3A0BE

Crystal structure of br-substituted photosystem ii complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 16
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3a0bE00
3JCUE 5KAIE 3KZIE 5B5EE 5TISE 1W5CE 5GTIE 5KAFE 1S5LE 2AXTE 3A0HE 5E79E 4UB8E 5B66E 5H2FE 3WU2E 5GTHE 3A0BE 4UB6E 4IL6E 4PJ0E
chains in the Genus database with same CATH superfamily
4JPZB 2CK3H 3AE1C 5BVZA 2M8RA 1HTLC 1KD1Q 1RF1C 2KYVA 4UB8H 1L4AB 2E42A 1NTZJ 3KZIE 1NU1G 3AE4C 3MHVA 2PFXA 1JMBA 5APVA 1IK9A 1G2CA 3Q1MA 2FFDB 3IF4A 4OGQC 5AW3B 1S9KD 2ZT9C 3L4FA 3SWFA 2Q7CA 1X0TA 1JY2O 1SFCC 1SQPE 1Q86Q 4WBAA 2HPCB 2IZ0A 1SFCA 2P10A 4LLHA 1BE3J 1KILB 2C9LY 1PGQA 1QVFO 3L71G 1X9VA 4H44B 5KKZC 1SQPD 1KQGB 2FYUG 2K3RA 1Q82Q 3TF5A 1FJKA 4YTPC 1SQQK 2Q3IA 3AEFC 1GW3A 1IJDB 1GTWA 2H43A 2E74D 1EXIA 1KORA 2A45I 3AE8C 3PH0A 4WY4A 1LT9B 1EZVI 1IZNB 4H44C 3U1AA 5KKZB 1M1JB 1FS0E 1S1CX 2KI7B 3AEBC 3L75G 3Q5SA 3CD6P 2B89A 1J1EC 2IBZI 4OGQB 3CMAP 1KFMA 3PTZA 2E75D 5GTIE 1T2KD 3H25A 1S5LE 2G8YA 2J59M 2R5BA 4C46A 5CCHC 1NWQA 1FZCA 2QJPB 3Q5RA 4IFMA 1BCCD 4H13C 2J58A 4PD4I 3P8CD 2QE7H 2Z5HA 3A0HE 1NAFA 2R5DA 2KLVA 4BRYA 1AVYA 3AE3C 3FXDA 1S9KE 2KOGA 3CX5I 3USSA 1FAVA 1GK6A 2KSJA 2RN0A 1SQQJ 1KQFB 1FZCB 1M90Q 1PPJE 3HTKA 3KXDA 1GDTA 2E43A 3CC2P 3RL0C 4L74A 1VQPP 2IPPA 3H1KJ 1RF0C 1VF5C 2HFED 2JO1A 5L8RJ 4D6TG 2QA4P 1LWUB 1ZMEC 1QGKB 3JCUE 5AVUB 1MV8A 2KXPB 2RMZA 2NPSB 4Y99B 2GUVA 2GM4A 2E76C 1AV1A 1OW8A 2WPVB 1KILD 3BRTB 3H1LE 5APQA 1SLQA 3TDKA 1YJNP 4DT0A 2ZYAA 3M0DC 1OMIA 2C0WA 2L5GB 2PAJA 1WT6A 3P7KA 1NTZK 3L74D 1YQ3C 4PD4D 1KILE 3H32A 2FKWB 1KFNA 2E74C 3L75D 1PZQA 2K37A 4W80A 5BU8B 1ZLLA 2K9JA 1KYOI 1PIXA 4EYYQ 4GODA 1FDMA 2H89C 2XZRA 1YHQP 1LNQA 1N7SA 1G1JA 4PJ0H 1SQBD 1Z56A 4M3LA 1VQ8P 1JCDA 3RBZA 4GOEA 2P1JA 1N73B 3CXHH 2OYHB 2YKQA 3B8EB 2YKOA 3TYYA 2E75B 2N9BA 3KPEA 4OGQD 1FOSF 1AVOA 2H88C 4D6TE 5CBOA 2HG5D 2POHA 2WMMA 2WSFH 2WSCJ 5KAFH 1SQXG 3C8VA 3M91A 3VN0A 1EZVD 1UIXA 4OVNF 4RJTA 1NTMK 3L75J 2HODB 2E76D 1T3JA 5APXA 3L74J 3BATA 2G3AA 2XU6A 4BWNA 5KAIH 1OVUA 2C0XA 4WY4B 1KQSO 3FGAD 1GL2D 2I8DA 2QG4A 3ITKA 1JY3N 1NKNA 1SQXJ 1VF5D 1RF1B 2YIUB 3MTUE 3RL0D 2ZVOB 2WPQA 5H2FE 1NU1K 1R5SA 1P84E 3G6EP 2JR8A 3I5CA 3L75E 4PV1B 3RK2B 1L0LJ 1CI6B 2FFDC 1NTKK 1PP9J 3A0BE 1LTJB 3CXHE 1HVVA 2A45H 2ZT9B 2AXTH 2H8PD 4WVZA 3V2PA 3BVHA 3AEAC 1P84D 3W67A 4H13D 1YQ4C 4Y28J 1L0NK 4EIJA 2I1KA 3IR9A 3RK3E 1K73Q 5CCHD 1FOSE 3MIWA 4H0LD 1JY3P 1GW4A 2R3SA 3NXSA 5M1BA 1NGMB 4GIFA 5TISE 4KHXA 3I55P 1FZCC 3NFQA 5AVYB 4L76A 4CPGA 1PGOA 1M7LA 5KTBA 5KAFE 5KLIC 4RO0A 2GUSA 1EZVG 2FYUJ 1S2EA 3HD7C 5KJ7C 4MN4C 4DOJA 2LR2A 1SQPG 2BCCE 2YMKA 1Y9BA 1HGVA 2K88A 2ZXEB 1JCCA 3AE9C 2A45G 2QJPC 1IC2A 1URQC 3FX0A 3HD7A 3LIEA 5CCGA 