3A0BO

Crystal structure of br-substituted photosystem ii complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 27
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2009-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3a0bO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3a0bO02
5GTHO 3A0HO 3A0BO 5E79O 1S5LO 5H2FO 5G3AA 4UB8O 5B5EO 3WU2O 3JCUO 4PJ0O 5G39A 5GTIO 5KAIO 5KAFO 4IL6O 5B66O 3KZIO 4UB6O 5TISO 2AXTO 5G38A
chains in the Genus database with same CATH superfamily
3AA0A 2LHFA 3SYBA 1ZHWA 2Y0HA 2W81C 3HWBA 5DL6A 1E54A 3RBHA 3HOEA 4BUMX 4E1SA 4RLCA 4AUIA 2IWVA 4FT6A 4PR7A 3POXA 3T24A 3UU2A 3PQUA 2WVPA 2F1VA 2MNHA 1THQA 3T20A 2GE4A 2Y7SA 4B61A 2LFUA 4FMSA 3PQSA 5H2FO 3VZTX 3POQA 2KXPA 3JTYA 3QRCA 2R88A 4KRAA 4UB8O 5PRNA 3VE1A 3WU2O 3PORA 3AA1A 4C00A 4FSOA 2J1NA 3G7GA 4FSPA 4RLBA 1MM4A 2J4UP 4N59A 4GF4A 4AYDC 2ZLDA 4O4XA 3QRAA 2F1TA 3NSGA 4AYID 2YPVA 4LSFA 3SY9A 3VZUX 3HW9A 2KC0A 4K3BA 3AA6A 3AA7A 3BRYA 2K0LA 2FGRA 2KZ7A 2W80C 7PRNA 3A0HO 3VY9X 1Q9FA 2ODJA 2YNKA 1BT9A 2WJQA 3A2SX 3PGRA 3AA6B 3AA7B 3HOLA 4FESA 4JCHA 3FYXA 1HXUA 4N75A 3LK41 3AA0B 4PUXA 1ORMA 1PHOA 1PRNA 2MHLA 4O49A 5E79O 1S5LO 3SYSA 3WI5A 3LK42 4XNLA 3DA3A 1HXTA 4LSHA 4FQEA 3DWNA 4GCQA 4O3ZA 4AKRA 5EE2A 3JCUO 4XNKA 5G39A 2O4VA 4N74A 5GTIO 3TZGA 4JFBA 1GFQA 2XE3A 4KR8A 5KAFO 1QJ9A 2K4TA 4AKRB 3DWOX 3GP6A 4GCSA 2KXPB 3BRZA 1YS5A 4LSIA 5G26A 3V8UA 5ADXK 5GV0A 1IZNA 5AFUK 2F1CX 3AA1B 3AAEA 4AZLA 4C4VA 1G90A 3BS0A 5D5DA 2FGQX 1GFNA 2AXTO 2N2MA 5FVNA 5G38A 3NJTA 2M06A 4G75A 4D64A 1MPFA 5IYUA 2QTKA 5GTHO 3LK3A 4O3WA 4C69X 4C4VB 2M07A 4LSEA 4RL9A 4U9CA 2Y0KA 1QJPA 2KDYA 4FRTA 4AYMC 3O0EA 1ZHZA 3WI4A 2KZ7B 2R89A 1ZHXA 4FZNA 1BXWA 2ERVA 5G3AA 3PF1A 4AKMA 2X27X 2XE5A 4AYEC 4D65A 5JDPA 4O4UA 3C5OA 3PGSA 4FUVA 4GCPA 3VZWX 1H6S1 3T0SA 1Q9GA 2XE2A 1GFPA 2R4LA 2Y0LA 1GFOA 2JQYA 4IL6O 4K3CA 5B66O 2R4NA 2R8AA 3UAQA 2WJRA 2OMFA 1GFMA 3VY8X 4FOZA 4AFKA 3EMNX 3LK2A 3SY7A 3PRNA 4O3YA 8PRNA 4Z3TA 1OSMA 2XE1A 1IZNB 3LK2B 4G76A 1HXXA 3AAEB 2PORA 2XG6A 3K19A 1T1LA 