3A0TA

Catalytic domain of histidine kinase thka (tm1359) in complex with adp and mg ion (trigonal)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
152
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 56
structure length 152
sequence length 152
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0tA00
5FWKA 1H7SA 2BZ5A 3ZKBA 4KSHA 4GEEA 4NH8A 5IDMA 1UYDA 1Y4SA 4URMA 2XDUA 5M4NA 3C11A 2YI0A 2XHTA 2FWZA 4LP0A 1U2OA 2O1WA 2YE9A 4B7PA 4JQLA 3QDDA 4L94A 2YI5A 1YT2A 3LPSA 4YKWA 1TIDA 3QTFA 4XD8A 1R62A 3GIGB 3PEHA 3Q5KA 2E0AA 4HZ5A 2YJXA 4EGIA 2YE7A 3ZXOA 2H8MA 4HXWA 4HYPA 1Z5CA 3CRKA 2K5BA 2YKEA 1Z5BA 4X9LA 4MP7A 3C0EA 5FNFA 2H55A 4EM7A 2WERA 2EXLA 1OSFA 3JZ3A 5F3KA 2BU6A 2BYHA 1TC0A 3A0RA 2CGFA 2YE4A 5FNDA 4XKOA 4WUDA 4CE3A 1BXDA 2XX5A 1UYIA 4XKAA 1BKNA 1BGQA 5CTXA 3HZ5A 1I5BA 4H85A 1H7UA 4XIRA 3OWDA 4KSGA 5D7DA 1JM6A 3EKOA 1QYEA 4CE1A 3R91A 1MU5A 2IWUA 2VW5A 2ZDYA 1YESA 2IWXA 4MOTA 4L93A 4LWGA 5J6AA 1ZWHA 2AKPA 4NH9A 4WUBA 2ZDXA 3TTZA 3TUHA 4CWFA 2BYIA 3RLRA 4MPEA 3K98A 1YETA 2VWCA 4LWFA 1UYMA 4ASAA 1BYQA 3T2SA 1YT1A 2XABA 3RLQA 1AM1A 4XITA 4XDMA 5BODA 3NMQA 5M4PA 2WEQA 2YE6A 2CH4A 3HYZA 2WI4A 4MB9A 1B63A 3EHGA 5CTWA 1TILA 2QF6A 4YKRA 3VHAA 3T1KA 3B24A 4EEHA 4O09A 4AWPA 2XDKA 2XCMA 3OPDA 2WI1A 4V25A 3B26A 2YGEA 4P8OA 2XDSA 3RLPA 3K99A 1L0OA 4QPKA 2XHRA 5CPHA 4PRVA 3H4LA 2FYPA 3O2FA 4E01A 4BQGA 1ZXMA 3ZKDA 4JASA 1Y8PA 4UROA 4AWQA 3O6OA 4HYMA 4CWNA 3R4MA 4AWOA 3DGEA 3GIFA 2YEDA 3CWVA 2WI6A 2YK9A 4CWTA 1A4HA 3OMUA 3U2DA 4LWEA 2XJGA 2FWYA 4MPNA 2YI6A 4GQTA 4JAVA 1YSRA 4CWOA 4V26A 4BIZA 2IOQA 1AH8A 3INWA 2QFOA 2HCHA 1I5AA 2WI5A 1GKXA 2VCJA 4R3MA 2YE8A 2XD6A 4XC0A 3FV5A 5J71A 4Q20A 1YSZA 1YC1A 4W7TA 5IN9A 1I58A 1I5CA 1Y8NA 4LWHA 4BXIA 3CRLA 4YKQA 2XX4A 5M4EA 3R4NA 4FCRA 4EFUA 2PNRA 4ZKIA 2O1UA 4XKKA 1KZNA 3A0WA 4XTJA 2GFDA 1Z59A 4CWQA 4KQVA 1UYKA 4L90A 2XJJA 1UYFA 2YEEA 4YKUA 4L8ZA 3K97A 4KTNA 1EI1A 1UY7A 1NHIA 5D7RA 4WUCA 1THNA 4U7NA 1B62A 2JKIA 2YKIA 2QG0A 5M4HA 1AJ6A 2IORA 3H80A 2Q8FA 3Q5LA 1Y4UA 4O0BA 1UY9A 3SL2A 2WEPA 2Q8HA 4ASBA 2CG9A 3WHAA 5IDJA 1QZRA 4EMVA 4FCQA 1UYCA 3HEKA 4LPBA 4PRXA 4HXZA 2YEHA 4XCLA 2FXSA 2YEFA 3D2RA 3G7BA 4E02A 4GCZA 1I5DA 3INXA 3R92A 1Z5AA 1ID0A 2BU2A 2XDLA 2YE3A 2GQPA 2YEJA 2YKCA 1KIJA 2JJCA 4FMTA 1GKZA 1UY6A 1YERA 1UYGA 3TZ4A 4EFTA 2YEBA 3R4OA 1YC3A 2BU5A 2BU7A 2BRCA 1UYLA 3FT5A 3VADA 2BU8A 3VHDA 3U2KA 1GJVA 3BMYA 4URNA 4LWIA 1AH6A 4XIQA 1TBWA 4XE2A 1TC6A 4BIUA 1US7A 2XDXA 4URLA 3A0ZA 1UYEA 3OW6A 5CTYA 3TZ5A 4ZVIA 1EA6A 3GIGA 1ZW9A 4NH7A 4R1FA 4BQJA 2YEIA 3HHUA 4QPJA 4YKTA 2ZKJA 4YKZA 3A0TA 5BOCA 4KFGA 1YT0A 2ESAA 3T10A 2HKJA 1AMWA 4DZYA 1U0ZA 2YGAA 4EGKA 2XX2A 4B6CA 3D0BA 3TZ0A 5C93A 4PL9A 4CWPA 2WI7A 3B28A 3PEJA 3KE6A 4ASFA 2YKJA 2IWSA 4O04A 3O0IA 2BREA 2UWDA 2YGFA 3CGZA 4GFNA 2IOPA 2XJXA 2YECA 2ZBKB 3EHFA 5F5RA 1S14A 2BTZA 3B27A 5M4MA 5D6QA 3IEDA 4BAEA 3HYYA 1YC4A 5GGZA 2YKBA 4HY1A 4P7AA 1TH8A 2CCTA 4CWRA 4O05A 3MNRP 4U93A 1Y8OA 4L91A 4E00A 3EKRA 2BT0A 3K60A 4R3AA 4MP2A 2O1VA 1UYHA 4FCPA 4PU9A 3LNUA 2CCUA 4O07A 3HZ1A 4YKYA 4GT8A 1NHJA 2XK2A 3RKZA 1NHHA 3Q5JA 4CWSA 1I59A 3WQ9A 4U7OA 4H7QA 1B3QA 3FT8A 2YEAA 3ZXQA 5D6PA 3T0ZA 5M4KA 3R4PA 1ZXNA 4HY6A 4ASGA 3TZ2A 3VHCA 2YI7A 1UY8A 5CF0A 3U67A 5L3JA 2Q2EB 3CGYA 1S16A 3ZM7A 5CTUA 4DUHA 4AS9A 4FPPA 4H81A 4I5SA 3A0XA 2XHXA 2HG1A 2YEGA 3G75A 4XIPA 4KP4A 2WI3A 4GGLA 2QG2A 2YJWA 4I3HA 4MBCA 4EGHA 1QY8A 4CE2A 1MX0A 3G7EA 3OWBA 5D7CA 1YS3A 2Q8GA 2YK2A 3EHJA 2CCSA 4JAUA 2YE2A 3EHHA 3BM9A 1PVGA 3GIEA 2VCIA 4HZ0A 4YKXA 2BSMA 4K4OA 2YE5A 3A0YA 4XCJA 3B25A 4MPCA 5FNCA 2C2AA 2WI2A 3D36A 3T0HA 2Q8IA
