 5TGTA 2NSYA 3VU8A 2JA2A 3IMGA 1QJCA 1OBCA 2PIDA 2YWCA 3DPIA 4L2IB 5FNZA 4ZT6A 3TQIA 4KKVA 2ZUFA 3A2KA 2QUHA 1NURA 5EKDA 1N1DA 3A05A 1M83A 1GPMA 4DDKA 4MW5A 1M1ZA 2GOYA 2VXOA 2Z3VA 3FY4A 2IJGX 3ILVA 2DPLA 1KORA 4RPIA 1WZ2A 2IP1A 4EG1A 2X0KA 3UK2A 1NUTA 1H3FA 5LLTA 1O97D 3AFHA 1OD6A 3CLSD 3MMXA 2E21A 4GRIA 1VBKA 4ND7A 1X6VA 2CFOA 4X0EA 3CVWA 1EUYA 1TQ8A 2A4MA 2E0IA 3K32A 1S4MA 1YULA 1TYDE 2I1LA 2J09A 3GMIA 3MLBA 4QRDA 4YP6A 3SEZA 3L93A 5FO0A 2RD2A
chains in the Genus database with same CATH superfamily
1YGPA 4BO1A 1IUPA 1DAKA 1NAIA 4BE9A 2GFQA 3A1TA 2FDRA 4AUNA 2BGIA 1QZUA 4IH9A 2KI5A 5GZ3A 3A1EA 2VP5A 3EC2A 1GZHB 3LUGA 4KLNA 4LEIA 2I3DA 4QKQA 1DJOA 1SURA 1ZGZA 1HTWA 2FZVA 3H4MA 4HDRA 4L9AA 4M98A 1FVFA 3BBPA 4D57A 5I8ZA 3ICPA 1P7VA 4J0CA 1GUDA 3DDHA 1NNEA 1PSDA 1F4LA 3AVPA 3L07A 4YJ2A 3ERCA 3P52A 3IPCA 4QGGA 3UG6A 2OKGA 3FYHA 1BGWA 2B9EA 1V1RA 4TS3A 3K1AB 2QMEA 4BN4A 4Z54A 1CUVA 4CLRA 5KPJA 4I55F 1JPUA 2YJZA 1GQQA 2EIXA 1QZ3A 5A3SA 3CJQA 4UUAA 2B25A 5AR1A 1HQCA 2Y2UA 4YJ2B 2WTNA 5ERXA 4N47A 3V8RA 2B4KA 4DMMA 2NU6B 4DT1A 1LRLA 4HZUA 2WWFA 5KKAA 4F3TA 1L4NA 3QEAZ 3ABZA 4UBNA 1QF7A 2OFPA 2VHVA 4RVHA 3L8MA 4D4KA 4IO1A 2QKYA 1V39A 2YASA 1MNAA 4K8RB 2QN9A 3T38A 5CA0F 1I7SB 3SNHA 1Z6QA 3BFKA 2ZETA 3JWGA 1PR9A 3D3WA 3UWKA 5BURA 3VI3B 3COJA 1V5FA 3H0CA 1BQEA 2TRSB 2GEFA 4L07A 3R0ZA 4MQ5A 5B1DA 1QS0B 2GJ8A 1PT6A 4KJZA 3RS0A 1WABA 1SC3A 3NH9A 5CFZA 1EE9A 1CQIA 5DN6A 1Z37A 4ZDJA 2W2NA 2PANA 1XU4A 3CBQA 4MW1A 4PBSA 1F0KA 3PYMA 2R8PA 4ZALA 4ZU3A 5FTWA 3RG2A 2H31A 2XD4A 1BTOA 1ZOIA 2CUNA 2JKYA 3ZHZA 3JYPA 4IFBA 2VZ0A 3KUUA 4R7TA 3IT1A 4Q18A 1CUEA 1NJ5A 2VR1A 1Z2AA 4Y6LA 5ALLA 1A9RA 3Q1LA 2QZZA 5JCZA 5KWEA 5IJ9A 4ZIRB 2FRXA 3NO4A 1IULA 4LK3A 1QYCA 4ZU6X 1DUIA 2YN4A 3F49S 4ZQHA 4EMBA 1X80A 3A25A 1PNQA 3UZUA 1T1RA 3P0RA 1PX0A 1ZMOA 4TM7A 5AESA 1QG0A 5F4ZA 3G5TA 2P9GA 3OJXA 2OHFA 2BIFA 1GTL1 3ER6A 4HOYA 2Z2YA 3QXJA 1Q6YA 2I34A 2BUCA 3TPZA 5CB4B 2BSAA 1DXYA 3PXAA 4Y18A 5AOAA 4Q4JB 3EEYA 1OI3A 4TV9B 4IEEA 1VIAA 5ICFA 3OFJA 1R6TA 1OXMA 4L8YA 2O1WA 4ZOLA 1XMJA 5AKLA 1IY2A 4INJA 2OCAA 2ISSD 3ZN2A 1CUWA 2R2GA 3NWOA 2XH8A 1DVRA 3ADOA 1MC5A 3X1DA 2A4KA 4P58A 1EXMA 1SCNE 1HMYA 4K2HA 1XGKA 5JWOA 2TMDA 3GJ3A 4UDNA 1TM2A 4DIUA 1G60A 3IDFA 1TK3A 2Y93A 4FD3A 4DIDA 2XOKA 2G1KA 3U3DA 4ZMSA 3OWOA 4LSGA 3WGKA 2FW7A 3H3JA 4IILA 3MT8A 4X94A 3P4UA 5DN6D 2KJQA 1UBEA 1S5PA 5DSXA 4LX8A 3WIUA 3H5AA 4HK4A 1F2TA 1XTJA 2EJTA 5KNBH 1MDBA 5CURA 1RABA 3PRKE 5AI4A 1J0BA 1OMOA 1R4MB 3Q9NA 1EWKA 1FRVA 1Z5OA 4FP9A 3E3NA 1DLIA 3H3XA 2C7RA 3WKEA 4WLUA 4UEKA 4CDNA 5JQWA 3ZWXA 1V8BA 4S0XA 2H51A 1CY8A 2ISCA 2YFHA 1DJMA 5JZVA 1SXHA 3G49A 2EX0A 5CFPA 3AIMA 4CIYA 4E1AA 5JI3E 4RELA 3CF6R 5I48A 1BCSA 2CDNA 1I4OA 3F9RA 4PLCA 1XZNA 4MV6A 1J39A 3K1ZA 3F5QA 3GG9A 1WHTA 1IBCA 2RJ3A 3L7JA 4YQYA 1AF7A 4RK1A 2PRJA 3ND6A 5CK4A 4AYXA 1NIPA 1WMDA 4LC0A 4IO0A 4X3PA 4Z8XA 4ZMRA 5BT8A 5BOVA 4LWZA 4D7AA 2Q8PA 5ALUA 1TKBA 5ALDA 2C2KA 1A27A 1DADA 4L6IA 5AXDA 5IBQA 2Z98A 2XEXA 3VQTA 5ALRA 3RGGA 1QNFA 1LFDB 3D7MA 3NB0A 3KALA 4MHTA 4PYKA 5J40A 3MOGA 5TQJA 2WV9A 2XOKD 4PU0A 3IKTA 4EYKA 1E2FA 4IJQA 4QODA 1XTKA 1QTRA 1Y37A 2C3UA 4OGGA 3I04M 5BQ3A 1VA5A 4KN9S 1RTKA 1QH8B 3TIXB 2I6UA 4E5PA 3WLFA 2R8YA 5D86A 4BMSA 4DSNA 2W2LD 1ZXXA 3ZHTA 4I1SA 4XLTA 4TS9A 4B6SA 1JZTA 5JOQA 4EZEA 1K1EA 3IP1A 3L8GA 1QDUA 4RMHA 1IC6A 4BCBA 4CQMB 4CKBA 3C5VA 3N2IA 2MHCA 3M34A 4KCGA 3FTPA 4X84A 2CW5A 1DWPA 2GK6A 2KMLA 4HP8A 4CR6A 4OHUA 4IDAA 1EWVA 4G4JA 1IY8A 5DSZA 2O8EA 4J9UE 1FSZA 5AJHA 5IT4A 2PUGA 3G82C 1MJNA 4LVNA 3ZZ1A 2CDBA 2C57A 2V0CA 3H9CA 4LRXA 5ALFA 2SICE 4V03A 5IAEA 2R7NA 3WQQA 2X19A 1MOPA 4DZZA 4BXOA 1R8XA 1I5RA 2J31A 2HFJA 2JEYA 2Y67A 3U7FB 1QCDA 3HU1A 4QBKA 3RU3A 4RY9A 3ZGVA 2IYWA 4JA0A 3CF4A 3HBAA 2VRCA 3FR7A 3HHPA 4D6XA 1EVZA 1MQSA 3R3UA 2D1YA 2NO5A 2WJYA 1NMQA 4LZPA 4PG4A 1Y9AA 2QN7A 5M04A 2HCBA 1RYZA 3ZC3A 3GLIA 3RDPA 1P2FA 1NVGA 1SCBA 3BGDA 3TSYA 4FS3A 4XQEA 4BE7B 2HOQA 1HE8B 3ACBA 4FW9A 4UZEA 2AMLA 4WZAE 2PX0A 2ZVDA 4EGSA 1CQJA 2I2DA 3BD7A 1A2BA 1O2DA 3F6EX 3CVYA 3WWCA 1EFPB 1RWWA 5DHFA 1R18A 3PD1A 2BFEB 5U4XA 1RC8A 3CX4A 4BEBA 3L7CA 3MTQA 4OP2A 1ZL2A 4EX7A 2AHOA 2Z9BA 1YJXA 2HDHA 4EFNA 1PS0A 3NHAA 3I0ZA 4YMUA 2XRFA 1MX5A 1Q74A 3RUPA 3B3AA 3K5WA 2GXUA 1J70A 5ERYA 4C87A 4DMRA 3RAJA 4N8DA 1DKPA 3S70A 3QHQA 1WZNA 3KHKA 5A62A 1II8A 1P77A 3O26A 5FA6A 1WB6A 2FPUA 2ASEA 5AKGA 5C1OA 3A10A 5C7YA 5BN3B 4E15A 3TJRA 5KQGA 3TMKA 1KO8A 1IAVA 1GLVA 4L85A 1XCPA 1W85B 3QLVA 4LF5B 1JBQA 2AYZA 2Z04A 2I87A 1AUVA 3V7FA 