3A0BE

Crystal structure of br-substituted photosystem ii complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 16
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3a0bE00
3KZIE 5GTIE 5GTHE 3JCUE 5KAFE 2AXTE 3A0BE 4UB6E 5KAIE 4PJ0E 3A0HE 5B66E 5E79E 5TISE 1W5CE 4IL6E 4UB8E 3WU2E 1S5LE 5B5EE 5H2FE
chains in the Genus database with same CATH superfamily
3RK2B 2OARA 2RKLA 2P67A 2HG5D 3G9RA 1VL2A 1D7MA 3V2PA 2OYIC 1KB9H 4IOIH 3Q3DA 3BRTB 1NHLA 1OVUA 2FFDA 2E74B 3CPWO 1ZXGA 3T97A 2M8RA 3VMZA 4KJMA 2ZFCA 4IFMA 5APXA 1YITP 3EWKA 2Q5UA 2K88A 1VQ7P 1HGZA 2YIUC 5DJUB 4UB6H 1HH0A 5APQA 2PP6A 3RL0C 3L72J 3W68A 2XKMA 2QIWA 2W6BA 2IPPA 2FY8A 1SQVG 5KLIC 2KS1A 1KQLA 2QM7A 1NGMB 3SSUA 2E76C 1RQVA 1XTCC 4PD4E 3O6QB 5CCHA 2R32A 5EFWB 1DX7A 4WB4A 1W5CE 1KZUB 4MN4C 1H0TA 3FXEA 1OIPA 1Q82Q 2YO2A 5M1BA 3EQ2A 1FZEA 2H88C 1VPCA 4PJ0E 1FJKA 4PD4I 3PRJA 3H25A 1L4AB 1NOHA 1SQVD 4EDFA 2KUBA 3M06A 1L0LG 1LTJC 2E43A 1S9KD 1NVOA 1RE3A 2R3SA 3HE5A 1OW6A 2WSSH 3USSA 3KHUA 3GLMA 4XFJA 2AXTE 1VQLP 3D71A 2NRGA 1JO5A 1QL1A 2XU6A 1ZRTD 2I1KA 1OW7A 3EFFK 2D2CB 3HD7D 2NZ2A 1P84D 1YJ9P 4TT3H 1RF1A 1URQC 3A7OA 5BU5A 3ITKA 2YKQA 2KSEA 1L0LD 2E5YA 1XTGB 3L70J 3GG2A 3L75J 3HUSA 3TGUG 1ZMEC 2KNCB 4WY4A 3GW6A 2KI7B 3MTUE 1NTKG 3WMM0 2H7HA 1LTTC 2NPSB 2KXPB 3CCJP 3L70E 1RH5B 3PLNA 4GIFA 3CD6P 3L75E 4DT0A 2ZYGA 1LT1A 1PGJA 3V6IA 1FZBA 2YNYA 4Y28J 2WT7B 2FYUK 5CMZA 3KXDA 3VMXA 1FS0E 2O1JA 3TGUD 2WPRA 3E1IA 1KV4A 1KFMA 1NTKD 1LWUC 1KN7A 4C7NA 2JR8A 2G3AA 5AW1B 1KORA 2YMKA 3LIEA 2E42A 3AE4C 3AE7C 1HF9A 3SFDC 1NKNA 3RK3C 1ZR2A 3TYYA 1BGYG 1SQQG 2IZ1A 2Q1KA 2POHA 3VOPA 4PJ0H 4ZKPA 1SFCC 3Q1MA 1S5LE 3GHGC 1FAVA 1Q2NA 1EQ7A 4H44C 4DZOA 3RBZA 2SPZA 3AEDC 2FXOA 2FYNC 1SQVJ 5TISE 3CCVP 1SQPJ 3M9BA 3CMAP 3Q5SA 2OQQA 1EZVI 1SQXK 3QWOC 3KZIE 1USDA 1NYHA 2L91A 1BGYD 1SQQD 2KYVA 1SQVE 4GKGA 1NU1K 1IFDA 1S9KE 1LTIC 1PPJG 4HH2A 1YTZI 1LP1B 1QX8A 4C7RA 2KLVA 3EFGA 3P8CD 1ZRTE 1M90Q 5CCGD 5KKZB 1KILA 1DD3A 1R5SA 1GTWA 1HUCA 2G8YA 3H6PA 3D6YA 3H1LG 5CBNA 3A0BE 1JCCA 1PPJD 4N78E 3D70A 1RHZB 3H1HG 3A5TA 1KMIZ 4LC1A 5L8RJ 2FFDC 2E75C 4JF7A 1ZW0A 1GD2E 5DJTB 3AE2C 3L72G 1KQGB 1H88A 3QH9A 5KAIE 3TGUJ 1E5WA 2ZYAA 2Q3EA 4EYYQ 2LR2A 1JNMA 3H1LD 2WSCJ 2I8DA 4B86A 2QEXP 1CI6A 3TGUE 5AW2B 2V7QH 1K9MQ 1L0NG 1WT6A 3H1HD 4L76A 3BRVB 5CCHC 4HYTB 4OWFA 3SWFA 1LGHB 5K5GB 3L74G 3L72D 4PD4D 1S5LH 2OYHB 1PGQA 1NTMK 4H0LC 2I1JA 1N7SC 1SP4A 2K37A 5KTBA 1NWQA 3CC2P 1MV8A 2IYOA 3S9OA 1K73Q 3ABVC 5TISH 1UIXA 1RE3C 1L0ND 1H0TB 2AEMA 1M1JB 1GL2C 2HODB 4GOFA 1G1IA 3L74D 1GMJA 1N73C 4BRYA 2WTYA 2ZXEB 1SFCA 2JO1A 3F5HA 3IFMA 3GHGA 1N8RQ 1BGYJ 2IFMA 3PTZA 5AVUB 3JCUE 1GK6A 3N7NA 2Q9IA 1L4AD 1RF1C 1LTAC 1DH3A 1FBMA 5KJ7D 4JYBA 3HRNA 3WUVA 1RQUA 