3M9QA 1JTHB 3F5HA 5CBNA 1JY2N 1ZP0C 2CPBA 3HUSB 5DJTB 3TNUB 5KLVG 3EFGA 1ZR2A 1VQ9P 3AE2C 2R3CA 2WSFJ 2B9BA 2DW3A 3WUTA 2YMYA 2KK7A 4YXDC 1P84H 3CMEP 2M0BA 1LJ2A 1T3UA 3HD7D 3AEEC 1SFCD 5APYA 1KB9H 2KP8A 2ZT9D 1FZFA 1DEBA 3CCUP 1J1DB 1YBKA 1S5LX 3M0DA 4EI2A 1M8OB 3H1LG 1BGYG 5EFWB 3OW2O 1Q2NA 3CCLP 1H0TB 3OA7A 2ZFCA 2OYOA 4O9BA 3L72J 5GTIH 1MFTA 2WT7B 3O6QA 1Q81Q 2HODA 2FYUD 2QJKC 1QVGO 1GL2A 3PJSK 2WSEJ 4AUWA 1LP1B 5E79E 1IFJA 1IFMA 2KNCB 2I1JA 5AW4B 2WZ7A 1VQKP 3TGUE 3SSUA 3AECC 2O01J 3VMAA 3SFDC 1HH0A 5CHXA 2N1TA 3B5NA 3B5NB 3P8MC 2MKVA 1ZXGA 1L0LD 3HRNA 3H1KE 2Y0DA 2JDIH 5KAIE 1IFDA 1JNMA 2WTYA 1K8AQ 5B66H 2Q6QA 1BCCG 2K9YA 1GU5A 1CI6A 3IFMA 4U3FE 1VQ4P 2K9JB 4D6TJ 2OTLP 2WQYC 3U1CA 3RK3B 1N7LA 3QH9A 3E1IA 3VP8A 4ASWA 5BU5A 3L70D 3B5ND 3O8ZA 5AW9B 1NTKG 1L0ND 2E74B 4I7ZC 4W7YA 1EDIA 2YKPA 1W2BO 1KTMA 2BCCJ 2QVAA 2IZ1A 5AVWB 2BEZF 3MGNA 5K5GB 2OYHA 3L73E 2LXBA 4Z1MH 1NYHA 1L0NE 1KC8Q 3D71A 4JF7A 3GHGC 1SQVD 3JCUH 2PGDA 2P7JA 3BCCG 1A02J 1VQ7P 1AFOA 1S3JA 1MFZA 1YJWP 1QLED 2JWAA 2ZYDA 4L75A 1AA0A 1FZEA 3L72D 1LP1A 5CJ4A 4BXLA 5E79H 3CWBG 1SQVE 2IFNA 1FZBA 2N1TD 3HTKB 3VOPA 2ZYGA 3AE6C 2Q9IA 3NTNA 3L71D 2IBZE 2JJLA 1JTHA 1URQD 2Y0EA 3TK1A 1SQPK 3CX5H 1A02F 3CC4P 1KN7A 1NTKD 1OW7A 3L73G 4GKGA 4OH8B 3CCSP 2O01N 1NU1E 4HH2A 1L0LE 1IFPA 1KYOD 1OZHA 2HR3A 2KIKA 2O1JA 3C1LA 3H1HG 1GK4A 3H6PA 1Y47A 5AW1B 1SQVK 1NTKE 5APTA 2H7HA 1EDLA 3V2RA 2BEQD 2WPRA 2Y9YA 1OVVA 4U3FD 3M9BA 4C7RA 3WUUA 1URQA 2FXPA 4N78D 3AE7C 5CCGC 3H32B 2OGUA 3KHUA 1BE3G 1M1KQ 4U3FG 1FC2C 2WITA 1SVFA 1SQBK 2KS1B 2XDJA 1JY3O 1MUUA 2WSCH 2P67A 3H1KG 4N78E 3LW5H 1N2DC 3RK2C 1J1EB 3N4XA 4XA4A 3VYIA 1ZRTD 3H1JJ 3WU2E 4ZMDA 1SQQG 1XTGB 3VP9A 2FY8A 1NHLA 1M56D 2IDBA 3HE4B 3R2PA 4AQRD 2YIUC 1T2KC 3AE5C 2W6AA 1LT1A 1KB9I 1JMMA 1QX8A 2ZJSE 4H13B 1LTBC 4WY4C 4H0LB 1JEKA 3CCRP 3CWBD 1RQVA 2IYOA 2W8ZA 3CX5D 4WB4A 5CCGD 2NPSC 4Y99C 2FXOA 3H1JG 2JWDA 2B87A 3MD0A 5KLVJ 1M1JC 4H44D 1SQQE 1X22A 2L91A 1W5CE 3CX5E 4NPFX 3RL0B 1BE3D 1T8ZA 1S72P 1LTJC 2V4HA 1PFIA 3KZIH 1RE3A 3KDPB 5CCHA 2AXTE 1FBMA 1LTJA 2FYZA 1ZOYC 2IYPA 3JSVC 2XKMA 1LT9C 1BE3E 5B66E 3RBXA 4YPCA 1WRGA 1R5LA 4LC1A 2N1TC 1RHZB 3RL0g 3V6IA 1LTGC 1RE4C 2WSSH 3GG2A 5H2FH 1USDA 1N73C 1EDJA 1VL2A 3R4YA 1PV3A 1BSHA 4JBZA 3H1HE 1YYCA 4TLFA 1N73A 5GTHH 2Z4EA 1G1IA 4PJ0E 3MZWB 3WU2H 5KLVE 2QM7A 4HKZH 3P8CE 2R32A 2AEFA 1FDIA 2OQQA 1AJYA 2IBZG 2KLUA 4WWIA 3PHLA 1FJPA 3T97B 4DJGA 2D2CC 2QIWA 3E1RA 1SQVG 1PPJD 3LIDA 1HUCA 4HB1A 1H0TA 3HUSC 1YTZT 3EFFK 5CJ0A 2OYHC 1SS1A 1U57A 1LTTC 1S5LH 4EOTA 3D6YA 3M06A 3L35A 3NMDA 3G4SP 2KSEA 1KYOH 3HUSA 1KZUB 3BCCE 3V2NA 1L0NG 1KMIZ 3GW6A 1HBWA 1SQQD 1NOHA 1LTIC 3FWLA 2WPSA 3L70G 4QMAA 3S1KA 4ASVA 1FDOA 3AEDC 4PV1D 4R4LA 3VTPC 