chains in the Genus database with same CATH superfamily
5FWKA 1H7SA 2BZ5A 3ZKBA 4KSHA 4GEEA 4NH8A 5IDMA 1UYDA 1Y4SA 4URMA 2XDUA 5M4NA 3C11A 2YI0A 2XHTA 2FWZA 4LP0A 1U2OA 2O1WA 2YE9A 4B7PA 4JQLA 3QDDA 4L94A 2YI5A 1YT2A 3LPSA 4YKWA 1TIDA 3QTFA 4XD8A 1R62A 3GIGB 3PEHA 3Q5KA 2E0AA 4HZ5A 2YJXA 4EGIA 2YE7A 3ZXOA 2H8MA 4HXWA 4HYPA 1Z5CA 3CRKA 2K5BA 2YKEA 1Z5BA 4X9LA 4MP7A 3C0EA 5FNFA 2H55A 4EM7A 2WERA 2EXLA 1OSFA 3JZ3A 5F3KA 2BU6A 2BYHA 1TC0A 3A0RA 2CGFA 2YE4A 5FNDA 4XKOA 4WUDA 4CE3A 1BXDA 2XX5A 1UYIA 4XKAA 1BKNA 1BGQA 5CTXA 3HZ5A 1I5BA 4H85A 1H7UA 4XIRA 3OWDA 4KSGA 5D7DA 1JM6A 3EKOA 1QYEA 4CE1A 3R91A 1MU5A 2IWUA 2VW5A 2ZDYA 1YESA 2IWXA 4MOTA 4L93A 4LWGA 5J6AA 1ZWHA 2AKPA 3CYGA 4NH9A 4WUBA 2ZDXA 3TTZA 3TUHA 4CWFA 2BYIA 3RLRA 4MPEA 3K98A 1YETA 2VWCA 4LWFA 2FTKA 1UYMA 4ASAA 1BYQA 3T2SA 1YT1A 2XABA 3RLQA 1AM1A 4XITA 4XDMA 5BODA 3NMQA 5M4PA 2WEQA 2YE6A 2CH4A 3HYZA 2WI4A 4MB9A 1B63A 3EHGA 5CTWA 1TILA 2QF6A 4YKRA 3VHAA 3T1KA 3B24A 4EEHA 4O09A 4AWPA 2XDKA 2XCMA 3OPDA 2WI1A 4V25A 3B26A 2YGEA 4P8OA 2XDSA 3RLPA 3K99A 1L0OA 4QPKA 2XHRA 1IXMA 5CPHA 4PRVA 3H4LA 2FYPA 3O2FA 4E01A 4BQGA 1ZXMA 3ZKDA 4JASA 1Y8PA 4UROA 4AWQA 3O6OA 4HYMA 4CWNA 3R4MA 4AWOA 3DGEA 3GIFA 2YEDA 3CWVA 2WI6A 2YK9A 4CWTA 1A4HA 3OMUA 3U2DA 4LWEA 2XJGA 2FWYA 4MPNA 2YI6A 4GQTA 4JAVA 1YSRA 4CWOA 4V26A 4BIZA 2IOQA 1AH8A 3INWA 2QFOA 2HCHA 1I5AA 2WI5A 1GKXA 2VCJA 4R3MA 2YE8A 2XD6A 4XC0A 3FV5A 5J71A 4Q20A 1YSZA 1YC1A 4W7TA 5IN9A 1I58A 1I5CA 1Y8NA 4LWHA 4BXIA 3CRLA 4YKQA 2XX4A 5M4EA 3R4NA 4FCRA 4EFUA 2PNRA 4ZKIA 2O1UA 4XKKA 1KZNA 3A0WA 4XTJA 2GFDA 1Z59A 4CWQA 4KQVA 1UYKA 4L90A 2XJJA 1UYFA 2YEEA 4YKUA 4L8ZA 3K97A 4KTNA 1EI1A 3S5TA 1UY7A 1NHIA 5D7RA 4WUCA 1THNA 4U7NA 1B62A 2JKIA 2YKIA 2QG0A 5M4HA 1AJ6A 2IORA 3H80A 2Q8FA 3Q5LA 1Y4UA 4O0BA 1UY9A 3SL2A 2WEPA 2Q8HA 4ASBA 2CG9A 3WHAA 5IDJA 1QZRA 4EMVA 4FCQA 1UYCA 3HEKA 4LPBA 4PRXA 4HXZA 2YEHA 4XCLA 2FXSA 2YEFA 3D2RA 3G7BA 4E02A 4GCZA 1I5DA 3INXA 3R92A 1Z5AA 1ID0A 2BU2A 2XDLA 2YE3A 2GQPA 2YEJA 2YKCA 1KIJA 4E72A 2JJCA 4FMTA 1GKZA 1UY6A 1YERA 1UYGA 3TZ4A 4EFTA 2YEBA 3R4OA 1YC3A 2BU5A 2BU7A 2BRCA 1UYLA 3FT5A 3VADA 2BU8A 3VHDA 3U2KA 1GJVA 3BMYA 2C1GA 4URNA 4LWIA 1AH6A 4XIQA 1TBWA 4XE2A 1TC6A 2C1IA 4BIUA 1US7A 2XDXA 4URLA 3A0ZA 1UYEA 3OW6A 5CTYA 3TZ5A 4ZVIA 1EA6A 3GIGA 1ZW9A 4NH7A 4R1FA 4BQJA 2YEIA 3HHUA 2HHIA 4QPJA 4YKTA 2ZKJA 4YKZA 3A0TA 5BOCA 4KFGA 1YT0A 2ESAA 3T10A 2HKJA 1AMWA 4DZYA 1U0ZA 2YGAA 4EGKA 2XX2A 4B6CA 3D0BA 3TZ0A 5C93A 4PL9A 4CWPA 2WI7A 3B28A 3PEJA 3KE6A 4ASFA 2YKJA 2IWSA 4O04A 3O0IA 2BREA 2UWDA 2YGFA 3CGZA 4GFNA 2IOPA 2XJXA 2YECA 2ZBKB 3EHFA 5F5RA 1S14A 2BTZA 3B27A 5M4MA 5D6QA 3IEDA 4BAEA 3HYYA 1YC4A 5GGZA 2YKBA 4HY1A 4P7AA 1TH8A 2CCTA 4CWRA 4O05A 3MNRP 4U93A 1Y8OA 