5AW7B 2O01J 3E7KA 2M5AB 1BGYE 2QG4A 2JJLA 1PP9G 4WY4C 1P84H 5AVRB 3L73J 1NKZB 1J1DB 1FZCB 1LNQA 3HD7A 2WSFJ 4NPFX 3A0BH 2XV5A 2BEQD 4PV1B 3CCEP 3L73E 3PP5A 5AW4B 3P8CE 1VF5C 3K5BA 4RO0A 2LKMA 1FZFA 2H8PD 4EOTA 3FGAD 1PP9D 1YBKA 1LT9B 3RK2C 1AFOA 2FKWB 3L36A 1T2KD 2ITAA 1YIJP 1PPJE 1LJ2A 4W7ZA 1URQD 4YXDC 1KYOE 1GU5A 1EZVG 3M0DA 2MKVA 2CPBA 3Q5PA 2N1TB 3H1LJ 2WSCH 2ZXXA 5AW0B 4I7ZB 1HBWA 1YTZT 2YXRB 3TSIA 1L2PA 5AW6B 3U1AA 1Q7YQ 3H1HJ 3AE8C 3H1IG 1KYOI 3KPEA 1FOSE 1RE4C 1S1CX 3H1LE 3U1CA 5CJ0A 2OYIB 1LTBC 2Y9YA 4K35A 3H1HE 5TJHA 1BDDA 2AXCA 1SQPG 1EZVD 1GU4A 1PV3A 3MIWA 3G3ZA 5APYA 2GA1A 3CMEP 2Y0CA 3L72E 1NO4A 2WZ7A 2KSJA 2YIUB 4YTPC 1G2CB 4YXWH 1L0NJ 4IL6H 4A7PA 5GTIE 3H1ID 3AEAC 2Y9ZA 3D6ZA 4KT0J 2J5UA 3H1JG 1N7SA 3JCUH 1KFNA 3L74J 4JYCA 2E76B 3AE9C 3TNUA 2QJPB 3L35A 1L0NE 3AEFC 3CCLP 4R4LA 3PJSK 1TU3F 1JB0J 1SQPD 3RK3D 3FWLA 4U3FG 3AEGC 3HTKA 3L74E 4LGDE 1GL2A 2ZVNB 4I6MC 3V2NA 3B5NA 5KAFH 4CPGA 1KILC 2B88A 2O01H 3CCUP 1N73A 2D2CC 1X9VA 4RJTA 4GT1A 1YJWP 3R2PA 1LTJB 2B87A 2QVAA 3F89A 2WSFH 2FBWC 4TLFA 1MFZA 1PGOA 3TK1A 2ZAEB 1VQKP 4U3FD 5B5EE 2NPSC 4N78D 3HE4B 3NXSA 3H1KG 1DEBA 3NMDA 3GMAA 1VQNP 1PP9J 2IFNA 1URQB 4ZKUA 3M91A 3NFQA 4QMAA 4H13D 1OVVA 4EIJA 1ZN5A 1PP9E 2HPCA 5KLVG 2IZ0A 5E79E 2Z5HA 4I2LC 1QLED 2KK7A 1Y8AA 3H1KD 1IFIA 2W90A 1DIPA 3CX5D 4OVNF 1R5LA 4HJGH 4LLHA 3L71G 1IFJA 2ZJSE 4PD4H 4W7YA 1CZQA 3WUUA 2WQYC 4GDOA 4AQRD 1T3JA 1LTGC 4EI2A 2OGUA 3P32A 5KLVD 2R3CA 1LWUB 5GTIH 1EC5A 3O8ZA 1RE4A 1PZQA 1FC2C 1QEXA 3IAOA 2CPSA 2MJZA 1EZVE 3FXDA 1G1JA 3H1IJ 1OMIA 1VQ4P 3UIAA 4AUWA 1H8AA 1BCCG 3O6QA 3L71D 1T8ZA 3RK3B 1Q86Q 3L73G 2AXTH 1JTHB 1AQ5A 4WVZA 2KOGA 3H1IE 3W67A 5APWA 3TF5A 5H2FE 1JUNA 1JY2N 1VQ8P 3MD0A 2ZT9D 1NTZK 3HD7C 2ZVOB 3S4RA 4H44B 2OTJP 1SQVK 1UIIA 3V2QA 1SQPE 3RK3E 5KJ7A 2K3RA 3PH0A 4Z1MH 1FOSF 3H1JJ 2Z4EA 1EDIA 5B5EH 3L73D 2C0WA 4D6TG 1M1KQ 3CC4P 2K9JB 1WRGA 4GOEA 3H1JE 3CXHD 2Y0DA 4U3FJ 5AW5B 4W80A 4DOJA 1CSBA 2QJKB 1QVGO 4PV1D 4R4MA 1L0LK 5AVQB 3AECC 1EXIA 4H13B 3M0DC 4U3FE 4WY4D 1KYOD 1IFPA 2Q6QA 3OJAB 2KNCA 5APTA 5E79H 1PL5A 2R5DA 1A02J 1FDOA 4D6TD 1NAFA 2NPSA 1SQBK 2R44A 1KD1Q 2OTLP 1QL2A 1X0TA 1GK4A 2YKOA 3WUTA 3H1KJ 2FFDB 1QVFO 2WT7A 3T97B 4YPCA 1Y47A 3IF4A 2N1TD 1VQOP 1EDKA 1NTKK 3AE6C 5B66E 1OZHA 3H1KE 2OYHC 3OAKA 4K3AA 1VQ9P 4ZMDA 3CX5E 2J58A 2A45G 3AE5C 2W27A 3AEEC 5KLVJ 2R5BA 3TDKA 5AW9B 4NPEA 2KS1B 1RY3A 2BEZF 2RN0A 5BVZA 2JEEA 5KLVE 5APUA 3CX5I 3CWBG 5H2FH 1YHQP 3CC7P 1FDMA 3Q5RA 3KZIH 3L71J 4OGQC 1NH4A 3B5NC 1IJDB 2BCCG 1OX3A 1S3JA 1ZR4A 1KB9I 1N7SB 3RL0D 5APVA 1OFCX 2ZT9B 3V4WA 5BU8B 2M3EA 4O9BA 3VP9A 3CCQP 2ZYDA 3S1KA 3JC22 3L71E 2QJYC 3ZDMA 3V5BA 2PGDA 2E76D 1VQMP 1W2BO 1WMKA 1IO4A 3HE5B 2Q3IA 2C9LY 4Y99C 2LXCB 3MZWB 