3A07A

Crystal structure of actinohivin; potent anti-hiv protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
116
structure length
116
Chain Sequence
QFASVTIRNAQTGRLLDSNYNGNVYTLPANGGNYQRWTGPGDGTVRNAQTGRCLDSNYDGAVYTLPCNGGSYQKWLFYSNGYIQNVETGRVLDSNYNGNVYTLPANGGNYQKWYTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism by which the lectin actinohivin blocks HIV infection of target cells
pubmed doi rcsb
molecule keywords Actinohivin
molecule tags Antiviral protein
total genus 34
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3a07A00
1ISXA 1IOBA 1FMZA 7I1BA 2AXMA 9ILBA 2I1BA 5EC5A 1JLXA 4QO3A 2ZR1B 3BTAA 2ERMA 4IONA 1SZ6B 1R8OA 1YF8B 3AKIA 3BRDA 3O5WB 3RTJB 3N7JA 3VT1A 4G6JA 3NJ5A 1DIWA 3B9UA 4JAWA 41BIA 2LIQA 4L4HA 2P39A 4L4IA 5JLVA 3POKA 3CQAA 1PC8B 3VSZA 4AN7B 3BADA 1G82A 5DUYA 3KMVA 1S0GA 2KI6B 4DCKC 1A8DA 1DFQA 3I2AA 5BXPA 1S0LA 2VLCA 4OUJA 4QALA 3AH4A 2QYIB 3FJIA 4OW4A 4KEJA 3AH1A 1MD6A 3A07A 4ZFUB 2ZQOA 3OJVA 4I4RA 4F34A 3WINA 2MLLB 3N7LA 5DZUA 4I4PA 3WMUA 5I1BA 4GOVA 1FWVA 2DRYA 3FJ9A 4EFPA 4G9MA 5F8SA 3AZWA 4ZA3B 1EV2A 2KI4A 2X2TA 4I3NA 4ISQA 3FJHA 2NTDA 4XKIA 3FJJA 4I4YA 4P0LA 3IM5A 4ZOTA 3JRRA 2Q3NB 4G6MA 4J23B 3WA1A 2F2FC 4AN6A 1TP0A 2AFGA 1JT3A 1AFCA 1Z0HA 21BIA 2VSEA 5GAQA 3CA1A 3HOMA 4QC4A 1WD3A 1ISWA 4HR6C 3TC2A 3OBTA 1JLYA 3VSFA 5BXTA 1G9DA 4J2SA 3CRHA 3BAOA 1WD4A 4J2KA 1CVSA 4IZEA 3I29B 1IRPA 2NYYA 5D63A 2L5XA 3ZC9A 1Q03A 2Y9XE 1DQGA 4LO3C 3O3QA 3W9TA 3VUOA 5F90A 3FJ8A 1FWUA 3BA5A 4I1BA 2KKIA 5BP5C 3AJ5A 3VWCA 1HCEA 4JP0A 3BRFA 3C9ZA 3OJMA 1TWEA 3I2XA 4IY9A 3VEQA 3CA6A 4A7YA 3QR5A 4I4UA 3CAHA 1PZZA 3UD7A 5BVPI 2M49A 5E24E 3AH2A 2GO2A 3O4DA 3AKHA 3CA4A 4ZKTB 1ITBA 1DZDA 1WBAA 2E4MC 4JKQA 8I1BA 1VCLA 1BFBA 4LO2C 4P6AA 2HWMA 1HIBA 2F2FA 3PMEA 1RZOB 3HMYA 4QD2C 1FV2A 1Z2VA 4X3AA 1QQLA 2RG9B 3O4AA 3A23A 4FVVA 4EFRA 3FJKA 3RSJA 3Q7XA 4J2XA 2DREA 3WO2A 1IHKA 3NBDA 1HWNB 4XFSA 1YTOA 1JT5A 1XYFA 4XFTA 5BOWA 4QKSA 1RMLA 2MIBA 1TOOA 3MPPG 3HBWA 3BRGC 4Z8SB 3CRGA 4Q91A 3V0AB 1AF9A 3H6RA 4LO3A 3FJBA 2D20A 1M16A 4QBCA 3AKFA 2NM1A 5BP5A 2DRZA 3NBNA 1G9BA 1HKNA 2RQ9A 4OWLA 1JTCA 4KC3A 3SNVA 3FJEA 5JMCA 3HALA 4DENA 2BEAA 3UD9A 4ISRA 1XG6A 3F62B 4II0A 1G9AA 3NBEA 3UJ4A 4LO1C 3RMYA 1S0DA 4IHZA 3CA5A 2E4MA 4LO2A 2D7IA 1HCDA 1Z4SA 1T9FA 2LIEA 4TLPA 1JT4A 1OQLB 4I2SA 1ABRB 1EVTA 4JPZA 1DFCA 1K5UA 3V0AA 4ZFYB 3BX1C 1PUMB 1ISYA 3O4BA 3PUBA 2MC2A 4G1RA 3RTIB 1V6XA 1DLLA 4X38A 4I4XA 4I6IA 3VT0A 3UD8A 3S8JA 1II4A 3BAQA 2X2SA 2F8XC 3Q7WA 5HPZA 5FZUA 2HW9A 3MALA 1BLAA 2Z49A 3A21A 4WBCA 3O4CA 1W3AA 2AQZA 2VXRA 1ISVA 1RG8A 4OWJA 5FZZA 4IY8A 1HWOB 1XHBA 1BLDA 3UDAA 4LO7C 2ZQNA 2UUSA 3OJ2A 1AVWB 3FUOA 2R9KB 4A7KA 2FFVA 2NP0A 1PWAA 2D7RA 3HSMA 3K1XA 1I1EA 4LO1A 4EB2B 3P53A 2D44A 5D62A 4ZGRB 5G00A 4JKXB 5FZYA 3BA7A 4LO7B 3R4UA 2YUGA 3RMXA 4EEEB 1BA7A 4XFUA 3AKGA 3AJ6A 1K5VA 4G9NA 3BAHA 4KBBA 3V79C 1AXMA 5FNWA 4YOLA 2IWTB 4FGFA 1S0BA 3BAGA 2J3PA 3BAVA 3O44A 3S8KA 1V6UA 3H6RB 3P6IA 1BARA 4PC4A 1FGAA 3R4SA 1Q04A 5DSSB 2D43A 3OBRA 1AVXB 4OEEA 1J0SA 3Q7YA 2BEBA 2RSTA 1EPWA 4ENDA 1WBCA 2HZ9A 3JUTA 1JQZA 4ZFWB 4GOYA 1YXWA 1JY0A 3FJFA 2VXTI 3FJAA 4QKRA 1NUNA 3H6SE 2D1ZA 3CA0A 3F1RA 3LTQA 3BAUA 4A7ZA 4D0TA 3QYDA 4QD2B 1FV3A 3IM6A 2FFUA 4I1EA 4H04A 3HN1A 1BFGA 5FNXA 4I8MA 2VU9A 3UJ0A 3CU1B 4J2YA 1RY7A 1DZCA 1E0OA 4Z9WB 3V0BA 2Z48A 4GP3A 4GP0A 1S0CA 3ZC8A 2AAIB 2VSAA 1KNMA 4IYBA 3IM7A 4QBVA 5F8WA 2P23A 6I1BA 3N7MA 1FN0A 1R8NA 4F83A 1TIEA 1MC9A 5BXRA 4HJJA 3ZXGA 5B2HA 1IJTA 1GGPB 3N7KA 1SR4C 1L2HA 1DQOA 1YYNA 1S0EA 3ZXDA 3LLPA 2K43A 4EKXB 2BFHA 1BFFA 3O4OA 2K8RA 2ESUA 2K4AB 3IAGC 1DJSB 3BA4A 4OWKA 2HWAA 4I0YA 1I1BA 4GAFA 4LO0C 2QN4A 4X37A 2DS0A 4D0ZA 4I96A 4I37A 1AVUA 4LO8B 3O49A 1EYLA 1G9CA 3FFZA 2D22A 1IT0A 2Q9XA 5EHAA 2WBCA 3CRIA 2FDBM 1W3FA 3D7WB 2NVHA 4OEFA 1CE7B 4X39A 1V6WA 3AZVA 3OGFA 5F8YA 3OGGA 1FMMS 1PUUB 