4L91A 4E00A 3EKRA 2BT0A 3K60A 4R3AA 4MP2A 2O1VA 1UYHA 4FCPA 4PU9A 3LNUA 2CCUA 4O07A 3HZ1A 4YKYA 3LMMA 4GT8A 1NHJA 2XK2A 3RKZA 1NHHA 3Q5JA 4CWSA 1I59A 3WQ9A 1F51A 4H7QA 4U7OA 1B3QA 3FT8A 2YEAA 3ZXQA 5D6PA 3T0ZA 5M4KA 3R4PA 1ZXNA 4HY6A 4ASGA 3TZ2A 3VHCA 2YI7A 1UY8A 5CF0A 3U67A 5L3JA 2Q2EB 3CGYA 1S16A 3ZM7A 5CTUA 4DUHA 4AS9A 4FPPA 4H81A 5JENA 4I5SA 3A0XA 2XHXA 2HG1A 2YEGA 3G75A 4XIPA 4KP4A 2WI3A 4GGLA 2QG2A 2YJWA 4I3HA 4MBCA 4EGHA 1QY8A 4CE2A 1MX0A 3G7EA 3OWBA 5D7CA 1YS3A 2Q8GA 2YK2A 3EHJA 2CCSA 4JAUA 2YE2A 3EHHA 3BM9A 1PVGA 3GIEA 2VCIA 4HZ0A 4YKXA 2BSMA 4K4OA 2YE5A 3A0YA 4XCJA 3B25A 4MPCA 5FNCA 2C2AA 2WI2A 3D36A 3T0HA 2Q8IA
chains in the Genus database with same CATH topology
5FWKA 1H7SA 2BZ5A 3ZKBA 4KSHA 4GEEA 4NH8A 5IDMA 1UYDA 1Y4SA 4URMA 2XDUA 5M4NA 3C11A 2YI0A 2XHTA 2FWZA 4LP0A 1U2OA 2O1WA 2YE9A 4B7PA 4JQLA 3QDDA 4L94A 2YI5A 1YT2A 3LPSA 4YKWA 1TIDA 3QTFA 4XD8A 1R62A 3GIGB 3PEHA 3Q5KA 2E0AA 4HZ5A 2YJXA 4EGIA 2YE7A 3ZXOA 2H8MA 4HXWA 4HYPA 1Z5CA 3CRKA 2K5BA 2YKEA 1Z5BA 4X9LA 4MP7A 3C0EA 5FNFA 2H55A 4EM7A 2WERA 2EXLA 1OSFA 3JZ3A 5F3KA 2BU6A 2BYHA 1TC0A 3A0RA 2CGFA 2YE4A 5FNDA 4XKOA 4WUDA 4CE3A 1BXDA 2XX5A 1UYIA 4XKAA 1BKNA 1BGQA 5CTXA 3HZ5A 1I5BA 4H85A 1H7UA 4XIRA 3OWDA 4KSGA 5D7DA 1JM6A 3EKOA 1QYEA 4CE1A 3R91A 1MU5A 2IWUA 2VW5A 2ZDYA 1YESA 2IWXA 4MOTA 4L93A 4LWGA 5J6AA 1ZWHA 2AKPA 4NH9A 4WUBA 2ZDXA 3TTZA 3TUHA 4CWFA 2BYIA 3RLRA 4MPEA 3K98A 1YETA 2VWCA 4LWFA 1UYMA 4ASAA 1BYQA 3T2SA 1YT1A 2XABA 3RLQA 1AM1A 4XITA 4XDMA 5BODA 3NMQA 5M4PA 2WEQA 2YE6A 2CH4A 3HYZA 2WI4A 4MB9A 1B63A 3EHGA 5CTWA 1TILA 2QF6A 4YKRA 3VHAA 3T1KA 3B24A 4EEHA 4O09A 4AWPA 2XDKA 2XCMA 3OPDA 2WI1A 4V25A 3B26A 2YGEA 4P8OA 2XDSA 3RLPA 3K99A 1L0OA 4QPKA 2XHRA 5CPHA 4PRVA 3H4LA 2FYPA 3O2FA 4E01A 4BQGA 1ZXMA 3ZKDA 4JASA 1Y8PA 4UROA 4AWQA 3O6OA 4HYMA 4CWNA 3R4MA 4AWOA 3DGEA 3GIFA 2YEDA 3CWVA 2WI6A 2YK9A 4CWTA 1A4HA 3OMUA 3U2DA 4LWEA 2XJGA 2FWYA 4MPNA 2YI6A 4GQTA 4JAVA 1YSRA 4CWOA 4V26A 4BIZA 2IOQA 1AH8A 3INWA 2QFOA 2HCHA 1I5AA 2WI5A 1GKXA 2VCJA 4R3MA 2YE8A 2XD6A 4XC0A 3FV5A 5J71A 4Q20A 1YSZA 1YC1A 4W7TA 5IN9A 1I58A 1I5CA 1Y8NA 4LWHA 4BXIA 3CRLA 4YKQA 2XX4A 5M4EA 3R4NA 4FCRA 4EFUA 2PNRA 4ZKIA 2O1UA 4XKKA 1KZNA 3A0WA 4XTJA 2GFDA 1Z59A 4CWQA 4KQVA 1UYKA 4L90A 2XJJA 1UYFA 2YEEA 4YKUA 4L8ZA 3K97A 4KTNA 1EI1A 1UY7A 1NHIA 5D7RA 4WUCA 1THNA 4U7NA 1B62A 2JKIA 2YKIA 2QG0A 5M4HA 1AJ6A 2IORA 3H80A 2Q8FA 3Q5LA 1Y4UA 4O0BA 1UY9A 3SL2A 2WEPA 2Q8HA 4ASBA 2CG9A 3WHAA 5IDJA 1QZRA 4EMVA 4FCQA 1UYCA 3HEKA 4LPBA 4PRXA 4HXZA 2YEHA 4XCLA 2FXSA 2YEFA 3D2RA 3G7BA 4E02A 4GCZA 1I5DA 3INXA 3R92A 1Z5AA 1ID0A 2BU2A 2XDLA 2YE3A 2GQPA 2YEJA 2YKCA 1KIJA 2JJCA 4FMTA 1GKZA 1UY6A 1YERA 1UYGA 3TZ4A 4EFTA 2YEBA 3R4OA 1YC3A 2BU5A 2BU7A 2BRCA 1UYLA 3FT5A 3VADA 2BU8A 3VHDA 3U2KA 1GJVA 3BMYA 4URNA 4LWIA 1AH6A 4XIQA 1TBWA 4XE2A 1TC6A 4BIUA 1US7A 2XDXA 4URLA 3A0ZA 1UYEA 3OW6A 5CTYA 3TZ5A 4ZVIA 1EA6A 3GIGA 1ZW9A 4NH7A 4R1FA 4BQJA 2YEIA 3HHUA 4QPJA 4YKTA 2ZKJA 4YKZA 3A0TA 5BOCA 4KFGA 1YT0A 2ESAA 3T10A 2HKJA 1AMWA 4DZYA 1U0ZA 2YGAA 4EGKA 2XX2A 4B6CA 3D0BA 3TZ0A 5C93A 4PL9A 4CWPA 2WI7A 3B28A 3PEJA 3KE6A 4ASFA 2YKJA 2IWSA 4O04A 3O0IA 2BREA 2UWDA 2YGFA 3CGZA 