4RPJA 1UWKA 3F7MA 5FTLA 4FB5A 2QJTA 4FWTA 3ROTA 1QIMA 1VG1A 2NPFA 1J56A 4K0RA 4N40A 2DWPA 3HNRA 1CF2O 2HZBA 1Z2DA 4FQ5A 3FLAA 2VRCD 4YRZA 2HT1A 5JBIA 3EEOA 1BC5A 3JYNA 4OHWA 3PRJA 2QRVB 2HPAA 1MAVA 3KP1A 4DDUA 3ZBTA 1PDWA 5BWOA 4Y6OA 3V48A 2QROA 3VNVA 4LS3A 3W90A 4JUCA 3N0TA 4H1HA 4PAGA 3E23A 4BNMA 4CMAA 4TSRA 2W2XA 3DBOB 4P4TA 3B9BA 2WTMA 1SBTA 4BN0A 2O3JA 3IB3A 1M6EX 3H6KA 2F8LA 2QSYA 2L19A 3K05A 3PE3A 3PXCX 3SHWA 1Z08A 2PUJA 3BD6A 1SO8A 3K15A 1OBHA 2DM6A 2GILA 2AN3A 4DLUA 1R6BX 2O7QA 1ONNA 1IOZA 2E4XA 3NASA 2BKLA 2WWWA 3KUCA 2VHQA 3F6BX 3DL4A 4HI0E 2G72A 2IPLA 3L7IA 4KQEA 5AW2A 2ZRPA 3M6LA 3R24A 5DLQC 3VVBA 3HP4A 4L95C 1GILA 2FSSA 1FRQA 4LWOA 4PZLA 1V9CA 2D0OB 4XUDA 4H08A 5TJ9A 2QXYA 4R51A 2YVQA 4J0EA 3M1IA 1MH9A 1ZUD1 4CF4A 4DANA 4J0DA 4HH1A 1VDZA 3IQHX 2FW9A 4MJXA 4BO4A 4BVKA 2QYHA 3W5VA 1DV2A 4FXPA 1YNOA 3UHJA 1GZDA 1NYRA 3NC4A 4NU5A 1L5MA 3OZXA 1SULA 1P45A 1RM5A 3FWPA 5EVCA 3FIUA 1MV8A 4UPEA 2BF7A 1VL8A 3KXLA 2XJ4A 1NKTA 2FLVA 1UWVA 2HU7A 3MBKA 4ZXPA 4D9MA 3X1WA 5BUQA 2XMRA 3GFOA 2DYKA 1UXIA 2B6NA 1X94A 4QREA 5AVOA 1CJMA 5LBUA 1TYEB 2G63A 1GUYA 4L7VA 3CJRA 1F1JA 1GZ3A 1V8PA 4KL8S 4AZWA 3CINA 3FOAA 2AC4A 3PDWA 2PJDA 5KYVA 3PTZA 3EDRA 2FGJA 2JATA 3JQ6A 3L0ZA 3TRJA 4BFSA 5C8XA 5TNXA 5IWCA 1XTBA 1USVA 2OV1A 2CEAA 1ST2A 2HPZA 1YR7A 4LYAA 1GQSA 1XYYA 3MTAA 1N9KA 4LYDA 4NEGA 5JNUA 4M1EA 3U81A 4P4NA 2FKNA 4NE7A 1L7XA 3SZMA 2SNIE 2V45A 3PQ7A 1IONA 1MRZA 3E9NA 3OG9A 4NC9A 1GPJA 1QIDA 2DUJA 2CJXA 4AZSA 3C70A 2PUFA 4RKYA 5AKHA 3DTVB 5CLJA 1EIWA 4J43A 1VQ1A 3HVKA 5C31A 1EAYA 4LPKA 1N0VC 3D3KA 1R0LA 1T35A 1RLUA 1B73A 2JRCA 4NZPA 5DLYA 2FPPA 4WBNA 1SHZA 3DMHA 3K5HA 5AJVB 3T5BA 1ZVMA 2QTTA 5T5QA 1JZSA 4K5QA 3ZV3A 4BNLA 1KEVA 3DOJA 5B36A 5ICEA 4JJIA 2OBYA 3ZU5A 2VT7A 4NH0A 2XUJA 1UBMS 4V0RA 1LJUA 4JP8A 1FNCA 1DRUA 1T4CA 1GVHA 2YRFA 4LHEA 1EU1A 3I2YX 4TKMA 4Z9BA 1C1XB 2IOQA 2PMWB 2F9MA 3A31A 1NYLA 1SU4A 3WLIA 4DCCA 4HVTA 4JHLA 4EUKA 4DGQA 1C8VB 4NV0A 3T8YA 1BXZA 1MENA 2AOUA 3OP4A 2XXAA 2YZKA 3OIFA 5J2TF 5HKOA 2A2ZA 2RBKA 4IXMA 4ZREA 4S0ZA 4EGFA 1OX6A 3OX3A 1VSVA 3ASZA 4J2HA 1SUCA 3R7NA 5CIYA 2X4DA 1U4SA 1EK5A 2HTEA 2HCRA 3D64A 4MAAA 4BBJA 5B4UA 2VCYA 2V58A 2ONJA 4YIKA 2X9GA 3JD0A 4ZYWA 1NUAA 1XKQA 3CX3A 3HUUA 4KDRA 1ZN9A 2IOHA 3RU7A 4J75A 3CNEA 3GLIE 1EZ1A 3THRA 4KWHA 1M1UA 1O6BA 1ZUNA 1QQ5A 2BGUA 2DF8A 3GUUA 3O47A 4HLUC 3IAM6 3LGXA 3EDOA 1M6VA 2JD1A 4OFZA 3M2PA 1DUVG 2FX5A 5ECDA 3RSLA 4LMPA 3TQSA 2E37A 4BGUA 3NT2A 4N7MA 1XJQA 2UUPA 4ZPJA 2OV4A 1U7PA 3GRCA 2DQYA 2CCGA 1U04A 4R1SA 2ZDQA 3PNKA 4R2MA 5BSUA 4IM7A 2JBAA 1WMFA 4C2AA 1U2DC 1TMOA 2DUMA 3GJ5A 1TADA 2Z8XA 3Q12A 2NNLD 1CQXA 1W88B 1XN1A 5KPDA 5KWVA 1KPGA 4JI0B 1S7CA 1I1QB 2BY4A 5JR3A 3OZ7A 4MULA 2O54A 2PA0A 1YFKA 4B9EA 2XCOA 1L1RA 1U81A 2X8JB 3DYBA 3KXIA 4JEHA 1YKGA 4X62B 3B82A 4CTKA 4F9FA 5KYTA 2PQ2A 3LQRA 4YASA 2CFTA 4BV8A 1UXJA 1EIZA 4F8JA 4I08A 3U7EB 4ZI7A 2JCGA 3IBFA 1K7EB 1MFPA 4Q3EA 4Q9LA 2G1UA 3MCTA 4JZKA 3MC1A 2OV2A 4QYIB 3O21A 1A9ZA 1PZHA 1E9CA 3KCNA 1CR6A 3QG1A 3WAJA 2QZPA 2GT1A 1R6VA 3HO1A 1EP2B 3QFCA 3PNOA 2W2OA 3IAEA 2IYQA 1UJMA 3RKUA 3AEQB 1GNTA 1CK4A 1P17A 4RPLA 4ZC8A 4GI2A 4D81A 2G1JA 2H5LA 2FUNB 4HMOA 1DLJA 4KC0A 1NQTA 2CB0A 4TVKA 5BSFA 3BULA 5JH7B 2W43A 3PXBA 2LP4Y 1GR1A 2C99A 4OQFA 2F90A 4NEHB 1YDGA 3T52A 3LBYA 2QMOA 5CYFA 3FWHA 2RGWA 1Y80A 1RAEA 1SIWA 3BDAA 3QP9A 4HWPA 4PV7A 3RJMA 3WRWA 3TUZC 3E6AA 5LMCA 4JI7B 1V1MA 1T36B 2WG0A 3CZCA 4GEKA 1DDGA 1IM2A 1CUYA 2BKVA 2EZ8A 4RSRA 4EKDA 1CE8A 1QWOA 1TT7A 2IL1A 3H7AA 1IY1A 3WGZA 4DWJA 2WF8A 3JQ7A 1ZOPA 1SRQA 2PCLA 3BWVA 3OKFA 3OQIA 5C8YF 1R7RA 3ESAA 3NHSA 4FYXA 4YGYA 1BE6A 5IJ9B 3G0GA 3VUEA 2ERYA 2Y6VA 4QD3A 5CG1A 3KKNA 4Y67A 1L4YA 1T1GA 4RZXA 1AKMA 1OZ0A 1QXSA 1HK7A 4X6UA 2M6KA 5AVYA 4KZKA 3GEIA 3WB2A 4N8SA 3LI2A 4EHKA 1RWMA 5KB3A 1ECJA 1RAAA 3I01M 4C07A 5HTKA 1W1IA 2VNHA 4U2BA 5FHQA 4QJ3A 2RAPA 1L5NA 4BRUA 4D4LA 1HFKA 3K70C 1NVUQ 2VP9A 1ZH2A 1CJKC 4J07A 3KE9A 4Y9TA 3A9WA 1YBAA 3PLNA 2JARA 3G8BA 1ZY2A 3BIFA 1ZD2P 4BEWA 3RODA 4FLEA 5BR1A 2XJ9A 2GH1A 3TRFA 4E1VA 1CIVA 5A2QA 4XM0A 3T7EA 1OW3B 1AQIA 3N2YA 3DDUA 3ZVMA 4PQFA 1W9HA 1OXTA 1H1LB 3IJPA 4C04A 5B37A 4HC4A 1HO3A 1VPDA 2EKLA 2IUFA 3BC1A 5FCDA 3SMQA 4BX3A 1KK2A 5BXQC 1B8UA 5HRUA 4YMGA 3UHFA 1X8LA 2E18A 3LK6A 1R66A 1JMKC 1ULSA 2JGDB 1E6EA 4P35A 4YJGA 4BMZA 5K8JB 3DHWC 3AZQA 4PQYA 1Q44A 5IAKA 2OCBA 2OAP1 3MQ2A 5ES4B 3KOXA 1MAHA 1FB5A 4TLEA 4XDHA 1FLAA 5IZCC 1ZVVA 1LZKA 2R4TA 2IX9A 4U7DA 3JQ8B 3B2QA 2HPHA 3FNHA 3LC2O 5I7SA 2O8FA 1TD1A 4TTJA 4XCXA 