4IFDK 5CCGC 3CWBD 1SQQK 4KHXA 1N73B 1OVRA 1BCCJ 1FZCC 3A3YB 1K04A 2BCCD 1FDIA 3E1RA 1USEA 2C9NY 1IK9A 4L74A 2B87B 3VP8A 1RF1B 1BCCE 3G71P 3M9HA 2JDIH 5APSA 4UB8E 2KLUA 4BXLA 2FYUG 1LP1A 4I1LA 1KQSO 3AEBC 1JMMA 3HUSB 2VRSA 3BATA 1J1EC 4WY4B 4ZNCA 2WPVB 3CXHE 1LT9C 3VMYA 4RKUJ 5KAIH 4L73A 1JY3N 2FYZA 3B71A 2BASA 1HJBA 4D6TJ 1FE6A 2JWDA 2N9BA 1OW8A 3N4XA 3P8MC 3RBXA 3CXHI 4BWNA 2E74C 4NPDA 2FYUD 2M0BA 1HJ0A 4D6TE 1YQ3C 4I7ZC 1Z56A 5B66H 3JSVC 3CX5H 4C7NB 2JP3A 1T6AA 4HKZH 2H89C 1ZV8A 3I56P 2IDBA 2Q7CA 1FZGA 1BSHA 1GDTA 2RH0A 2YO3A 1U7MA 1SQXG 2JWAA 2IYPA 1NTZG 2OYHA 1JMBA 1YI2P 3RL0B 1CW5A 1KTMA 5GTHE 1HGVA 1NU1G 3G4SP 3RGUA 1NAYA 4M3LA 1K05A 2WSEJ 5CJ4A 1U7JA 1JY2O 2QJPC 5C39A 2KZJA 5KLIB 1YYCA 1L4AC 1VQ5P 5KJ7C 2WMMA 5AW8B 1L0NK 2JKVA 3OW2O 2PRRA 4IL6X 1M1JA 1MFTA 1H89A 3AE1C 4DJGA 1A02F 2N9YB 2HODA 1OWAA 1SS1A 1SQXD 1VDFA 1SFCD 1NTZD 4WBAA 4JBZA 3CWBJ 1MZ9A 2PAJA 2B9BA 1PIXA 2E5TA 1NU1D 4ASWA 4H44D 3BASA 4UB8H 2BCCJ 4DCKA 3H1JD 1AQTA 3KDPB 3CWBE 1M57D 3CXHH 2A45I 2M5AA 1RF0A 1BE3G 2KIKA 3U59A 2O3JA 4GODA 5CCGA 2BCCE 1SQBG 1KILB 1FZCA 2QA4P 2QSIA 1YJNP 2IBZG 1T2KC 2WPSA 3AE3C 1PFIA 1FJPA 2M3BA 1YQ4C 1KYOH 2WITA 3PHLA 3SWYA 2W83C 3H32A 3CCMP 1KILE 1AA0A 4XA4A 1VQ6P 1S2EA 1HVVA 3VN0A 3MUDA 1VQPP 1BE3D 4L75A 1JY2P 1LT9A 2FYUJ 3C9IA 1GW4A 3A0HE 1SQBD 3Q2YA 3CLQA 2P10A 1NTMG 1ZOYC 2QRXA 2IBZD 2W8ZA 2QM8A 3OA7A 3M9QA 1KQFB 2FYUE 1JOCA 2YKPA 1CI6B 4C46A 1IFMA 3IR9A 1Q90D 2N1TA 2E75D 2H43A 1KB9D 1MUUA 1BSNA 1M7LA 1E79H 2B89A 5GTHH 2V7QJ 1NTMD 2OYIA 3G6EP 2QE7H 2UWJE 2V4HA 1EDJA 3I55P 3MP7B 3L4FA 1HTLC 2P58A 2WSEH 5CCHD 3GF3A 1M56D 2A45H 3CI9A 1G2CA 4ASVA 2DW3A 1JCDA 4BRYB 3B8EB 2OYOA 1SFCB 4H0LD 1LTSC 1N7SD 3BVHA 3GHGB 1X8YA 1SQXJ 3V2RA 3BCCG 1AJYA 1W2EA 3VMAA 1NTZJ 3M0AA 2GUSA 1KC8Q 1SQPK 2FXPA 2WPQA 2CK3H 2P2UA 1L4AA 3KYQA 2J59M 1NU1J 2PFXA 2WWWA 2FYNB 1SQXE 2FXMA 1GL2D 4OGQD 1BCCD 3B5ND 3C1LA 1NTZE 5AVWB 5KKZC 3LW5J 2A06G 2YXQB 3HD7B 3VTPC 1NU1E 2Z5IA 1IK7A 2QJKC 3A2AA 1DD4A 1HWTC 1LTJA 3BCCD 3MGNA 4H13C 4N3YB 3CCRP 1JY3O 1X22A 1SVFA 3LIDA 1L0LJ 1AVYA 4AYCA 2W6AA 1JM0A 2IX7C 3A0HH 1P84E 3WU2E 2KP8A 3HE4A 1IFNA 2C0XA 4JPZB 1AVOA 1N7LA 2HYNA 2GM4A 2A06D 2KB7P 1L0LE 2P1JA 1BE3J 1SQBJ 1URQA 2XZRA 1DEEG 4N6JA 2XNXA 1EDLA 3V4QA 3GF7A 1K8AQ 1P84I 1QGKB 1VF5D 2OTKE 1BE3E 1AV1A 2E75B 1SQBE 2XDJA 2IBZE 3RK2D 4U7JA 1N86A 5AVYB 1NTKJ 2L5GB 1Y9BA 3CL3D 3CCSP 2E74D 1NTMJ 1EXJA 1NTKE 2O01N 1KB9E 2KZIA 2IBZI 3NTNA 5AVSB 4RESB 2P7JA 1M8OB 2WVRA 3R4YA 4WWIA 5KLVK 1M1JC 1S5LX 3IN6A 3L37A 2YMYA 1LWUA 1NTME 1JY3P 1ZLLA 2ZT9C 1X79B 4UB6E 4H0LB 5AVTB 1BDCA 3FWNA 3TNUB 2Y0EA 3HTKB 1JTHA 1GL2B 3FX0A 4OGQB 3B5NB 1MKMA 1RF0C 5AVXB 2AEJA 5AW3B 1FZAA 4IL6E 1SLQA 3VYIA 1J1DC 3C8VA 1SQQJ 2XNDH 