4GFNA 2IOPA 2XJXA 2YECA 2ZBKB 3EHFA 5F5RA 1S14A 2BTZA 3B27A 5M4MA 5D6QA 3IEDA 4BAEA 3HYYA 1YC4A 5GGZA 2YKBA 4HY1A 4P7AA 1TH8A 2CCTA 4CWRA 4O05A 3MNRP 4U93A 1Y8OA 4L91A 4E00A 3EKRA 2BT0A 3K60A 4R3AA 4MP2A 2O1VA 1UYHA 4FCPA 4PU9A 3LNUA 2CCUA 4O07A 3HZ1A 4YKYA 4GT8A 1NHJA 2XK2A 3RKZA 1NHHA 3Q5JA 4CWSA 1I59A 3WQ9A 4U7OA 4H7QA 1B3QA 3FT8A 2YEAA 3ZXQA 5D6PA 3T0ZA 5M4KA 3R4PA 1ZXNA 4HY6A 4ASGA 3TZ2A 3VHCA 2YI7A 1UY8A 5CF0A 3U67A 5L3JA 2Q2EB 3CGYA 1S16A 3ZM7A 5CTUA 4DUHA 4AS9A 4FPPA 4H81A 4I5SA 3A0XA 2XHXA 2HG1A 2YEGA 3G75A 4XIPA 4KP4A 2WI3A 4GGLA 2QG2A 2YJWA 4I3HA 4MBCA 4EGHA 1QY8A 4CE2A 1MX0A 3G7EA 3OWBA 5D7CA 1YS3A 2Q8GA 2YK2A 3EHJA 2CCSA 4JAUA 2YE2A 3EHHA 3BM9A 1PVGA 3GIEA 2VCIA 4HZ0A 4YKXA 2BSMA 4K4OA 2YE5A 3A0YA 4XCJA 3B25A 4MPCA 5FNCA 2C2AA 2WI2A 3D36A 3T0HA 2Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWK A;  1H7S A;  2BZ5 A;  3ZKB A;  4KSH A;  4GEE A;  4NH8 A;  5IDM A;  1UYD A;  1Y4S A;  4URM A;  2XDU A;  5M4N A;  3C11 A;  2YI0 A;  2XHT A;  2FWZ A;  4LP0 A;  1U2O A;  2O1W A;  2YE9 A;  4B7P A;  4JQL A;  3QDD A;  4L94 A;  2YI5 A;  1YT2 A;  3LPS A;  4YKW A;  1TID A;  3QTF A;  4XD8 A;  1R62 A;  3GIG B;  3PEH A;  3Q5K A;  2E0A A;  4HZ5 A;  2YJX A;  4EGI A;  2YE7 A;  3ZXO A;  2H8M A;  4HXW A;  4HYP A;  1Z5C A;  3CRK A;  2K5B A;  2YKE A;  1Z5B A;  4X9L A;  4MP7 A;  3C0E A;  5FNF A;  2H55 A;  4EM7 A;  2WER A;  2EXL A;  1OSF A;  3JZ3 A;  5F3K A;  2BU6 A;  2BYH A;  1TC0 A;  3A0R A;  2CGF A;  2YE4 A;  5FND A;  4XKO A;  4WUD A;  4CE3 A;  1BXD A;  2XX5 A;  1UYI A;  4XKA A;  1BKN A;  1BGQ A;  5CTX A;  3HZ5 A;  1I5B A;  4H85 A;  1H7U A;  4XIR A;  3OWD A;  4KSG A;  5D7D A;  1JM6 A;  3EKO A;  1QYE A;  4CE1 A;  3R91 A;  1MU5 A;  2IWU A;  2VW5 A;  2ZDY A;  1YES A;  2IWX A;  4MOT A;  4L93 A;  4LWG A;  5J6A A;  1ZWH A;  2AKP A;  4NH9 A;  4WUB A;  2ZDX A;  3TTZ A;  3TUH A;  4CWF A;  2BYI A;  3RLR A;  4MPE A;  3K98 A;  1YET A;  2VWC A;  4LWF A;  1UYM A;  4ASA A;  1BYQ A;  3T2S A;  1YT1 A;  2XAB A;  3RLQ A;  1AM1 A;  4XIT A;  4XDM A;  5BOD A;  3NMQ A;  5M4P A;  2WEQ A;  2YE6 A;  2CH4 A;  3HYZ A;  2WI4 A;  4MB9 A;  1B63 A;  3EHG A;  5CTW A;  1TIL A;  2QF6 A;  4YKR A;  3VHA A;  3T1K A;  3B24 A;  4EEH A;  4O09 A;  4AWP A;  2XDK A;  2XCM A;  3OPD A;  2WI1 A;  4V25 A;  3B26 A;  2YGE A;  4P8O A;  2XDS A;  3RLP A;  3K99 A;  1L0O A;  4QPK A;  2XHR A;  5CPH A;  4PRV A;  3H4L A;  2FYP A;  3O2F A;  4E01 A;  4BQG A;  1ZXM A;  3ZKD A;  4JAS A;  1Y8P A;  4URO A;  4AWQ A;  3O6O A;  4HYM A;  4CWN A;  3R4M A;  4AWO A;  3DGE A;  3GIF A;  2YED A;  3CWV A;  2WI6 A;  2YK9 A;  4CWT A;  1A4H A;  3OMU A;  3U2D A;  4LWE A;  2XJG A;  2FWY A;  4MPN A;  2YI6 A;  4GQT A;  4JAV A;  1YSR A;  4CWO A;  4V26 A;  4BIZ A;  2IOQ A;  1AH8 A;  3INW A;  2QFO A;  2HCH A;  1I5A A;  2WI5 A;  1GKX A;  2VCJ A;  4R3M A;  2YE8 A;  2XD6 A;  4XC0 A;  3FV5 A;  5J71 A;  4Q20 A;  1YSZ A;  1YC1 A;  4W7T A;  5IN9 A;  1I58 A;  1I5C A;  1Y8N A;  4LWH A;  4BXI A;  3CRL A;  4YKQ A;  2XX4 A;  5M4E A;  3R4N A;  4FCR A;  4EFU A;  2PNR A;  4ZKI A;  2O1U A;  4XKK A;  1KZN A;  3A0W A;  4XTJ A;  2GFD A;  1Z59 A;  4CWQ A;  4KQV A;  1UYK A;  