3KSDO 3QVGA 5JAZA 1Z5NA 2HBQA 2YS7A 4QRHA 2G9ZA 3UHAA 1Y8QB 3I2FA 1WHSB 2CD9A 1Q1ZA 1T25A 3PVCA 4W8GA 2MMCA 2JEZA 4XTCS 2B69A 4YO7A 3K1JA 3LUHA 4L9SA 3SJBA 1NXVA 1RIIA 2NUAA 3QVMA 1X7WA 4RMIA 1KC1A 1NPYA 4ZPXA 5E1DA 3V6LA 4EJ0A 2ODBA 2ZSEA 5DISB 3WYGA 1ISIA 3KUXA 3HCOA 4HWKA 4M9XA 5JS8A 1JL3A 5E4TA 3QVWA 4BNUA 1PT7A 4FQ7A 4NCBA 2G36A 5H80A 3UF0A 3EDMA 4AP5A 4B4VA 6NULA 1E5LA 1O4VA 2PT5A 4DSAA 1H6DA 2JA1A 2HLHA 2QVZX 3AM5A 2CFSA 3HUTA 4E2WA 1Z8FA 2Y92A 3RVNA 3TOXA 2A5LA 1GP2A 2OAEA 3MA0A 5HS6A 3WDLA 1ZNXA 4CQLB 4INZA 2SKCA 3FMIA 4L2IA 5CA1A 2O07A 3MCAA 1QFZA 3KSBC 3T1QA 3PFCA 2BEUB 2LXNA 3DLAA 4J0KA 3SI7A 2GN1A 1QOPB 4RJIA 5CD9A 4C3ZA 1ZKMA 2R84A 4RENA 5ECYA 2VYQA 5FFMA 1C9YA 1E5TA 3EVAA 3F9IA 4KACA 5D00A 4NKRA 4ZQFA 5F51A 3WNDA 5JAUA 2NP7A 2YJ3A 2Q1XA 2GPJA 4BEJA 1Z6PA 4CU2A 1WXEA 4FNOA 5K3BA 3D5EA 3MMNA 4YMLA 1RHJA 2C94A 3IP5A 4X1IA 4P3KA 5CXQA 5HK9A 1PU2A 5AK6A 2I67A 4D9EA 1VTKA 3EEIA 5DYTA 2CXUA 3TE6A 2F1OA 4KB5A 1L7OA 3NZEA 1KZ7B 4N3CA 16PKA 2KLHA 1CR1A 1DC6A 4YJDA 5KYWA 4BJ3A 1IN7A 5I7EA 1QGDA 2IELA 3H1FA 3ZVKA 1XBTA 2QEQA 4PRLA 4FSHA 1BHSA 1EWRA 2BFMA 3I32A 1OUMA 4J0IA 1R6UA 3AUUA 4M1YA 4PCUA 4XYBA 2IW3A 4G67A 3T9EA 3VPXA 1P4RA 5BSGA 2PRYA 2BGWA 4RYDA 1WM1A 3JARA 1KY3A 4XR4A 3OFSA 4UHJA 3JD2A 3U39A 1Z74A 2R60A 2QIOA 4Q3LA 2I7VA 3CLRC 4RS4A 1N5LA 1H2AS 2C78A 2DSTA 3HM2A 3KLNA 4NU8X 3WIDA 5A9SA 2PSJA 1GN8A 4MTCA 4RVNA 5HK8A 3TECE 1LLUA 1T2DA 4X97A 5EUCA 3UIEA 1K4YA 1Q15A 3MXOA 3NM4A 3DOOA 3TOVA 4KUHA 1W49A 3DEIA 2WHPB 3W2FA 4KH1A 1B1CA 5TQ0A 1FDRA 2ID7A 2Y0BA 4IDQA 5ILQA 1MO3A 4EITA 2A3RA 4MVYA 4OVKA 3HFSA 5FBLB 4D4IA 5BSWA 1XHEA 1P33A 2Y76A 2O5VA 1NQVA 4ZXFA 3KKKA 1BIFA 3TOCA 3ZU6A 4HGZA 4D0RA 4YRMA 2H1VA 4WN3A 1NXXA 5B1IA 1P9RA 1HQKA 4F9GA 5KIAA 3RAFC 3K53A 1E3IA 4AMVA 1PWEA 2WD9A 4KQCA 4YFVA 3RNOA 3GFTA 4ENQA 3L8CA 2FPGB 2X6QA 2DPHA 1HBJA 2WU3A 4TWRA 3B6JA 2F4VB 3ULKA 3WRYA 2D7JA 1B3BA 1CB0A 1HA3A 4TTSA 1BWRA 5SZIA 3SSOA 3D0RA 1L7EA 1UBRS 5DK6A 2KBEA 5JASA 1NQXA 3DMGA 5EHQA 5JECA 1APBA 4KE8A 1SUEA 1A98A 4R9SA 3WLPA 4RTPA 2IPXA 5ICSA 3TCXB 3TDNA 3U61B 1RYMA 1CTQA 3IO5A 3DZCA 4EZBA 2QVXX 2OTCA 4O2BB 1JG2A 1DC5A 1QF9A 2OVBA 5CNKA 4D6YA 3IP3A 1A76A 2WAAA 2GM5A 3FXAA 4C0LA 3O8DA 4UVEA 2J9FA 2HF7A 2B82A 2HA0A 4EB3A 4IG9A 2IPOA 3L4BA 3BRSA 3FUUA 3OCJA 4XUGB 3ZV6A 3KAQA 5ITSA 4HQ6A 2OZLA 1Z47A 4F1WA 1W1WA 1H2HA 3E9MA 4FHEA 1O9BA 2JAPA 3PNMA 1BKSB 2ZB4A 3G7SA 3GLGA 5IXYA 1YD7A 2BBSA 2BGNA 1XAHA 2OCXA 3M9LA 5I5EA 4J0GA 3UBMA 4QYXA 3HDYA 3WNQA 3KDPA 5K2MA 4BWGA 3F8TA 5BQOA 1UXGA 5M29A 3KVOA 1KI9A 5LA6F 3SHTA 2GTIA 2NG1A 1RCFA 1QZXA 2WVAA 2UXCB 3EWIA 1TZKA 1DJNA 1M67A 1DARA 4QHTA 1IE3A 4IHQA 4AMBA 4OB8A 3SBOA 3DMPA 2O2JA 1J5EB 1WQ4A 3G68A 1W581 4XCVA 1Z8NA 3L49A 2AX4A 2CZCA 1UM9B 1RR6A 4K86A 4LDZA 1V3UA 4V0LA 3A9SA 4M0MA 2QK4A 3HB9A 2IZ6A 4KP7A 3B5EA 2WYWA 1FQJA 4B83A 3OMWA 4TTRA 2WWYA 4OO3A 3IAFA 3G9QA 4FCWA 1UOQA 1SB9A 1E61A 1TNDA 2ORWA 1B3RA 4KX5A 5FNVB 1Q7CA 1E7SA 4YEDA 5LQCA 2ZDHA 3IS3A 5BVHA 1E2IA 3IQWA 1NNI1 4U5QA 2FFHA 4BKOA 3TJMA 5GQSA 3HNPA 3UV6A 2BR4A 5JYEA 4DV6B 5E6UA 2FZGA 5DTJA 4RNCA 3U7JA 4PO3X 3N76A 2HO5A 3QPAA 5AHWA 1I6KA 1XXHA 2WP8J 3QELA 2ZG6A 4LXGA 5FI1B 2C5GA 3ECCA 1N5KA 3GH1A 1I6MA 3SF0A 1DDOA 1BDMA 2QQ0A 5AVZA 3L06A 3SC2B 1A8PA 4CNQA 1EHIA 1OZHA 3O2QB 1UPCA 2OLKA 1GGVA 5E2BA 1QRTA 1TF7A 3L43A 4Z4CA 3TF5A 2VQFB 2GBIA 3HN2A 1SVSA 1JEJA 3BZBA 3R20A 3A27A 5ES3A 5CDUA 2B4AA 2GN2A 1N75A 4M83A 1ZIXA 1OROA 5LBIA 1CY2A 1JJBA 2V3VA 1NJ8A 3M89A 2GEDA 4P92A 3HY4A 1TQDA 3FPAA 3UH1A 4C6HA 2CNDA 2X6RA 3GNSA 1OIXA 4LNHA 5JYDA 1NP6A 2WJJA 3ZDZB 5A7FA 3P27A 1DI0A 3QV1A 3VSBA 2OV3A 2CHUA 4JJZA 4CMCA 3UPDA 4B79A 2Q5CA 2ZWIA 1LQTA 4RFLA 4X6XA 1HG0A 2VWQA 3B85A 3NHLA 3ZVRA 5REQA 3AIOA 5F35A 4NMMA 4DMGA 5F5XA 1J33A 4GBJA 4D2IA 5EIEA 5ADWA 1R50A 2OV6A 4H18A 4I1IA 2R5NA 3RROA 1X7ZA 1JKJB 4YCLA 1M1YA 1JR4A 4PNZA 3G9UA 1VPVA 1GT6A 1WSAA 1RYBA 5LXTA 5B6PA 4JWTA 3YASA 2AKEA 2JHGA 4W6ZA 5BR4A 1AO3A 2EKPA 1SVLA 1TJYA 2D0PB 2XVYA 4HV4A 3WDMA 5ITZB 1LB1B 5EUMA 1CJTC 3OPYA 4R8RA 3R5TA 1FPMA 2ILVA 2DU8A 5H02A 1TX4B 1JPVA 2YWBA 2EF0A 4EB6B 1E2UA 4IL5A 3QU4A 4AY4A 1QQBA 2AC7A 3RFFA 1QHSA 4HTFA 1ADGA 5T8KA 1Q14A 3ABOB 1UCFA 3FGOA 1S2GA 1WCYA 1GU0A 3ZVLA 4B3TB 3FPKA 1JWLA 4ZGBA 2XECA 5CJPA 5LUBA 2HA7A 5COAA 5CB6A 4CUZA 2H4ZA 2JI4A 1D04A 5LQUA 2C77A 2KE5A 3RYHA 4LQLA 2F1IA 2IFTA 3RRNA 1FW6A 1IVSA 4Y8VA 1EDDA 1XMPA 1T6ZA 4QECA 4XQ9A 3M0EA 1TT5B 2H59A 4ZP1A 4A0QA 3WGVA 1PQYA 2P0AA 2R9VA 1Z0DA 3AFOA 3CA8A 3G0OA 5DNEA 1JFTA 3GEMA 