1TFMB 1F31A 3E8LC 3N0KA 1ISZA 3VT2A 3FJDA 3NBCA 4IQPA 2Y9FA 4DEPA 3H6QA 4EFQA 2KLLA 3ZX7A 2IHOA 4USOA 1UPSA 2KH2A 5DVHA 1SR4A 4H9WA 5EG6C 5BXSA 3EF2A 5BQUC 1IILA 3BB2A 1N4KA 4KEIA 3IIRA 4ZLBB 1P63A 1ILR1 2WRYA 3ILAA 31BIA 2XOAA 4D8HA 3FGMA 4LO0A 1T4QA 3WO3A 1V6VA 3T8SA 1JT7A 4I7IA 1TWMA 2ET2A 1M2TB 3V0BB 4I4OA 1AVAC 1XZZA 3PHZA 1HWMB 4USPA 2Y9WC 3P6JA 1QQKA 4OEGA 4CJMA 1FQ9A 2D23A 4GAIA 4HA2A 4I4SA 4JRAA 4KEKA 3FUQA 1BASA 4P0JA 4P0KA 2GZBA 1YBIA 3PG0A 2FGFA 3FJCA 1W3GA 4JQ0A 1TTUA 2D24A 4I4VA 3A22A 1ONKB 2FO1A 2NZ9A 3CA3A 4I4QA 4Q9PA 5BQUA 2Y9GA 1BFCA 3WO4A 3WINC 1HWPB 1D0HA 4R6UB 5D61A 1QXMA 1S0FA 3WMVA 4Q9GA 4ZBVB 1Q1UA 2VUAA 1NZKA 4IZXA 1IRAX
chains in the Genus database with same CATH superfamily
1ISXA 1IOBA 1FMZA 7I1BA 2AXMA 9ILBA 2I1BA 5EC5A 1JLXA 4QO3A 2ZR1B 3BTAA 2ERMA 4IONA 1SZ6B 1R8OA 1YF8B 3AKIA 3BRDA 3O5WB 3RTJB 3N7JA 4H75A 3VT1A 4G6JA 3NJ5A 1DIWA 3B9UA 4JAWA 41BIA 2LIQA 4L4HA 2P39A 4L4IA 5JLVA 3POKA 3CQAA 1PC8B 3VSZA 4AN7B 3BADA 1G82A 5DUYA 3KMVA 1S0GA 2KI6B 4DCKC 1A8DA 1DFQA 3I2AA 5BXPA 1S0LA 2VLCA 4OUJA 4QALA 3AH4A 2QYIB 3FJIA 4OW4A 4KEJA 3AH1A 1MD6A 3A07A 4ZFUB 2ZQOA 3OJVA 4I4RA 4F34A 3WINA 2MLLB 3N7LA 5DZUA 4I4PA 3WMUA 5I1BA 4GOVA 1FWVA 2DRYA 3FJ9A 4EFPA 4G9MA 5F8SA 3AZWA 4ZA3B 1EV2A 2KI4A 2X2TA 4I3NA 4ISQA 3FJHA 2NTDA 4XKIA 3FJJA 4I4YA 4P0LA 3IM5A 4ZOTA 3JRRA 2Q3NB 4G6MA 4J23B 3WA1A 2F2FC 4AN6A 1TP0A 2AFGA 1JT3A 1AFCA 1Z0HA 21BIA 2VSEA 5GAQA 3CA1A 3HOMA 4QC4A 1WD3A 1ISWA 4HR6C 3TC2A 3OBTA 1JLYA 3VSFA 5BXTA 1G9DA 4J2SA 3CRHA 3BAOA 1WD4A 4J2KA 1CVSA 4IZEA 3I29B 1IRPA 2NYYA 5D63A 2L5XA 3ZC9A 1Q03A 2Y9XE 1DQGA 4LO3C 3O3QA 3W9TA 3VUOA 5F90A 3FJ8A 1FWUA 3BA5A 4I1BA 2KKIA 5BP5C 3AJ5A 3VWCA 1HCEA 4JP0A 3BRFA 3C9ZA 3OJMA 1TWEA 3I2XA 4IY9A 3VEQA 3CA6A 4A7YA 3QR5A 4I4UA 3CAHA 1PZZA 2NS2A 3UD7A 5BVPI 2M49A 5E24E 3AH2A 2GO2A 3O4DA 3AKHA 3CA4A 4ZKTB 1ITBA 1DZDA 1WBAA 2E4MC 4JKQA 8I1BA 1VCLA 1BFBA 4LO2C 4P6AA 2HWMA 1HIBA 2F2FA 3PMEA 1RZOB 3HMYA 4QD2C 1FV2A 1Z2VA 4X3AA 1QQLA 2RG9B 3O4AA 3A23A 4FVVA 4EFRA 3FJKA 3RSJA 3Q7XA 4J2XA 2DREA 3WO2A 1IHKA 3NBDA 1HWNB 4XFSA 1YTOA 1JT5A 1XYFA 4XFTA 5BOWA 4QKSA 1RMLA 2MIBA 1TOOA 3MPPG 3HBWA 3BRGC 4Z8SB 3CRGA 4Q91A 3V0AB 1AF9A 3H6RA 4LO3A 3FJBA 2D20A 1M16A 4QBCA 3AKFA 2NM1A 5BP5A 2DRZA 3NBNA 1G9BA 1HKNA 2RQ9A 4OWLA 1JTCA 4KC3A 3SNVA 3FJEA 5JMCA 3HALA 4DENA 2BEAA 3UD9A 4ISRA 1XG6A 3F62B 4II0A 1G9AA 3NBEA 3UJ4A 4LO1C 3RMYA 1S0DA 4IHZA 3CA5A 2E4MA 4LO2A 2D7IA 1HCDA 1Z4SA 1T9FA 2LIEA 4TLPA 1JT4A 1OQLB 4I2SA 1ABRB 1EVTA 4JPZA 1DFCA 1K5UA 3V0AA 4ZFYB 3BX1C 1PUMB 1ISYA 3O4BA 3PUBA 2MC2A 4G1RA 3RTIB 1V6XA 1DLLA 4X38A 4I4XA 4I6IA 3VT0A 3UD8A 3S8JA 1II4A 3BAQA 2X2SA 2F8XC 3Q7WA 5HPZA 5FZUA 2HW9A 3MALA 1BLAA 2Z49A 3A21A 4WBCA 3O4CA 1W3AA 2AQZA 2VXRA 1ISVA 1RG8A 4OWJA 5FZZA 4IY8A 1HWOB 4MZHA 1XHBA 1BLDA 3UDAA 4LO7C 2ZQNA 2UUSA 3OJ2A 1AVWB 3FUOA 2R9KB 4A7KA 2FFVA 2NP0A 1PWAA 2D7RA 3HSMA 3K1XA 1I1EA 4LO1A 4EB2B 3P53A 2D44A 5D62A 4ZGRB 5G00A 4JKXB 5FZYA 3BA7A 4LO7B 3R4UA 2YUGA 3RMXA 4EEEB 1BA7A 4XFUA 3AKGA 3AJ6A 1K5VA 4G9NA 3BAHA 4KBBA 3V79C 1AXMA 5FNWA 4YOLA 2IWTB 4FGFA 1S0BA 3BAGA 2J3PA 3BAVA 3O44A 3S8KA 1V6UA 3H6RB 3P6IA 1BARA 4PC4A 1FGAA 3R4SA 1Q04A 5DSSB 2D43A 3OBRA 1AVXB 4OEEA 1J0SA 4UY4A 3Q7YA 2BEBA 2RSTA 1EPWA 4ENDA 1WBCA 2HZ9A 3JUTA 1JQZA 4ZFWB 4GOYA 1YXWA 1JY0A 3FJFA 2VXTI 3FJAA 4QKRA 1NUNA 3H6SE 2D1ZA 3CA0A 3F1RA 3LTQA 3BAUA 4A7ZA 4D0TA 3QYDA 4QD2B 1FV3A 3IM6A 2FFUA 4I1EA 4H04A 3HN1A 1BFGA 5FNXA 4I8MA 2VU9A 3UJ0A 3CU1B 4J2YA 1RY7A 1DZCA 1E0OA 4Z9WB 3V0BA 2Z48A 4GP3A 4GP0A 1S0CA 3ZC8A 2AAIB 2VSAA 1KNMA 4IYBA 3IM7A 4QBVA 5F8WA 2P23A 6I1BA 3N7MA 1FN0A 1R8NA 4F83A 1TIEA 1MC9A 5BXRA 4HJJA 3ZXGA 5B2HA 1IJTA 1GGPB 3N7KA 1SR4C 1L2HA 1DQOA 1YYNA 1S0EA 3ZXDA 3LLPA 2K43A 4EKXB 2BFHA 1BFFA 3O4OA 2K8RA 2ESUA 2K4AB 3IAGC 1DJSB 3BA4A 4OWKA 2HWAA 4I0YA 1I1BA 4GAFA 4LO0C 2QN4A 