1NJIQ 3L70G 1FU1A 3L75G 1PGPA 3LW5H 2QJYB 3II6A 1R8EA 1JEKA 4PV1C 2HFED 1U57A 3I5CA 1T3UA 3SFEC 3B4SA 2RMZA 1SQQE 1GZLA 3HUSC 4Y99B 4HB1A 5CHXA 3BCCJ 3WU2H 3SWKA 2W6JH 1OXZA 3RL0g 1N2DC 2HLOA 2K9JA 5KAFE 5CBOA 3MUDC 2AEFA 1KILD 1IZNB 2K9YA 2D2CD 2GUVA 3MHVA 3BCCE 3L70D 2HR3A 4IFFA 1GW3A 3L75D 1Q81Q 3H32B 1ZP0C 2LXBA 1IC2A 1S4XA 2O1KA 1J2JB 1VF5B 1J1EB 5AVZB 2N1TC 2HPCB 1S72P 5AVVB 3KQGA 4XE5B 4JQ0D 2K1AA 3P7KA 2A06E 2NPSD 4OH8B
chains in the Genus database with same CATH topology
3KZIE 5GTIE 5GTHE 3JCUE 5KAFE 2AXTE 3A0BE 4UB6E 5KAIE 4PJ0E 3A0HE 5B66E 5E79E 5TISE 1W5CE 4IL6E 4UB8E 3WU2E 1S5LE 5B5EE 5H2FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  5GTI E;  5GTH E;  3JCU E;  5KAF E;  2AXT E;  3A0B E;  4UB6 E;  5KAI E;  4PJ0 E;  3A0H E;  5B66 E;  5E79 E;  5TIS E;  1W5C E;  4IL6 E;  4UB8 E;  3WU2 E;  1S5L E;  5B5E E;  5H2F E; 
#chains in the Genus database with same CATH topology
 3RK2 B;  2OAR A;  2RKL A;  2P67 A;  2HG5 D;  3G9R A;  1VL2 A;  1D7M A;  3V2P A;  2OYI C;  1KB9 H;  4IOI H;  3Q3D A;  3BRT B;  1NHL A;  1OVU A;  2FFD A;  2E74 B;  3CPW O;  1ZXG A;  3T97 A;  2M8R A;  3VMZ A;  4KJM A;  2ZFC A;  4IFM A;  5APX A;  1YIT P;  3EWK A;  2Q5U A;  2K88 A;  1VQ7 P;  1HGZ A;  2YIU C;  5DJU B;  4UB6 H;  1HH0 A;  5APQ A;  2PP6 A;  3RL0 C;  3L72 J;  3W68 A;  2XKM A;  2QIW A;  2W6B A;  2IPP A;  2FY8 A;  1SQV G;  5KLI C;  2KS1 A;  1KQL A;  2QM7 A;  1NGM B;  3SSU A;  2E76 C;  1RQV A;  1XTC C;  4PD4 E;  3O6Q B;  5CCH A;  2R32 A;  5EFW B;  1DX7 A;  4WB4 A;  1W5C E;  1KZU B;  4MN4 C;  1H0T A;  3FXE A;  1OIP A;  1Q82 Q;  2YO2 A;  5M1B A;  3EQ2 A;  1FZE A;  2H88 C;  1VPC A;  4PJ0 E;  1FJK A;  4PD4 I;  3PRJ A;  3H25 A;  1L4A B;  1NOH A;  1SQV D;  4EDF A;  2KUB A;  3M06 A;  1L0L G;  1LTJ C;  2E43 A;  1S9K D;  1NVO A;  1RE3 A;  2R3S A;  3HE5 A;  1OW6 A;  2WSS H;  3USS A;  3KHU A;  3GLM A;  4XFJ A;  2AXT E;  1VQL P;  3D71 A;  2NRG A;  1JO5 A;  1QL1 A;  2XU6 A;  1ZRT D;  2I1K A;  1OW7 A;  3EFF K;  2D2C B;  3HD7 D;  2NZ2 A;  1P84 D;  1YJ9 P;  4TT3 H;  1RF1 A;  1URQ C;  3A7O A;  5BU5 A;  3ITK A;  2YKQ A;  2KSE A;  1L0L D;  2E5Y A;  1XTG B;  3L70 J;  3GG2 A;  3L75 J;  3HUS A;  3TGU G;  1ZME C;  2KNC B;  4WY4 A;  3GW6 A;  2KI7 B;  3MTU E;  1NTK G;  3WMM 0;  2H7H A;  1LTT C;  2NPS B;  2KXP B;  3CCJ P;  3L70 E;  1RH5 B;  3PLN A;  4GIF A;  3CD6 P;  3L75 E;  4DT0 A;  2ZYG A;  1LT1 A;  1PGJ A;  3V6I A;  1FZB A;  2YNY A;  4Y28 J;  2WT7 B;  2FYU K;  5CMZ A;  3KXD A;  3VMX A;  1FS0 E;  2O1J A;  3TGU D;  2WPR A;  3E1I A;  1KV4 A;  1KFM A;  1NTK D;  1LWU C;  1KN7 A;  4C7N A;  2JR8 A;  2G3A A;  5AW1 B;  1KOR A;  2YMK A;  3LIE A;  2E42 A;  3AE4 C;  3AE7 C;  1HF9 A;  3SFD C;  1NKN A;  