3A0BE

Crystal structure of br-substituted photosystem ii complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 16
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3a0bE00
5TISE 5H2FE 3A0BE 3KZIE 5GTIE 5B66E 5GTHE 5B5EE 4PJ0E 3JCUE 4IL6E 5E79E 1W5CE 2AXTE 3WU2E 1S5LE 5KAFE 3A0HE 4UB8E 5KAIE 4UB6E
chains in the Genus database with same CATH superfamily
3CX5E 3C8VA 3I5CA 2M3BA 1SQXE 4PD4D 2FFDC 4JQ0D 2O01J 2YIUB 4EDFA 4MN4C 2QJPC 1OVVA 3GG2A 2I1JA 1YJWP 5AW5B 2E42A 3VMYA 3BVHA 2R3CA 1FOSE 4IFFA 1IO4A 2M3EA 1YITP 3M9QA 1SQBD 1ZLLA 2LXCB 2ZT9C 3HE4B 1VQLP 1CZQA 3HD7A 2FYUG 2YNYA 2R44A 1EZVD 1VF5D 2FY8A 2WSFJ 3CCSP 5GTIE 3LW5J 1IJDB 4PJ0E 4K3AA 1Q7YQ 4L73A 5CJ0A 3E7KA 3AE3C 2L5GB 2Q3EA 3H1LD 1P84H 2H8PD 2E76D 1LJ2A 2YIUC 1VQ7P 1SQPK 2Q6QA 1BGYG 1NTMK 3VMZA 1LTAC 1MFZA 4D6TD 1S5LH 1OFCX 2G8YA 4L75A 1BSHA 3AEBC 4ASVA 1SQVG 3H1ID 1SFCB 5B5EH 3CC4P 2C9LY 3VMXA 3G9RA 1YYCA 4YXWH 2YMYA 1YHQP 5KLVJ 1T6AA 1LWUB 1L0NK 2GUSA 2AXCA 2WT7B 2D2CD 2ZT9D 1KB9D 2Y0EA 1W2EA 2HODA 4EI2A 3AEFC 3L70E 3MHVA 1QGKB 1NTKD 1NTZD 3B5NB 2IFMA 3P32A 3L71G 2NRGA 4WB4A 3GHGC 2J58A 4LLHA 2QVAA 1SLQA 1MFTA 1M90Q 3M06A 2FXOA 4YTPC 4A7PA 3BCCE 4WY4C 3Q5PA 3GLMA 1L0LK 5CJ4A 4EOTA 2OTKE 3TNUB 2QJKC 3HE5A 1SFCC 1L4AA 3PLNA 1KYOH 4HJGH 1DH3A 1JY2O 2GUVA 2WSEJ 2WZ7A 3CLQA 4ASWA 3AEGC 3L74E 3CXHH 3Q2YA 3GMAA 2OTJP 3V4QA 1GL2B 3HUSA 2N1TC 4HYTB 1EDIA 3SWFA 3BRVB 4GDOA 1DEBA 2IZ0A 5APVA 1Q82Q 4PD4E 1S5LX 3VOPA 2KI7B 1M8OB 3MTUE 3MD0A 2JKVA 1VQ5P 2PRRA 3B8EB 1IFDA 3CCUP 3CCJP 3BCCG 1Y47A 2KUBA 1J2JB 4EIJA 4DJGA 1AQTA 4XFJA 5TJHA 1SQBE 1KQSO 2C9NY 3H32A 3EFFK 1HUCA 1H0TA 5AW1B 1JM0A 1EZVE 3AE8C 1FJKA 1IK9A 5CBNA 3GF3A 4H0LC 1J1EC 1SFCD 1M1JA 2KLUA 2OARA 5KLIB 3K5BA 3VTPC 1FE6A 3KZIE 3ZDMA 1CW5A 5KLVD 3SFEC 2K88A 2KS1A 2A06D 2P67A 2M5AA 1KFMA 2VRSA 1ZR4A 1EXJA 2FXPA 3H1LE 2QEXP 1HBWA 3VN0A 1OW8A 5TISE 2E74C 2N1TD 3B5ND 1FZFA 2BASA 3OA7A 1K04A 1FBMA 4DZOA 5KJ7C 4KT0J 1T2KC 3H1IE 1SQBG 1LT9A 3CWBJ 1G2CB 4I2LC 2FYUD 1EZVG 1LTGC 1GTWA 2BCCG 1KB9E 5AVUB 3V4WA 4AQRD 4W7YA 4N3YB 1LTTC 1PGPA 1NTKE 1NTZE 4AYCA 1KILB 2PP6A 5H2FE 2K9JB 1FOSF 1PPJG 3H1LG 3CX5I 1BE3G 2GA1A 2WSCH 4Y99C 1G1IA 4GKGA 3H6PA 1N7SC 2JWDA 3G6EP 2QJYC 4D6TG 2UWJE 2WITA 2QE7H 3A3YB 1IC2A 3H1JG 1FC2C 2IX7C 4C46A 1N86A 4WWIA 1URQB 3CC7P 1SQPJ 1NTMJ 1EDJA 3GHGA 1SS1A 2N9BA 4HKZH 1N73B 3KYQA 3JCUH 2Y9YA 2OQQA 1JO5A 3O6QA 3IR9A 1VDFA 5DJTB 1SQQK 3OJAB 3M9BA 1KILC 3F5HA 1NHLA 5APXA 3FXDA 3L71D 5APWA 1NU1K 2XNXA 5AVYB 1YTZI 5CBOA 1L0NJ 1P84D 4W7ZA 4C7NA 3HE5B 1TU3F 2A45H 3JC22 1EC5A 1E5WA 2WQYC 4UB6H 1RF0A 1LTBC 1OMIA 1S2EA 1FZCA 1URQC 1DEEG 1MZ9A 3MGNA 3WMM0 1ZN5A 2E75C 1OX3A 4B86A 3CWBD 1LTJC 2O01N 2K3RA 3L72G 3P7KA 1L0LJ 5APYA 2W8ZA 1SQXK 