1VL0A 5JO0A 1P5ZB 4ARIA 3O90A 5KAPA 3TX6A 4JCCA 4MWEA 2XRYA 1E6CA 4H0NA 3PXXA 3DMNA 4QOSA 2O3RA 3T1NA 5AJZA 1O95A 2X5NA 3P2IA 4PSDA 4X92A 5JD3A 4YXFA 2PSHA 1K66A 1YRHA 1BVRA 2IU4A 3DMDA 2UKDA 5EE1A 1PLJA 1JV2B 2GYYA 3C41J 4BLWA 2XWSA 4D3YA 1WCIB 1WV0A 3CEPB 5CU7A 4R1NA 5EJ2A 1EX6A 5K0FA 4Y2QA 3R9WA 2WILA 3MIZA 5CA0A 4JR0A 4OQZA 2F9LA 5MFZA 1WUHS 4PZYA 2ACVA 1OB5A 3NG1A 4GF5A 4CNBA 5JEDA 2OGTA 4A6DA 4B4DA 2EKQA 3PFBA 3UNXA 3ENKA 1D8AA 3KOYA 4FSXA 2REQB 3V6MA 1ENZA 2EC5A 2NGRA 2ZJZA 3PNVA 3RTDA 1QU2A 1MB3A 4PRZA 4GX0A 1WD7A 4RJJA 5EIBC 5E4FA 3THYA 1YS1X 2Q5QA 4ZHQF 1XEXB 2F17A 1BE1A 3R7DA 2Q62A 4FE3A 1WXIA 1ONBA 3O9ZA 5F7ZA 4QNRA 3NBMA 3UUGA 4CMHA 1F51E 4ZAZA 1GTSA 1M5TA 1P0IA 3HJCA 5JCJA 1QH0A 1M2KA 2O3QA 4YBZA 2B1IA 3GT0A 3I9V1 5BV7A 3V7UA 2XGOA 4OAQA 3FDFA 3T9BA 1N7JA 1IBLB 3EGVA 1ZNZA 4RA6A 4UVGA 3USCS 4B3XA 3N8HA 4BTEA 5KAMA 5JWRA 2CV0A 4Y1FA 4NNJA 3JCZA 4KMSA 1XMOB 2XDYA 5KC9A 5FUBA 5DX1A 1IG0A 2R87A 5DWDA 1SA0B 1OZGA 2QPTA 4E13A 1CY0A 1CUHA 5DXAA 1RLJA 5K4HA 3TXAA 3GLGE 1LWOA 3P9YA 1O95D 1IEXA 4REQA 1E9FA 1FUUA 2KX7A 2VDKB 2YJ5A 4FZVA 3H65A 1G21A 5THQA 3UGKA 4E2ZA 5C37A 5IDQA 2I6SA 1RWPA 4BCCA 2GZDA 1UFKA 3PT5A 2FN7A 3L0OA 4BNVA 3BIJA 4FB4A 3DQPA 4UNSA 2ZJ6A 1U9CA 5BQPA 1KVTA 2FWPA 3WLSA 4D3XA 3MCVA 4PXYA 4CGYA 3UV7A 3RYCB 5NULA 2O2EA 1X0XA 2ZUSA 2RG7A 5CDTA 3BD9A 2FOLA 3TLXA 3U3XA 3GFPA 5IN5A 4ZV4A 1UBUS 5CGZA 2UVQA 1NW6A 1SU8A 3FNRA 4LA4A 2DEUA 1J8VA 1YXMA 2OHGA 2D1QA 2JZNA 3O38A 4ZTBA 1YQTA 3S2FA 2WIKA 4RF3A 1CRZA 4ZAWA 1GWNA 2G9VA 4OCZA 3H6GA 3LKVA 3PFHA 5JCJD 4XA8A 5IKPA 3SVTA 4ZT6A 3A2KA 1NXQA 2Q9UA 1Y6RA 4FW8A 3UT5A 5KTYA 6GPBA 2RJNA 3X0DA 3TZBA 1T5OA 3EE6A 1XXHE 3L1HA 3GMSA 2V7VA 4YREA 2CLOB 4QXAA 3SX2A 1LW6E 1KORA 1X77A 4DSZA 4O4HB 3EFOA 4LDNA 5KTMA 1H3FA 2DBRA 4RMJA 2APJA 2PZGA 4B43A 2GKGA 3AF1A 2QSZA 5TLSA 1T1SA 2WKRA 4PLZA 3ZDDA 3CLSD 2FQWA 3K1YA 4B4WA 4MV1A 4H4DA 1NR1A 1GCIA 1F06A 3TAUA 4NARA 2X76A 2ZIVB 3GGDA 3HI6A 3W1EA 4K6CA 4KYTA 3BMOA 3RS8A 4ZVNA 4TQUS 1ICIA 2CMHA 4BNFA 3EGDA 3IOMA 3IEMA 5C80A 1VI5A 2Z9DA 3RYFA 1QUEA 2JFUA 1ODKA 3GD7A 3GLHB 2HJ9A 3F67A 4LCBA 4I7EA 2C4NA 3TSCA 1OHHA 1PJ8A 1R8JA 4DTCA 2O8CA 2NVOA 3AQ4A 2I1LA 2P7HA 2QDXA 3PD7A 3HGTA 4QRDA 2GRAA 1GKYA 3HFRA 2TYSB 1DWUA 3U37A 3V00A 2R97A 4BC0A 2EZUA 3FGPA 1L5RA 2BVNA 2UXBB 1P72A 3SIPA 3WLHA 3RFVA 4DARA 1EX7A 4R8KA 1U8EA 4UE2A 2VF2A 3RT1A 1YBHA 1KPHA 3RYIB 2VSFA 4RVSA 4WGGA 4F4IA 1Q16A 1O8CA 4C2TA 1T9AA 3DKPA 5I45A 4F92B 3UW1A 5ALHA 3HJFA 1M1YE 3SZ3A 4ZJYA 2ZUUA 4RIGA 5KSZA 4CEHB 4CF7A 3ANNA 3ZLTA 4C7VA 2EDAA 3P94A 1Y5IA 4F4JA 2JI7A 4Q47A 4V39A 1EUCA 4DIBA 3H2JA 1J2YA 4JU9A 5LDHA 1CS0B 4PBTA 1E1RA 1ZCBA 1NQAO 3EIFA 4TV8F 3QYJA 1OJ7A 2NTYC 1GUFA 4F4FA 3Q7TA 4C6RA 3AERB 4K40A 4Q7QA 1YI1A 2FYTA 4OMUA 3WNCA 5KX5B 4DM4A 1KXZA 2AW3A 2PUHA 3MGCA 1I7DA 4PFQA 3RM3A 4K3VA 3JV7A 4GMXA 1X8KA 2H6EA 5JXWA 3FHJA 1OFVA 1RI4A 2NAPA 3IKVA 3TIGA 3KWLA 4OXKA 5KTSA 2O52A 3GUZA 4NFLA 1XELA 5E7IA 3LZDA 4HYYA 4R7ZA 1RVV1 5C5IA 1X1DA 1JR6A 1EQAA 5ALVA 5I7RA 2C9ZA 3D3JA 5F4BA 3MAGA 1VYHA 3FI9A 2A0KA 1OHHD 3BWYA 1C29B 2FN9A 1JEDA 3K8OE 2A35A 1V9SA 4KPUA 4D0SA 5CDFE 3RADC 1AHNA 1NVEA 1QBKC 1KBZA 4MUNA 5A3QA 4RBNA 1PQWA 3OHMA 2JHPA 4R8SA 1TEZA 2VSOA 3L46A 1ZD4A 1O03A 4Y2SA 3WSTA 4ZIRA 5JXHA 3OQOA 5P8WA 5FD8A 4MVJM 3RVMA 1H2ZA 1ORDA 3VAZA 4M6WB 3WC4A 1EVLA 3CE9A 4KVAA 3MOSA 5CHEA 1GRRA 1QIIA 1Z0KA 2PLNA 3U48A 2NYRA 1CZNA 2F3TA 3UFBA 4GMHA 1E5QA 4EUHA 1XF1A 2MR5A 3N5KA 4PLTA 4JLNA 1LPPA 4MICA 2W7TA 1FFSA 3T7IA 5CB4A 3G13A 3HB7A 3RS7A 2XEDA 3ZXIA 3BJMA 4NICA 4PG8A 1SOAA 4B40A 1AJEA 2J32A 5BPFA 1EFHA 5E3JA 2X0JA 1E1RD 3H1PA 4G36A 3EY9A 1Z2OX 2R4UA 1KZ4A 2XVAA 4MKXA 2IGBA 1EKXA 5FLXA 1HLPA 3C43A 4B85A 4RV4A 1FFCA 1C8KA 5FA8A 3DW3X 4KTTE 4N54A 4QPDA 3UMRA 2ORIA 1DXOA 4GDMA 4QM6A 3GJ8A 3MQ4A 1J2TA 3PSHA 3OPYI 3NV7A 1L8XA 2P69A 4RXMA 1E1DA 4FZ5A 1L7RA 1UC4B 1UFRA 4TS1A 1UFVA 3MTDA 4ZU1X 3I83A 5TPZA 4QPCA 5ELLA 2C5BA 4B74A 3NU1A 4WERA 3W3AA 1HQDA 2O0HA 3AHHA 1NBEA 1XQ6A 4MQEB 1E3MA 1J7JA 4LDJA 1YCFA 1VHQA 4NK5A 5AIBA 3KK0A 1JILA 4Z3OA 3W9UA 3DVAB 3UMFA 3W8EA 3SKXA 3AFIA 4Q9NA 2NU7B 2WTAA 2WD8A 4HNVA 1K9SA 1XYVA 3RIYA 3VZRA 4CLXA 4G37A 2PS0A 5DW0A 3CSDA 4IHJF 4HQKA 3LOUA 5IAAA 3U4DA 3RYTC 2AYYA 5FO1A 1E3DA 4ZFNA 1W44A 1S8AA 1OPXA 3SZLA 4CV1A 4GFDA 2HDNB 4C3UA 3H9QA 3RQIA 1G21E 1WZEA 1ZH8A 2H07A 4PSCA 3U3OA 1XSEA 2JGFA 2ZI6A 3H83A 3LPNA 4IQ8A 5C3MA 3QWAA 4CT0A 1WCV1 2B30A 3V1YA 3QE9Y 3PK0A 2K7FA 5HQTA 2GUGA 1H2EA 1ZGGA 3F97A 3U60B 1E66A 1Z4NA 1NJ6A 1QMGA 1F17A 