3RK3 C;  1ZR2 A;  3TYY A;  1BGY G;  1SQQ G;  2IZ1 A;  2Q1K A;  2POH A;  3VOP A;  4PJ0 H;  4ZKP A;  1SFC C;  3Q1M A;  1S5L E;  3GHG C;  1FAV A;  1Q2N A;  1EQ7 A;  4H44 C;  4DZO A;  3RBZ A;  2SPZ A;  3AED C;  2FXO A;  2FYN C;  1SQV J;  5TIS E;  3CCV P;  1SQP J;  3M9B A;  3CMA P;  3Q5S A;  2OQQ A;  1EZV I;  1SQX K;  3QWO C;  3KZI E;  1USD A;  1NYH A;  2L91 A;  1BGY D;  1SQQ D;  2KYV A;  1SQV E;  4GKG A;  1NU1 K;  1IFD A;  1S9K E;  1LTI C;  1PPJ G;  4HH2 A;  1YTZ I;  1LP1 B;  1QX8 A;  4C7R A;  2KLV A;  3EFG A;  3P8C D;  1ZRT E;  1M90 Q;  5CCG D;  5KKZ B;  1KIL A;  1DD3 A;  1R5S A;  1GTW A;  1HUC A;  2G8Y A;  3H6P A;  3D6Y A;  3H1L G;  5CBN A;  3A0B E;  1JCC A;  1PPJ D;  4N78 E;  3D70 A;  1RHZ B;  3H1H G;  3A5T A;  1KMI Z;  4LC1 A;  5L8R J;  2FFD C;  2E75 C;  4JF7 A;  1ZW0 A;  1GD2 E;  5DJT B;  3AE2 C;  3L72 G;  1KQG B;  1H88 A;  3QH9 A;  5KAI E;  3TGU J;  1E5W A;  2ZYA A;  2Q3E A;  4EYY Q;  2LR2 A;  1JNM A;  3H1L D;  2WSC J;  2I8D A;  4B86 A;  2QEX P;  1CI6 A;  3TGU E;  5AW2 B;  2V7Q H;  1K9M Q;  1L0N G;  1WT6 A;  3H1H D;  4L76 A;  3BRV B;  5CCH C;  4HYT B;  4OWF A;  3SWF A;  1LGH B;  5K5G B;  3L74 G;  3L72 D;  4PD4 D;  1S5L H;  2OYH B;  1PGQ A;  1NTM K;  4H0L C;  2I1J A;  1N7S C;  1SP4 A;  2K37 A;  5KTB A;  1NWQ A;  3CC2 P;  1MV8 A;  2IYO A;  3S9O A;  1K73 Q;  3ABV C;  5TIS H;  1UIX A;  1RE3 C;  1L0N D;  1H0T B;  2AEM A;  1M1J B;  1GL2 C;  2HOD B;  4GOF A;  1G1I A;  3L74 D;  1GMJ A;  1N73 C;  4BRY A;  2WTY A;  2ZXE B;  1SFC A;  2JO1 A;  3F5H A;  3IFM A;  3GHG A;  1N8R Q;  1BGY J;  2IFM A;  3PTZ A;  5AVU B;  3JCU E;  1GK6 A;  3N7N A;  2Q9I A;  1L4A D;  1RF1 C;  1LTA C;  1DH3 A;  1FBM A;  5KJ7 D;  4JYB A;  3HRN A;  3WUV A;  1RQU A;  5AW7 B;  2O01 J;  3E7K A;  2M5A B;  1BGY E;  2QG4 A;  2JJL A;  1PP9 G;  4WY4 C;  1P84 H;  5AVR B;  3L73 J;  1NKZ B;  1J1D B;  1FZC B;  1LNQ A;  3HD7 A;  2WSF J;  4NPF X;  3A0B H;  2XV5 A;  2BEQ D;  4PV1 B;  3CCE P;  3L73 E;  3PP5 A;  5AW4 B;  3P8C E;  1VF5 C;  3K5B A;  4RO0 A;  2LKM A;  1FZF A;  2H8P D;  4EOT A;  3FGA D;  1PP9 D;  1YBK A;  1LT9 B;  3RK2 C;  1AFO A;  2FKW B;  3L36 A;  1T2K D;  2ITA A;  1YIJ P;  1PPJ E;  1LJ2 A;  4W7Z A;  1URQ D;  4YXD C;  1KYO E;  1GU5 A;  1EZV G;  3M0D A;  2MKV A;  2CPB A;  3Q5P A;  2N1T B;  3H1L J;  2WSC H;  2ZXX A;  5AW0 B;  4I7Z B;  1HBW A;  1YTZ T;  2YXR B;  3TSI A;  1L2P A;  5AW6 B;  3U1A A;  1Q7Y Q;  3H1H J;  3AE8 C;  3H1I G;  1KYO I;  3KPE A;  1FOS E;  1RE4 C;  1S1C X;  3H1L E;  3U1C A;  5CJ0 A;  2OYI B;  1LTB C;  2Y9Y A;  4K35 A;  3H1H E;  5TJH A;  1BDD A;  2AXC A;  1SQP G;  1EZV D;  1GU4 A;  1PV3 A;  3MIW A;  3G3Z A;  5APY A;  2GA1 A;  3CME P;  2Y0C A;  3L72 E;  1NO4 A;  2WZ7 A;  2KSJ A;  