3V5BA 3V2QA 1DIPA 1OFCX 3L74E 5C39A 1BCCJ 1ZR4A 1VQNP 4LGDE 1EC5A 3OJAB 4K3AA 4L73A 1GU4A 3CPWO 1BCCE 4GDOA 3WUVA 3HE5A 3CCEP 3RK2D 2E76B 4KT0J 2V7QH 3H1HD 2NZ2A 3PP5A 3Q5PA 3H1ID 2A06G 4R4MA 2QJYC 3PLNA 5KLVD 1SQBE 1BDDA 1YI2P 5AVQB 5KLVK 1VF5B 2OYIA 5KJ7A 1OXZA 1P84I 3FWNA 1IO4A 2BASA 1JO5A 4I7ZB 5TISH 1IK7A 1IFIA 3L36A 5TJHA 1FE6A 1ZW0A 3QWOC 2BCCD 3W68A 1E5WA 3ZDMA 4B86A 4DCKA 1H8AA 1FZGA 2JKVA 1SQXE 1KILA 1SP4A 3CCMP 1EXJA 1LTSC 1W2EA 2KUBA 2N9YB 1MZ9A 1XTCC 3L72G 4JYCA 4N3YB 2IFMA 3CCVP 3H1LD 1RQUA 4NPDA 5APWA 4RKUJ 5APUA 4IL6E 4PD4E 3GMAA 4KJMA 3TSIA 2OTJP 2WWWA 1SQBJ 1AQTA 1VDFA 2B87B 2W90A 1PGPA 2O01H 2OARA 3LW5J 3VMXA 2QRXA 4GT1A 3L74G 3VMZA 1NO4A 1Q7YQ 2FXMA 1M1JA 3G3ZA 2QM8A 5B5EH 1PP9E 1SQVJ 1VPCA 4I6MC 5B5EE 5AW5B 3CC7P 2E5TA 4JQ0D 1PGJA 1OWAA 1U7JA 1VQLP 4ZNCA 2W6BA 2C9NY 3SWYA 1PP9D 2QEXP 1NKZB 3L70J 1N7SB 3H1IE 1SQPJ 4AYCA 3GLMA 1PL5A 3F89A 4H0LC 4D6TD 3CI9A 3GF7A 3ABVC 1RE4A 2BCCG 3WMM0 2O3JA 1RY3A 3RGUA 4IL6X 1KV4A 4N6JA 1EZVE 3K5BA 1S4XA 2LKMA 1N7SD 4XE5B 1SFCB 2KZIA 3FXEA 4YXWH 1SQXD 1GL2B 1PPJG 3B71A 1CSBA 3N7NA 3CCJP 1HJBA 3H1IG 2JEEA 3S4RA 2HYNA 2Q5UA 2YXRB 3C9IA 3TNUA 1VQOP 3A3YB 1IFNA 2Y9ZA 1YIJP 5AVVB 1GZLA 2KS1A 1L4AC 3EWKA 1DX7A 2AEMA 3BASA 1PP9G 4ZKPA 2M5AA 3P32A 1L4AA 3TGUJ 3H1HJ 1DH3A 2OYIC 3L71J 1EQ7A 2FYNB 2YNYA 5DJUB 1LGHB 1GD2E 3GHGA 3L73D 5AW8B 3RK3D 1HGZA 1R8EA 3PRJA 2WT7A 3B4SA 4GOFA 2Q1KA 2D2CD 2KB7P 4BRYB 3D6ZA 1OIPA 1BDCA 3CCQP 2CPSA 3L72E 1K05A 1WMKA 2PRRA 2XNXA 4HJGH 1BSNA 1NVOA 1ZV8A 3HE5B 4K35A 1OVRA 1FU1A 4EDFA 2E5YA 3Q2YA 3UIAA 1JY2P 5AW0B 1MKMA 3SFEC 1UIIA 5AW2B 3B5NC 1X79B 2IBZD 1HJ0A 3S9OA 2ZAEB 2ITAA 2JP3A 1J1DC 3EQ2A 3A5TA 1D7MA 1SQBG 3AEGC 1NJIQ 2W83C 1RF1A 2A06E 1KYOE 3CLQA 2YXQB 1USEA 3SWKA 2NPSD 1L4AD 2N1TB 3HD7B 3L73J 4OWFA 3KQGA 1Y8AA 2PP6A 2FYNC 3OAKA 4WY4D 1OX3A 5CMZA 2A06D 2OTKE 2XNDH 4C7NB 3H1KD 1KILC 1EDKA 1NAYA 3V4QA 2AEJA 1X8YA 1QL1A 1DD4A 1JB0J 4UB6H 1TU3F 3A0BH 1M57D 1E79H 3G9RA 1NTMD 2VRSA 2ZXXA 4JYBA 4W7ZA 2YO3A 1L0LG 3T97A 2NRGA 3L70E 1YTZI 1HF9A 1T6AA 1ZRTE 5GTHE 2D2CB 3CXHD 1NTME 1G2CB 1NTZE 3KYQA 2FFDA 2E75C 5AVTB 3D70A 1Q90D 2UWJE 5AW7B 1JOCA 2KNCA 2B88A 1K04A 2QJKB 3CWBE 4IOIH 1YITP 2FYUK 3GF3A 2HLOA 5AVZB 1HWTC 1KQLA 1N86A 2W27A 3U59A 1JM0A 3IN6A 3HE4A 3BRVB 3MP7B 3TGUD 2FBWC 2XV5A 1GL2C 1RE3C 4I2LC 2Z5IA 1VQMP 3BCCJ 3CXHI 1BGYD 4IFFA 1QL2A 5AW6B 3JC22 3VMYA 5KLIB 1N8RQ 2GA1A 3G71P 2SPZA 1H89A 1NH4A 1L0NJ 4IL6H 4NPEA 4PD4H 2IX7C 4UB8E 1GMJA 1KB9E 2P58A 3E7KA 3MUDA 3GHGB 1DEEG 4ZKUA 3A2AA 3IAOA 1AQ5A 1URQB 2V7QJ 1J2JB 4HYTB 4IFDK 1LWUA 1NTKJ 2QSIA 2WSEH 1L0LK 2ZVNB 3MUDC 1K9MQ 4UB6E 5KJ7D 2QJYB 3M0AA 1KB9D 1LWUC 1NU1J 2YO2A 1QEXA 4C7NA 4XFJA 2RH0A 2M5AB 3O6QB 4A7PA 1SQXK 1RF0A 4U3FJ 