2A9KA 3AF4A 3INRA 1VJGA 1A2OA 3DP7A 3QXHA 4F3KA 3I9NA 1NW5A 5JDCA 3U4AA 1YJQA 3RHTA 2VWGA 4OQLA 4B4OA 4G0WA 1S02A 4MYTA 1F14A 2WIAA 3GDGA 3HCEA 4JC5A 1QONA 5A05A 9LDTA 3NHJA 4EQ6B 3LO5A 5C7OO 5L4NA 2JDIA 4NIMA 4XGRA 3W0LB 4IWXA 1QRUA 2Z5VA 5A4DA 2A7QA 2GZ1A 2HM7A 3UAOA 1J8FA 1PF7E 2DHRA 4D9BA 3KB2A 3LNTA 5TPZD 4MRPA 2ETXA 1AN0A 3ONEA 4IMPA 4W1RA 2C8KA 4RK0A 3W3AD 1EG2A 3IXQA 4N7RA 3RI3A 3W7BA 5JVDF 3TDKA 2IXGA 3QKTA 4ND8B 3IALA 3D7SA 4XWWA 5KTRA 3CNQS 3OJLA 3SS9X 1WDLA 5B2FA 1CS4C 4YPFA 3JWHA 4Y6QA 2AG6A 1ILEA 3RVKA 4IICA 3RV4A 4G01B 3CNBA 5CGQB 4JJ7A 2IU6A 1O58A 3AW9A 1NVDA 4A5SA 3V32A 1ZW6A 3DZ8A 2LW7A 4QUKA 3S1LA 3T61A 5DRYA 3KLBA 4MJ7A 1V7PC 1YOBA 2EQ5A 2IXDA 3OZIA 3RJ9A 2Q2VA 1DIHA 3VU9A 3SC3A 2C31A 1K5GA 2Z57A 3MBOA 3Q9LA 2X7JA 4LXXA 4LTMA 1KI3A 3ICQB 4NPCA 4MO9A 1USUA 4XM2A 3EMDA 2JAXA 4JUIA 1TM1E 1XVUA 4NS4A 4PRYA 2W6ZA 2IY7A 5E9AA 2GEBA 1SR8A 4GMFA 4H7FA 3EVCA 1Z33A 3M6UA 3N8GA 3VA7A 2K4MA 2G3YA 2R4QA 3SIXA 5JPCA 2FW1A 1FYEA 1TAUA 1VL5A 3ABRB 3KYJB 3O8BA 1RKBA 4S1TA 1Y9JA 4YAJA 1IRXA 4ZOEA 3HCCA 3SJCA 5DNCA 1ZI9A 2QD2A 3GJSA 3UWSA 2JDID 1EFPA 1NBAA 2H5EA 1VE7A 2PQ6A 3E9ZA 4G1MB 4QQFA 3AR6A 5HE8A 3I76A 4B84A 2IOFA 3P96A 5ESWA 3TIVA 1Y82A 2E89A 3UWMA 2ECQA 2OPHA 4I4TB 2QRQA 4GW3A 1PX2A 2RC6A 3AHCA 3B3FA 4AI6A 1TC1A 4ZVSA 4IIVA 2VN8A 5JZMA 1K06A 1CZUA 5CJ2A 4W4TA 4BNXA 5LU8A 5BN3A 4C0SA 1YR1A 1K8ZB 5IC6A 2NZJA 4WPGA 1J22A 4O1IA 3QTTA 4TLMB 4RKWA 2WMDA 2OG1A 3AOEA 3EJ6A 4QGAA 5JCOC 1L7VC 4JXJA 1G4HA 1VJ5A 1ZIYA 2RJOA 3FHCB 3RVBA 3COSA 4H3KB 1PEYA 3COPA 4JI4B 1B6RA 1YKFA 4HDQB 3TLGA 2R2AA 4GX2A 1T4DA 3DBVO 3LBFA 5LSAA 3FSJX 4YHHB 1RYHA 5GJWC 1O6CA 3TBFA 5C8DA 4XZ3A 1SQFA 3MF4A 4CU5A 4BDTA 2ZIWB 3NW9A 1MTZA 1NN3A 2ZSBA 4HAOA 3AVVA 1ZJZA 4DV2B 2AIRA 4FMPA 2ENWA 4ICIA 1ZQ9A 4FBMA 4YTEA 5C1BA 1H1TA 1YL7A 4BLUA 2QR5A 1LSSA 4MWTA 3FYTA 2FUCA 2H4YA 4AQYB 4DM3A 2FN3A 3DDSA 1TJNA 3KOZA 1NF8A 2H2IA 2Q8NA 1M9NA 3PIDA 3O8QB 4P8RA 5HILA 5IYZB 1JIKA 1INLA 5CM2Z 1KNQA 3L02A 1VG8A 1MGOA 3I2JA 2FWAA 3SQXA 4E09A 2ZPTX 1ZLYA 2PWBA 1E0KA 1EGMB 4MPJA 3C7TA 3TFWA 4YRPA 3IXMA 1LC3A 2ZPAA 4GLBA 2XT9A 1ORWA 2VAPA 5G1NA 5IDXA 2QP3A 3PBKA 4J3NA 1E5XA 5TXGA 1VG0B 4IVQA 3ZZUA 3ELBA 3JPWA 4NFSA 3OTHA 2YWJA 3AF5A 5A5FA 4AKTA 1DFIA 1FX1A 3FN4A 3WFZA 5GINE 5FOXA 1CNFA 4L5BA 4QNMA 4H6PA 2G88A 1IVNA 2DUWA 3H04A 1TQ6A 4TXLA 2CL6X 4M0CA 1FP2A 1NPDA 1UBJS 5DNUA 3KQNA 1JJ7A 2UDPA 3BYZA 3JWEA 3V1UA 5H81A 1PZGA 4FFBB 1C3VA 5H3HA 3T9FA 3M1AA 3PYLA 3EXAA 4UBJA 3V8EA 4U00A 4DQXA 1Q1NA 4Q01A 4L4UA 3MRXA 3HN7A 5E0OA 1DS6A 1ODSA 3OZSA 3O6VA 4OHYA 4DLTA 2ZIXB 4LJ8A 1PZFA 2A0XA 4PYQA 4Q4AB 4F8YA 4OI4A 2ISQA 1YKSA 3UHOA 4KIWA 4UU0A 4JZYA 3I9OA 1HL7A 4BQFA 3ETEA 2FPOA 4DRZA 1N77A 1LBSA 4DQVA 4HNQA 1GG9A 1IQ0A 4MXDA 1ZJ4A 3FCOA 1DIRA 1AT1A 1JHXA 1X7GA 4J1SA 5L4LA 2ODEA 1UBKS 2HRBA 2PBLA 1M54A 4DSTA 5C8YA 1W5AA 4GC9A 5GADl 2ADFA 1L5QA 2G25A 1A95A 1TDJA 3NVMB 5EE0A 5LP6C 3ROPA 1RE0A 3EB9A 1G8KA 4N5IX 4EBBA 3DGEC 5AXAA 1E58A 3GT3A 4PAQA 2OB2A 3AB8A 1E3LA 4Z86A 2C4UA 4ZWNA 2PGNA 2CWWA 3CH5A 3TPCA 4TL8A 2YXNA 2G4VA 4XIYA 3Q5GA 5KJCA 3HWWA 2IHBA 3T1VA 4UOZA 1L1QA 1G8JA 3VPFA 2PX2A 2YV2A 5J4LA 2JLRA 1PV2A 4ISBA 3ZBPA 4DB4A 2OB1A 2BJVA 4B7XA 1NM5A 2B4RO 3BB4A 4JP2A 3AUJB 3F6RA 1PO7A 4YAOA 1A0OA 3ZJUA 4BAGA 1L7NA 3AY6A 3HHEA 2GXAA 5C5EA 5BQ5A 1FVHA 1G3QA 3IQGX 1Z36A 3GUHA 4O02B 2LDXA 4JOQA 5LP6B 2R1VB 4L27A 1W36C 3EH1A 3L0SA 1E98A 3K0CC 4D4HA 1C1XA 5H3CA 2O0JA 2WBLC 2XKAA 3G79A 3L1VA 1P3DA 5JS2A 1JALA 1GPUA 3JVUA 2BD0A 3O4IA 4B31A 3TIFA 1A7KA 5JSUA 2ZSJA 3I58A 5GVRA 3RC2A 1QP7A 3UICA 4D5EA 1SBQA 1QZTA 1MOSA 2B7LA 4JYZA 2VDWB 2WLTA 3B51X 3AHJA 2O7RA 3K0FA 2FWJA 3KYCB 3R3WA 3ZCTA 1SPBS 2X4GA 1U9IA 2PRSA 5HKKA 5HQ3B 4PIVA 1RNLA 5JXGA 3NS7A 5DTEA 1Z28A 2JJ8A 3X1KA 4BV2A 4C7XA 2QN2A 2ENUA 3TYXA 4X7MA 4H1TA 3TEJA 2J5KA 1GNQA 3LDAA 2ATCA 4CE6A 1JA1A 2M6SA 1ISJA 2BN4A 2VRBA 3I5YA 3ZW8A 2Q50A 3RLIA 1CUBA 2BM0A 2JLAA 4HEHA 4KXUA 4Y2VA 1FS6A 3OE4A 2JFNA 1W94A 1LH0A 1V8FA 2Q21A 3KHUA 1XZCA 2QQ5A 3LUDA 3KWFA 1T5IA 1WQ3A 2OD9A 3E3OA 5DYWA 4B33A 5JUWA 1QKJA 1UKAA 2WIFA 2VC2B 3N0VA 4B3FX 5M2QA 1PJLA 4RHYA 4CMIB 4R5MA 3BE4A 3AX6A 3TTWA 1Z5UA 4F38A 4GYJA 3IUQA 4GI3A 3DV0B 1U2QA 5A4KA 4MITA 4GVXA 5EP4A 4NSNA 3EG9B 3S81A 4BRWA 2HMVA 2RGUA 3HDQA 3ON5A 1UAAA 2JFYA 3BFVA 3KNZA 3O7WA 5HUQA 3LUKA 4JBLA 1NA5A 3ECAA 1OLUA 4TLLB 4FILA 5K8IA 3WGOA 2ZR8A 1WSWA 2ICAA 3MJRA 4INAA 4DCUA 1F8XA 1VM6A 3D8SA 3R0IA 1CLUA 4P4GA 5AJUA 5ENVA 1F7VA 3J7AC 3B1VA 6LDHA 4JNKA 3RIGA 3IAM1 3UJAA 4G8JA 4QYIA 