4X37A 2DS0A 4D0ZA 4I96A 4I37A 1AVUA 4LO8B 3O49A 1EYLA 1G9CA 3FFZA 2D22A 1IT0A 2Q9XA 5EHAA 2WBCA 3CRIA 2FDBM 1W3FA 3D7WB 2NVHA 4OEFA 1CE7B 4X39A 1V6WA 3AZVA 3OGFA 5F8YA 3OGGA 4MZFB 1FMMS 1PUUB 1TFMB 1F31A 3E8LC 3N0KA 1ISZA 3VT2A 3FJDA 3NBCA 4IQPA 2Y9FA 4DEPA 3H6QA 4EFQA 2KLLA 3ZX7A 2IHOA 4USOA 1UPSA 2KH2A 5DVHA 1SR4A 4H9WA 5EG6C 5BXSA 3EF2A 5BQUC 1IILA 3BB2A 1N4KA 4KEIA 3IIRA 4ZLBB 1P63A 1ILR1 2WRYA 3ILAA 31BIA 2XOAA 4D8HA 3FGMA 4LO0A 1T4QA 3WO3A 1V6VA 3T8SA 1JT7A 4I7IA 1TWMA 2ET2A 1M2TB 4MZGB 3V0BB 4I4OA 1AVAC 1XZZA 3PHZA 1HWMB 4USPA 2Y9WC 3P6JA 1QQKA 4OEGA 4CJMA 1FQ9A 2D23A 4GAIA 4HA2A 4I4SA 4JRAA 4KEKA 3FUQA 1BASA 4P0JA 4P0KA 2GZBA 1YBIA 3PG0A 2FGFA 3FJCA 1W3GA 4JQ0A 1TTUA 2D24A 4I4VA 3A22A 1ONKB 2FO1A 2NZ9A 3CA3A 4I4QA 4Q9PA 5BQUA 2Y9GA 1BFCA 3WO4A 3WINC 1HWPB 1D0HA 4R6UB 5D61A 1QXMA 1S0FA 3WMVA 4Q9GA 4ZBVB 1Q1UA 2VUAA 1NZKA 4IZXA 1IRAX
chains in the Genus database with same CATH topology
1ISXA 1IOBA 1FMZA 7I1BA 2AXMA 9ILBA 2I1BA 5EC5A 1JLXA 4QO3A 2ZR1B 3BTAA 2ERMA 4IONA 1SZ6B 1R8OA 1YF8B 3AKIA 3BRDA 3O5WB 3RTJB 3N7JA 4H75A 3VT1A 4G6JA 3NJ5A 1DIWA 3B9UA 4JAWA 41BIA 2LIQA 4L4HA 2P39A 4L4IA 5JLVA 3POKA 3CQAA 1PC8B 3VSZA 4AN7B 3BADA 1G82A 5DUYA 3KMVA 1S0GA 2KI6B 4DCKC 1A8DA 1DFQA 3I2AA 5BXPA 1S0LA 2VLCA 4OUJA 4QALA 3AH4A 2QYIB 3FJIA 4OW4A 4KEJA 3AH1A 1MD6A 3A07A 4ZFUB 2ZQOA 3OJVA 4I4RA 4F34A 3WINA 2MLLB 3N7LA 5DZUA 4I4PA 3WMUA 5I1BA 4GOVA 1FWVA 2DRYA 3FJ9A 4EFPA 4G9MA 5F8SA 3AZWA 4ZA3B 1EV2A 2KI4A 2X2TA 4I3NA 4ISQA 3FJHA 2NTDA 4XKIA 3FJJA 4I4YA 4P0LA 3IM5A 4ZOTA 3JRRA 2Q3NB 4G6MA 4J23B 3WA1A 2F2FC 4AN6A 1TP0A 2AFGA 1JT3A 1AFCA 1Z0HA 21BIA 2VSEA 5GAQA 3CA1A 3HOMA 4QC4A 1WD3A 1ISWA 4HR6C 3TC2A 3OBTA 1JLYA 3VSFA 5BXTA 1G9DA 4J2SA 3CRHA 3BAOA 1WD4A 4J2KA 1CVSA 4IZEA 3I29B 1IRPA 2NYYA 5D63A 2L5XA 3ZC9A 1Q03A 2Y9XE 1DQGA 4LO3C 3O3QA 3W9TA 3VUOA 5F90A 3FJ8A 1FWUA 3BA5A 4I1BA 2KKIA 5BP5C 3AJ5A 3VWCA 1HCEA 4JP0A 3BRFA 3C9ZA 3OJMA 1TWEA 3I2XA 4IY9A 3VEQA 3CA6A 4A7YA 3QR5A 4I4UA 3CAHA 1PZZA 2NS2A 3UD7A 5BVPI 2M49A 5E24E 3AH2A 2GO2A 3O4DA 3AKHA 3CA4A 4ZKTB 1ITBA 1DZDA 1WBAA 2E4MC 4JKQA 8I1BA 1VCLA 1BFBA 4LO2C 4P6AA 2HWMA 1HIBA 2F2FA 3PMEA 1RZOB 3HMYA 4QD2C 1FV2A 1Z2VA 4X3AA 1QQLA 2RG9B 3O4AA 3A23A 4FVVA 4EFRA 3FJKA 3RSJA 3Q7XA 4J2XA 2DREA 3WO2A 1IHKA 3NBDA 1HWNB 4XFSA 1YTOA 1JT5A 1XYFA 4XFTA 5BOWA 4QKSA 1RMLA 2MIBA 1TOOA 3MPPG 3HBWA 3BRGC 4Z8SB 3CRGA 4Q91A 3V0AB 1AF9A 3H6RA 4LO3A 3FJBA 2D20A 1M16A 4QBCA 3AKFA 2NM1A 5BP5A 2DRZA 3NBNA 1G9BA 1HKNA 2RQ9A 4OWLA 1JTCA 4KC3A 3SNVA 3FJEA 5JMCA 3HALA 4DENA 2BEAA 3UD9A 4ISRA 1XG6A 3F62B 4II0A 1G9AA 3NBEA 3UJ4A 4LO1C 3RMYA 1S0DA 4IHZA 3CA5A 2E4MA 4LO2A 2D7IA 1HCDA 1Z4SA 1T9FA 2LIEA 4TLPA 1JT4A 1OQLB 4I2SA 1ABRB 1EVTA 4JPZA 1DFCA 1K5UA 3V0AA 4ZFYB 3BX1C 1PUMB 1ISYA 3O4BA 3PUBA 2MC2A 4G1RA 3RTIB 1V6XA 1DLLA 4X38A 4I4XA 4I6IA 3VT0A 3UD8A 3S8JA 1II4A 3BAQA 2X2SA 2F8XC 3Q7WA 5HPZA 5FZUA 2HW9A 3MALA 1BLAA 2Z49A 3A21A 4WBCA 3O4CA 1W3AA 2AQZA 2VXRA 1ISVA 1RG8A 4OWJA 5FZZA 4IY8A 1HWOB 4MZHA 1XHBA 1BLDA 3UDAA 4LO7C 2ZQNA 2UUSA 3OJ2A 1AVWB 3FUOA 2R9KB 4A7KA 2FFVA 2NP0A 1PWAA 2D7RA 3HSMA 3K1XA 1I1EA 4LO1A 4EB2B 3P53A 2D44A 5D62A 4ZGRB 5G00A 4JKXB 5FZYA 3BA7A 4LO7B 3R4UA 2YUGA 3RMXA 4EEEB 1BA7A 4XFUA 3AKGA 3AJ6A 1K5VA 4G9NA 3BAHA 4KBBA 3V79C 1AXMA 5FNWA 4YOLA 2IWTB 4FGFA 1S0BA 3BAGA 2J3PA 3BAVA 3O44A 3S8KA 1V6UA 3H6RB 3P6IA 1BARA 4PC4A 1FGAA 3R4SA 1Q04A 5DSSB 2D43A 3OBRA 1AVXB 4OEEA 1J0SA 4UY4A 3Q7YA 2BEBA 2RSTA 1EPWA 4ENDA 1WBCA 2HZ9A 3JUTA 1JQZA 4ZFWB 4GOYA 1YXWA 1JY0A 3FJFA 2VXTI 3FJAA 4QKRA 1NUNA 3H6SE 2D1ZA 3CA0A 3F1RA 3LTQA 3BAUA 4A7ZA 4D0TA 3QYDA 4QD2B 1FV3A 3IM6A 2FFUA 4I1EA 4H04A 3HN1A 1BFGA 5FNXA 4I8MA 2VU9A 3UJ0A 3CU1B 4J2YA 1RY7A 1DZCA 1E0OA 4Z9WB 3V0BA 2Z48A 4GP3A 4GP0A 1S0CA 3ZC8A 2AAIB 2VSAA 1KNMA 4IYBA 3IM7A 4QBVA 5F8WA 2P23A 6I1BA 3N7MA 1FN0A 1R8NA 4F83A 1TIEA 1MC9A 