5KLVE 1IFJA 1GW4A 1S3JA 2A06E 1PGJA 3M0DC 2HG5D 5CCGA 2RMZA 3CL3D 3H1JJ 3AE6C 1SVFA 1M1KQ 1KILD 1YQ3C 1H89A 1VPCA 3H32B 2H89C 1RF1C 3WUUA 1FAVA 1M57D 2CPBA 5E79E 1QLED 3LIEA 2OYIC 3C1LA 1WT6A 5KKZC 1M1JB 4UB8E 5KAIE 2FYUE 1FDOA 3FWNA 5E79H 1X0TA 1Y9BA 1URQD 1X9VA 1SQPD 3CMAP 1NTMD 2FYNB 5EFWB 3B71A 4QMAA 2QM7A 1CI6A 4L74A 3CXHD 2E5YA 3H1KJ 3PH0A 5KLVG 3CPWO 1LT1A 1KQGB 3ABVC 5KJ7A 2A06G 2WSCJ 4L76A 4JPZB 2ZYAA 3BASA 2BEQD 3WU2H 1BGYE 3U1CA 4H13C 4PD4I 1VQOP 4OH8B 2MJZA 2R3SA 2KXPB 2KSEA 5AVRB 3CX5H 3RK3B 1L0ND 1SQVE 3USSA 3CCVP 3G71P 3TSIA 2D2CC 2ZVOB 2JEEA 3L72J 4BWNA 3T97A 1Q90D 1IK7A 3HRNA 3IF4A 2OYHB 1QVFO 4ZKPA 1NU1G 1N2DC 1EZVI 2BCCD 2IBZG 3FXEA 3AE9C 2FYNC 2PFXA 3MP7B 5AVZB 1DX7A 3E1IA 2QRXA 2WVRA 3Q1MA 3TGUG 3L73J 4OWFA 3L71E 3NTNA 1JTHA 1PPJD 1L0LD 3V2QA 5GTIH 1BE3D 4PJ0H 5AVVB 2LR2A 3CI9A 2XNDH 2LKMA 3E1RA 2GM4A 2NPSB 3RK3C 1RE3C 1JEKA 2CK3H 3H1JD 3M9HA 2B87A 3MUDA 4GIFA 2QSIA 1NOHA 4H13D 2XV5A 2WSSH 4LC1A 2OYHC 3CWBE 3NFQA 1J1DB 4JBZA 1VQPP 3HTKB 1KB9I 1GD2E 4NPEA 2KOGA 4GOEA 2JP3A 5BVZA 4WBAA 3IFMA 2C0WA 2Y0CA 3VYIA 1RE4C 2KNCA 2P10A 3H1KD 1KILE 2NPSC 3N4XA 2ZJSE 2Z5HA 5GTHE 4IFDK 1FDIA 1VQ4P 1NU1J 5KTBA 2HYNA 3I55P 3RK3D 3PHLA 1RY3A 1YI2P 1LWUC 1J1DC 3TGUJ 2YKQA 4GODA 3CWBG 3CCRP 5APUA 3L72D 1SQPE 2R32A 1N7LA 4HB1A 4GT1A 1JUNA 3B5NC 3N7NA 2JJLA 2M0BA 3D6YA 1U7JA 1S4XA 2OYIA 3L75J 2YKOA 3EQ2A 3TF5A 3C9IA 3AE7C 1SQXJ 4AUWA 2M8RA 1L0NE 1S9KD 2ZFCA 4PD4H 4BRYB 2HPCA 3Q5RA 3AE2C 1RQVA 2IPPA 2NPSD 1NAYA 2P7JA 2OTLP 1NTZK 1RH5B 1PGQA 1CI6B 5KAFE 2BCCE 2Y9ZA 2FFDA 3UIAA 4O9BA 1GL2C 3R2PA 2WPQA 1SQPG 1NTMG 2FBWC 1JY3P 3MIWA 1G1JA 1M56D 1PPJE 1L0LE 2B89A 5APQA 1BE3E 1QL2A 3KZIH 3CCLP 4HH2A 1NKZB 3RK2B 4D6TE 1AV1A 3H1JE 4IL6E 3LIDA 1D7MA 2XKMA 1VL2A 1W2BO 3HD7B 1W5CE 1CSBA 1L0NG 3AECC 1EDLA 5TISH 1LGHB 3D71A 1UIXA 5CCHD 1N8RQ 4IFMA 5CMZA 3RBZA 3A7OA 1HGVA 1YTZT 1VQ9P 1NU1D 1GU4A 2O3JA 2W27A 4DT0A 2AXTE 2IBZD 2KK7A 5KLIC 3CCEP 1K9MQ 3V2PA 2PAJA 2CPSA 1PP9G 1RE3A 4R4LA 2HFED 3TGUD 5B66E 3P8CD 1YJ9P 3H1HG 1L0LG 1KB9H 3HE4A 3S1KA 3KDPB 2Q7CA 1ZR2A 1GL2D 2RH0A 3H1KE 1NWQA 3PRJA 3PJSK 2B87B 5H2FH 3SFDC 3CC2P 1VQNP 4DCKA 2KB7P 2Q5UA 1PFIA 4YPCA 3ITKA 3L75D 2IYOA 4Z1MH 1JCCA 2YXRB 1NKNA 1VQKP 1SQXD 5CHXA 5AW3B 2ZVNB 2L91A 3RK3E 3KHUA 2HODB 2LXBA 4JYBA 2N9YB 2B88A 1FDMA 3A0BE 3L72E 2Y0DA 2E43A 4KHXA 1K8AQ 4WY4A 2HLOA 5AVTB 3L74J 2V7QH 2JDIH 1JOCA 1OZHA 3RL0B 3A0HE 1GZLA 1SFCA 1BDDA 1KTMA 1JY3N 2XU6A 1H8AA 2AEFA 3H1KG 2WSFH 1P84I 4ZNCA 2KZJA 2IFNA 1L4AB 1OWAA 2FYUK 4PV1B 2KZIA 2WT7A 2JWAA 1EDKA 4C7RA 3VP9A 4NPFX 1A02J 3EWKA 2N1TA 3B5NA 3RK2D 1ZW0A 1FJPA 2I8DA 2H7HA 5AVSB 1PP9J 3HD7D 3V5BA 3HUSB 1N73C 1S72P 4N6JA 2Q9IA 1VF5B 3H1HJ 1LTIC 5C39A 1T3JA 1NAFA 1KV4A 1ZRTD 