2OYIB 1U7MA 3A7OA 3RK3C 3CWBJ 3A0HH 2M3BA 1OW6A 3TGUG 1NTZD 1CW5A 2LXCB 3H1JE 4U7JA 3Q3DA 1VQ5P 1BGYJ 4TT3H 1RH5B 2RKLA 1NTMJ 1L2PA 2NPSA 3I56P 1YJ9P 2J5UA 2HPCA 1LTAC 3H1JD 4DZOA 3BCCD 2P2UA 2FYUE 3II6A 1FZAA 3L37A 2R44A 5AVSB 3V4WA 3L71E 3H1IJ 1VQ6P 2W6JH 1CZQA 2MJZA 2Q3EA 5AVXB 2WVRA 4I1LA 5APSA 5AVRB 2O1KA 1NU1D 1BGYE 1LT9A 2AXCA 2KZJA 2M3EA 4PV1C 4RESB 1JUNA 1NTZG 3CL3D 1NTMG 1N7SC 2Y0CA 1H88A 3M9HA 1DD3A 1ZN5A 3H1LJ 2K1AA
chains in the Genus database with same CATH topology
3JCUE 5KAIE 3KZIE 5B5EE 5TISE 1W5CE 5GTIE 5KAFE 1S5LE 2AXTE 3A0HE 5E79E 4UB8E 5B66E 5H2FE 3WU2E 5GTHE 3A0BE 4UB6E 4IL6E 4PJ0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU E;  5KAI E;  3KZI E;  5B5E E;  5TIS E;  1W5C E;  5GTI E;  5KAF E;  1S5L E;  2AXT E;  3A0H E;  5E79 E;  4UB8 E;  5B66 E;  5H2F E;  3WU2 E;  5GTH E;  3A0B E;  4UB6 E;  4IL6 E;  4PJ0 E; 
#chains in the Genus database with same CATH topology
 4JPZ B;  2CK3 H;  3AE1 C;  5BVZ A;  2M8R A;  1HTL C;  1KD1 Q;  1RF1 C;  2KYV A;  4UB8 H;  1L4A B;  2E42 A;  1NTZ J;  3KZI E;  1NU1 G;  3AE4 C;  3MHV A;  2PFX A;  1JMB A;  5APV A;  1IK9 A;  1G2C A;  3Q1M A;  2FFD B;  3IF4 A;  4OGQ C;  5AW3 B;  1S9K D;  2ZT9 C;  3L4F A;  3SWF A;  2Q7C A;  1X0T A;  1JY2 O;  1SFC C;  1SQP E;  1Q86 Q;  4WBA A;  2HPC B;  2IZ0 A;  1SFC A;  2P10 A;  4LLH A;  1BE3 J;  1KIL B;  2C9L Y;  1PGQ A;  1QVF O;  3L71 G;  1X9V A;  4H44 B;  5KKZ C;  1SQP D;  1KQG B;  2FYU G;  2K3R A;  1Q82 Q;  3TF5 A;  1FJK A;  4YTP C;  1SQQ K;  2Q3I A;  3AEF C;  1GW3 A;  1IJD B;  1GTW A;  2H43 A;  2E74 D;  1EXI A;  1KOR A;  2A45 I;  3AE8 C;  3PH0 A;  4WY4 A;  1LT9 B;  1EZV I;  1IZN B;  4H44 C;  3U1A A;  5KKZ B;  1M1J B;  1FS0 E;  1S1C X;  2KI7 B;  3AEB C;  3L75 G;  3Q5S A;  3CD6 P;  2B89 A;  1J1E C;  2IBZ I;  4OGQ B;  3CMA P;  1KFM A;  3PTZ A;  2E75 D;  5GTI E;  1T2K D;  3H25 A;  1S5L E;  2G8Y A;  2J59 M;  2R5B A;  4C46 A;  5CCH C;  1NWQ A;  1FZC A;  2QJP B;  3Q5R A;  4IFM A;  1BCC D;  4H13 C;  2J58 A;  4PD4 I;  3P8C D;  2QE7 H;  2Z5H A;  3A0H E;  1NAF A;  2R5D A;  2KLV A;  4BRY A;  1AVY A;  3AE3 C;  3FXD A;  1S9K E;  2KOG A;  3CX5 I;  3USS A;  1FAV A;  1GK6 A;  2KSJ A;  2RN0 A;  1SQQ J;  1KQF B;  1FZC B;  1M90 Q;  1PPJ E;  3HTK A;  3KXD A;  1GDT A;  2E43 A;  3CC2 P;  3RL0 C;  4L74 A;  1VQP P;  2IPP A;  3H1K J;  1RF0 C;  1VF5 C;  2HFE D;  2JO1 A;  5L8R J;  4D6T G;  2QA4 P;  1LWU B;  1ZME C;  1QGK B;  3JCU E;  5AVU B;  1MV8 A;  2KXP B;  2RMZ A;  2NPS B;  4Y99 B;  2GUV A;  2GM4 A;  2E76 C;  1AV1 A;  1OW8 A;  2WPV B;  1KIL D;  3BRT B;  3H1L E;  5APQ A;  1SLQ A;  3TDK A;  1YJN P;  4DT0 A;  2ZYA A;  3M0D C;  1OMI A;  2C0W A;  2L5G B;  2PAJ A;  1WT6 A;  3P7K A;  1NTZ K;  3L74 D;  