3VC2A 1UT8A 5JALA 4PVDA 3ZJ4A 2QU8A 5HKKD 3A1VA 1W76A 3BF8A 4BQEA 4ZAYA 4PX9A 5DGCA 1JDJA 1AUQA 5J4VA 1GEEA 4B3DA 3CN9A 2PIDA 3RTBA 2HN9A 2JFVA 3AEQA 3HBMA 3S2SA 2IYRA 2FE4A 3PD0A 2VUTA 4JJGA 1XRLA 3LVFO 3H5VA 3A05A 1GPMA 5HCUA 4B3RB 3W6UA 3GPBA 1POWA 1J90A 5JS1A 9LDBA 1YIOA 2I6TA 3KQQA 3OI7A 2ZYDA 3AP2A 3KQHA 3F5MA 2Z8YM 4TWBA 3ED1A 2C4WA 1NV9A 2WTXA 2QD4A 1G8AA 4XSGA 1E1NA 4Q6WA 1TUBB 3QEBZ 1Q12A 1VBKA 3NRJA 4WMLA 2VNAA 2YIVX 4WW0A 3LQ2A 2VEDA 1PZXA 3N2KB 4EEKA 5B7PA 2C00A 3JVIA 2EWVA 3F2VA 2FF5A 5JPDA 4GPEA 3K32A 2V7TA 1XEAA 1S4MA 2AE1A 1SZDA 2P5UA 4RHEA 1DBWA 4RPCA 4EB8A 4KPYA 2CJPA 1J9ZA 1P18A 4F84A 3ZI0A 4MKZA 2WJPA 3AI3A 4P2GA 3JYQA 3KAJA 3B6MA 4GR9A 3S2IA 3KR2A 2MU1A 3U16A 4XM1A 3HJNA 4L73A 4O5AA 4Y1RB 4ZO6A 3THWB 2V6BA 2WVJA 3PWZA 2FHSA 4JQOA 5LKAA 4MR7B 2XCQA 3GFRA 4QEDA 3THSA 1J8QA 4QL3A 1DEHA 1Z5ZA 2VPWA 1LNZA 1DOAA 3ZIAA 2FRVA 2FWNA 4RA9B 3QA3E 5EIXA 3AEXA 3HG7A 1L4UA 2JCVA 2BHLA 3EQ9A 1RI5A 3CO0S 3LVRE 2DWQA 3HSSA 3T5MA 3UPUA 3FHLA 3IL2A 3IP7A 2UZ1B 3PPXA 1SU6A 4ARZA 3RIHA 1NHWA 5E1OA 3W04A 4WADA 2Q0HA 3CM0A 4PCVA 4PZ0A 2P1RA 1VIMA 1M8GA 4DPKA 4YCJA 2VHYA 1SG0A 4AAYA 4CHGA 2AFHA 1P5HA 4JLDA 4IP0A 2UU9B 4DIMA 3TNLA 1MDFA 2G83A 5FR2A 5F98A 4V3BA 5HIJA 1DG9A 1HKUA 1XDSA 1KDZA 5CFRA 1Z73A 4LZNA 7REQB 4UFOA 3IELA 3PX2A 3EZFA 4V02A 3QBEA 4CLEA 2RCYA 1L4LA 4DY6A 3K6SB 3DOHA 3SP1A 1FYDA 1PGQA 4E31A 1CBUA 3OJ0A 4I1RA 2DETA 3E5HA 1X1EA 3SU8A 1GNPA 1GADO 4TMWA 2BYTA 2PGJA 3G59A 1O4WA 3HI4A 1T9HA 1RM3A 4R2WA 3DFZA 1Y8QA 2ATEA 3ORYA 2I78A 2EFCB 2OAQ1 2ZTHA 4HYQA 1SC6A 3D02A 2YHUA 3KQTA 4RY8A 3AYZB 3PXDA 3FMPB 3GA5A 5LA6A 5ERGB 3C8DA 2XCTB 3I37X 3ZYCA 5DT9A 2BGTA 4OXXA 1NIJA 4XDYA 3VYVA 4AVYA 1CJCA 4MYUA 3SBDA 3TRIA 3ZIAD 3OTOB 2HNBA 2FSVA 3UGQA 2BFOA 4KXVA 2VNIA 4I9NA 4S1PA 1YASA 3B53X 1AKRA 5HDBB 1OH8A 1TFRA 2ZIFA 3DE2X 4TRNA 2C42A 1NVAA 4O8CA 3KUDA 2A5FA 1RADA 3BMNB 3D9QX 4KQ9A 2H0QA 2WIDA 4LKOA 4CQLA 1BWQA 1M2OB 1WV1A 3WQSB 4AJ4A 1Z88A 3WRXA 3OQJA 2A0WA 1C1YA 1N0WA 5B55A 2HHHB 2NU8B 4DMHA 4PHGA 5JRDS 1J42A 4WXEA 4B32A 1BOFA 2FPLA 2HI0A 5FPHA 5LJLA 3JAKA 2YQ5A 1OV6A 4WRRA 4ARVA 3DBLB 3Q0TA 2BLLA 3GN1A 3WE7A 1QH9A 1QRAA 3TW8B 3V4OA 5ICMA 4ZD6A 5H82A 3OPQA 1IPHA 3EZ2A 5ELMA 2NZ2A 3CCBA 4DDWA 4E22A 1DAIA 2DY0A 1ZUHA 3AESB 4M53A 3ZUPA 1RACA 4XPZA 2R7AA 3V3TA 3T5DA 4D4GA 2NO4A 1GAEO 2W5UA 3WG9A 2JJQA 4B80A 5JFTA 3GJRA 4Z9XA 4GSLA 5FQNA 1UDRA 3KAKA 4BUCA 2ZAMA 2OHJA 3RUCA 4DV4B 3VOSA 3U44A 1S2MA 1EM8A 4M88A 3ZWPA 1HOXA 1ST3A 5JG7A 1QHEA 2VNJA 1DTWB 4DUPA 4O3FA 1KR2A 2YKGA 1PWYE 4LKRA 1JIXA 1DTEA 4HLQB 1U8XX 2HNKA 2YWEA 2ZP1A 3EIWA 5HA5A 1N34B 5H9WA 1B0ZA 2RARA 1L9KA 1K86A 2G70A 2TS1A 2IYLD 3W6NA 3ZTTA 3DLHA 3CMCO 1RW4A 2V5UA 1Y6QA 3BG5A 1B6SA 3B3GA 3CKLA 3H6HA 2VXCA 2QTVA 3G88A 3O8OA 5TQ2A 1KQFA 4BB0A 1BHO1 3PZBA 4UDYX 3H17A 3CW2A 4B0PA 4MCIA 4WFIA 5BW6B 4E5UA 1VKHA 1NW4A 4LCJA 1IOLA 4A8PA 5LL6P 4HN9A 3LOQA 2FEPA 4IH1A 1H22A 2VBIA 4PZAA 1RKVA 2V7GA 3GRAA 3TNDA 1V11A 4R3WA 1ZM2A 2QVLA 1EX9A 4BVJA 3IIJA 2XTMA 4NESA 4Q1FA 5BW4A 3RSHA 1LD3A 3KZKA 1US8B 2AA3A 2P2DA 1GYRA 1VYVA 4W6QA 4AD8A 5CT5A 4G65A 4IFEA 4X7RA 3MILA 3M4ZA 3ET4A 4KAFA 4LHZA 2Y3IA 1YZ3A 3FCAA 3HB5X 4OYHA 3R40A 3QNWA 4ETWA 2C7OA 2FFAA 4UATA 3UJCA 1DP4A 2GRUA 3F5FA 1GQRA 2X2OA 4RK5A 4XWTA 4OHKA 5K3OA 2YTZA 2PD4A 3CLUD 3JQAB 1XZPA 5COBA 2V6FA 4TQGA 1KO7A 3ZE2B 3D1JA 1LBIA 5GM1A 3WR5A 2Q6OA 4BGVA 3E22A 2I3BA 4KQWA 1KMIY 4UAJA 4G8CA 3D7LA 3MSCA 1C3OA 2A5YB 4KRXA 4L57A 2XQKA 4A27A 4O2BA 5BYBA 2NO7A 3G0BA 5B5SA 3NNSA 3PTAA 4M9RA 2H11A 2XDWA 3QBVA 4HH0A 1DB3A 1LWNA 2Q4EA 4RDIA 4RMGA 1WG8A 2P2SA 4HH4A 3DFMA 4HUQB 1JQ3A 1KS2A 2CLCX 2QV7A 1NNLA 4NYIQ 1W9MA 2DG2A 2OC4A 3W5HA 5C4IA 1AUXA 2GFIA 5AM0A 5A4JA 4DR7B 3AWIA 3WLNA 3OPVA 2PUBA 2AEFA 1KNXA 5JZBA 2I4RA 3QFFA 1QYXA 4MVJG 4WDRA 2QBYA 2J5BA 1EVKA 1GITA 3T9DA 3BGVA 3EGCA 4G6ZA 4QICA 2DZDA 4WBXC 2BH9A 4KLAA 4DOMA 5KMGB 5DM60 4LFAB 5A4AA 1NXTA 1SOUA 2J07A 1D4AA 2EQAA 5J2UF 1XJ0A 2B94A 2IYFA 4I6JA 4MW7A 2Y1WA 3WQHA 5JBQA 2A9PA 3IGFA 2JEOA 1SHTX 4G86A 1EFRA 1SG6A 4HVCA 4DRXB 1W47A 3KJNA 4DTIA 1NV8A 1P9OA 2OBNA 1KEEB 1E1YA 1N3LA 4JUAA 1ZI6A 2DTEA 1A5BB 2ID9A 2IHYA 3FAKA 3CUEF 3EXHC 1Q7GA 4EY6A 1U2EA 4GSYA 2WJAA 5JJCA 3CO5A 4JXKA 5JMOA 1PR6A 4FEAA 3DEKA 2R3SA 2TSYB 4UVIA 4R7GA 1OTYA 3FUVA 5FWYA 5JIBA 1HFJA 1MR3F 2W2KB 4LV5B 5HCIA 5LD2C 5CBKA 2XRZA 2XYPA 1M2WA 3E0QA 3Q1KA 3L01A 2FRDA 1G6Q1 2HA3A 2Y8EA 4RPHA 5FBWB 1JSZA 1N1MA 1IUNA 4YDHB 4ZAVA 2AF4C 2ZYVX 2QTNA 5KWSA 1Z9BA 3PJRA 1ZONA 1E8NA 2YXBA 1HFEL 2GPNA 1G7CA 