2IDBA 3EFGA 3TNUA 3RL0C 1MKMA 2XDJA 5AVXB 3V2RA 1YQ4C 2ZAEB 4RKUJ 2W90A 1OW6A 1SQVK 2R5DA 1ZV8A 1LNQA 4WVZA 3L73G 1L4AC 1PIXA 4JYCA 1KZUB 1KQFB 2K1AA 1H0TB 3RGUA 2A45G 1AA0A 1E79H 2WTYA 5BU8B 1NJIQ 1BCCJ 1OW7A 3H1IJ 1KYOD 2G3AA 3PP5A 3HUSC 1T3UA 1NU1E 3AE1C 3FWLA 2W6AA 2IBZE 2OGUA 2KS1B 1MUUA 3CCMP 2M5AB 4U3FG 4UB8H 3TK1A 5KAIH 1SP4A 4I1LA 2POHA 3TGUE 3CXHI 4R4MA 5APSA 1EQ7A 3P8CE 1K05A 2YKPA 2H88C 1ZOYC 3L74D 3BATA 5K5GB 3RL0g 3AEDC 4I7ZB 1LT9B 1KC8Q 3RL0D 5M1BA 3L75E 2Z4EA 1R5LA 2BEZF 2HR3A 3B4SA 1SQQG 1M1JC 1L4AD 3OAKA 4PV1D 3AEAC 1YIJP 1IFNA 3AEEC 3QH9A 2W6JH 2V7QJ 1LP1A 3G4SP 1N7SA 4KJMA 1AVYA 1PP9D 1XTGB 1U57A 1HWTC 3S4RA 2RKLA 1GK4A 1HGZA 2YO3A 3NXSA 2OYOA 3H1HD 1FZEA 1G2CA 1KFNA 4NPDA 3VMAA 3P8MC 1P84E 1AFOA 3TYYA 4I7ZC 1LT9C 1JB0J 1EXIA 2SPZA 3KQGA 3L75G 1S5LE 1QVGO 3GHGB 4OGQB 1RQUA 4RO0A 1KILA 4JF7A 1DIPA 1SQXG 2K9JA 3U59A 4M3LA 4U3FJ 3WUTA 5B5EE 3O6QB 3JSVC 4WY4B 1NO4A 2O1KA 4H44B 3OW2O 1BCCD 1KN7A 2QJKB 1USEA 1GU5A 1S1CX 1ZRTE 3W67A 3H25A 4C7NB 2P1JA 1JY3O 3A5TA 1URQA 3I56P 1ZMEC 2R5BA 3SSUA 1VQ6P 3RBXA 1SQBK 1Q86Q 3L36A 1FZCB 1N73A 5AW0B 2N1TB 2IZ1A 1SQQJ 3V2NA 1LTJA 1OXZA 2KLVA 4RJTA 4OGQC 2J59M 1K73Q 1PZQA 1KYOE 3M0DA 3R4YA 5GTHH 2QA4P 2QIWA 4U7JA 3IN6A 5AVWB 1VQMP 2FYUJ 4H44C 3VP8A 1PL5A 1NTME 2YMKA 2J5UA 5APTA 2AEMA 3CXHE 4GOFA 1RF1A 1NYHA 1Q81Q 1OVUA 2XZRA 2ZXXA 2E5TA 4BXLA 4H0LB 2I1KA 1J1EB 1JCDA 1RF0C 5CCHC 3L73D 1FZCC 3CMEP 1QEXA 3IAOA 3L70G 1BGYJ 3U1AA 1KMIZ 3G3ZA 2MKVA 1OVRA 2Q1KA 2A45I 3BRTB 1FZBA 2JO1A 2ZXEB 1XTCC 2C0XA 4CPGA 1SQVJ 2E74B 1AQ5A 2PGDA 1NTKK 3GW6A 2QM8A 4OGQD 2WWWA 3Q5SA 4U3FD 5CCGC 2B9BA 2FYZA 1PP9E 1T8ZA 5L8RJ 1QL1A 2KP8A 4WY4D 5KAFH 3H1HE 3M0AA 4H44D 1R8EA 3L71J 3L74G 1GK6A 3AE4C 1NGMB 3QWOC 1Z56A 1Y8AA 3T97B 1Q2NA 4N78D 1BSNA 1GW3A 4Y99B 1SQQD 4LGDE 4I6MC 1LP1B 4IL6H 3L35A 2K9YA 1N7SB 1QX8A 2QJYB 5AW8B 2ZYGA 2KIKA 1FS0E 1JY2P 1BCCE 4K35A 1JTHB 2IBZI 1KQLA 1NVOA 5AW2B 1UIIA 2WPVB 2AXTH 1AJYA 1ZP0C 3L70J 2H43A 2DW3A 1U7MA 3M91A 1JMBA 2O1JA 5CCGD 5AVQB 2OYHA 3RK2C 2IYPA 2V4HA 1DD4A 5B66H 3W68A 3HD7C 1YJNP 2QG4A 1JNMA 2W6BA 1X79B 3SWYA 5BU5A 2RN0A 4H0LD 2AEJA 3CX5D 3BCCJ 2FXMA 1JMMA 1X8YA 2WMMA 1BGYD 3KPEA 1WMKA 2KSJA 1H88A 5AW9B 4OVNF 5KLVK 3D70A 2O01H 3FX0A 1RE4A 1OIPA 1L2PA 1SQVD 2K37A 1BCCG 2NPSA 3TDKA 1GMJA 3JCUE 1BDCA 3H1IG 3L37A 2E74D 1AVOA 1LTSC 2KNCB 1GDTA 1RHZB 2E75B 3A0BH 3AE5C 1KORA 5KJ7D 1MV8A 3SWKA 1LTJB 1FZAA 1T2KD 3L73E 3MUDC 1LWUA 1DD3A 1NTKG 1NTZG 3A0HH 3LW5H 3MZWB 3L4FA 3II6A 1S9KE 3HTKA 5AW4B 4IL6X 3CCQP 4UB6E 2Z5IA 1SQBJ 2FKWB 2NZ2A 1IFMA 1FZGA 4IOIH 3A2AA 2KYVA 2JR8A 4RESB 1RF1B 4U3FE 5CCHA 3FGAD 4ZMDA 4TLFA 2BCCJ 2OYIB 1N7SD 5KKZB 4ZKUA 1HVVA 1JY2N 1IZNB 1R5SA 5DJUB 3GF7A 2P2UA 4EYYQ 3CD6P 1HJ0A 