1YQ3 C;  4PD4 D;  1KIL E;  3H32 A;  2FKW B;  1KFN A;  2E74 C;  3L75 D;  1PZQ A;  2K37 A;  4W80 A;  5BU8 B;  1ZLL A;  2K9J A;  1KYO I;  1PIX A;  4EYY Q;  4GOD A;  1FDM A;  2H89 C;  2XZR A;  1YHQ P;  1LNQ A;  1N7S A;  1G1J A;  4PJ0 H;  1SQB D;  1Z56 A;  4M3L A;  1VQ8 P;  1JCD A;  3RBZ A;  4GOE A;  2P1J A;  1N73 B;  3CXH H;  2OYH B;  2YKQ A;  3B8E B;  2YKO A;  3TYY A;  2E75 B;  2N9B A;  3KPE A;  4OGQ D;  1FOS F;  1AVO A;  2H88 C;  4D6T E;  5CBO A;  2HG5 D;  2POH A;  2WMM A;  2WSF H;  2WSC J;  5KAF H;  1SQX G;  3C8V A;  3M91 A;  3VN0 A;  1EZV D;  1UIX A;  4OVN F;  4RJT A;  1NTM K;  3L75 J;  2HOD B;  2E76 D;  1T3J A;  5APX A;  3L74 J;  3BAT A;  2G3A A;  2XU6 A;  4BWN A;  5KAI H;  1OVU A;  2C0X A;  4WY4 B;  1KQS O;  3FGA D;  1GL2 D;  2I8D A;  2QG4 A;  3ITK A;  1JY3 N;  1NKN A;  1SQX J;  1VF5 D;  1RF1 B;  2YIU B;  3MTU E;  3RL0 D;  2ZVO B;  2WPQ A;  5H2F E;  1NU1 K;  1R5S A;  1P84 E;  3G6E P;  2JR8 A;  3I5C A;  3L75 E;  4PV1 B;  3RK2 B;  1L0L J;  1CI6 B;  2FFD C;  1NTK K;  1PP9 J;  3A0B E;  1LTJ B;  3CXH E;  1HVV A;  2A45 H;  2ZT9 B;  2AXT H;  2H8P D;  4WVZ A;  3V2P A;  3BVH A;  3AEA C;  1P84 D;  3W67 A;  4H13 D;  1YQ4 C;  4Y28 J;  1L0N K;  4EIJ A;  2I1K A;  3IR9 A;  3RK3 E;  1K73 Q;  5CCH D;  1FOS E;  3MIW A;  4H0L D;  1JY3 P;  1GW4 A;  2R3S A;  3NXS A;  5M1B A;  1NGM B;  4GIF A;  5TIS E;  4KHX A;  3I55 P;  1FZC C;  3NFQ A;  5AVY B;  4L76 A;  4CPG A;  1PGO A;  1M7L A;  5KTB A;  5KAF E;  5KLI C;  4RO0 A;  2GUS A;  1EZV G;  2FYU J;  1S2E A;  3HD7 C;  5KJ7 C;  4MN4 C;  4DOJ A;  2LR2 A;  1SQP G;  2BCC E;  2YMK A;  1Y9B A;  1HGV A;  2K88 A;  2ZXE B;  1JCC A;  3AE9 C;  2A45 G;  2QJP C;  1IC2 A;  1URQ C;  3FX0 A;  3HD7 A;  3LIE A;  5CCG A;  3M9Q A;  1JTH B;  3F5H A;  5CBN A;  1JY2 N;  1ZP0 C;  2CPB A;  3HUS B;  5DJT B;  3TNU B;  5KLV G;  3EFG A;  1ZR2 A;  1VQ9 P;  3AE2 C;  2R3C A;  2WSF J;  2B9B A;  2DW3 A;  3WUT A;  2YMY A;  2KK7 A;  4YXD C;  1P84 H;  3CME P;  2M0B A;  1LJ2 A;  1T3U A;  3HD7 D;  3AEE C;  1SFC D;  5APY A;  1KB9 H;  2KP8 A;  2ZT9 D;  1FZF A;  1DEB A;  3CCU P;  1J1D B;  1YBK A;  1S5L X;  3M0D A;  4EI2 A;  1M8O B;  3H1L G;  1BGY G;  5EFW B;  3OW2 O;  1Q2N A;  3CCL P;  1H0T B;  3OA7 A;  2ZFC A;  2OYO A;  4O9B A;  3L72 J;  5GTI H;  1MFT A;  2WT7 B;  3O6Q A;  1Q81 Q;  2HOD A;  2FYU D;  2QJK C;  1QVG O;  1GL2 A;  3PJS K;  2WSE J;  4AUW A;  1LP1 B;  5E79 E;  1IFJ A;  1IFM A;  2KNC B;  2I1J A;  5AW4 B;  2WZ7 A;  1VQK P;  3TGU E;  3SSU A;  3AEC C;  2O01 J;  3VMA A;  3SFD C;  1HH0 A;  5CHX A;  2N1T A;  3B5N A;  3B5N B;  3P8M C;  2MKV A;  1ZXG A;  1L0L D;  3HRN A;  3H1K E;  2Y0D A;  2JDI H;  5KAI E;  1IFD A;  1JNM A;  2WTY A;  1K8A Q;  5B66 H;  2Q6Q A;  1BCC G;  