4L90 A;  2XJJ A;  1UYF A;  2YEE A;  4YKU A;  4L8Z A;  3K97 A;  4KTN A;  1EI1 A;  1UY7 A;  1NHI A;  5D7R A;  4WUC A;  1THN A;  4U7N A;  1B62 A;  2JKI A;  2YKI A;  2QG0 A;  5M4H A;  1AJ6 A;  2IOR A;  3H80 A;  2Q8F A;  3Q5L A;  1Y4U A;  4O0B A;  1UY9 A;  3SL2 A;  2WEP A;  2Q8H A;  4ASB A;  2CG9 A;  3WHA A;  5IDJ A;  1QZR A;  4EMV A;  4FCQ A;  1UYC A;  3HEK A;  4LPB A;  4PRX A;  4HXZ A;  2YEH A;  4XCL A;  2FXS A;  2YEF A;  3D2R A;  3G7B A;  4E02 A;  4GCZ A;  1I5D A;  3INX A;  3R92 A;  1Z5A A;  1ID0 A;  2BU2 A;  2XDL A;  2YE3 A;  2GQP A;  2YEJ A;  2YKC A;  1KIJ A;  2JJC A;  4FMT A;  1GKZ A;  1UY6 A;  1YER A;  1UYG A;  3TZ4 A;  4EFT A;  2YEB A;  3R4O A;  1YC3 A;  2BU5 A;  2BU7 A;  2BRC A;  1UYL A;  3FT5 A;  3VAD A;  2BU8 A;  3VHD A;  3U2K A;  1GJV A;  3BMY A;  4URN A;  4LWI A;  1AH6 A;  4XIQ A;  1TBW A;  4XE2 A;  1TC6 A;  4BIU A;  1US7 A;  2XDX A;  4URL A;  3A0Z A;  1UYE A;  3OW6 A;  5CTY A;  3TZ5 A;  4ZVI A;  1EA6 A;  3GIG A;  1ZW9 A;  4NH7 A;  4R1F A;  4BQJ A;  2YEI A;  3HHU A;  4QPJ A;  4YKT A;  2ZKJ A;  4YKZ A;  3A0T A;  5BOC A;  4KFG A;  1YT0 A;  2ESA A;  3T10 A;  2HKJ A;  1AMW A;  4DZY A;  1U0Z A;  2YGA A;  4EGK A;  2XX2 A;  4B6C A;  3D0B A;  3TZ0 A;  5C93 A;  4PL9 A;  4CWP A;  2WI7 A;  3B28 A;  3PEJ A;  3KE6 A;  4ASF A;  2YKJ A;  2IWS A;  4O04 A;  3O0I A;  2BRE A;  2UWD A;  2YGF A;  3CGZ A;  4GFN A;  2IOP A;  2XJX A;  2YEC A;  2ZBK B;  3EHF A;  5F5R A;  1S14 A;  2BTZ A;  3B27 A;  5M4M A;  5D6Q A;  3IED A;  4BAE A;  3HYY A;  1YC4 A;  5GGZ A;  2YKB A;  4HY1 A;  4P7A A;  1TH8 A;  2CCT A;  4CWR A;  4O05 A;  3MNR P;  4U93 A;  1Y8O A;  4L91 A;  4E00 A;  3EKR A;  2BT0 A;  3K60 A;  4R3A A;  4MP2 A;  2O1V A;  1UYH A;  4FCP A;  4PU9 A;  3LNU A;  2CCU A;  4O07 A;  3HZ1 A;  4YKY A;  4GT8 A;  1NHJ A;  2XK2 A;  3RKZ A;  1NHH A;  3Q5J A;  4CWS A;  1I59 A;  3WQ9 A;  4U7O A;  4H7Q A;  1B3Q A;  3FT8 A;  2YEA A;  3ZXQ A;  5D6P A;  3T0Z A;  5M4K A;  3R4P A;  1ZXN A;  4HY6 A;  4ASG A;  3TZ2 A;  3VHC A;  2YI7 A;  1UY8 A;  5CF0 A;  3U67 A;  5L3J A;  2Q2E B;  3CGY A;  1S16 A;  3ZM7 A;  5CTU A;  4DUH A;  4AS9 A;  4FPP A;  4H81 A;  4I5S A;  3A0X A;  2XHX A;  2HG1 A;  2YEG A;  3G75 A;  4XIP A;  4KP4 A;  2WI3 A;  4GGL A;  2QG2 A;  2YJW A;  4I3H A;  4MBC A;  4EGH A;  1QY8 A;  4CE2 A;  1MX0 A;  3G7E A;  3OWB A;  5D7C A;  1YS3 A;  2Q8G A;  2YK2 A;  3EHJ A;  2CCS A;  4JAU A;  2YE2 A;  3EHH A;  3BM9 A;  1PVG A;  3GIE A;  2VCI A;  4HZ0 A;  4YKX A;  2BSM A;  4K4O A;  2YE5 A;  3A0Y A;  4XCJ A;  3B25 A;  4MPC A;  5FNC A;  2C2A A;  2WI2 A;  3D36 A;  3T0H A;  2Q8I A; 
#chains in the Genus database with same CATH topology
 5FWK A;  1H7S A;  2BZ5 A;  3ZKB A;  4KSH A;  4GEE A;  4NH8 A;  5IDM A;  1UYD A;  1Y4S A;  4URM A;  2XDU A;  5M4N A;  3C11 A;  2YI0 A;  2XHT A;  2FWZ A;  4LP0 A;  1U2O A;  2O1W A;  2YE9 A;  4B7P A;  4JQL A;  3QDD A;  4L94 A;  2YI5 A;  1YT2 A;  3LPS A;  4YKW A;  1TID A;  3QTF A;  4XD8 A;  1R62 A;  3GIG B;  3PEH A;  3Q5K A;  2E0A A;  4HZ5 A;  2YJX A;  4EGI A;  2YE7 A;  3ZXO A;  2H8M A;  4HXW A;  4HYP A;  1Z5C A;  3CRK A;  2K5B A;  2YKE A;  1Z5B A;  4X9L A;  4MP7 A;  3C0E A;  5FNF A;  2H55 