4XE5B 2E76B 2HPCB 3H1LJ 4W80A 1BE3J 4YXDC 3Q3DA 1HJBA 3L70D 4PV1C 5AW7B 1YBKA 4XA4A 4D6TJ 4N78E 1GL2A 1IFPA 1HTLC 1SQQE 2WPSA 1PV3A 4Y28J 2FFDB 4H13B 3V6IA 2QJPB 3F89A 1KYOI 1X22A 3BCCD 2ZYDA 1WRGA 2YO2A 2YXQB 3KXDA 1VF5C 1NH4A 2D2CB 1M7LA 2ZT9B 4DOJA 1ZXGA 2P58A 3WUVA 1FU1A 4BRYA 2W83C 5AW6B 1IFIA 1PGOA 1USDA 1VQ8P 3O8ZA 2WSEH 4TT3H 1NTKJ 1NTZJ 1KD1Q 3S9OA 3NMDA 2Q3IA 2E76C 1HH0A 2ITAA 3PTZA 1HF9A 3WU2E 3D6ZA 2WPRA 2E75D 1A02F
chains in the Genus database with same CATH topology
5TISE 5H2FE 3A0BE 3KZIE 5GTIE 5B66E 5GTHE 5B5EE 4PJ0E 3JCUE 4IL6E 5E79E 1W5CE 2AXTE 3WU2E 1S5LE 5KAFE 3A0HE 4UB8E 5KAIE 4UB6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS E;  5H2F E;  3A0B E;  3KZI E;  5GTI E;  5B66 E;  5GTH E;  5B5E E;  4PJ0 E;  3JCU E;  4IL6 E;  5E79 E;  1W5C E;  2AXT E;  3WU2 E;  1S5L E;  5KAF E;  3A0H E;  4UB8 E;  5KAI E;  4UB6 E; 
#chains in the Genus database with same CATH topology
 3CX5 E;  3C8V A;  3I5C A;  2M3B A;  1SQX E;  4PD4 D;  2FFD C;  4JQ0 D;  2O01 J;  2YIU B;  4EDF A;  4MN4 C;  2QJP C;  1OVV A;  3GG2 A;  2I1J A;  1YJW P;  5AW5 B;  2E42 A;  3VMY A;  3BVH A;  2R3C A;  1FOS E;  4IFF A;  1IO4 A;  2M3E A;  1YIT P;  3M9Q A;  1SQB D;  1ZLL A;  2LXC B;  2ZT9 C;  3HE4 B;  1VQL P;  1CZQ A;  3HD7 A;  2FYU G;  2YNY A;  2R44 A;  1EZV D;  1VF5 D;  2FY8 A;  2WSF J;  3CCS P;  5GTI E;  3LW5 J;  1IJD B;  4PJ0 E;  4K3A A;  1Q7Y Q;  4L73 A;  5CJ0 A;  3E7K A;  3AE3 C;  2L5G B;  2Q3E A;  3H1L D;  1P84 H;  2H8P D;  2E76 D;  1LJ2 A;  2YIU C;  1VQ7 P;  1SQP K;  2Q6Q A;  1BGY G;  1NTM K;  3VMZ A;  1LTA C;  1MFZ A;  4D6T D;  1S5L H;  1OFC X;  2G8Y A;  4L75 A;  1BSH A;  3AEB C;  4ASV A;  1SQV G;  3H1I D;  1SFC B;  5B5E H;  3CC4 P;  2C9L Y;  3VMX A;  3G9R A;  1YYC A;  4YXW H;  2YMY A;  1YHQ P;  5KLV J;  1T6A A;  1LWU B;  1L0N K;  2GUS A;  2AXC A;  2WT7 B;  2D2C D;  2ZT9 D;  1KB9 D;  2Y0E A;  1W2E A;  2HOD A;  4EI2 A;  3AEF C;  3L70 E;  3MHV A;  1QGK B;  1NTK D;  1NTZ D;  3B5N B;  2IFM A;  3P32 A;  3L71 G;  2NRG A;  4WB4 A;  3GHG C;  2J58 A;  4LLH A;  2QVA A;  1SLQ A;  1MFT A;  1M90 Q;  3M06 A;  2FXO A;  4YTP C;  4A7P A;  3BCC E;  4WY4 C;  3Q5P A;  3GLM A;  1L0L K;  5CJ4 A;  4EOT A;  2OTK E;  3TNU B;  2QJK C;  3HE5 A;  1SFC C;  1L4A A;  3PLN A;  1KYO H;  4HJG H;  1DH3 A;  1JY2 O;  2GUV A;  2WSE J;  2WZ7 A;  3CLQ A;  4ASW A;  3AEG C;  3L74 E;  3CXH H;  3Q2Y A;  3GMA A;  2OTJ P;  3V4Q A;  1GL2 B;  3HUS A;  2N1T C;  4HYT B;  1EDI A;  3SWF A;  3BRV B;  4GDO A;  1DEB A;  2IZ0 A;  5APV A;  1Q82 Q;  4PD4 E;  1S5L X;  3VOP A;  2KI7 B;  1M8O B;  3MTU E;  3MD0 A;  2JKV A;  1VQ5 P;  2PRR A;  3B8E B;  1IFD A;  3CCU P;  3CCJ P;  3BCC G;  1Y47 A;  2KUB A;  1J2J B;  4EIJ A;  4DJG A;  