2K9Y A;  1GU5 A;  1CI6 A;  3IFM A;  4U3F E;  1VQ4 P;  2K9J B;  4D6T J;  2OTL P;  2WQY C;  3U1C A;  3RK3 B;  1N7L A;  3QH9 A;  3E1I A;  3VP8 A;  4ASW A;  5BU5 A;  3L70 D;  3B5N D;  3O8Z A;  5AW9 B;  1NTK G;  1L0N D;  2E74 B;  4I7Z C;  4W7Y A;  1EDI A;  2YKP A;  1W2B O;  1KTM A;  2BCC J;  2QVA A;  2IZ1 A;  5AVW B;  2BEZ F;  3MGN A;  5K5G B;  2OYH A;  3L73 E;  2LXB A;  4Z1M H;  1NYH A;  1L0N E;  1KC8 Q;  3D71 A;  4JF7 A;  3GHG C;  1SQV D;  3JCU H;  2PGD A;  2P7J A;  3BCC G;  1A02 J;  1VQ7 P;  1AFO A;  1S3J A;  1MFZ A;  1YJW P;  1QLE D;  2JWA A;  2ZYD A;  4L75 A;  1AA0 A;  1FZE A;  3L72 D;  1LP1 A;  5CJ4 A;  4BXL A;  5E79 H;  3CWB G;  1SQV E;  2IFN A;  1FZB A;  2N1T D;  3HTK B;  3VOP A;  2ZYG A;  3AE6 C;  2Q9I A;  3NTN A;  3L71 D;  2IBZ E;  2JJL A;  1JTH A;  1URQ D;  2Y0E A;  3TK1 A;  1SQP K;  3CX5 H;  1A02 F;  3CC4 P;  1KN7 A;  1NTK D;  1OW7 A;  3L73 G;  4GKG A;  4OH8 B;  3CCS P;  2O01 N;  1NU1 E;  4HH2 A;  1L0L E;  1IFP A;  1KYO D;  1OZH A;  2HR3 A;  2KIK A;  2O1J A;  3C1L A;  3H1H G;  1GK4 A;  3H6P A;  1Y47 A;  5AW1 B;  1SQV K;  1NTK E;  5APT A;  2H7H A;  1EDL A;  3V2R A;  2BEQ D;  2WPR A;  2Y9Y A;  1OVV A;  4U3F D;  3M9B A;  4C7R A;  3WUU A;  1URQ A;  2FXP A;  4N78 D;  3AE7 C;  5CCG C;  3H32 B;  2OGU A;  3KHU A;  1BE3 G;  1M1K Q;  4U3F G;  1FC2 C;  2WIT A;  1SVF A;  1SQB K;  2KS1 B;  2XDJ A;  1JY3 O;  1MUU A;  2WSC H;  2P67 A;  3H1K G;  4N78 E;  3LW5 H;  1N2D C;  3RK2 C;  1J1E B;  3N4X A;  4XA4 A;  3VYI A;  1ZRT D;  3H1J J;  3WU2 E;  4ZMD A;  1SQQ G;  1XTG B;  3VP9 A;  2FY8 A;  1NHL A;  1M56 D;  2IDB A;  3HE4 B;  3R2P A;  4AQR D;  2YIU C;  1T2K C;  3AE5 C;  2W6A A;  1LT1 A;  1KB9 I;  1JMM A;  1QX8 A;  2ZJS E;  4H13 B;  1LTB C;  4WY4 C;  4H0L B;  1JEK A;  3CCR P;  3CWB D;  1RQV A;  2IYO A;  2W8Z A;  3CX5 D;  4WB4 A;  5CCG D;  2NPS C;  4Y99 C;  2FXO A;  3H1J G;  2JWD A;  2B87 A;  3MD0 A;  5KLV J;  1M1J C;  4H44 D;  1SQQ E;  1X22 A;  2L91 A;  1W5C E;  3CX5 E;  4NPF X;  3RL0 B;  1BE3 D;  1T8Z A;  1S72 P;  1LTJ C;  2V4H A;  1PFI A;  3KZI H;  1RE3 A;  3KDP B;  5CCH A;  2AXT E;  1FBM A;  1LTJ A;  2FYZ A;  1ZOY C;  2IYP A;  3JSV C;  2XKM A;  1LT9 C;  1BE3 E;  5B66 E;  3RBX A;  4YPC A;  1WRG A;  1R5L A;  4LC1 A;  2N1T C;  1RHZ B;  3RL0 g;  3V6I A;  1LTG C;  1RE4 C;  2WSS H;  3GG2 A;  5H2F H;  1USD A;  1N73 C;  1EDJ A;  1VL2 A;  3R4Y A;  1PV3 A;  1BSH A;  4JBZ A;  3H1H E;  1YYC A;  4TLF A;  1N73 A;  5GTH H;  2Z4E A;  1G1I A;  4PJ0 E;  3MZW B;  3WU2 H;  5KLV E;  2QM7 A;  4HKZ H;  3P8C E;  2R32 A;  2AEF A;  1FDI A;  2OQQ A;  1AJY A;  2IBZ G;  2KLU A;  4WWI A;  3PHL A;  1FJP A;  3T97 B;  4DJG A;  2D2C C;  2QIW A;  3E1R A;  1SQV G;  1PPJ D;  3LID A;  1HUC A;  4HB1 A;  1H0T