3A0BO

Crystal structure of br-substituted photosystem ii complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport
total genus 27
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2009-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3a0bO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3a0bO02
4UB8O 4UB6O 5E79O 5G39A 5KAIO 5G38A 5G3AA 5TISO 3A0HO 5GTHO 3WU2O 3KZIO 4IL6O 3A0BO 5KAFO 5B5EO 2AXTO 1S5LO 3JCUO 4PJ0O 5B66O 5H2FO 5GTIO
chains in the Genus database with same CATH superfamily
3AA1B 3SY9A 8PRNA 1ZHWA 2F1TA 3BS0A 5KAIO 3T24A 3TZGA 2J4UP 2JQYA 4LSHA 4UB8O 3UU2A 3VY8X 5B66O 3KVDD 4N58A 1GFNA 3GP6A 2WVPA 3NSGA 3DA4A 3PORA 1PHOA 4FESA 5G38A 3LK42 3A0HO 4AYNA 4C4VB 4FOZA 4FRXA 5G26A 3AA6A 2LHFA 3PF1A 4AYEC 1GFOA 1ORMA 2R4OA 5GTHO 2M07A 3AA0A 3PGRA 4KR8A 4GCQA 4AUIA 1OSMA 4CTDA 2KZ7A 4O3ZA 2KC0A 3C5OA 4O3YA 4LSIA 2XTRA 4BUMX 5AFUL 1MM5A 1S5LO 2FGQX 4KR4A 4O4XA 4U9CA 1G90A 3HWBA 3AA7B 4GCSA 3AAEB 4O3WA 1HXXA 3BRZA 2N2LA 2R8AA 3K19A 4GF4A 3DWNA 3SY7A 1MM4A 4JFBA 1HXUA 4PUXA 3WI4A 4AYID 2XTQA 3LK2A 2Y0KA 3VE1A 1T16A 1GFPA 2XE5A 5DL6A 5PRNA 3UPGA 1MPFA 3PQUA 2MHLA 4E1SA 4F4BA 4FZNA 2XG6A 3VZTX 3PGSA 4RL9A 1Q9GA 1GFQA 1Q9FA 4AKRB 1H6S1 2J1NA 2F1CX 3O0EA 4N74A 2R4NA 3T0SA 2WJQA 4AKMA 3A0BO 4QQ1A 1IZNA 3DZMA 3RBHA 3AAAB 3G7GA 3LK3A 4LSFA 2XE2A 2KXPA 2WJRA 1PRNA 5GV0A 3FYXA 1QJ9A 3AA1A 3PRNA 1YS5A 4GHBA 5T5FA 4FQEA 4G75A 3VZWX 1QJPA 4RJWA 3SYBA 3NJTA 3POXA 5GTIO 4C4VA 4O4UA 3EMNX 2Y0HA 2ZLDA 4UB6O 5E79O 5DL5A 5G39A 4XNLA 5FVNA 4B61A 4D64A 1P4TA 2F1VA 2YNKA 3POQA 4FZMA 3HOLA 1THQA 2XE3A 1OPFA 3BRYA 2X9KA 4XNKA 3DA3A 3PGUA 4O3XB 5ADXK 2ODJA 6PRNA 4GCPA 2LFUA 3KZIO 4FUVA 3VE2A 4RLBA 5KAFO 2R89A 2R4PA 3AAEA 3AA7A 4RLCA 3A2SX 2O4VA 1HXTA 3AA6B 2PRNA 4G76A 5EE2A 3AA0B 1ZHZA 3HOEA 3DWOX 4FRTA 4FMSA 4JCHA 5B5EO 1GFMA 2FGRA 2KZ7B 1BH3A 3WI5A 2N2MA 4FT6A 1ZHXA 2PORA 3PQSA 1BT9A 4PJ0O 3SYSA 2KDYA 2XMXA 5JDPA 3VY9X 2IWWA 2JMMA 4K3CA 2GE4A 4FSPA 4AKRA 5H2FO 1T1LA 3POUA 4AYDC 2XE1A 3UAQA 4KRAA 2ERVA 4PR7A 4LSEA 4RJXA 2K4TA 4AFKA 2M06A 