1AQT A;  4XFJ A;  5TJH A;  1SQB E;  1KQS O;  2C9N Y;  3H32 A;  3EFF K;  1HUC A;  1H0T A;  5AW1 B;  1JM0 A;  1EZV E;  3AE8 C;  1FJK A;  1IK9 A;  5CBN A;  3GF3 A;  4H0L C;  1J1E C;  1SFC D;  1M1J A;  2KLU A;  2OAR A;  5KLI B;  3K5B A;  3VTP C;  1FE6 A;  3KZI E;  3ZDM A;  1CW5 A;  5KLV D;  3SFE C;  2K88 A;  2KS1 A;  2A06 D;  2P67 A;  2M5A A;  1KFM A;  2VRS A;  1ZR4 A;  1EXJ A;  2FXP A;  3H1L E;  2QEX P;  1HBW A;  3VN0 A;  1OW8 A;  5TIS E;  2E74 C;  2N1T D;  3B5N D;  1FZF A;  2BAS A;  3OA7 A;  1K04 A;  1FBM A;  4DZO A;  5KJ7 C;  4KT0 J;  1T2K C;  3H1I E;  1SQB G;  1LT9 A;  3CWB J;  1G2C B;  4I2L C;  2FYU D;  1EZV G;  1LTG C;  1GTW A;  2BCC G;  1KB9 E;  5AVU B;  3V4W A;  4AQR D;  4W7Y A;  4N3Y B;  1LTT C;  1PGP A;  1NTK E;  1NTZ E;  4AYC A;  1KIL B;  2PP6 A;  5H2F E;  2K9J B;  1FOS F;  1PPJ G;  3H1L G;  3CX5 I;  1BE3 G;  2GA1 A;  2WSC H;  4Y99 C;  1G1I A;  4GKG A;  3H6P A;  1N7S C;  2JWD A;  3G6E P;  2QJY C;  4D6T G;  2UWJ E;  2WIT A;  2QE7 H;  3A3Y B;  1IC2 A;  3H1J G;  1FC2 C;  2IX7 C;  4C46 A;  1N86 A;  4WWI A;  1URQ B;  3CC7 P;  1SQP J;  1NTM J;  1EDJ A;  3GHG A;  1SS1 A;  2N9B A;  4HKZ H;  1N73 B;  3KYQ A;  3JCU H;  2Y9Y A;  2OQQ A;  1JO5 A;  3O6Q A;  3IR9 A;  1VDF A;  5DJT B;  1SQQ K;  3OJA B;  3M9B A;  1KIL C;  3F5H A;  1NHL A;  5APX A;  3FXD A;  3L71 D;  5APW A;  1NU1 K;  2XNX A;  5AVY B;  1YTZ I;  5CBO A;  1L0N J;  1P84 D;  4W7Z A;  4C7N A;  3HE5 B;  1TU3 F;  2A45 H;  3JC2 2;  1EC5 A;  1E5W A;  2WQY C;  4UB6 H;  1RF0 A;  1LTB C;  1OMI A;  1S2E A;  1FZC A;  1URQ C;  1DEE G;  1MZ9 A;  3MGN A;  3WMM 0;  1ZN5 A;  2E75 C;  1OX3 A;  4B86 A;  3CWB D;  1LTJ C;  2O01 N;  2K3R A;  3L72 G;  3P7K A;  1L0L J;  5APY A;  2W8Z A;  1SQX K;  5KLV E;  1IFJ A;  1GW4 A;  1S3J A;  2A06 E;  1PGJ A;  3M0D C;  2HG5 D;  5CCG A;  2RMZ A;  3CL3 D;  3H1J J;  3AE6 C;  1SVF A;  1M1K Q;  1KIL D;  1YQ3 C;  1H89 A;  1VPC A;  3H32 B;  2H89 C;  1RF1 C;  3WUU A;  1FAV A;  1M57 D;  2CPB A;  5E79 E;  1QLE D;  3LIE A;  2OYI C;  3C1L A;  1WT6 A;  5KKZ C;  1M1J B;  4UB8 E;  5KAI E;  2FYU E;  1FDO A;  3FWN A;  5E79 H;  1X0T A;  1Y9B A;  1URQ D;  1X9V A;  1SQP D;  3CMA P;  1NTM D;  2FYN B;  5EFW B;  3B71 A;  4QMA A;  2QM7 A;  1CI6 A;  4L74 A;  3CXH D;  2E5Y A;  3H1K J;  3PH0 A;  5KLV G;  3CPW O;  1LT1 A;  1KQG B;  3ABV C;  5KJ7 A;  2A06 G;  2WSC J;  4L76 A;  4JPZ B;  2ZYA A;  3BAS A;  2BEQ D;  3WU2 H;  1BGY E;  3U1C A;  4H13 C;  4PD4 I;  1VQO P;  4OH8 B;  2MJZ A;  2R3S A;  2KXP B;  2KSE A;  5AVR B;  3CX5 H;  3RK3 B;  1L0N D;  1SQV E;  3USS A;  3CCV P;  3G71 P;  3TSI A;  2D2C C;  2ZVO B;  2JEE A;  3L72 J;  4BWN A;  3T97 A;  1Q90 D;  1IK7 A;  3HRN A;  3IF4 A;  2OYH B;  1QVF O;  4ZKP A;  1NU1 G;  