A;  4EM7 A;  2WER A;  2EXL A;  1OSF A;  3JZ3 A;  5F3K A;  2BU6 A;  2BYH A;  1TC0 A;  3A0R A;  2CGF A;  2YE4 A;  5FND A;  4XKO A;  4WUD A;  4CE3 A;  1BXD A;  2XX5 A;  1UYI A;  4XKA A;  1BKN A;  1BGQ A;  5CTX A;  3HZ5 A;  1I5B A;  4H85 A;  1H7U A;  4XIR A;  3OWD A;  4KSG A;  5D7D A;  1JM6 A;  3EKO A;  1QYE A;  4CE1 A;  3R91 A;  1MU5 A;  2IWU A;  2VW5 A;  2ZDY A;  1YES A;  2IWX A;  4MOT A;  4L93 A;  4LWG A;  5J6A A;  1ZWH A;  2AKP A;  3CYG A;  4NH9 A;  4WUB A;  2ZDX A;  3TTZ A;  3TUH A;  4CWF A;  2BYI A;  3RLR A;  4MPE A;  3K98 A;  1YET A;  2VWC A;  4LWF A;  2FTK A;  1UYM A;  4ASA A;  1BYQ A;  3T2S A;  1YT1 A;  2XAB A;  3RLQ A;  1AM1 A;  4XIT A;  4XDM A;  5BOD A;  3NMQ A;  5M4P A;  2WEQ A;  2YE6 A;  2CH4 A;  3HYZ A;  2WI4 A;  4MB9 A;  1B63 A;  3EHG A;  5CTW A;  1TIL A;  2QF6 A;  4YKR A;  3VHA A;  3T1K A;  3B24 A;  4EEH A;  4O09 A;  4AWP A;  2XDK A;  2XCM A;  3OPD A;  2WI1 A;  4V25 A;  3B26 A;  2YGE A;  4P8O A;  2XDS A;  3RLP A;  3K99 A;  1L0O A;  4QPK A;  2XHR A;  1IXM A;  5CPH A;  4PRV A;  3H4L A;  2FYP A;  3O2F A;  4E01 A;  4BQG A;  1ZXM A;  3ZKD A;  4JAS A;  1Y8P A;  4URO A;  4AWQ A;  3O6O A;  4HYM A;  4CWN A;  3R4M A;  4AWO A;  3DGE A;  3GIF A;  2YED A;  3CWV A;  2WI6 A;  2YK9 A;  4CWT A;  1A4H A;  3OMU A;  3U2D A;  4LWE A;  2XJG A;  2FWY A;  4MPN A;  2YI6 A;  4GQT A;  4JAV A;  1YSR A;  4CWO A;  4V26 A;  4BIZ A;  2IOQ A;  1AH8 A;  3INW A;  2QFO A;  2HCH A;  1I5A A;  2WI5 A;  1GKX A;  2VCJ A;  4R3M A;  2YE8 A;  2XD6 A;  4XC0 A;  3FV5 A;  5J71 A;  4Q20 A;  1YSZ A;  1YC1 A;  4W7T A;  5IN9 A;  1I58 A;  1I5C A;  1Y8N A;  4LWH A;  4BXI A;  3CRL A;  4YKQ A;  2XX4 A;  5M4E A;  3R4N A;  4FCR A;  4EFU A;  2PNR A;  4ZKI A;  2O1U A;  4XKK A;  1KZN A;  3A0W A;  4XTJ A;  2GFD A;  1Z59 A;  4CWQ A;  4KQV A;  1UYK A;  4L90 A;  2XJJ A;  1UYF A;  2YEE A;  4YKU A;  4L8Z A;  3K97 A;  4KTN A;  1EI1 A;  3S5T A;  1UY7 A;  1NHI A;  5D7R A;  4WUC A;  1THN A;  4U7N A;  1B62 A;  2JKI A;  2YKI A;  2QG0 A;  5M4H A;  1AJ6 A;  2IOR A;  3H80 A;  2Q8F A;  3Q5L A;  1Y4U A;  4O0B A;  1UY9 A;  3SL2 A;  2WEP A;  2Q8H A;  4ASB A;  2CG9 A;  3WHA A;  5IDJ A;  1QZR A;  4EMV A;  4FCQ A;  1UYC A;  3HEK A;  4LPB A;  4PRX A;  4HXZ A;  2YEH A;  4XCL A;  2FXS A;  2YEF A;  3D2R A;  3G7B A;  4E02 A;  4GCZ A;  1I5D A;  3INX A;  3R92 A;  1Z5A A;  1ID0 A;  2BU2 A;  2XDL A;  2YE3 A;  2GQP A;  2YEJ A;  2YKC A;  1KIJ A;  4E72 A;  2JJC A;  4FMT A;  1GKZ A;  1UY6 A;  1YER A;  1UYG A;  3TZ4 A;  4EFT A;  2YEB A;  3R4O A;  1YC3 A;  2BU5 A;  2BU7 A;  2BRC A;  1UYL A;  3FT5 A;  3VAD A;  2BU8 A;  3VHD A;  3U2K A;  1GJV A;  3BMY A;  2C1G A;  4URN A;  4LWI A;  1AH6 A;  4XIQ A;  1TBW A;  4XE2 A;  1TC6 A;  2C1I A;  4BIU A;  1US7 A;  2XDX A;  4URL A;  3A0Z A;  1UYE A;  3OW6 A;  5CTY A;  3TZ5 A;  4ZVI A;  1EA6 A;  3GIG A;  1ZW9 A;  4NH7 A;  4R1F A;  4BQJ A;  2YEI A;  3HHU A;  2HHI A;  4QPJ A;  4YKT A;  2ZKJ A;  4YKZ A;  3A0T A;  5BOC A;  4KFG A;  1YT0 A;  2ESA A;  3T10 A;  2HKJ A;  1AMW A;  4DZY A;  1U0Z A;  2YGA A;  4EGK A;  2XX2 A;  4B6C A;  3D0B A;  3TZ0 A;  5C93 A;  4PL9 A;  4CWP A;  2WI7 A;  3B28 A;  3PEJ A;  3KE6 A;  4ASF