2YIU B;  4YTP C;  1G2C B;  4YXW H;  1L0N J;  4IL6 H;  4A7P A;  5GTI E;  3H1I D;  3AEA C;  2Y9Z A;  3D6Z A;  4KT0 J;  2J5U A;  3H1J G;  1N7S A;  3JCU H;  1KFN A;  3L74 J;  4JYC A;  2E76 B;  3AE9 C;  3TNU A;  2QJP B;  3L35 A;  1L0N E;  3AEF C;  3CCL P;  4R4L A;  3PJS K;  1TU3 F;  1JB0 J;  1SQP D;  3RK3 D;  3FWL A;  4U3F G;  3AEG C;  3HTK A;  3L74 E;  4LGD E;  1GL2 A;  2ZVN B;  4I6M C;  3V2N A;  3B5N A;  5KAF H;  4CPG A;  1KIL C;  2B88 A;  2O01 H;  3CCU P;  1N73 A;  2D2C C;  1X9V A;  4RJT A;  4GT1 A;  1YJW P;  3R2P A;  1LTJ B;  2B87 A;  2QVA A;  3F89 A;  2WSF H;  2FBW C;  4TLF A;  1MFZ A;  1PGO A;  3TK1 A;  2ZAE B;  1VQK P;  4U3F D;  5B5E E;  2NPS C;  4N78 D;  3HE4 B;  3NXS A;  3H1K G;  1DEB A;  3NMD A;  3GMA A;  1VQN P;  1PP9 J;  2IFN A;  1URQ B;  4ZKU A;  3M91 A;  3NFQ A;  4QMA A;  4H13 D;  1OVV A;  4EIJ A;  1ZN5 A;  1PP9 E;  2HPC A;  5KLV G;  2IZ0 A;  5E79 E;  2Z5H A;  4I2L C;  1QLE D;  2KK7 A;  1Y8A A;  3H1K D;  1IFI A;  2W90 A;  1DIP A;  3CX5 D;  4OVN F;  1R5L A;  4HJG H;  4LLH A;  3L71 G;  1IFJ A;  2ZJS E;  4PD4 H;  4W7Y A;  1CZQ A;  3WUU A;  2WQY C;  4GDO A;  4AQR D;  1T3J A;  1LTG C;  4EI2 A;  2OGU A;  3P32 A;  5KLV D;  2R3C A;  1LWU B;  5GTI H;  1EC5 A;  3O8Z A;  1RE4 A;  1PZQ A;  1FC2 C;  1QEX A;  3IAO A;  2CPS A;  2MJZ A;  1EZV E;  3FXD A;  1G1J A;  3H1I J;  1OMI A;  1VQ4 P;  3UIA A;  4AUW A;  1H8A A;  1BCC G;  3O6Q A;  3L71 D;  1T8Z A;  3RK3 B;  1Q86 Q;  3L73 G;  2AXT H;  1JTH B;  1AQ5 A;  4WVZ A;  2KOG A;  3H1I E;  3W67 A;  5APW A;  3TF5 A;  5H2F E;  1JUN A;  1JY2 N;  1VQ8 P;  3MD0 A;  2ZT9 D;  1NTZ K;  3HD7 C;  2ZVO B;  3S4R A;  4H44 B;  2OTJ P;  1SQV K;  1UII A;  3V2Q A;  1SQP E;  3RK3 E;  5KJ7 A;  2K3R A;  3PH0 A;  4Z1M H;  1FOS F;  3H1J J;  2Z4E A;  1EDI A;  5B5E H;  3L73 D;  2C0W A;  4D6T G;  1M1K Q;  3CC4 P;  2K9J B;  1WRG A;  4GOE A;  3H1J E;  3CXH D;  2Y0D A;  4U3F J;  5AW5 B;  4W80 A;  4DOJ A;  1CSB A;  2QJK B;  1QVG O;  4PV1 D;  4R4M A;  1L0L K;  5AVQ B;  3AEC C;  1EXI A;  4H13 B;  3M0D C;  4U3F E;  4WY4 D;  1KYO D;  1IFP A;  2Q6Q A;  3OJA B;  2KNC A;  5APT A;  5E79 H;  1PL5 A;  2R5D A;  1A02 J;  1FDO A;  4D6T D;  1NAF A;  2NPS A;  1SQB K;  2R44 A;  1KD1 Q;  2OTL P;  1QL2 A;  1X0T A;  1GK4 A;  2YKO A;  3WUT A;  3H1K J;  2FFD B;  1QVF O;  2WT7 A;  3T97 B;  4YPC A;  1Y47 A;  3IF4 A;  2N1T D;  1VQO P;  1EDK A;  1NTK K;  3AE6 C;  5B66 E;  1OZH A;  3H1K E;  2OYH C;  3OAK A;  4K3A A;  1VQ9 P;  4ZMD A;  3CX5 E;  2J58 A;  2A45 G;  3AE5 C;  2W27 A;  3AEE C;  5KLV J;  2R5B A;  3TDK A;  5AW9 B;  4NPE A;  2KS1 B;  1RY3 A;  2BEZ F;  2RN0 A;  5BVZ A;  2JEE A;  5KLV E;  5APU A;  3CX5 I;  3CWB G;  5H2F H;  1YHQ P;  3CC7 P;  1FDM A;  3Q5R A;  3KZI H;  3L71 