1N2D C;  1EZV I;  2BCC D;  2IBZ G;  3FXE A;  3AE9 C;  2FYN C;  2PFX A;  3MP7 B;  5AVZ B;  1DX7 A;  3E1I A;  2QRX A;  2WVR A;  3Q1M A;  3TGU G;  3L73 J;  4OWF A;  3L71 E;  3NTN A;  1JTH A;  1PPJ D;  1L0L D;  3V2Q A;  5GTI H;  1BE3 D;  4PJ0 H;  5AVV B;  2LR2 A;  3CI9 A;  2XND H;  2LKM A;  3E1R A;  2GM4 A;  2NPS B;  3RK3 C;  1RE3 C;  1JEK A;  2CK3 H;  3H1J D;  3M9H A;  2B87 A;  3MUD A;  4GIF A;  2QSI A;  1NOH A;  4H13 D;  2XV5 A;  2WSS H;  4LC1 A;  2OYH C;  3CWB E;  3NFQ A;  1J1D B;  4JBZ A;  1VQP P;  3HTK B;  1KB9 I;  1GD2 E;  4NPE A;  2KOG A;  4GOE A;  2JP3 A;  5BVZ A;  4WBA A;  3IFM A;  2C0W A;  2Y0C A;  3VYI A;  1RE4 C;  2KNC A;  2P10 A;  3H1K D;  1KIL E;  2NPS C;  3N4X A;  2ZJS E;  2Z5H A;  5GTH E;  4IFD K;  1FDI A;  1VQ4 P;  1NU1 J;  5KTB A;  2HYN A;  3I55 P;  3RK3 D;  3PHL A;  1RY3 A;  1YI2 P;  1LWU C;  1J1D C;  3TGU J;  2YKQ A;  4GOD A;  3CWB G;  3CCR P;  5APU A;  3L72 D;  1SQP E;  2R32 A;  1N7L A;  4HB1 A;  4GT1 A;  1JUN A;  3B5N C;  3N7N A;  2JJL A;  2M0B A;  3D6Y A;  1U7J A;  1S4X A;  2OYI A;  3L75 J;  2YKO A;  3EQ2 A;  3TF5 A;  3C9I A;  3AE7 C;  1SQX J;  4AUW A;  2M8R A;  1L0N E;  1S9K D;  2ZFC A;  4PD4 H;  4BRY B;  2HPC A;  3Q5R A;  3AE2 C;  1RQV A;  2IPP A;  2NPS D;  1NAY A;  2P7J A;  2OTL P;  1NTZ K;  1RH5 B;  1PGQ A;  1CI6 B;  5KAF E;  2BCC E;  2Y9Z A;  2FFD A;  3UIA A;  4O9B A;  1GL2 C;  3R2P A;  2WPQ A;  1SQP G;  1NTM G;  2FBW C;  1JY3 P;  3MIW A;  1G1J A;  1M56 D;  1PPJ E;  1L0L E;  2B89 A;  5APQ A;  1BE3 E;  1QL2 A;  3KZI H;  3CCL P;  4HH2 A;  1NKZ B;  3RK2 B;  4D6T E;  1AV1 A;  3H1J E;  4IL6 E;  3LID A;  1D7M A;  2XKM A;  1VL2 A;  1W2B O;  3HD7 B;  1W5C E;  1CSB A;  1L0N G;  3AEC C;  1EDL A;  5TIS H;  1LGH B;  3D71 A;  1UIX A;  5CCH D;  1N8R Q;  4IFM A;  5CMZ A;  3RBZ A;  3A7O A;  1HGV A;  1YTZ T;  1VQ9 P;  1NU1 D;  1GU4 A;  2O3J A;  2W27 A;  4DT0 A;  2AXT E;  2IBZ D;  2KK7 A;  5KLI C;  3CCE P;  1K9M Q;  3V2P A;  2PAJ A;  2CPS A;  1PP9 G;  1RE3 A;  4R4L A;  2HFE D;  3TGU D;  5B66 E;  3P8C D;  1YJ9 P;  3H1H G;  1L0L G;  1KB9 H;  3HE4 A;  3S1K A;  3KDP B;  2Q7C A;  1ZR2 A;  1GL2 D;  2RH0 A;  3H1K E;  1NWQ A;  3PRJ A;  3PJS K;  2B87 B;  5H2F H;  3SFD C;  3CC2 P;  1VQN P;  4DCK A;  2KB7 P;  2Q5U A;  1PFI A;  4YPC A;  3ITK A;  3L75 D;  2IYO A;  4Z1M H;  1JCC A;  2YXR B;  1NKN A;  1VQK P;  1SQX D;  5CHX A;  5AW3 B;  2ZVN B;  2L91 A;  3RK3 E;  3KHU A;  2HOD B;  2LXB A;  4JYB A;  2N9Y B;  2B88 A;  1FDM A;  3A0B E;  3L72 E;  2Y0D A;  2E43 A;  4KHX A;  1K8A Q;  4WY4 A;  2HLO A;  5AVT B;  3L74 J;  2V7Q H;  2JDI H;  1JOC A;  1OZH A;  3RL0 B;  3A0H E;  1GZL A;  1SFC A;  1BDD A;  1KTM A;  1JY3 N;  2XU6 A;  1H8A A;  2AEF A;  3H1K G;  2WSF H;  1P84 I;  4ZNC