2NQ8A 3BEDA 4TGLA 4ISCA 2YY7A 3BIOA 3QUQA 3WHKA 3OOJA 1JKXA 1R4AA 4XFJA 2IEZA 2FK7A 4CIWA 2Q49A 4EY5A 5FPTA 3SC2A 1PD0A 2GPWA 4EGCB 4MW9A 1NASA 4IIJB 5AYVA 2H63A 4I50B 2IZZA 4L4RA 1SMKA 3T06B 1BXGB 3MWEA 2JD2A 1T2CA 3D6MA 3FYCA 1NOJA 1E2LA 2C3OA 1Y3CE 1VMIA 4FYHA 1ML4A 5KTKA 4MCHA 2D4AA 1UKCA 2ZRIA 4JGBA 1X74A 3E2MA 4M0FA 3R8CA 4DLKA 3AU9A 5CLFA 3OD1A 2BL4A 2XHEA 3CRMA 1Y8CA 1SVOA 1J2JA 1KK0A 1XMVA 2V7UA 1EFRD 3CR3C 2YXDA 1HWYA 4FFWA 4P38A 3WBKA 5AW4A 1ZVQA 2OV8A 1XP8A 4X90A 1B76A 1GT91 2LWIA 3TL3A 1CQZA 3R8XA 2E49A 4QLBA 2I4IA 3HVRA 2JVIA 1RWQA 3PDUA 4PQGA 1QVWA 1PL7A 1KO5A 3LLSA 4B2LA 2E5LB 2I55A 4NEQA 4QTTB 3QEMB 4UMVA 3S5JA 1K63A 1M8FA 1JKJA 1KIAA 1Y5RA 4L78A 1JHVA 3GZTB 3BJZA 1V6SA 1YJ8A 5DWQA 1DZ3A 4R1PA 4YECA 3X1YA 4CEJA 4O4IB 1T1EA 1UODA 3A7EA 3Q3IA 4JLAA 5DMHA 1OGIA 3AC0A 3HEMA 3DFIA 2ZEJA 1HEUA 2XMSA 1MVOA 2QG9A 1Z6AA 3ZEAA 5ITZA 5JU6A 2X22A 3UUWA 4GOND 5KHAA 1EH5A 3WYBA 4RJ2A 4DWWA 4KPEC 1TAGA 2JIZA 3LGAA 4R40A 1WF6A 2OQRA 2XE8A 4QGFA 4RX1A 4EATA 4OM7A 3CLVA 3EHEA 3GWZA 4JLSA 3H1EA 1R9MA 1BD3A 1H6AA 3BXXA 3O8NA 4LOJA 3FPFA 4BAUA 1NN1A 3GDHA 4IS3A 4QVGA 4Y2RA 3M6WA 1TQ2A 5CR9A 4CMEC 3EWNA 1OH6A 1CFZA 2WF5A 2EFYA 5AJTA 1GAJA 3JX9A 4FCCA 1NI4B 3BZWA 4J4TA 3SNKA 3VKUA 4FM9A 1ZJYA 1P29A 1IZ7A 5I7FA 5HE9A 2P2ZA 3BCSA 3SS8A 3EXEA 1OXUA 3U7QB 1B8PA 2G04A 1KP3A 1Q1BA 1SNYA 4FJ0A 4XLLA 1GTMA 1Y5LA 1QP8A 4IOLA 5CFLA 5I51A 4WASA 4XX1A 4LBZA 3BICA 5TF0A 4FCTA 1QHIA 5KYUA 3RABA 4CM3A 4UXHA 3CCFA 3CVJA 3CKMA 1YRLA 4JI8B 2QM0A 1WIWA 1JQDA 1ES9A 1UK9A 3O9MA 4ER3A 4GWLA 3HGMA 2JCBA 1JG4A 2OMKA 5FWAA 3CLHA 4DKXA 3L3BA 1KMNA 2OORC 4UNQA 3L9XA 3IJ5A 1NQ5A 2YBEA 1V71A 1GPKA 2PX8A 4IEIA 1SUSA 1WY7A 3QWBA 1STOA 1RBYA 1JTEA 2OHXA 4HWGA 1A2QA 3DVLA 4KLCA 4WA7A 4ZOCA 3CRRA 4EHJA 1YMVA 3I2HA 2RBEA 1LLCA 2DLDA 3INGA 3NYRA 5MGBA 3OQMA 4FI3C 4US1R 5FYDA 3E82A 1E2NA 1SXGA 1TUEA 1HY3A 2EERA 1JXMA 2PXCA 3DCIA 1ZNQO 3DNPA 3EA5A 4YN3A 5J63A 4H6XA 5TT1A 4CN8A 5AD1A 2JIZD 4MUXA 5EP2A 3O4HA 3NI2A 4CUKA 1OAKA 3TRKA 4BE4A 1SHKA 2W4MA 3ENWA 3R6GA 1YUBA 1J97A 3I5UA 4UBLA 3ITEA 4YRLA 1IIBA 2J3KA 2OXEA 2Q9AA 1MB0A 1UZMA 2DVMA 4P36A 4DXAA 4LG1A 2A5GA 1QGYA 3IOCA 1Z45A 3SF8A 1FSSA 1LQUA 4DBZA 4PPYA 1S3FA 5FUMA 2VQEB 1NF9A 1P19A 3N9IA 2DJIA 3BAFA 4M9SA 4EHNA 1Q22A 1M2EA 1VLJA 4U7GA 3R7AA 3U3JA 2BCGY 4TKZA 3FCSB 1U0NA 1Z6TA 3TS1A 2JIOA 4IGIA 1FMLA 1NW7A 1RPJA 2CXOA 4C03A 1HF3A 2IHVA 3DHEA 2XQVA 3QI2A 4GMDA 3CB4A 4PC1A 3SBXA 5J5VA 2PY6A 3LRXA 2PFSA 3VV3A 1AHPA 4N0MA 2QZ4A 3U1TA 3LQQA 3NDPA 4B0OA 1WULS 3PC3A 1BO6A 3VMFA 2WOOA 2ZE6A 5DI3A 2MJLA 3WL7A 4LTNA 5JNVA 1QJ4A 4IDCA 1MT0A 2HCJB 3L7YA 2P6OA 3UT0A 1ULHA 2NM0A 2IP2A 4QRIA 3ST7A 5KYKA 1UEXC 1GGMA 2BP7B 3VPDA 3RQSA 5HTOA 2F3SA 2H4FA 1O77A 3BXGA 1X7XB 2FVYA 2QDKA 3L6EA 4KKXB 4HNGA 4WQMA 4K1XA 3RYCA 1VSBA 1RXEA 2ZUWA 2HK7A 5KOHA 2EFEB 4EG3A 3IE0A 4PYLA 1OU0A 3MT0A 1W0CA 4Z8YA 4F86A 3HFJA 2XWJI 2GESA 3FDZA 4FT2A 1ZW1A 3UANA 5JSKA 1FTQA 1MLDA 2QTFA 3G2JA 2I03A 2QRMA 2IPMA 3V4PB 2R1TA 1AZLA 3P9KA 3ZY3A 4AMGA 3Q72A 4DCJA 3KT6A 4RS3A 5TMBA 3NAMA 1VGRA 3KEQA 4YJ3B 4ZJPA 4HDOB 2RSLA 2OLEA 1BFUA 3FMFA 4I4NA 1DT5A 3TEMA 3QE3A 3OLCX 3S3TA 1YFJA 2Z56A 1QHFA 2VP0A 1FNNA 1TVCA 2AJLI 5H16A 3FBWA 3GFSA 2XCRB 5ALOA 5IZ4A 1ZN7A 2WF6A 4BS9A 3DTYA 4I6GA 2R6CA 4U6QA 1ENOA 3EC1A 2IHNA 2G71A 3VC1A 1KFCB 2Y0PA 3MM4A 3PS9A 1UKYA 1ZIOA 4DWOA 4YMTA 1I4LD 4YR7A 2C59A 3X2FA 2HK6A 4MS1B 3GEHA 2PDAA 1SOMA 2EBHX 4FR2A 4KI7A 4K9DA 3N53A 2Q99A 4KKVA 4KZPA 2ZT8A 3WGLA 4RH1A 4E33A 2J48A 2PTGA 3T7RA 2R11A 4IDFA 1OT5A 4NP6A 3LWDA 3GLHA 2L17A 1QYWA 3ILVA 4QX6A 3KJGA 4LWPA 1RWVA 3DWGA 4WY5A 1WZ2A 5B4TA 3QPDA 3E4CA 3UK2A 2ECOA 4W63A 4Q66C 2RHLA 3JQBA 3D6JA 5JAHA 1SHJA 1DC4A 4DR3B 3QEOA 3V4LA 2ZB3A 2RHMA 1HYQA 2QNRA 5GZ6A 4KGDA 3LYAA 4IJ5A 3RT7A 4LYJA 4N7BA 2C1ZA 2NLOA 3NUQA 1GRQA 3H11A 4WLFA 1F2UA 1OXVA 5GJCA 2R6HA 3GUYA 3ZJYA 1Z2EA 4XWAA 2ZITA 3T41A 1QANA 3IVRA 3RYIA 2V59A 2VAVA 3FA2A 3ID6C 4RTQA 4YUYA 1DQPA 3O1JC 4LFCB 4ZEWA 4XEHA 1ISGA 2ZIZA 3P97A 3IR5A 4O4LB 5JVDA 1BVYF 1TUGA 2JLSA 1ZC4A 5CH5A 2I71A 1JLSA 1G2PA 2WKSA 3AM3A 3JQDA 1CLEA 3GRFA 2DKFA 2ZIAA 3H84A 1EEHA 5CIQA 2Y1CA 2AVNA 1BN6A 1M6WA 2IXFA 4E6EA 6REQB 2OECA 1CS0A 3RLFA 1W87A 2J5QA 1RT9A 5KVVA 3E7WA 2Q4RA 5A6VA 3H99A 1UDWA 1DV1A 3QU7A 4HJXA 3K9WA 4MA0A 1HURA 1X9GA 2W6MA 3DO6A 5KX5A 1E2DA 1OYYA 3LPDA 4X61A 1NP7A 2II6A 4A8JB 1Q0RA 3K1TA 4G8BA 5FOWA 3TTTA 4C0WA 1V26A 3T7SA 5IDVA 4HLDA 3VR0A 1L5SA 4ILEA 3VX4A 2V5AA 1JNYA 3ND7A 3OLVA 2F3QA 4G5QA 1GEGA 1OXXK 5CT6A 3MJCA 2PFKA 