3V8UA 3LK2B 5G3AA 5TISO 4C69X 4N59A 5DL8A 3AAAA 4FZLA 5D5DA 4D65A 2ZFGA 3SZDA 3WU2O 5AFUK 3T20A 2YPVA 3LK41 2X27X 4K3BA 7PRNA 1BXWA 5IYUA 4IL6O 1ZHTA 2QTKA 3SZVA 2Y7SA 2AXTO 3HW9A 2W80C 4N75A 4Z3TA 4C00A 2R88A 2IWVA 4AZLA 3VZUX 3QRCA 5ADXL 2R4LA 2K0LA 4O49A 1IZNB 3JCUO 3JTYA 2OMFA 3QRAA 4D5UA 1E54A 1ZHYA 2Y2XA 3LK3B 4FSOA 4E1TA 2Y0LA 2KXPB 2W81C 1QJ8A 4AYMC 5DL7A 2MNHA
chains in the Genus database with same CATH topology
4UB8O 4UB6O 5E79O 5G39A 5KAIO 5G38A 5G3AA 5TISO 3A0HO 5GTHO 3WU2O 3KZIO 4IL6O 3A0BO 5KAFO 5B5EO 2AXTO 1S5LO 3JCUO 4PJ0O 5B66O 5H2FO 5GTIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 O;  4UB6 O;  5E79 O;  5G39 A;  5KAI O;  5G38 A;  5G3A A;  5TIS O;  3A0H O;  5GTH O;  3WU2 O;  3KZI O;  4IL6 O;  3A0B O;  5KAF O;  5B5E O;  2AXT O;  1S5L O;  3JCU O;  4PJ0 O;  5B66 O;  5H2F O;  5GTI O; 
#chains in the Genus database with same CATH topology
 3AA1 B;  3SY9 A;  8PRN A;  1ZHW A;  2F1T A;  3BS0 A;  5KAI O;  3T24 A;  3TZG A;  2J4U P;  2JQY A;  4LSH A;  4UB8 O;  3UU2 A;  3VY8 X;  5B66 O;  3KVD D;  4N58 A;  1GFN A;  3GP6 A;  2WVP A;  3NSG A;  3DA4 A;  3POR A;  1PHO A;  4FES A;  5G38 A;  3LK4 2;  3A0H O;  4AYN A;  4C4V B;  4FOZ A;  4FRX A;  5G26 A;  3AA6 A;  2LHF A;  3PF1 A;  4AYE C;  1GFO A;  1ORM A;  2R4O A;  5GTH O;  2M07 A;  3AA0 A;  3PGR A;  4KR8 A;  4GCQ A;  4AUI A;  1OSM A;  4CTD A;  2KZ7 A;  4O3Z A;  2KC0 A;  3C5O A;  4O3Y A;  4LSI A;  2XTR A;  4BUM X;  5AFU L;  1MM5 A;  1S5L O;  2FGQ X;  4KR4 A;  4O4X A;  4U9C A;  1G90 A;  3HWB A;  3AA7 B;  4GCS A;  3AAE B;  4O3W A;  1HXX A;  3BRZ A;  2N2L A;  2R8A A;  3K19 A;  4GF4 A;  3DWN A;  3SY7 A;  1MM4 A;  4JFB A;  1HXU A;  4PUX A;  3WI4 A;  4AYI D;  2XTQ A;  3LK2 A;  2Y0K A;  3VE1 A;  1T16 A;  1GFP A;  2XE5 A;  5DL6 A;  5PRN A;  3UPG A;  1MPF A;  3PQU A;  2MHL A;  4E1S A;  4F4B A;  4FZN A;  2XG6 A;  3VZT X;  3PGS A;  4RL9 A;  1Q9G A;  1GFQ A;  1Q9F A;  4AKR B;  1H6S 1;  2J1N A;  2F1C X;  3O0E A;  4N74 A;  2R4N A;  3T0S A;  2WJQ A;  4AKM A;  3A0B O;  4QQ1 A;  1IZN A;  3DZM