A;  2KZJ A;  2IFN A;  1L4A B;  1OWA A;  2FYU K;  4PV1 B;  2KZI A;  2WT7 A;  2JWA A;  1EDK A;  4C7R A;  3VP9 A;  4NPF X;  1A02 J;  3EWK A;  2N1T A;  3B5N A;  3RK2 D;  1ZW0 A;  1FJP A;  2I8D A;  2H7H A;  5AVS B;  1PP9 J;  3HD7 D;  3V5B A;  3HUS B;  1N73 C;  1S72 P;  4N6J A;  2Q9I A;  1VF5 B;  3H1H J;  1LTI C;  5C39 A;  1T3J A;  1NAF A;  1KV4 A;  1ZRT D;  2IDB A;  3EFG A;  3TNU A;  3RL0 C;  1MKM A;  2XDJ A;  5AVX B;  3V2R A;  1YQ4 C;  2ZAE B;  4RKU J;  2W90 A;  1OW6 A;  1SQV K;  2R5D A;  1ZV8 A;  1LNQ A;  4WVZ A;  3L73 G;  1L4A C;  1PIX A;  4JYC A;  1KZU B;  1KQF B;  2K1A A;  1H0T B;  3RGU A;  2A45 G;  1AA0 A;  1E79 H;  2WTY A;  5BU8 B;  1NJI Q;  1BCC J;  1OW7 A;  3H1I J;  1KYO D;  2G3A A;  3PP5 A;  3HUS C;  1T3U A;  1NU1 E;  3AE1 C;  3FWL A;  2W6A A;  2IBZ E;  2OGU A;  2KS1 B;  1MUU A;  3CCM P;  2M5A B;  4U3F G;  4UB8 H;  3TK1 A;  5KAI H;  1SP4 A;  4I1L A;  2POH A;  3TGU E;  3CXH I;  4R4M A;  5APS A;  1EQ7 A;  3P8C E;  1K05 A;  2YKP A;  2H88 C;  1ZOY C;  3L74 D;  3BAT A;  5K5G B;  3RL0 g;  3AED C;  4I7Z B;  1LT9 B;  1KC8 Q;  3RL0 D;  5M1B A;  3L75 E;  2Z4E A;  1R5L A;  2BEZ F;  2HR3 A;  3B4S A;  1SQQ G;  1M1J C;  1L4A D;  3OAK A;  4PV1 D;  3AEA C;  1YIJ P;  1IFN A;  3AEE C;  3QH9 A;  2W6J H;  2V7Q J;  1LP1 A;  3G4S P;  1N7S A;  4KJM A;  1AVY A;  1PP9 D;  1XTG B;  1U57 A;  1HWT C;  3S4R A;  2RKL A;  1GK4 A;  1HGZ A;  2YO3 A;  3NXS A;  2OYO A;  3H1H D;  1FZE A;  1G2C A;  1KFN A;  4NPD A;  3VMA A;  3P8M C;  1P84 E;  1AFO A;  3TYY A;  4I7Z C;  1LT9 C;  1JB0 J;  1EXI A;  2SPZ A;  3KQG A;  3L75 G;  1S5L E;  1QVG O;  3GHG B;  4OGQ B;  1RQU A;  4RO0 A;  1KIL A;  4JF7 A;  1DIP A;  1SQX G;  2K9J A;  3U59 A;  4M3L A;  4U3F J;  3WUT A;  5B5E E;  3O6Q B;  3JSV C;  4WY4 B;  1NO4 A;  2O1K A;  4H44 B;  3OW2 O;  1BCC D;  1KN7 A;  2QJK B;  1USE A;  1GU5 A;  1S1C X;  1ZRT E;  3W67 A;  3H25 A;  4C7N B;  2P1J A;  1JY3 O;  3A5T A;  1URQ A;  3I56 P;  1ZME C;  2R5B A;  3SSU A;  1VQ6 P;  3RBX A;  1SQB K;  1Q86 Q;  3L36 A;  1FZC B;  1N73 A;  5AW0 B;  2N1T B;  2IZ1 A;  1SQQ J;  3V2N A;  1LTJ A;  1OXZ A;  2KLV A;  4RJT A;  4OGQ C;  2J59 M;  1K73 Q;  1PZQ A;  1KYO E;  3M0D A;  3R4Y A;  5GTH H;  2QA4 P;  2QIW A;  4U7J A;  3IN6 A;  5AVW B;  1VQM P;  2FYU J;  4H44 C;  3VP8 A;  1PL5 A;  1NTM E;  2YMK A;  2J5U A;  5APT A;  2AEM A;  3CXH E;  4GOF A;  1RF1 A;  1NYH A;  1Q81 Q;  1OVU A;  2XZR A;  2ZXX A;  2E5T A;  4BXL A;  4H0L B;  2I1K A;  1J1E B;  1JCD A;  1RF0 C;  5CCH C;  3L73 D;  1FZC C;  3CME P;  1QEX A;  3IAO A;  3L70 G;  1BGY J;  3U1A A;  1KMI Z;  3G3Z A;  2MKV A;  1OVR A;  2Q1K A;  2A45 I;  3BRT B;  1FZB A;  2JO1 A;  2ZXE B;  1XTC C;  2C0X A;  4CPG A;  1SQV J;  2E74 B;  1AQ5 A;  2PGD