5BXRA 4HJJA 3ZXGA 5B2HA 1IJTA 1GGPB 3N7KA 1SR4C 1L2HA 1DQOA 1YYNA 1S0EA 3ZXDA 3LLPA 2K43A 4EKXB 2BFHA 1BFFA 3O4OA 2K8RA 2ESUA 2K4AB 3IAGC 1DJSB 3BA4A 4OWKA 2HWAA 4I0YA 1I1BA 4GAFA 4LO0C 2QN4A 4X37A 2DS0A 4D0ZA 4I96A 4I37A 1AVUA 4LO8B 3O49A 1EYLA 1G9CA 3FFZA 2D22A 1IT0A 2Q9XA 5EHAA 2WBCA 3CRIA 2FDBM 1W3FA 3D7WB 2NVHA 4OEFA 1CE7B 4X39A 1V6WA 3AZVA 3OGFA 5F8YA 3OGGA 4MZFB 1FMMS 1PUUB 1TFMB 1F31A 3E8LC 3N0KA 1ISZA 3VT2A 3FJDA 3NBCA 4IQPA 2Y9FA 4DEPA 3H6QA 4EFQA 2KLLA 3ZX7A 2IHOA 4USOA 1UPSA 2KH2A 5DVHA 1SR4A 4H9WA 5EG6C 5BXSA 3EF2A 5BQUC 1IILA 3BB2A 1N4KA 4KEIA 3IIRA 4ZLBB 1P63A 1ILR1 2WRYA 3ILAA 31BIA 2XOAA 4D8HA 3FGMA 4LO0A 1T4QA 3WO3A 1V6VA 3T8SA 1JT7A 4I7IA 1TWMA 2ET2A 1M2TB 4MZGB 3V0BB 4I4OA 1AVAC 1XZZA 3PHZA 1HWMB 4USPA 2Y9WC 3P6JA 1QQKA 4OEGA 4CJMA 1FQ9A 2D23A 4GAIA 4HA2A 4I4SA 4JRAA 4KEKA 3FUQA 1BASA 4P0JA 4P0KA 2GZBA 1YBIA 3PG0A 2FGFA 3FJCA 1W3GA 4JQ0A 1TTUA 2D24A 4I4VA 3A22A 1ONKB 2FO1A 2NZ9A 3CA3A 4I4QA 4Q9PA 5BQUA 2Y9GA 1BFCA 3WO4A 3WINC 1HWPB 1D0HA 4R6UB 5D61A 1QXMA 1S0FA 3WMVA 4Q9GA 4ZBVB 1Q1UA 2VUAA 1NZKA 4IZXA 1IRAX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISX A;  1IOB A;  1FMZ A;  7I1B A;  2AXM A;  9ILB A;  2I1B A;  5EC5 A;  1JLX A;  4QO3 A;  2ZR1 B;  3BTA A;  2ERM A;  4ION A;  1SZ6 B;  1R8O A;  1YF8 B;  3AKI A;  3BRD A;  3O5W B;  3RTJ B;  3N7J A;  3VT1 A;  4G6J A;  3NJ5 A;  1DIW A;  3B9U A;  4JAW A;  41BI A;  2LIQ A;  4L4H A;  2P39 A;  4L4I A;  5JLV A;  3POK A;  3CQA A;  1PC8 B;  3VSZ A;  4AN7 B;  3BAD A;  1G82 A;  5DUY A;  3KMV A;  1S0G A;  2KI6 B;  4DCK C;  1A8D A;  1DFQ A;  3I2A A;  5BXP A;  1S0L A;  2VLC A;  4OUJ A;  4QAL A;  3AH4 A;  2QYI B;  3FJI A;  4OW4 A;  4KEJ A;  3AH1 A;  1MD6 A;  3A07 A;  4ZFU B;  2ZQO A;  3OJV A;  4I4R A;  4F34 A;  3WIN A;  2MLL B;  3N7L A;  5DZU A;  4I4P A;  3WMU A;  5I1B A;  4GOV A;  1FWV A;  2DRY A;  3FJ9 A;  4EFP A;  4G9M A;  5F8S A;  3AZW A;  4ZA3 B;  1EV2 A;  2KI4 A;  2X2T A;  4I3N A;  4ISQ A;  3FJH A;  2NTD A;  4XKI A;  3FJJ A;  4I4Y A;  4P0L A;  3IM5 A;  4ZOT A;  3JRR A;  2Q3N B;  4G6M A;  4J23 B;  3WA1 A;  2F2F C;  4AN6 A;  1TP0 A;  2AFG A;  1JT3 A;  1AFC A;  1Z0H A;  21BI A;  2VSE A;  5GAQ A;  3CA1 A;  3HOM A;  4QC4 A;  1WD3 A;  1ISW A;  4HR6 C;  3TC2 A;  3OBT A;  1JLY A;  3VSF A;  5BXT A;  1G9D A;  4J2S A;  3CRH A;  3BAO A;  1WD4 A;  4J2K A;  1CVS A;  4IZE A;  3I29 B;  1IRP A;  2NYY A;  5D63 A;  2L5X A;  3ZC9 A;  1Q03 A;  2Y9X E;  1DQG A;  4LO3 C;  3O3Q A;  3W9T A;  3VUO A;  5F90 A;  3FJ8 A;  1FWU A;  3BA5 A;  4I1B A;  2KKI A;  5BP5 C;  3AJ5 A;  3VWC A;  1HCE A;  4JP0 A;  3BRF A;  3C9Z A;  3OJM A;  1TWE A;  3I2X A;  4IY9 A;  3VEQ A;  3CA6 A;  4A7Y A;  3QR5 A;  4I4U A;  3CAH A;  1PZZ A;  3UD7 A;  5BVP I;  2M49 A;  5E24 E;  3AH2 A;  2GO2 A;  3O4D A;  3AKH A;  3CA4 A;  4ZKT B;  1ITB A;  1DZD A;  1WBA A;  2E4M C;  4JKQ A;  8I1B A;  1VCL A;  1BFB A;  4LO2 C;  4P6A A;  2HWM A;  1HIB A;  2F2F A;  3PME A;  1RZO B;  3HMY A;  4QD2 C;  1FV2 A;  1Z2V A;  4X3A A;  1QQL A;  2RG9 B;  3O4A A;  3A23 A;  4FVV A;  4EFR A;  3FJK A;  3RSJ A;  3Q7X A;  4J2X A;  2DRE A;  3WO2 A;  1IHK A;  3NBD A;  1HWN B;  4XFS A;  1YTO A;  1JT5 A;  1XYF A;  4XFT A;  5BOW A;  4QKS A;  1RML A;  2MIB A;  1TOO A;  3MPP G;  3HBW A;  3BRG C;  4Z8S B;  3CRG A;  4Q91 A;  3V0A B;  1AF9 A;  3H6R A;  4LO3 A;  3FJB A;  2D20 A;  1M16 A;  4QBC A;  3AKF A;  2NM1 A;  5BP5 A;  2DRZ A;  3NBN A;  1G9B A;  1HKN A;  2RQ9 A;  4OWL A;  1JTC A;  4KC3 A;  3SNV A;  3FJE A;  5JMC A;  3HAL A;  4DEN A;  2BEA A;  3UD9 A;  4ISR A;  1XG6 A;  3F62 B;  4II0 A;  1G9A A;  3NBE A;  3UJ4 A;  4LO1 C;  3RMY A;  1S0D A;  4IHZ A;  3CA5 A;  2E4M A;  4LO2 A;  2D7I A;  1HCD A;  1Z4S A;  1T9F A;  2LIE A;  4TLP A;  1JT4 A;  1OQL B;  4I2S A;  1ABR B;  1EVT A;  4JPZ A;  1DFC A;  1K5U A;  3V0A A;  4ZFY B;  3BX1 C;  1PUM