1GDDA 3HVHA 1D1TA 1NWCA 3IUEA 1LDEA 3GVPA 3LY9A 1ZVJA 4FE7A 3W4IA 4B6FA 3UHPA 5K20A 1CEEA 5BSRA 4QAJA 4RTNA 3NIDB 1PFKA 1QORA 3P19A 4J6FA 4BU0A 5K2OA 3KKQA 1SK8A 2O57A 1PJ3A 1E2PA 2P75A 1EE1A 1RAHA 3EBOA 1RBQA 4DLYA 5CB8A 5LQAA 4MAFA 4F4DA 1FTSA 1OYVA 1F2DA 3P9CA 2VFAA 1AB6A 4L28A 5ECWA 1Q7EA 3C3CA 3NBZC 5CVEA 3OJEA 4CF3A 1OC2A 1EFVA 2D5CA 3CT6A 4ERXA 4WJZA 4LVOA 3CBGA 3W2EA 4ER5A 1XT6A 4MIOA 1FNMA 1NKSA 4BFWA 5JSZB 5DM1A 3DLBA 3G23A 4S12A 1E9VA 1XZ8A 3N7AA 1LEHA 5BYJA 1FK8A 4IZOA 3T4UA 3VAYA 3AEKB 1EXVA 2J9ZB 5DPMA 1XQXA 2ZUCA 2N75A 2V65A 1EK6A 2OBMA 3GN2A 2QW0X 2OSVA 2QP4A 4OFWA 5T4EA 2Y99A 5G4KA 3ZV7A 4YAKA 3U6KA 1KBQA 1EK1A 3IO3A 4HEA6 1RWKA 2HCTA 2RH9B 3F3KA 3R0VA 1U7XA 1HM5A 1NDHA 5SYMA 4PTYA 4BWVA 4D9GA 5JS7A 4MI1A 3OCYA 5JJKA 5EZYB 1M2VA 3D5TA 4DG9A 2ZT5A 3F3YA 2VJBA 2QMYA 4L75A 4GPBA 4URFA 5J5AA 2YVAA 5E9WA 3EPRA 4DV5B 3KB1A 4AY2A 1E3JA 4LJLA 4G0NA 4GZMA 1C8BA 1VL6A 5FPQA 3TIIA 4KXXA 4JI3B 4QFDA 1QKIA 3OECA 4MRVA 4FE4A 3I53A 2OLJA 2R6DA 3LPCA 3OWXA 3T4XA 2P4SA 2NZWA 3RSGA 2BV3A 5KTPA 1KRXA 2VNSA 2YIJA 4W99A 4B2IA 2IEAA 5TEWA 4JIMA 1T4MA 3FRIA 1Q17A 4MWCA 2JFFA 3TQOA 5GONB 4BKPA 4D9IA 4FFPA 3OT1A 3FFBA 3A2LA 3BHIA 3N86A 1IOVA 1HDRA 3AR8A 3O4VA 4YRCA 3PPIA 4AY3A 3DE0X 5LOVF 5HM6A 1SQ0A 5FPPA 2B3TA 2AZXA 2QYTA 4HG2A 3TG2A 2DQZA 1SXJA 1LS1A 3HJUA 1KQPA 1PVDA 2G5TA 3FIJA 3IQEA 3PIRA 1THTA 4UOEA 4K9RA 2JPDA 2QQEA 2WKQA 3DJFA 4MP6A 2VHEA 1XPOA 2GF2A 2O1XA 4FNAA 3U5ZB 1KSHA 1YQUA 1WBDA 3WA7A 2IYNA 2Q8QA 1ZK3A 4KGXA 4MUFA 4EG8A 3S55A 2VK8A 5DHUA 5SZKB 5DM2A 4GYYA 2V8OA 4CIBA 2WSMA 4POOA 1EM6A 3M5WA 3VI4B 2YNMA 2RHHA 1PK8A 2QT9A 3WL6A 4ZK6A 4RIEA 1VMDA 1WJGA 2BJWA 3JQCA 2XYHA 3PQ2A 4GKAA 3KT3A 4NABA 1I9GA 5K6RA 2ZIEA 3ZH9B 2WQ6A 3L0CA 2QL5A 5EZSA 3K4QA 3PHLA 4ZI5A 4H4CA 4O2LA 2G8LA 3G2IA 1I2MA 1U2GA 3C3EA 4Z2YA 4ZCTA 5IULC 2E4WA 4MDHA 3NEAA 1M1NB 5CXXA 1Z34A 5FFFA 4ND8A 3ZS9A 1JIUA 3UJ3X 1KSFX 3BIWA 3OLWA 3HJBA 1DIBA 3H4IA 5HG0A 5HYVA 3K96A 5C46F 2FEWB 2PR2A 1XEWX 2GNPA 5FI3A 3DUFB 1I13A 2HGSA 1AU9A 2HXGA 2JAHA 3C5CA 2NUBA 2XLCA 4IJKA 1A5ZA 1G0NA 1F6DA 1I4EB 1MBZA 3CRNA 3FFWA 5A0TA 1NI5A 1D2CA 4JKOA 2OD2A 4JY7A 4MUEA 5B3LA 3EIUA 3PE4A 3IP8A 4UU8A 5D51S 1NT2A 2IYUA 1AKWA 2H0RA 1SFRA 1G66A 1SXJD 2NTVA 2PGAA 3FWNA 3IHKA 4H15A 5K3FB 1XDBA 2VTKA 2QL9A 3DL2A 1DOHA 4DZRA 1FYWA 4UUOA 3SXUA 3ZG6A 1KU6A 1CZOA 3DA8A 2I99A 1W2WB 3W5JA 2FP3A 2KSQA 3CTPA 3I9KA 4B2YA 5DIZA 2EZ9A 5JHGB 4GNKA 4M8LA 4X6YA 5C32A 1ZRHA 2O6LA 3ESXA 4G5GA 1D4ZA 3TLEA 2IS4A 1GSIA 3LH5A 1AQ6A 1HLGA 4FOOA 1MOZA 5DJ5A 4F5DA 4F6LA 2Z4TA 4ACAA 2YNMD 4C29A 2LCQA 2R8ZA 1FDSA 1B16A 2CWDA 2FJPA 1MPTA 1JQKA 2PO5A 3LUPA 4MUKA 4DWVA 1SBNE 4JC0A 2WAXA 3VZDA 1C4WA 2IUYA 2CT8A 1WA5A 3DC2A 4I4TA 2HK8A 4JA2A 4HDKB 5U4QA 5KQLA 5GP1A 4EY7A 3H42B 4QQRA 5C1PA 2ZUEA 4ZEXA 4K3UA 2AXEA 3TFOA 2P9BA 1JBEA 1PVOA 2OHHA 2Z8ZA 5EQDA 4NK4A 4F3CA 5AVWA 3C8MA 1PAUA 3W5CA 4OUDB 4YALA 3DZJA 1I7QB 2PUAA 4R1LA 3WL5A 2VBGA 3JAWB 4DEVA 5FNVF 1PEKE 3H5WA 1SBCA 4WVLA 4QXRA 4II2A 3BBLA 3MWGA 2X7XA 3U4QB 3MD0A 4RHCA 1NUPA 3KL2A 4K9LA 1J8DA 5TJHA 3RFCA 3TKYA 4B71A 1RHQA 1XG5A 4EA7A 5EUBA 5C9ZA 3O03A 1UJCA 1P73A 2HMSA 4OJQA 4FDMA 4KGVA 5I4IA 3MMSA 2Z58A 2ZIGA 4M0EA 5DGIA 4RF4A 1AE1A 2GJ9A 2D1RA 1P4HA 1RAFA 4YCBA 3ZHQA 4CLOA 2C2XA 3V8NA 5AW9A 3OE5A 3VPAA 2DFDA 1JAXA 3FNGA 3V3KA 4RHFA 1BKDR 1PV4A 2ZSFA 2ZZMA 5JAMA 1IIRA 2F1HA 3QMWA 3AONB 3D1VA 4L0MA 4UM9B 3GZNB 3F71A 3R6WA 2PMEA 2VTBB 4OATA 2DB3A 1O96B 1ZEJA 2EL9A 4Q24A 3KQUA 4RD3A 3I09A 3P0JA 1RHMA 3U4HA 2HHAA 1SQGA 4QUAA 4ETMA 2LNDA 4EI9A 1HI9A 2ON6A 4D82A 3A28A 3K6RA 5BV1A 4GL2A 2G28A 3ETDA 4KIUA 1I80A 4L22A 3HXTA 4X8HA 4BQNA 2QXTA 4EHIA 1JR3E 4Q19A 1HE5A 4X3OA 3HWRA 2IHKA 1X3LA 4Z51A 3QX7A 2QYOA 4IGEA 4RSGA 5D6NA 3OZRA 4IDHA 1NE2A 2I8LA 3DV2A 3HBLA 3LUJA 4NV1A 2X58A 5AKZA 3ZWAA 3WLEA 3OJFA 4RPGA 3VDRA 3KUKA 4M87A 4XIJA 3USES 5B3JC 5DCUA 3I8OA 4UARA 4YP5A 2F3UA 2JCXA 4G0ZA 4LDRA 1V2GA 4RD6A 1BMFA 1XRNA 3OC0A 2VTEA 4Q1BA 4NCIA 5ALZA 2CUKA 2F59A 3DDCA 3LYUA 3QLTA 5T3UA 1L4HA 2GO1A 5THKA 4D42A 3PG5A 4HQ0A 4L3OA 4WUTA 2QU7A 2OXIA 3CUUA 4U6NA 1YB2A 4O0LA 3U09A 4Q4AA 3ZXXA 1R74A 5ER6A 4PGFA 2W2PA 3ZHXA 2I4MA 1SXJE 2HZ7A 3ZWWA 5GTDA 1Z5PA 4B48A 3IRVA 4OX9B 2CLFB 2YVKA 3BGSA 3KSMA 3Q7IA 1ADFA 1TZ2A 2Z2KA 3N1UA 4OBEA 5A06A 2UUAB 4G5RA 4MEAA 2DERA 3H19A 1DAMA 4EYQA 3ACCA 2EGGA 3HDTA 5DX8A 5BNTA 2V1UA 1Y7HA 3LP8A 2Z4RA 3HXQA 2XNKA 4HLCA 3QMVA 3U7HB 5BUCA 3TGLA 4GU5A 3E3LA 1F48A 3GDFA 3ASUA 3C6MA 1PR1A 2W6PA 3IEXA 4AX4A 4BVHA 2ZSDA 5LIPA 4CQNA 1AUPA