A;  2YKJ A;  2IWS A;  4O04 A;  3O0I A;  2BRE A;  2UWD A;  2YGF A;  3CGZ A;  4GFN A;  2IOP A;  2XJX A;  2YEC A;  2ZBK B;  3EHF A;  5F5R A;  1S14 A;  2BTZ A;  3B27 A;  5M4M A;  5D6Q A;  3IED A;  4BAE A;  3HYY A;  1YC4 A;  5GGZ A;  2YKB A;  4HY1 A;  4P7A A;  1TH8 A;  2CCT A;  4CWR A;  4O05 A;  3MNR P;  4U93 A;  1Y8O A;  4L91 A;  4E00 A;  3EKR A;  2BT0 A;  3K60 A;  4R3A A;  4MP2 A;  2O1V A;  1UYH A;  4FCP A;  4PU9 A;  3LNU A;  2CCU A;  4O07 A;  3HZ1 A;  4YKY A;  3LMM A;  4GT8 A;  1NHJ A;  2XK2 A;  3RKZ A;  1NHH A;  3Q5J A;  4CWS A;  1I59 A;  3WQ9 A;  1F51 A;  4H7Q A;  4U7O A;  1B3Q A;  3FT8 A;  2YEA A;  3ZXQ A;  5D6P A;  3T0Z A;  5M4K A;  3R4P A;  1ZXN A;  4HY6 A;  4ASG A;  3TZ2 A;  3VHC A;  2YI7 A;  1UY8 A;  5CF0 A;  3U67 A;  5L3J A;  2Q2E B;  3CGY A;  1S16 A;  3ZM7 A;  5CTU A;  4DUH A;  4AS9 A;  4FPP A;  4H81 A;  5JEN A;  4I5S A;  3A0X A;  2XHX A;  2HG1 A;  2YEG A;  3G75 A;  4XIP A;  4KP4 A;  2WI3 A;  4GGL A;  2QG2 A;  2YJW A;  4I3H A;  4MBC A;  4EGH A;  1QY8 A;  4CE2 A;  1MX0 A;  3G7E A;  3OWB A;  5D7C A;  1YS3 A;  2Q8G A;  2YK2 A;  3EHJ A;  2CCS A;  4JAU A;  2YE2 A;  3EHH A;  3BM9 A;  1PVG A;  3GIE A;  2VCI A;  4HZ0 A;  4YKX A;  2BSM A;  4K4O A;  2YE5 A;  3A0Y A;  4XCJ A;  3B25 A;  4MPC A;  5FNC A;  2C2A A;  2WI2 A;  3D36 A;  3T0H A;  2Q8I A; 
#chains in the Genus database with same CATH homology
 5FWK A;  1H7S A;  2BZ5 A;  3ZKB A;  4KSH A;  4GEE A;  4NH8 A;  5IDM A;  1UYD A;  1Y4S A;  4URM A;  2XDU A;  5M4N A;  3C11 A;  2YI0 A;  2XHT A;  2FWZ A;  4LP0 A;  1U2O A;  2O1W A;  2YE9 A;  4B7P A;  4JQL A;  3QDD A;  4L94 A;  2YI5 A;  1YT2 A;  3LPS A;  4YKW A;  1TID A;  3QTF A;  4XD8 A;  1R62 A;  3GIG B;  3PEH A;  3Q5K A;  2E0A A;  4HZ5 A;  2YJX A;  4EGI A;  2YE7 A;  3ZXO A;  2H8M A;  4HXW A;  4HYP A;  1Z5C A;  3CRK A;  2K5B A;  2YKE A;  1Z5B A;  4X9L A;  4MP7 A;  3C0E A;  5FNF A;  2H55 A;  4EM7 A;  2WER A;  2EXL A;  1OSF A;  3JZ3 A;  5F3K A;  2BU6 A;  2BYH A;  1TC0 A;  3A0R A;  2CGF A;  2YE4 A;  5FND A;  4XKO A;  4WUD A;  4CE3 A;  1BXD A;  2XX5 A;  1UYI A;  4XKA A;  1BKN A;  1BGQ A;  5CTX A;  3HZ5 A;  1I5B A;  4H85 A;  1H7U A;  4XIR A;  3OWD A;  4KSG A;  5D7D A;  1JM6 A;  3EKO A;  1QYE A;  4CE1 A;  3R91 A;  1MU5 A;  2IWU A;  2VW5 A;  2ZDY A;  1YES A;  2IWX A;  4MOT A;  4L93 A;  4LWG A;  5J6A A;  1ZWH A;  2AKP A;  4NH9 A;  4WUB A;  2ZDX A;  3TTZ A;  3TUH A;  4CWF A;  2BYI A;  3RLR A;  4MPE A;  3K98 A;  1YET A;  2VWC A;  4LWF A;  1UYM A;  4ASA A;  1BYQ A;  3T2S A;  1YT1 A;  2XAB A;  3RLQ A;  1AM1 A;  4XIT A;  4XDM A;  5BOD A;  3NMQ A;  5M4P A;  2WEQ A;  2YE6 A;  2CH4 A;  3HYZ A;  2WI4 A;  4MB9 A;  1B63 A;  3EHG A;  5CTW A;  1TIL A;  2QF6 A;  4YKR A;  3VHA A;  3T1K A;  3B24 A;  4EEH A;  4O09 A;  4AWP A;  2XDK A;  2XCM A;  3OPD A;  2WI1 A;  4V25 A;  3B26 A;  2YGE A;  4P8O A;  2XDS A;  3RLP A;  3K99 A;  1L0O A;  4QPK A;  2XHR A;  5CPH A;  4PRV A;  3H4L A;  2FYP A;  3O2F A;  4E01 A;  4BQG A;  1ZXM A;  3ZKD A;  4JAS A;  1Y8P A;  4URO A;  4AWQ A;  3O6O A;  4HYM A;  4CWN A;  3R4M A;  4AWO A;  3DGE A;  3GIF A;  2YED A;  3CWV A;  2WI6 A;  2YK9 A;  4CWT A;  1A4H A;  3OMU A;  3U2D A;  