4KR4A 3A0BO 3VE2A 1ZHYA 2PRNA 2XTRA 4AYNA 3SZDA 1OPFA 5T5FA 3LK3B 2R4PA 1MM5A 2ZFGA 3SZVA 4FZMA 4E1TA 5B5EO 3UPGA 3AAAA 1QJ8A 4PJ0O 2XTQA 3KVDD 4GHBA 4F4BA 4FZLA 4RJWA 5KAIO 4N58A 6PRNA 5ADXL 3DA4A 4RJXA 5AFUL 3KZIO 1BH3A 1P4TA 3AAAB 2X9KA 2Y2XA 5DL8A 4D5UA 2R4OA 2XMXA 3PGUA 2JMMA 4O3XB 4QQ1A 2N2LA 4UB6O 5DL5A 5DL7A 5TISO 4CTDA 1ZHTA 1T16A 3POUA 2IWWA 4FRXA 3DZMA
chains in the Genus database with same CATH topology
5GTHO 3A0HO 3A0BO 5E79O 1S5LO 5H2FO 5G3AA 4UB8O 5B5EO 3WU2O 3JCUO 4PJ0O 5G39A 5GTIO 5KAIO 5KAFO 4IL6O 5B66O 3KZIO 4UB6O 5TISO 2AXTO 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  3A0H O;  3A0B O;  5E79 O;  1S5L O;  5H2F O;  5G3A A;  4UB8 O;  5B5E O;  3WU2 O;  3JCU O;  4PJ0 O;  5G39 A;  5GTI O;  5KAI O;  5KAF O;  4IL6 O;  5B66 O;  3KZI O;  4UB6 O;  5TIS O;  2AXT O;  5G38 A; 
#chains in the Genus database with same CATH topology
 3AA0 A;  2LHF A;  3SYB A;  1ZHW A;  2Y0H A;  2W81 C;  3HWB A;  5DL6 A;  1E54 A;  3RBH A;  3HOE A;  4BUM X;  4E1S A;  4RLC A;  4AUI A;  2IWV A;  4FT6 A;  4PR7 A;  3POX A;  3T24 A;  3UU2 A;  3PQU A;  2WVP A;  2F1V A;  2MNH A;  1THQ A;  3T20 A;  2GE4 A;  2Y7S A;  4B61 A;  2LFU A;  4FMS A;  3PQS A;  5H2F O;  3VZT X;  3POQ A;  2KXP A;  3JTY A;  3QRC A;  2R88 A;  4KRA A;  4UB8 O;  5PRN A;  3VE1 A;  3WU2 O;  3POR A;  3AA1 A;  4C00 A;  4FSO A;  2J1N A;  3G7G A;  4FSP A;  4RLB A;  1MM4 A;  2J4U P;  4N59 A;  4GF4 A;  4AYD C;  2ZLD A;  4O4X A;  3QRA A;  2F1T A;  3NSG A;  4AYI D;  2YPV A;  4LSF A;  3SY9 A;  3VZU X;  3HW9 A;  2KC0 A;  4K3B A;  3AA6 A;  3AA7 A;  3BRY A;  2K0L A;  2FGR A;  2KZ7 A;  2W80 C;  7PRN A;  3A0H O;  3VY9 X;  1Q9F A;  2ODJ A;  2YNK A;  1BT9 A;  2WJQ A;  3A2S X;  3PGR A;  3AA6 B;  3AA7 B;  3HOL A;  4FES A;  4JCH A;  3FYX A;  1HXU A;  4N75 A;  3LK4 1;  3AA0 B;  4PUX A;  1ORM A;  1PHO A;  1PRN A;  2MHL A;  4O49 A;  5E79 O;  1S5L O;  3SYS A;  3WI5 A;  3LK4 2;  4XNL A;  3DA3 A;  1HXT A;  4LSH A;  4FQE A;  3DWN A;  4GCQ A;  4O3Z A;  4AKR A;  5EE2 A;  3JCU O;  4XNK A;  5G39 