A;  3HUS C;  1YTZ T;  3EFF K;  5CJ0 A;  2OYH C;  1SS1 A;  1U57 A;  1LTT C;  1S5L H;  4EOT A;  3D6Y A;  3M06 A;  3L35 A;  3NMD A;  3G4S P;  2KSE A;  1KYO H;  3HUS A;  1KZU B;  3BCC E;  3V2N A;  1L0N G;  1KMI Z;  3GW6 A;  1HBW A;  1SQQ D;  1NOH A;  1LTI C;  3FWL A;  2WPS A;  3L70 G;  4QMA A;  3S1K A;  4ASV A;  1FDO A;  3AED C;  4PV1 D;  4R4L A;  3VTP C;  3V5B A;  3V2Q A;  1DIP A;  1OFC X;  3L74 E;  5C39 A;  1BCC J;  1ZR4 A;  1VQN P;  4LGD E;  1EC5 A;  3OJA B;  4K3A A;  4L73 A;  1GU4 A;  3CPW O;  1BCC E;  4GDO A;  3WUV A;  3HE5 A;  3CCE P;  3RK2 D;  2E76 B;  4KT0 J;  2V7Q H;  3H1H D;  2NZ2 A;  3PP5 A;  3Q5P A;  3H1I D;  2A06 G;  4R4M A;  2QJY C;  3PLN A;  5KLV D;  1SQB E;  1BDD A;  1YI2 P;  5AVQ B;  5KLV K;  1VF5 B;  2OYI A;  5KJ7 A;  1OXZ A;  1P84 I;  3FWN A;  1IO4 A;  2BAS A;  1JO5 A;  4I7Z B;  5TIS H;  1IK7 A;  1IFI A;  3L36 A;  5TJH A;  1FE6 A;  1ZW0 A;  3QWO C;  2BCC D;  3W68 A;  1E5W A;  3ZDM A;  4B86 A;  4DCK A;  1H8A A;  1FZG A;  2JKV A;  1SQX E;  1KIL A;  1SP4 A;  3CCM P;  1EXJ A;  1LTS C;  1W2E A;  2KUB A;  2N9Y B;  1MZ9 A;  1XTC C;  3L72 G;  4JYC A;  4N3Y B;  2IFM A;  3CCV P;  3H1L D;  1RQU A;  4NPD A;  5APW A;  4RKU J;  5APU A;  4IL6 E;  4PD4 E;  3GMA A;  4KJM A;  3TSI A;  2OTJ P;  2WWW A;  1SQB J;  1AQT A;  1VDF A;  2B87 B;  2W90 A;  1PGP A;  2O01 H;  2OAR A;  3LW5 J;  3VMX A;  2QRX A;  4GT1 A;  3L74 G;  3VMZ A;  1NO4 A;  1Q7Y Q;  2FXM A;  1M1J A;  3G3Z A;  2QM8 A;  5B5E H;  1PP9 E;  1SQV J;  1VPC A;  4I6M C;  5B5E E;  5AW5 B;  3CC7 P;  2E5T A;  4JQ0 D;  1PGJ A;  1OWA A;  1U7J A;  1VQL P;  4ZNC A;  2W6B A;  2C9N Y;  3SWY A;  1PP9 D;  2QEX P;  1NKZ B;  3L70 J;  1N7S B;  3H1I E;  1SQP J;  4AYC A;  3GLM A;  1PL5 A;  3F89 A;  4H0L C;  4D6T D;  3CI9 A;  3GF7 A;  3ABV C;  1RE4 A;  2BCC G;  3WMM 0;  2O3J A;  1RY3 A;  3RGU A;  4IL6 X;  1KV4 A;  4N6J A;  1EZV E;  3K5B A;  1S4X A;  2LKM A;  1N7S D;  4XE5 B;  1SFC B;  2KZI A;  3FXE A;  4YXW H;  1SQX D;  1GL2 B;  1PPJ G;  3B71 A;  1CSB A;  3N7N A;  3CCJ P;  1HJB A;  3H1I G;  2JEE A;  3S4R A;  2HYN A;  2Q5U A;  2YXR B;  3C9I A;  3TNU A;  1VQO P;  3A3Y B;  1IFN A;  2Y9Z A;  1YIJ P;  5AVV B;  1GZL A;  2KS1 A;  1L4A C;  3EWK A;  1DX7 A;  2AEM A;  3BAS A;  1PP9 G;  4ZKP A;  2M5A A;  3P32 A;  1L4A A;  3TGU J;  3H1H J;  1DH3 A;  2OYI C;  3L71 J;  1EQ7 A;  2FYN B;  2YNY A;  5DJU B;  1LGH B;  1GD2 E;  3GHG A;  3L73 D;  5AW8 B;  3RK3 D;  1HGZ A;  1R8E A;  3PRJ A;  2WT7 A;  3B4S A;  4GOF A;  2Q1K A;  2D2C D;  2KB7 P;  4BRY B;  3D6Z A;  1OIP A;  1BDC A;  3CCQ P;  2CPS A;  3L72 E;  1K05 A;  1WMK A;  2PRR A;  2XNX A;  4HJG H;  1BSN A;  1NVO A;  1ZV8 A;  3HE5 B;  4K35 A;  1OVR A;  1FU1 A;  4EDF A;  2E5Y A;  3Q2Y A;  3UIA