B;  1ISY A;  3O4B A;  3PUB A;  2MC2 A;  4G1R A;  3RTI B;  1V6X A;  1DLL A;  4X38 A;  4I4X A;  4I6I A;  3VT0 A;  3UD8 A;  3S8J A;  1II4 A;  3BAQ A;  2X2S A;  2F8X C;  3Q7W A;  5HPZ A;  5FZU A;  2HW9 A;  3MAL A;  1BLA A;  2Z49 A;  3A21 A;  4WBC A;  3O4C A;  1W3A A;  2AQZ A;  2VXR A;  1ISV A;  1RG8 A;  4OWJ A;  5FZZ A;  4IY8 A;  1HWO B;  1XHB A;  1BLD A;  3UDA A;  4LO7 C;  2ZQN A;  2UUS A;  3OJ2 A;  1AVW B;  3FUO A;  2R9K B;  4A7K A;  2FFV A;  2NP0 A;  1PWA A;  2D7R A;  3HSM A;  3K1X A;  1I1E A;  4LO1 A;  4EB2 B;  3P53 A;  2D44 A;  5D62 A;  4ZGR B;  5G00 A;  4JKX B;  5FZY A;  3BA7 A;  4LO7 B;  3R4U A;  2YUG A;  3RMX A;  4EEE B;  1BA7 A;  4XFU A;  3AKG A;  3AJ6 A;  1K5V A;  4G9N A;  3BAH A;  4KBB A;  3V79 C;  1AXM A;  5FNW A;  4YOL A;  2IWT B;  4FGF A;  1S0B A;  3BAG A;  2J3P A;  3BAV A;  3O44 A;  3S8K A;  1V6U A;  3H6R B;  3P6I A;  1BAR A;  4PC4 A;  1FGA A;  3R4S A;  1Q04 A;  5DSS B;  2D43 A;  3OBR A;  1AVX B;  4OEE A;  1J0S A;  3Q7Y A;  2BEB A;  2RST A;  1EPW A;  4END A;  1WBC A;  2HZ9 A;  3JUT A;  1JQZ A;  4ZFW B;  4GOY A;  1YXW A;  1JY0 A;  3FJF A;  2VXT I;  3FJA A;  4QKR A;  1NUN A;  3H6S E;  2D1Z A;  3CA0 A;  3F1R A;  3LTQ A;  3BAU A;  4A7Z A;  4D0T A;  3QYD A;  4QD2 B;  1FV3 A;  3IM6 A;  2FFU A;  4I1E A;  4H04 A;  3HN1 A;  1BFG A;  5FNX A;  4I8M A;  2VU9 A;  3UJ0 A;  3CU1 B;  4J2Y A;  1RY7 A;  1DZC A;  1E0O A;  4Z9W B;  3V0B A;  2Z48 A;  4GP3 A;  4GP0 A;  1S0C A;  3ZC8 A;  2AAI B;  2VSA A;  1KNM A;  4IYB A;  3IM7 A;  4QBV A;  5F8W A;  2P23 A;  6I1B A;  3N7M A;  1FN0 A;  1R8N A;  4F83 A;  1TIE A;  1MC9 A;  5BXR A;  4HJJ A;  3ZXG A;  5B2H A;  1IJT A;  1GGP B;  3N7K A;  1SR4 C;  1L2H A;  1DQO A;  1YYN A;  1S0E A;  3ZXD A;  3LLP A;  2K43 A;  4EKX B;  2BFH A;  1BFF A;  3O4O A;  2K8R A;  2ESU A;  2K4A B;  3IAG C;  1DJS B;  3BA4 A;  4OWK A;  2HWA A;  4I0Y A;  1I1B A;  4GAF A;  4LO0 C;  2QN4 A;  4X37 A;  2DS0 A;  4D0Z A;  4I96 A;  4I37 A;  1AVU A;  4LO8 B;  3O49 A;  1EYL A;  1G9C A;  3FFZ A;  2D22 A;  1IT0 A;  2Q9X A;  5EHA A;  2WBC A;  3CRI A;  2FDB M;  1W3F A;  3D7W B;  2NVH A;  4OEF A;  1CE7 B;  4X39 A;  1V6W A;  3AZV A;  3OGF A;  5F8Y A;  3OGG A;  1FMM S;  1PUU B;  1TFM B;  1F31 A;  3E8L C;  3N0K A;  1ISZ A;  3VT2 A;  3FJD A;  3NBC A;  4IQP A;  2Y9F A;  4DEP A;  3H6Q A;  4EFQ A;  2KLL A;  3ZX7 A;  2IHO A;  4USO A;  1UPS A;  2KH2 A;  5DVH A;  1SR4 A;  4H9W A;  5EG6 C;  5BXS A;  3EF2 A;  5BQU C;  1IIL A;  3BB2 A;  1N4K A;  4KEI A;  3IIR A;  4ZLB B;  1P63 A;  1ILR 1;  2WRY A;  3ILA A;  31BI A;  2XOA A;  4D8H A;  3FGM A;  4LO0 A;  1T4Q A;  3WO3 A;  1V6V A;  3T8S A;  1JT7 A;  4I7I A;  1TWM A;  2ET2 A;  1M2T B;  3V0B B;  4I4O A;  1AVA C;  1XZZ A;  3PHZ A;  1HWM B;  4USP A;  2Y9W C;  3P6J A;  1QQK A;  4OEG A;  4CJM A;  1FQ9 A;  2D23 A;  4GAI A;  4HA2 A;  4I4S A;  4JRA A;  4KEK A;  3FUQ A;  1BAS A;  4P0J A;  4P0K A;  2GZB A;  1YBI A;  3PG0 A;  2FGF A;  3FJC A;  1W3G A;  4JQ0 A;  1TTU A;  2D24 A;  4I4V A;  3A22 A;  1ONK B;  2FO1 A;  2NZ9 A;  3CA3 A;  4I4Q A;  4Q9P A;  5BQU A;  2Y9G A;  1BFC A;  3WO4 A;  3WIN C;  1HWP B;  1D0H A;  4R6U B;  5D61 A;  1QXM A;  1S0F A;  3WMV A;  4Q9G A;  4ZBV B;  1Q1U A;  2VUA A;  1NZK A;  4IZX A;  1IRA X; 
#chains in the Genus database with same CATH topology