J;  4OGQ C;  1NH4 A;  3B5N C;  1IJD B;  2BCC G;  1OX3 A;  1S3J A;  1ZR4 A;  1KB9 I;  1N7S B;  3RL0 D;  5APV A;  1OFC X;  2ZT9 B;  3V4W A;  5BU8 B;  2M3E A;  4O9B A;  3VP9 A;  3CCQ P;  2ZYD A;  3S1K A;  3JC2 2;  3L71 E;  2QJY C;  3ZDM A;  3V5B A;  2PGD A;  2E76 D;  1VQM P;  1W2B O;  1WMK A;  1IO4 A;  3HE5 B;  2Q3I A;  2C9L Y;  4Y99 C;  2LXC B;  3MZW B;  4IFD K;  5CCG C;  3CWB D;  1SQQ K;  4KHX A;  1N73 B;  1OVR A;  1BCC J;  1FZC C;  3A3Y B;  1K04 A;  2BCC D;  1FDI A;  3E1R A;  1USE A;  2C9N Y;  1IK9 A;  4L74 A;  2B87 B;  3VP8 A;  1RF1 B;  1BCC E;  3G71 P;  3M9H A;  2JDI H;  5APS A;  4UB8 E;  2KLU A;  4BXL A;  2FYU G;  1LP1 A;  4I1L A;  1KQS O;  3AEB C;  1JMM A;  3HUS B;  2VRS A;  3BAT A;  1J1E C;  4WY4 B;  4ZNC A;  2WPV B;  3CXH E;  1LT9 C;  3VMY A;  4RKU J;  5KAI H;  4L73 A;  1JY3 N;  2FYZ A;  3B71 A;  2BAS A;  1HJB A;  4D6T J;  1FE6 A;  2JWD A;  2N9B A;  1OW8 A;  3N4X A;  3P8M C;  3RBX A;  3CXH I;  4BWN A;  2E74 C;  4NPD A;  2FYU D;  2M0B A;  1HJ0 A;  4D6T E;  1YQ3 C;  4I7Z C;  1Z56 A;  5B66 H;  3JSV C;  3CX5 H;  4C7N B;  2JP3 A;  1T6A A;  4HKZ H;  2H89 C;  1ZV8 A;  3I56 P;  2IDB A;  2Q7C A;  1FZG A;  1BSH A;  1GDT A;  2RH0 A;  2YO3 A;  1U7M A;  1SQX G;  2JWA A;  2IYP A;  1NTZ G;  2OYH A;  1JMB A;  1YI2 P;  3RL0 B;  1CW5 A;  1KTM A;  5GTH E;  1HGV A;  1NU1 G;  3G4S P;  3RGU A;  1NAY A;  4M3L A;  1K05 A;  2WSE J;  5CJ4 A;  1U7J A;  1JY2 O;  2QJP C;  5C39 A;  2KZJ A;  5KLI B;  1YYC A;  1L4A C;  1VQ5 P;  5KJ7 C;  2WMM A;  5AW8 B;  1L0N K;  2JKV A;  3OW2 O;  2PRR A;  4IL6 X;  1M1J A;  1MFT A;  1H89 A;  3AE1 C;  4DJG A;  1A02 F;  2N9Y B;  2HOD A;  1OWA A;  1SS1 A;  1SQX D;  1VDF A;  1SFC D;  1NTZ D;  4WBA A;  4JBZ A;  3CWB J;  1MZ9 A;  2PAJ A;  2B9B A;  1PIX A;  2E5T A;  1NU1 D;  4ASW A;  4H44 D;  3BAS A;  4UB8 H;  2BCC J;  4DCK A;  3H1J D;  1AQT A;  3KDP B;  3CWB E;  1M57 D;  3CXH H;  2A45 I;  2M5A A;  1RF0 A;  1BE3 G;  2KIK A;  3U59 A;  2O3J A;  4GOD A;  5CCG A;  2BCC E;  1SQB G;  1KIL B;  1FZC A;  2QA4 P;  2QSI A;  1YJN P;  2IBZ G;  1T2K C;  2WPS A;  3AE3 C;  1PFI A;  1FJP A;  2M3B A;  1YQ4 C;  1KYO H;  2WIT A;  3PHL A;  3SWY A;  2W83 C;  3H32 A;  3CCM P;  1KIL E;  1AA0 A;  4XA4 A;  1VQ6 P;  1S2E A;  1HVV A;  3VN0 A;  3MUD A;  1VQP P;  1BE3 D;  4L75 A;  1JY2 P;  1LT9 A;  2FYU J;  3C9I A;  1GW4 A;  3A0H E;  1SQB D;  3Q2Y A;  3CLQ A;  2P10 A;  1NTM G;  1ZOY C;  2QRX A;  2IBZ D;  2W8Z A;  2QM8 A;  3OA7 A;  3M9Q A;  1KQF B;  2FYU E;  1JOC A;  2YKP A;  1CI6 B;  4C46 A;  1IFM A;  3IR9 A;  1Q90 D;  2N1T A;  2E75 D;  2H43 A;  1KB9 D;  1MUU A;  1BSN A;  1M7L A;  1E79 H;  2B89 A;  5GTH H;  2V7Q J;  1NTM D;  2OYI A;  3G6E P;  2QE7 H;  2UWJ E;  2V4H A;  1EDJ A;  3I55 