A;  1NTK K;  3GW6 A;  2QM8 A;  4OGQ D;  2WWW A;  3Q5S A;  4U3F D;  5CCG C;  2B9B A;  2FYZ A;  1PP9 E;  1T8Z A;  5L8R J;  1QL1 A;  2KP8 A;  4WY4 D;  5KAF H;  3H1H E;  3M0A A;  4H44 D;  1R8E A;  3L71 J;  3L74 G;  1GK6 A;  3AE4 C;  1NGM B;  3QWO C;  1Z56 A;  1Y8A A;  3T97 B;  1Q2N A;  4N78 D;  1BSN A;  1GW3 A;  4Y99 B;  1SQQ D;  4LGD E;  4I6M C;  1LP1 B;  4IL6 H;  3L35 A;  2K9Y A;  1N7S B;  1QX8 A;  2QJY B;  5AW8 B;  2ZYG A;  2KIK A;  1FS0 E;  1JY2 P;  1BCC E;  4K35 A;  1JTH B;  2IBZ I;  1KQL A;  1NVO A;  5AW2 B;  1UII A;  2WPV B;  2AXT H;  1AJY A;  1ZP0 C;  3L70 J;  2H43 A;  2DW3 A;  1U7M A;  3M91 A;  1JMB A;  2O1J A;  5CCG D;  5AVQ B;  2OYH A;  3RK2 C;  2IYP A;  2V4H A;  1DD4 A;  5B66 H;  3W68 A;  3HD7 C;  1YJN P;  2QG4 A;  1JNM A;  2W6B A;  1X79 B;  3SWY A;  5BU5 A;  2RN0 A;  4H0L D;  2AEJ A;  3CX5 D;  3BCC J;  2FXM A;  1JMM A;  1X8Y A;  2WMM A;  1BGY D;  3KPE A;  1WMK A;  2KSJ A;  1H88 A;  5AW9 B;  4OVN F;  5KLV K;  3D70 A;  2O01 H;  3FX0 A;  1RE4 A;  1OIP A;  1L2P A;  1SQV D;  2K37 A;  1BCC G;  2NPS A;  3TDK A;  1GMJ A;  3JCU E;  1BDC A;  3H1I G;  3L37 A;  2E74 D;  1AVO A;  1LTS C;  2KNC B;  1GDT A;  1RHZ B;  2E75 B;  3A0B H;  3AE5 C;  1KOR A;  5KJ7 D;  1MV8 A;  3SWK A;  1LTJ B;  1FZA A;  1T2K D;  3L73 E;  3MUD C;  1LWU A;  1DD3 A;  1NTK G;  1NTZ G;  3A0H H;  3LW5 H;  3MZW B;  3L4F A;  3II6 A;  1S9K E;  3HTK A;  5AW4 B;  4IL6 X;  3CCQ P;  4UB6 E;  2Z5I A;  1SQB J;  2FKW B;  2NZ2 A;  1IFM A;  1FZG A;  4IOI H;  3A2A A;  2KYV A;  2JR8 A;  4RES B;  1RF1 B;  4U3F E;  5CCH A;  3FGA D;  4ZMD A;  4TLF A;  2BCC J;  2OYI B;  1N7S D;  5KKZ B;  4ZKU A;  1HVV A;  1JY2 N;  1IZN B;  1R5S A;  5DJU B;  3GF7 A;  2P2U A;  4EYY Q;  3CD6 P;  1HJ0 A;  4XE5 B;  2E76 B;  2HPC B;  3H1L J;  4W80 A;  1BE3 J;  4YXD C;  3Q3D A;  1HJB A;  3L70 D;  4PV1 C;  5AW7 B;  1YBK A;  4XA4 A;  4D6T J;  4N78 E;  1GL2 A;  1IFP A;  1HTL C;  1SQQ E;  2WPS A;  1PV3 A;  4Y28 J;  2FFD B;  4H13 B;  3V6I A;  2QJP B;  3F89 A;  1KYO I;  1X22 A;  3BCC D;  2ZYD A;  1WRG A;  2YO2 A;  2YXQ B;  3KXD A;  1VF5 C;  1NH4 A;  2D2C B;  1M7L A;  2ZT9 B;  4DOJ A;  1ZXG A;  2P58 A;  3WUV A;  1FU1 A;  4BRY A;  2W83 C;  5AW6 B;  1IFI A;  1PGO A;  1USD A;  1VQ8 P;  3O8Z A;  2WSE H;  4TT3 H;  1NTK J;  1NTZ J;  1KD1 Q;  3S9O A;  3NMD A;  2Q3I A;  2E76 C;  1HH0 A;  2ITA A;  3PTZ A;  1HF9 A;  3WU2 E;  3D6Z A;  2WPR A;  2E75 D;  1A02 F; 
#chains in the Genus database with same CATH homology
 5TIS E;  5H2F E;  3A0B E;  3KZI E;  5GTI E;  5B66 E;  5GTH E;  5B5E E;  4PJ0 E;  3JCU E;  4IL6 E;  5E79 E;  1W5C E;  2AXT E;  3WU2 E;  1S5L E;  5KAF E;  3A0H E;  4UB8 E;  5KAI E;  4UB6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...