A;  2O4V A;  4N74 A;  5GTI O;  3TZG A;  4JFB A;  1GFQ A;  2XE3 A;  4KR8 A;  5KAF O;  1QJ9 A;  2K4T A;  4AKR B;  3DWO X;  3GP6 A;  4GCS A;  2KXP B;  3BRZ A;  1YS5 A;  4LSI A;  5G26 A;  3V8U A;  5ADX K;  5GV0 A;  1IZN A;  5AFU K;  2F1C X;  3AA1 B;  3AAE A;  4AZL A;  4C4V A;  1G90 A;  3BS0 A;  5D5D A;  2FGQ X;  1GFN A;  2AXT O;  2N2M A;  5FVN A;  5G38 A;  3NJT A;  2M06 A;  4G75 A;  4D64 A;  1MPF A;  5IYU A;  2QTK A;  5GTH O;  3LK3 A;  4O3W A;  4C69 X;  4C4V B;  2M07 A;  4LSE A;  4RL9 A;  4U9C A;  2Y0K A;  1QJP A;  2KDY A;  4FRT A;  4AYM C;  3O0E A;  1ZHZ A;  3WI4 A;  2KZ7 B;  2R89 A;  1ZHX A;  4FZN A;  1BXW A;  2ERV A;  5G3A A;  3PF1 A;  4AKM A;  2X27 X;  2XE5 A;  4AYE C;  4D65 A;  5JDP A;  4O4U A;  3C5O A;  3PGS A;  4FUV A;  4GCP A;  3VZW X;  1H6S 1;  3T0S A;  1Q9G A;  2XE2 A;  1GFP A;  2R4L A;  2Y0L A;  1GFO A;  2JQY A;  4IL6 O;  4K3C A;  5B66 O;  2R4N A;  2R8A A;  3UAQ A;  2WJR A;  2OMF A;  1GFM A;  3VY8 X;  4FOZ A;  4AFK A;  3EMN X;  3LK2 A;  3SY7 A;  3PRN A;  4O3Y A;  8PRN A;  4Z3T A;  1OSM A;  2XE1 A;  1IZN B;  3LK2 B;  4G76 A;  1HXX A;  3AAE B;  2POR A;  2XG6 A;  3K19 A;  1T1L A;  4KR4 A;  3A0B O;  3VE2 A;  1ZHY A;  2PRN A;  2XTR A;  4AYN A;  3SZD A;  1OPF A;  5T5F A;  3LK3 B;  2R4P A;  1MM5 A;  2ZFG A;  3SZV A;  4FZM A;  4E1T A;  5B5E O;  3UPG A;  3AAA A;  1QJ8 A;  4PJ0 O;  2XTQ A;  3KVD D;  4GHB A;  4F4B A;  4FZL A;  4RJW A;  5KAI O;  4N58 A;  6PRN A;  5ADX L;  3DA4 A;  4RJX A;  5AFU L;  3KZI O;  1BH3 A;  1P4T A;  3AAA B;  2X9K A;  2Y2X A;  5DL8 A;  4D5U A;  2R4O A;  2XMX A;  3PGU A;  2JMM A;  4O3X B;  4QQ1 A;  2N2L A;  4UB6 O;  5DL5 A;  5DL7 A;  5TIS O;  4CTD A;  1ZHT A;  1T16 A;  3POU A;  2IWW A;  4FRX A;  3DZM A; 
#chains in the Genus database with same CATH homology
 5GTH O;  3A0H O;  3A0B O;  5E79 O;  1S5L O;  5H2F O;  5G3A A;  4UB8 O;  5B5E O;  3WU2 O;  3JCU O;  4PJ0 O;  5G39 A;  5GTI O;  5KAI O;  5KAF O;  4IL6 O;  5B66 O;  3KZI O;  4UB6 O;  5TIS O;  2AXT O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...