 1ISX A;  1IOB A;  1FMZ A;  7I1B A;  2AXM A;  9ILB A;  2I1B A;  5EC5 A;  1JLX A;  4QO3 A;  2ZR1 B;  3BTA A;  2ERM A;  4ION A;  1SZ6 B;  1R8O A;  1YF8 B;  3AKI A;  3BRD A;  3O5W B;  3RTJ B;  3N7J A;  4H75 A;  3VT1 A;  4G6J A;  3NJ5 A;  1DIW A;  3B9U A;  4JAW A;  41BI A;  2LIQ A;  4L4H A;  2P39 A;  4L4I A;  5JLV A;  3POK A;  3CQA A;  1PC8 B;  3VSZ A;  4AN7 B;  3BAD A;  1G82 A;  5DUY A;  3KMV A;  1S0G A;  2KI6 B;  4DCK C;  1A8D A;  1DFQ A;  3I2A A;  5BXP A;  1S0L A;  2VLC A;  4OUJ A;  4QAL A;  3AH4 A;  2QYI B;  3FJI A;  4OW4 A;  4KEJ A;  3AH1 A;  1MD6 A;  3A07 A;  4ZFU B;  2ZQO A;  3OJV A;  4I4R A;  4F34 A;  3WIN A;  2MLL B;  3N7L A;  5DZU A;  4I4P A;  3WMU A;  5I1B A;  4GOV A;  1FWV A;  2DRY A;  3FJ9 A;  4EFP A;  4G9M A;  5F8S A;  3AZW A;  4ZA3 B;  1EV2 A;  2KI4 A;  2X2T A;  4I3N A;  4ISQ A;  3FJH A;  2NTD A;  4XKI A;  3FJJ A;  4I4Y A;  4P0L A;  3IM5 A;  4ZOT A;  3JRR A;  2Q3N B;  4G6M A;  4J23 B;  3WA1 A;  2F2F C;  4AN6 A;  1TP0 A;  2AFG A;  1JT3 A;  1AFC A;  1Z0H A;  21BI A;  2VSE A;  5GAQ A;  3CA1 A;  3HOM A;  4QC4 A;  1WD3 A;  1ISW A;  4HR6 C;  3TC2 A;  3OBT A;  1JLY A;  3VSF A;  5BXT A;  1G9D A;  4J2S A;  3CRH A;  3BAO A;  1WD4 A;  4J2K A;  1CVS A;  4IZE A;  3I29 B;  1IRP A;  2NYY A;  5D63 A;  2L5X A;  3ZC9 A;  1Q03 A;  2Y9X E;  1DQG A;  4LO3 C;  3O3Q A;  3W9T A;  3VUO A;  5F90 A;  3FJ8 A;  1FWU A;  3BA5 A;  4I1B A;  2KKI A;  5BP5 C;  3AJ5 A;  3VWC A;  1HCE A;  4JP0 A;  3BRF A;  3C9Z A;  3OJM A;  1TWE A;  3I2X A;  4IY9 A;  3VEQ A;  3CA6 A;  4A7Y A;  3QR5 A;  4I4U A;  3CAH A;  1PZZ A;  2NS2 A;  3UD7 A;  5BVP I;  2M49 A;  5E24 E;  3AH2 A;  2GO2 A;  3O4D A;  3AKH A;  3CA4 A;  4ZKT B;  1ITB A;  1DZD A;  1WBA A;  2E4M C;  4JKQ A;  8I1B A;  1VCL A;  1BFB A;  4LO2 C;  4P6A A;  2HWM A;  1HIB A;  2F2F A;  3PME A;  1RZO B;  3HMY A;  4QD2 C;  1FV2 A;  1Z2V A;  4X3A A;  1QQL A;  2RG9 B;  3O4A A;  3A23 A;  4FVV A;  4EFR A;  3FJK A;  3RSJ A;  3Q7X A;  4J2X A;  2DRE A;  3WO2 A;  1IHK A;  3NBD A;  1HWN B;  4XFS A;  1YTO A;  1JT5 A;  1XYF A;  4XFT A;  5BOW A;  4QKS A;  1RML A;  2MIB A;  1TOO A;  3MPP G;  3HBW A;  3BRG C;  4Z8S B;  3CRG A;  4Q91 A;  3V0A B;  1AF9 A;  3H6R A;  4LO3 A;  3FJB A;  2D20 A;  1M16 A;  4QBC A;  3AKF A;  2NM1 A;  5BP5 A;  2DRZ A;  3NBN A;  1G9B A;  1HKN A;  2RQ9 A;  4OWL A;  1JTC A;  4KC3 A;  3SNV A;  3FJE A;  5JMC A;  3HAL A;  4DEN A;  2BEA A;  3UD9 A;  4ISR A;  1XG6 A;  3F62 B;  4II0 A;  1G9A A;  3NBE A;  3UJ4 A;  4LO1 C;  3RMY A;  1S0D A;  4IHZ A;  3CA5 A;  2E4M A;  4LO2 A;  2D7I A;  1HCD A;  1Z4S A;  1T9F A;  2LIE A;  4TLP A;  1JT4 A;  1OQL B;  4I2S A;  1ABR B;  1EVT A;  4JPZ A;  1DFC A;  1K5U A;  3V0A A;  4ZFY B;  3BX1 C;  1PUM B;  1ISY A;  3O4B A;  3PUB A;  2MC2 A;  4G1R A;  3RTI B;  1V6X A;  1DLL A;  4X38 A;  4I4X A;  4I6I A;  3VT0 A;  3UD8 A;  3S8J A;  1II4 A;  3BAQ A;  2X2S A;  2F8X C;  3Q7W A;  5HPZ A;  5FZU A;  2HW9 A;  3MAL A;  1BLA A;  2Z49 A;  3A21 A;  4WBC A;  3O4C A;  1W3A A;  2AQZ A;  2VXR A;  1ISV A;  1RG8 A;  4OWJ A;  5FZZ A;  4IY8 A;  1HWO B;  4MZH A;  1XHB A;  1BLD A;  3UDA A;  4LO7 C;  2ZQN A;  2UUS A;  3OJ2 A;  1AVW B;  3FUO A;  2R9K B;  4A7K A;  2FFV A;  2NP0 A;  1PWA A;  2D7R A;  3HSM A;  3K1X A;  1I1E A;  4LO1 A;  4EB2 B;  3P53 A;  2D44 A;  5D62 A;  4ZGR B;  5G00 A;  4JKX B;  5FZY A;  3BA7 A;  4LO7 B;  3R4U A;  2YUG A;  3RMX A;  4EEE B;  1BA7 A;  4XFU A;  3AKG A;  3AJ6 A;  1K5V A;  4G9N A;  3BAH A;  4KBB A;  3V79 C;  1AXM A;  5FNW A;  4YOL A;  2IWT B;  4FGF A;  1S0B A;  3BAG A;  2J3P A;  3BAV A;  3O44 A;  3S8K A;  1V6U A;  3H6R B;  3P6I A;  1BAR A;  4PC4 A;  1FGA A;  3R4S A;  1Q04 A;  5DSS B;  2D43 A;  3OBR A;  1AVX B;  4OEE A;  1J0S A;  4UY4 A;  3Q7Y A;  2BEB A;  2RST A;  1EPW A;  4END A;  1WBC A;  2HZ9 A;  3JUT A;  1JQZ A;  4ZFW B;  4GOY A;  1YXW A;  1JY0 A;  3FJF A;  2VXT I;  3FJA A;  4QKR A;  1NUN A;  3H6S E;  2D1Z A;  3CA0 A;  3F1R A;  3LTQ A;  3BAU A;  4A7Z A;  4D0T A;  3QYD A;  4QD2 B;  1FV3 A;  3IM6 A;  2FFU A;  4I1E A;  4H04 A;  3HN1 A;  1BFG A;  5FNX A;  4I8M A;  2VU9 A;  3UJ0 A;  3CU1 B;  4J2Y A;  1RY7 A;  1DZC A;  1E0O A;  4Z9W B;  3V0B A;  2Z48 A;  4GP3 A;  4GP0 A;  1S0C A;  3ZC8 A;  2AAI B;  2VSA A;  1KNM A;  4IYB A;  3IM7 A;  4QBV A;  5F8W A;  2P23 A;  6I1B A;  3N7M A;  1FN0 A;  1R8N A;  4F83 A;  1TIE A;  1MC9 A;  5BXR A;  4HJJ A;  3ZXG A;  5B2H A;  1IJT A;  1GGP