P;  3MP7 B;  3L4F A;  1HTL C;  2P58 A;  2WSE H;  5CCH D;  3GF3 A;  1M56 D;  2A45 H;  3CI9 A;  1G2C A;  4ASV A;  2DW3 A;  1JCD A;  4BRY B;  3B8E B;  2OYO A;  1SFC B;  4H0L D;  1LTS C;  1N7S D;  3BVH A;  3GHG B;  1X8Y A;  1SQX J;  3V2R A;  3BCC G;  1AJY A;  1W2E A;  3VMA A;  1NTZ J;  3M0A A;  2GUS A;  1KC8 Q;  1SQP K;  2FXP A;  2WPQ A;  2CK3 H;  2P2U A;  1L4A A;  3KYQ A;  2J59 M;  1NU1 J;  2PFX A;  2WWW A;  2FYN B;  1SQX E;  2FXM A;  1GL2 D;  4OGQ D;  1BCC D;  3B5N D;  3C1L A;  1NTZ E;  5AVW B;  5KKZ C;  3LW5 J;  2A06 G;  2YXQ B;  3HD7 B;  3VTP C;  1NU1 E;  2Z5I A;  1IK7 A;  2QJK C;  3A2A A;  1DD4 A;  1HWT C;  1LTJ A;  3BCC D;  3MGN A;  4H13 C;  4N3Y B;  3CCR P;  1JY3 O;  1X22 A;  1SVF A;  3LID A;  1L0L J;  1AVY A;  4AYC A;  2W6A A;  1JM0 A;  2IX7 C;  3A0H H;  1P84 E;  3WU2 E;  2KP8 A;  3HE4 A;  1IFN A;  2C0X A;  4JPZ B;  1AVO A;  1N7L A;  2HYN A;  2GM4 A;  2A06 D;  2KB7 P;  1L0L E;  2P1J A;  1BE3 J;  1SQB J;  1URQ A;  2XZR A;  1DEE G;  4N6J A;  2XNX A;  1EDL A;  3V4Q A;  3GF7 A;  1K8A Q;  1P84 I;  1QGK B;  1VF5 D;  2OTK E;  1BE3 E;  1AV1 A;  2E75 B;  1SQB E;  2XDJ A;  2IBZ E;  3RK2 D;  4U7J A;  1N86 A;  5AVY B;  1NTK J;  2L5G B;  1Y9B A;  3CL3 D;  3CCS P;  2E74 D;  1NTM J;  1EXJ A;  1NTK E;  2O01 N;  1KB9 E;  2KZI A;  2IBZ I;  3NTN A;  5AVS B;  4RES B;  2P7J A;  1M8O B;  2WVR A;  3R4Y A;  4WWI A;  5KLV K;  1M1J C;  1S5L X;  3IN6 A;  3L37 A;  2YMY A;  1LWU A;  1NTM E;  1JY3 P;  1ZLL A;  2ZT9 C;  1X79 B;  4UB6 E;  4H0L B;  5AVT B;  1BDC A;  3FWN A;  3TNU B;  2Y0E A;  3HTK B;  1JTH A;  1GL2 B;  3FX0 A;  4OGQ B;  3B5N B;  1MKM A;  1RF0 C;  5AVX B;  2AEJ A;  5AW3 B;  1FZA A;  4IL6 E;  1SLQ A;  3VYI A;  1J1D C;  3C8V A;  1SQQ J;  2XND H;  1NJI Q;  3L70 G;  1FU1 A;  3L75 G;  1PGP A;  3LW5 H;  2QJY B;  3II6 A;  1R8E A;  1JEK A;  4PV1 C;  2HFE D;  1U57 A;  3I5C A;  1T3U A;  3SFE C;  3B4S A;  2RMZ A;  1SQQ E;  1GZL A;  3HUS C;  4Y99 B;  4HB1 A;  5CHX A;  3BCC J;  3WU2 H;  3SWK A;  2W6J H;  1OXZ A;  3RL0 g;  1N2D C;  2HLO A;  2K9J A;  5KAF E;  5CBO A;  3MUD C;  2AEF A;  1KIL D;  1IZN B;  2K9Y A;  2D2C D;  2GUV A;  3MHV A;  3BCC E;  3L70 D;  2HR3 A;  4IFF A;  1GW3 A;  3L75 D;  1Q81 Q;  3H32 B;  1ZP0 C;  2LXB A;  1IC2 A;  1S4X A;  2O1K A;  1J2J B;  1VF5 B;  1J1E B;  5AVZ B;  2N1T C;  2HPC B;  1S72 P;  5AVV B;  3KQG A;  4XE5 B;  4JQ0 D;  2K1A A;  3P7K A;  2A06 E;  2NPS D;  4OH8 B; 
#chains in the Genus database with same CATH homology
 3KZI E;  5GTI E;  5GTH E;  3JCU E;  5KAF E;  2AXT E;  3A0B E;  4UB6 E;  5KAI E;  4PJ0 E;  3A0H E;  5B66 E;  5E79 E;  5TIS E;  1W5C E;  4IL6 E;  4UB8 E;  3WU2 E;  1S5L E;  5B5E E;  5H2F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...