4LWE A;  2XJG A;  2FWY A;  4MPN A;  2YI6 A;  4GQT A;  4JAV A;  1YSR A;  4CWO A;  4V26 A;  4BIZ A;  2IOQ A;  1AH8 A;  3INW A;  2QFO A;  2HCH A;  1I5A A;  2WI5 A;  1GKX A;  2VCJ A;  4R3M A;  2YE8 A;  2XD6 A;  4XC0 A;  3FV5 A;  5J71 A;  4Q20 A;  1YSZ A;  1YC1 A;  4W7T A;  5IN9 A;  1I58 A;  1I5C A;  1Y8N A;  4LWH A;  4BXI A;  3CRL A;  4YKQ A;  2XX4 A;  5M4E A;  3R4N A;  4FCR A;  4EFU A;  2PNR A;  4ZKI A;  2O1U A;  4XKK A;  1KZN A;  3A0W A;  4XTJ A;  2GFD A;  1Z59 A;  4CWQ A;  4KQV A;  1UYK A;  4L90 A;  2XJJ A;  1UYF A;  2YEE A;  4YKU A;  4L8Z A;  3K97 A;  4KTN A;  1EI1 A;  1UY7 A;  1NHI A;  5D7R A;  4WUC A;  1THN A;  4U7N A;  1B62 A;  2JKI A;  2YKI A;  2QG0 A;  5M4H A;  1AJ6 A;  2IOR A;  3H80 A;  2Q8F A;  3Q5L A;  1Y4U A;  4O0B A;  1UY9 A;  3SL2 A;  2WEP A;  2Q8H A;  4ASB A;  2CG9 A;  3WHA A;  5IDJ A;  1QZR A;  4EMV A;  4FCQ A;  1UYC A;  3HEK A;  4LPB A;  4PRX A;  4HXZ A;  2YEH A;  4XCL A;  2FXS A;  2YEF A;  3D2R A;  3G7B A;  4E02 A;  4GCZ A;  1I5D A;  3INX A;  3R92 A;  1Z5A A;  1ID0 A;  2BU2 A;  2XDL A;  2YE3 A;  2GQP A;  2YEJ A;  2YKC A;  1KIJ A;  2JJC A;  4FMT A;  1GKZ A;  1UY6 A;  1YER A;  1UYG A;  3TZ4 A;  4EFT A;  2YEB A;  3R4O A;  1YC3 A;  2BU5 A;  2BU7 A;  2BRC A;  1UYL A;  3FT5 A;  3VAD A;  2BU8 A;  3VHD A;  3U2K A;  1GJV A;  3BMY A;  4URN A;  4LWI A;  1AH6 A;  4XIQ A;  1TBW A;  4XE2 A;  1TC6 A;  4BIU A;  1US7 A;  2XDX A;  4URL A;  3A0Z A;  1UYE A;  3OW6 A;  5CTY A;  3TZ5 A;  4ZVI A;  1EA6 A;  3GIG A;  1ZW9 A;  4NH7 A;  4R1F A;  4BQJ A;  2YEI A;  3HHU A;  4QPJ A;  4YKT A;  2ZKJ A;  4YKZ A;  3A0T A;  5BOC A;  4KFG A;  1YT0 A;  2ESA A;  3T10 A;  2HKJ A;  1AMW A;  4DZY A;  1U0Z A;  2YGA A;  4EGK A;  2XX2 A;  4B6C A;  3D0B A;  3TZ0 A;  5C93 A;  4PL9 A;  4CWP A;  2WI7 A;  3B28 A;  3PEJ A;  3KE6 A;  4ASF A;  2YKJ A;  2IWS A;  4O04 A;  3O0I A;  2BRE A;  2UWD A;  2YGF A;  3CGZ A;  4GFN A;  2IOP A;  2XJX A;  2YEC A;  2ZBK B;  3EHF A;  5F5R A;  1S14 A;  2BTZ A;  3B27 A;  5M4M A;  5D6Q A;  3IED A;  4BAE A;  3HYY A;  1YC4 A;  5GGZ A;  2YKB A;  4HY1 A;  4P7A A;  1TH8 A;  2CCT A;  4CWR A;  4O05 A;  3MNR P;  4U93 A;  1Y8O A;  4L91 A;  4E00 A;  3EKR A;  2BT0 A;  3K60 A;  4R3A A;  4MP2 A;  2O1V A;  1UYH A;  4FCP A;  4PU9 A;  3LNU A;  2CCU A;  4O07 A;  3HZ1 A;  4YKY A;  4GT8 A;  1NHJ A;  2XK2 A;  3RKZ A;  1NHH A;  3Q5J A;  4CWS A;  1I59 A;  3WQ9 A;  4U7O A;  4H7Q A;  1B3Q A;  3FT8 A;  2YEA A;  3ZXQ A;  5D6P A;  3T0Z A;  5M4K A;  3R4P A;  1ZXN A;  4HY6 A;  4ASG A;  3TZ2 A;  3VHC A;  2YI7 A;  1UY8 A;  5CF0 A;  3U67 A;  5L3J A;  2Q2E B;  3CGY A;  1S16 A;  3ZM7 A;  5CTU A;  4DUH A;  4AS9 A;  4FPP A;  4H81 A;  4I5S A;  3A0X A;  2XHX A;  2HG1 A;  2YEG A;  3G75 A;  4XIP A;  4KP4 A;  2WI3 A;  4GGL A;  2QG2 A;  2YJW A;  4I3H A;  4MBC A;  4EGH A;  1QY8 A;  4CE2 A;  1MX0 A;  3G7E A;  3OWB A;  5D7C A;  1YS3 A;  2Q8G A;  2YK2 A;  3EHJ A;  2CCS A;  4JAU A;  2YE2 A;  3EHH A;  3BM9 A;  1PVG A;  3GIE A;  2VCI A;  4HZ0 A;  4YKX A;  2BSM A;  4K4O A;  2YE5 A;  3A0Y A;  4XCJ A;  3B25 A;  4MPC A;  5FNC A;  2C2A A;  2WI2 A;  3D36 A;  3T0H A;  2Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...