A;  1JY2 P;  5AW0 B;  1MKM A;  3SFE C;  1UII A;  5AW2 B;  3B5N C;  1X79 B;  2IBZ D;  1HJ0 A;  3S9O A;  2ZAE B;  2ITA A;  2JP3 A;  1J1D C;  3EQ2 A;  3A5T A;  1D7M A;  1SQB G;  3AEG C;  1NJI Q;  2W83 C;  1RF1 A;  2A06 E;  1KYO E;  3CLQ A;  2YXQ B;  1USE A;  3SWK A;  2NPS D;  1L4A D;  2N1T B;  3HD7 B;  3L73 J;  4OWF A;  3KQG A;  1Y8A A;  2PP6 A;  2FYN C;  3OAK A;  4WY4 D;  1OX3 A;  5CMZ A;  2A06 D;  2OTK E;  2XND H;  4C7N B;  3H1K D;  1KIL C;  1EDK A;  1NAY A;  3V4Q A;  2AEJ A;  1X8Y A;  1QL1 A;  1DD4 A;  1JB0 J;  4UB6 H;  1TU3 F;  3A0B H;  1M57 D;  1E79 H;  3G9R A;  1NTM D;  2VRS A;  2ZXX A;  4JYB A;  4W7Z A;  2YO3 A;  1L0L G;  3T97 A;  2NRG A;  3L70 E;  1YTZ I;  1HF9 A;  1T6A A;  1ZRT E;  5GTH E;  2D2C B;  3CXH D;  1NTM E;  1G2C B;  1NTZ E;  3KYQ A;  2FFD A;  2E75 C;  5AVT B;  3D70 A;  1Q90 D;  2UWJ E;  5AW7 B;  1JOC A;  2KNC A;  2B88 A;  1K04 A;  2QJK B;  3CWB E;  4IOI H;  1YIT P;  2FYU K;  3GF3 A;  2HLO A;  5AVZ B;  1HWT C;  1KQL A;  1N86 A;  2W27 A;  3U59 A;  1JM0 A;  3IN6 A;  3HE4 A;  3BRV B;  3MP7 B;  3TGU D;  2FBW C;  2XV5 A;  1GL2 C;  1RE3 C;  4I2L C;  2Z5I A;  1VQM P;  3BCC J;  3CXH I;  1BGY D;  4IFF A;  1QL2 A;  5AW6 B;  3JC2 2;  3VMY A;  5KLI B;  1N8R Q;  2GA1 A;  3G71 P;  2SPZ A;  1H89 A;  1NH4 A;  1L0N J;  4IL6 H;  4NPE A;  4PD4 H;  2IX7 C;  4UB8 E;  1GMJ A;  1KB9 E;  2P58 A;  3E7K A;  3MUD A;  3GHG B;  1DEE G;  4ZKU A;  3A2A A;  3IAO A;  1AQ5 A;  1URQ B;  2V7Q J;  1J2J B;  4HYT B;  4IFD K;  1LWU A;  1NTK J;  2QSI A;  2WSE H;  1L0L K;  2ZVN B;  3MUD C;  1K9M Q;  4UB6 E;  5KJ7 D;  2QJY B;  3M0A A;  1KB9 D;  1LWU C;  1NU1 J;  2YO2 A;  1QEX A;  4C7N A;  4XFJ A;  2RH0 A;  2M5A B;  3O6Q B;  4A7P A;  1SQX K;  1RF0 A;  4U3F J;  2OYI B;  1U7M A;  3A7O A;  3RK3 C;  3CWB J;  3A0H H;  2M3B A;  1OW6 A;  3TGU G;  1NTZ D;  1CW5 A;  2LXC B;  3H1J E;  4U7J A;  3Q3D A;  1VQ5 P;  1BGY J;  4TT3 H;  1RH5 B;  2RKL A;  1NTM J;  1L2P A;  2NPS A;  3I56 P;  1YJ9 P;  2J5U A;  2HPC A;  1LTA C;  3H1J D;  4DZO A;  3BCC D;  2P2U A;  2FYU E;  3II6 A;  1FZA A;  3L37 A;  2R44 A;  5AVS B;  3V4W A;  3L71 E;  3H1I J;  1VQ6 P;  2W6J H;  1CZQ A;  2MJZ A;  2Q3E A;  5AVX B;  2WVR A;  4I1L A;  5APS A;  5AVR B;  2O1K A;  1NU1 D;  1BGY E;  1LT9 A;  2AXC A;  2KZJ A;  2M3E A;  4PV1 C;  4RES B;  1JUN A;  1NTZ G;  3CL3 D;  1NTM G;  1N7S C;  2Y0C A;  1H88 A;  3M9H A;  1DD3 A;  1ZN5 A;  3H1L J;  2K1A A; 
#chains in the Genus database with same CATH homology
 3JCU E;  5KAI E;  3KZI E;  5B5E E;  5TIS E;  1W5C E;  5GTI E;  5KAF E;  1S5L E;  2AXT E;  3A0H E;  5E79 E;  4UB8 E;  5B66 E;  5H2F E;  3WU2 E;  5GTH E;  3A0B E;  4UB6 E;  4IL6 E;  4PJ0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...