B;  3N7K A;  1SR4 C;  1L2H A;  1DQO A;  1YYN A;  1S0E A;  3ZXD A;  3LLP A;  2K43 A;  4EKX B;  2BFH A;  1BFF A;  3O4O A;  2K8R A;  2ESU A;  2K4A B;  3IAG C;  1DJS B;  3BA4 A;  4OWK A;  2HWA A;  4I0Y A;  1I1B A;  4GAF A;  4LO0 C;  2QN4 A;  4X37 A;  2DS0 A;  4D0Z A;  4I96 A;  4I37 A;  1AVU A;  4LO8 B;  3O49 A;  1EYL A;  1G9C A;  3FFZ A;  2D22 A;  1IT0 A;  2Q9X A;  5EHA A;  2WBC A;  3CRI A;  2FDB M;  1W3F A;  3D7W B;  2NVH A;  4OEF A;  1CE7 B;  4X39 A;  1V6W A;  3AZV A;  3OGF A;  5F8Y A;  3OGG A;  4MZF B;  1FMM S;  1PUU B;  1TFM B;  1F31 A;  3E8L C;  3N0K A;  1ISZ A;  3VT2 A;  3FJD A;  3NBC A;  4IQP A;  2Y9F A;  4DEP A;  3H6Q A;  4EFQ A;  2KLL A;  3ZX7 A;  2IHO A;  4USO A;  1UPS A;  2KH2 A;  5DVH A;  1SR4 A;  4H9W A;  5EG6 C;  5BXS A;  3EF2 A;  5BQU C;  1IIL A;  3BB2 A;  1N4K A;  4KEI A;  3IIR A;  4ZLB B;  1P63 A;  1ILR 1;  2WRY A;  3ILA A;  31BI A;  2XOA A;  4D8H A;  3FGM A;  4LO0 A;  1T4Q A;  3WO3 A;  1V6V A;  3T8S A;  1JT7 A;  4I7I A;  1TWM A;  2ET2 A;  1M2T B;  4MZG B;  3V0B B;  4I4O A;  1AVA C;  1XZZ A;  3PHZ A;  1HWM B;  4USP A;  2Y9W C;  3P6J A;  1QQK A;  4OEG A;  4CJM A;  1FQ9 A;  2D23 A;  4GAI A;  4HA2 A;  4I4S A;  4JRA A;  4KEK A;  3FUQ A;  1BAS A;  4P0J A;  4P0K A;  2GZB A;  1YBI A;  3PG0 A;  2FGF A;  3FJC A;  1W3G A;  4JQ0 A;  1TTU A;  2D24 A;  4I4V A;  3A22 A;  1ONK B;  2FO1 A;  2NZ9 A;  3CA3 A;  4I4Q A;  4Q9P A;  5BQU A;  2Y9G A;  1BFC A;  3WO4 A;  3WIN C;  1HWP B;  1D0H A;  4R6U B;  5D61 A;  1QXM A;  1S0F A;  3WMV A;  4Q9G A;  4ZBV B;  1Q1U A;  2VUA A;  1NZK A;  4IZX A;  1IRA X; 
#chains in the Genus database with same CATH homology
 1ISX A;  1IOB A;  1FMZ A;  7I1B A;  2AXM A;  9ILB A;  2I1B A;  5EC5 A;  1JLX A;  4QO3 A;  2ZR1 B;  3BTA A;  2ERM A;  4ION A;  1SZ6 B;  1R8O A;  1YF8 B;  3AKI A;  3BRD A;  3O5W B;  3RTJ B;  3N7J A;  4H75 A;  3VT1 A;  4G6J A;  3NJ5 A;  1DIW A;  3B9U A;  4JAW A;  41BI A;  2LIQ A;  4L4H A;  2P39 A;  4L4I A;  5JLV A;  3POK A;  3CQA A;  1PC8 B;  3VSZ A;  4AN7 B;  3BAD A;  1G82 A;  5DUY A;  3KMV A;  1S0G A;  2KI6 B;  4DCK C;  1A8D A;  1DFQ A;  3I2A A;  5BXP A;  1S0L A;  2VLC A;  4OUJ A;  4QAL A;  3AH4 A;  2QYI B;  3FJI A;  4OW4 A;  4KEJ A;  3AH1 A;  1MD6 A;  3A07 A;  4ZFU B;  2ZQO A;  3OJV A;  4I4R A;  4F34 A;  3WIN A;  2MLL B;  3N7L A;  5DZU A;  4I4P A;  3WMU A;  5I1B A;  4GOV A;  1FWV A;  2DRY A;  3FJ9 A;  4EFP A;  4G9M A;  5F8S A;  3AZW A;  4ZA3 B;  1EV2 A;  2KI4 A;  2X2T A;  4I3N A;  4ISQ A;  3FJH A;  2NTD A;  4XKI A;  3FJJ A;  4I4Y A;  4P0L A;  3IM5 A;  4ZOT A;  3JRR A;  2Q3N B;  4G6M A;  4J23 B;  3WA1 A;  2F2F C;  4AN6 A;  1TP0 A;  2AFG A;  1JT3 A;  1AFC A;  1Z0H A;  21BI A;  2VSE A;  5GAQ A;  3CA1 A;  3HOM A;  4QC4 A;  1WD3 A;  1ISW A;  4HR6 C;  3TC2 A;  3OBT A;  1JLY A;  3VSF A;  5BXT A;  1G9D A;  4J2S A;  3CRH A;  3BAO A;  1WD4 A;  4J2K A;  1CVS A;  4IZE A;  3I29 B;  1IRP A;  2NYY A;  5D63 A;  2L5X A;  3ZC9 A;  1Q03 A;  2Y9X E;  1DQG A;  4LO3 C;  3O3Q A;  3W9T A;  3VUO A;  5F90 A;  3FJ8 A;  1FWU A;  3BA5 A;  4I1B A;  2KKI A;  5BP5 C;  3AJ5 A;  3VWC A;  1HCE A;  4JP0 A;  3BRF A;  3C9Z A;  3OJM A;  1TWE A;  3I2X A;  4IY9 A;  3VEQ A;  3CA6 A;  4A7Y A;  3QR5 A;  4I4U A;  3CAH A;  1PZZ A;  2NS2 A;  3UD7 A;  5BVP I;  2M49 A;  5E24 E;  3AH2 A;  2GO2 A;  3O4D A;  3AKH A;  3CA4 A;  4ZKT B;  1ITB A;  1DZD A;  1WBA A;  2E4M C;  4JKQ A;  8I1B A;  1VCL A;  1BFB A;  4LO2 C;  4P6A A;  2HWM A;  1HIB A;  2F2F A;  3PME A;  1RZO B;  3HMY A;  4QD2 C;  1FV2 A;  1Z2V A;  4X3A A;  1QQL A;  2RG9 B;  3O4A A;  3A23 A;  4FVV A;  4EFR A;  3FJK A;  3RSJ A;  3Q7X A;  4J2X A;  2DRE A;  3WO2 A;  1IHK A;  3NBD A;  1HWN B;  4XFS A;  1YTO A;  1JT5 A;  1XYF A;  4XFT A;  5BOW A;  4QKS A;  1RML A;  2MIB A;  1TOO A;  3MPP G;  3HBW A;  3BRG C;  4Z8S B;  3CRG A;  4Q91 A;  3V0A B;  1AF9 A;  3H6R