A;  3RBH A;  3AAA B;  3G7G A;  3LK3 A;  4LSF A;  2XE2 A;  2KXP A;  2WJR A;  1PRN A;  5GV0 A;  3FYX A;  1QJ9 A;  3AA1 A;  3PRN A;  1YS5 A;  4GHB A;  5T5F A;  4FQE A;  4G75 A;  3VZW X;  1QJP A;  4RJW A;  3SYB A;  3NJT A;  3POX A;  5GTI O;  4C4V A;  4O4U A;  3EMN X;  2Y0H A;  2ZLD A;  4UB6 O;  5E79 O;  5DL5 A;  5G39 A;  4XNL A;  5FVN A;  4B61 A;  4D64 A;  1P4T A;  2F1V A;  2YNK A;  3POQ A;  4FZM A;  3HOL A;  1THQ A;  2XE3 A;  1OPF A;  3BRY A;  2X9K A;  4XNK A;  3DA3 A;  3PGU A;  4O3X B;  5ADX K;  2ODJ A;  6PRN A;  4GCP A;  2LFU A;  3KZI O;  4FUV A;  3VE2 A;  4RLB A;  5KAF O;  2R89 A;  2R4P A;  3AAE A;  3AA7 A;  4RLC A;  3A2S X;  2O4V A;  1HXT A;  3AA6 B;  2PRN A;  4G76 A;  5EE2 A;  3AA0 B;  1ZHZ A;  3HOE A;  3DWO X;  4FRT A;  4FMS A;  4JCH A;  5B5E O;  1GFM A;  2FGR A;  2KZ7 B;  1BH3 A;  3WI5 A;  2N2M A;  4FT6 A;  1ZHX A;  2POR A;  3PQS A;  1BT9 A;  4PJ0 O;  3SYS A;  2KDY A;  2XMX A;  5JDP A;  3VY9 X;  2IWW A;  2JMM A;  4K3C A;  2GE4 A;  4FSP A;  4AKR A;  5H2F O;  1T1L A;  3POU A;  4AYD C;  2XE1 A;  3UAQ A;  4KRA A;  2ERV A;  4PR7 A;  4LSE A;  4RJX A;  2K4T A;  4AFK A;  2M06 A;  3V8U A;  3LK2 B;  5G3A A;  5TIS O;  4C69 X;  4N59 A;  5DL8 A;  3AAA A;  4FZL A;  5D5D A;  4D65 A;  2ZFG A;  3SZD A;  3WU2 O;  5AFU K;  3T20 A;  2YPV A;  3LK4 1;  2X27 X;  4K3B A;  7PRN A;  1BXW A;  5IYU A;  4IL6 O;  1ZHT A;  2QTK A;  3SZV A;  2Y7S A;  2AXT O;  3HW9 A;  2W80 C;  4N75 A;  4Z3T A;  4C00 A;  2R88 A;  2IWV A;  4AZL A;  3VZU X;  3QRC A;  5ADX L;  2R4L A;  2K0L A;  4O49 A;  1IZN B;  3JCU O;  3JTY A;  2OMF A;  3QRA A;  4D5U A;  1E54 A;  1ZHY A;  2Y2X A;  3LK3 B;  4FSO A;  4E1T A;  2Y0L A;  2KXP B;  2W81 C;  1QJ8 A;  4AYM C;  5DL7 A;  2MNH A; 
#chains in the Genus database with same CATH homology
 4UB8 O;  4UB6 O;  5E79 O;  5G39 A;  5KAI O;  5G38 A;  5G3A A;  5TIS O;  3A0H O;  5GTH O;  3WU2 O;  3KZI O;  4IL6 O;  3A0B O;  5KAF O;  5B5E O;  2AXT O;  1S5L O;  3JCU O;  4PJ0 O;  5B66 O;  5H2F O;  5GTI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...