A;  4LO3 A;  3FJB A;  2D20 A;  1M16 A;  4QBC A;  3AKF A;  2NM1 A;  5BP5 A;  2DRZ A;  3NBN A;  1G9B A;  1HKN A;  2RQ9 A;  4OWL A;  1JTC A;  4KC3 A;  3SNV A;  3FJE A;  5JMC A;  3HAL A;  4DEN A;  2BEA A;  3UD9 A;  4ISR A;  1XG6 A;  3F62 B;  4II0 A;  1G9A A;  3NBE A;  3UJ4 A;  4LO1 C;  3RMY A;  1S0D A;  4IHZ A;  3CA5 A;  2E4M A;  4LO2 A;  2D7I A;  1HCD A;  1Z4S A;  1T9F A;  2LIE A;  4TLP A;  1JT4 A;  1OQL B;  4I2S A;  1ABR B;  1EVT A;  4JPZ A;  1DFC A;  1K5U A;  3V0A A;  4ZFY B;  3BX1 C;  1PUM B;  1ISY A;  3O4B A;  3PUB A;  2MC2 A;  4G1R A;  3RTI B;  1V6X A;  1DLL A;  4X38 A;  4I4X A;  4I6I A;  3VT0 A;  3UD8 A;  3S8J A;  1II4 A;  3BAQ A;  2X2S A;  2F8X C;  3Q7W A;  5HPZ A;  5FZU A;  2HW9 A;  3MAL A;  1BLA A;  2Z49 A;  3A21 A;  4WBC A;  3O4C A;  1W3A A;  2AQZ A;  2VXR A;  1ISV A;  1RG8 A;  4OWJ A;  5FZZ A;  4IY8 A;  1HWO B;  4MZH A;  1XHB A;  1BLD A;  3UDA A;  4LO7 C;  2ZQN A;  2UUS A;  3OJ2 A;  1AVW B;  3FUO A;  2R9K B;  4A7K A;  2FFV A;  2NP0 A;  1PWA A;  2D7R A;  3HSM A;  3K1X A;  1I1E A;  4LO1 A;  4EB2 B;  3P53 A;  2D44 A;  5D62 A;  4ZGR B;  5G00 A;  4JKX B;  5FZY A;  3BA7 A;  4LO7 B;  3R4U A;  2YUG A;  3RMX A;  4EEE B;  1BA7 A;  4XFU A;  3AKG A;  3AJ6 A;  1K5V A;  4G9N A;  3BAH A;  4KBB A;  3V79 C;  1AXM A;  5FNW A;  4YOL A;  2IWT B;  4FGF A;  1S0B A;  3BAG A;  2J3P A;  3BAV A;  3O44 A;  3S8K A;  1V6U A;  3H6R B;  3P6I A;  1BAR A;  4PC4 A;  1FGA A;  3R4S A;  1Q04 A;  5DSS B;  2D43 A;  3OBR A;  1AVX B;  4OEE A;  1J0S A;  4UY4 A;  3Q7Y A;  2BEB A;  2RST A;  1EPW A;  4END A;  1WBC A;  2HZ9 A;  3JUT A;  1JQZ A;  4ZFW B;  4GOY A;  1YXW A;  1JY0 A;  3FJF A;  2VXT I;  3FJA A;  4QKR A;  1NUN A;  3H6S E;  2D1Z A;  3CA0 A;  3F1R A;  3LTQ A;  3BAU A;  4A7Z A;  4D0T A;  3QYD A;  4QD2 B;  1FV3 A;  3IM6 A;  2FFU A;  4I1E A;  4H04 A;  3HN1 A;  1BFG A;  5FNX A;  4I8M A;  2VU9 A;  3UJ0 A;  3CU1 B;  4J2Y A;  1RY7 A;  1DZC A;  1E0O A;  4Z9W B;  3V0B A;  2Z48 A;  4GP3 A;  4GP0 A;  1S0C A;  3ZC8 A;  2AAI B;  2VSA A;  1KNM A;  4IYB A;  3IM7 A;  4QBV A;  5F8W A;  2P23 A;  6I1B A;  3N7M A;  1FN0 A;  1R8N A;  4F83 A;  1TIE A;  1MC9 A;  5BXR A;  4HJJ A;  3ZXG A;  5B2H A;  1IJT A;  1GGP B;  3N7K A;  1SR4 C;  1L2H A;  1DQO A;  1YYN A;  1S0E A;  3ZXD A;  3LLP A;  2K43 A;  4EKX B;  2BFH A;  1BFF A;  3O4O A;  2K8R A;  2ESU A;  2K4A B;  3IAG C;  1DJS B;  3BA4 A;  4OWK A;  2HWA A;  4I0Y A;  1I1B A;  4GAF A;  4LO0 C;  2QN4 A;  4X37 A;  2DS0 A;  4D0Z A;  4I96 A;  4I37 A;  1AVU A;  4LO8 B;  3O49 A;  1EYL A;  1G9C A;  3FFZ A;  2D22 A;  1IT0 A;  2Q9X A;  5EHA A;  2WBC A;  3CRI A;  2FDB M;  1W3F A;  3D7W B;  2NVH A;  4OEF A;  1CE7 B;  4X39 A;  1V6W A;  3AZV A;  3OGF A;  5F8Y A;  3OGG A;  4MZF B;  1FMM S;  1PUU B;  1TFM B;  1F31 A;  3E8L C;  3N0K A;  1ISZ A;  3VT2 A;  3FJD A;  3NBC A;  4IQP A;  2Y9F A;  4DEP A;  3H6Q A;  4EFQ A;  2KLL A;  3ZX7 A;  2IHO A;  4USO A;  1UPS A;  2KH2 A;  5DVH A;  1SR4 A;  4H9W A;  5EG6 C;  5BXS A;  3EF2 A;  5BQU C;  1IIL A;  3BB2 A;  1N4K A;  4KEI A;  3IIR A;  4ZLB B;  1P63 A;  1ILR 1;  2WRY A;  3ILA A;  31BI A;  2XOA A;  4D8H A;  3FGM A;  4LO0 A;  1T4Q A;  3WO3 A;  1V6V A;  3T8S A;  1JT7 A;  4I7I A;  1TWM A;  2ET2 A;  1M2T B;  4MZG B;  3V0B B;  4I4O A;  1AVA C;  1XZZ A;  3PHZ A;  1HWM B;  4USP A;  2Y9W C;  3P6J A;  1QQK A;  4OEG A;  4CJM A;  1FQ9 A;  2D23 A;  4GAI A;  4HA2 A;  4I4S A;  4JRA A;  4KEK A;  3FUQ A;  1BAS A;  4P0J A;  4P0K A;  2GZB A;  1YBI A;  3PG0 A;  2FGF A;  3FJC A;  1W3G A;  4JQ0 A;  1TTU A;  2D24 A;  4I4V A;  3A22 A;  1ONK B;  2FO1 A;  2NZ9 A;  3CA3 A;  4I4Q A;  4Q9P A;  5BQU A;  2Y9G A;  1BFC A;  3WO4 A;  3WIN C;  1HWP B;  1D0H A;  4R6U B;  5D61 A;  1QXM A;  1S0F A;  3WMV A;  4Q9G A;  4ZBV B;  1Q1U A;  2VUA A;  1NZK A;  4IZX A;  1IRA X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...