3A0TA

Catalytic domain of histidine kinase thka (tm1359) in complex with adp and mg ion (trigonal)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
152
Chain Sequence
b'MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 56
structure length 152
sequence length 152
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0tA00
1TBWA 1QZRA 3B28A 1U2OA 3TUHA 4R1FA 2WEPA 3VHCA 2BU8A 4L93A 4XC0A 1S16A 5M4PA 5M4KA 1YETA 2YEAA 3B24A 4ASAA 2WI4A 2XD6A 4YKRA 1TH8A 5D7CA 1UYMA 2WEQA 3R92A 4JQLA 1QYEA 2JJCA 2YE9A 1UY6A 4YKTA 4R3MA 4AWOA 1UY8A 1THNA 2BRCA 3G7BA 1I58A 3VHAA 2ZDYA 4XKAA 1YS3A 3KE6A 2BU2A 4XIRA 4O04A 4O07A 4HXZA 1H7UA 4PRVA 3R4PA 1YSRA 4YKZA 3INWA 3D36A 4P8OA 5CPHA 4EGHA 4BIZA 3HEKA 2Q2EB 2XDLA 1MU5A 2YEBA 1A4HA 3CGYA 4B6CA 4CWSA 4EGIA 4ASBA 4B7PA 1GKXA 4BQJA 4MOTA 4LWHA 3U2KA 1Z5BA 1Z5CA 1B62A 1AJ6A 3GIGA 2WI7A 3O6OA 2FWZA 2YE8A 1US7A 1B3QA 1UYLA 2YGEA 2QG0A 3VADA 3HYYA 4H7QA 1BKNA 2ZBKB 3VHDA 4KQVA 3TZ0A 4XE2A 3A0WA 1TILA 2BYIA 2YEJA 1I5AA 3K60A 1I5DA 4XITA 3OWBA 4XDMA 1YC4A 5CTUA 2ZDXA 5J6AA 4CWRA 1ZW9A 3ZKDA 3CRLA 1NHJA 4P7AA 1ZXMA 3FT5A 5J71A 2YJXA 5CTWA 1YT0A 1S14A 1GJVA 3EKRA 2CGFA 2YKEA 3A0TA 1OSFA 2WI1A 3CGZA 1TC6A 3C11A 4CWOA 3DGEA 2WI6A 3T0HA 4XTJA 4W7TA 4XIPA 2IOQA 3JZ3A 2YE5A 3R91A 4AWQA 4YKWA 3GIEA 4UROA 4CWQA 4ASFA 4V26A 3U2DA 5CTYA 3A0ZA 3Q5KA 3MNRP 2YEEA 3BMYA 3WHAA 3ZXOA 4JAUA 3G75A 4HY6A 2HG1A 2YI5A 1AH8A 2YE4A 1Y8NA 5D7RA 4CE3A 4FMTA 1YERA 2XDSA 4GCZA 4PRXA 4CE1A 2PNRA 3LPSA 3R4OA 2H8MA 2BTZA 5FNCA 4HZ5A 4H81A 4XKKA 5GGZA 2YK9A 4L91A 3TZ4A 2QFOA 2BSMA 3H80A 4CE2A 5M4MA 3O2FA 2YJWA 2Q8GA 1UY7A 3EHGA 2Q8FA 4MB9A 2YE7A 2XX4A 4CWFA 2YEFA 4QPJA 1UYKA 3CWVA 5M4EA 3A0RA 4DZYA 3ZM7A 1UYCA 3ZXQA 2ZKJA 1R62A 1UYDA 4E00A 1ZXNA 3TZ5A 4AWPA 4O0BA 3K99A 2YI6A 3B25A 4HYMA 2UWDA 3T2SA 1JM6A 2XX2A 4QPKA 4L94A 4LWIA 4O05A 2HCHA 2YE6A 2GFDA 4MP2A 4KTNA 2XHXA 4Q20A 5M4HA 4MBCA 2WI2A 4EM7A 5D6PA 2O1WA 3B27A 1BGQA 5M4NA 1ID0A 2YECA 1NHIA 2QF6A 3QDDA 4L90A 2XHTA 4X9LA 4CWPA 2YEGA 3D0BA 3A0YA 4URNA 2BT0A 2CCUA 4HY1A 3TZ2A 2WI3A 3RKZA 5IDJA 2IORA 2JKIA 2BYHA 3G7EA 4FCQA 3GIFA 3R4MA 5CTXA 2Q8HA 1H7SA 4URLA 3WQ9A 3H4LA 3RLQA 3LNUA 3TTZA 1KZNA 5F5RA 4LWGA 2BU7A 2XJJA 1AH6A 1QY8A 4HYPA 1Y4UA 1TC0A 4JAVA 4MPEA 2XHRA 2CCTA 4ZKIA 4ZVIA 1UYEA 4KSGA 4L8ZA 4PU9A 4EGKA 1EA6A 2E0AA 2YKBA 1UYIA 5F3KA 2IWXA 2XABA 4LPBA 4EMVA 4BQGA 4E02A 2CH4A 2VW5A 2YGFA 4WUDA 2K5BA 3FT8A 4U7NA 2BU5A 3OMUA 2VCIA 4PL9A 4E01A 1AMWA 4I5SA 1YT2A 2XK2A 4XCJA 4AS9A 3HHUA 5D7DA 5FWKA 4V25A 3INXA 4MPCA 1YC3A 4FCRA 4KP4A 1MX0A 4EFUA 1B63A 2YEDA 2IWSA 5IDMA 4U93A 4LP0A 1AM1A 4MP7A 5D6QA 3HZ5A 2YKCA 2YE2A 4K4OA 4NH7A 4MPNA 4XKOA 3C0EA 4U7OA 1TIDA 3D2RA 3B26A 3U67A 4FCPA 2AKPA 2Q8IA 4ASGA 2WERA 1I5CA 2CG9A 4BAEA 4YKXA 2YE3A 3O0IA 4I3HA 2GQPA 4YKUA 4BXIA 2CCSA 1NHHA 4O09A 1L0OA 1Y8PA 4YKQA 3CRKA 2XDKA 2IWUA 1YSZA 1UYGA 1I59A 3T0ZA 5BODA 5FNFA 4LWEA 4FPPA 2FWYA 2YGAA 1BXDA 3NMQA 3EHHA 1UYHA 2BZ5A 4NH8A 2EXLA 3T10A 2XX5A 2YK2A 3K97A 4HXWA 2XJGA 3EHFA 3PEJA 4GT8A 4CWTA 1YC1A 2QG2A 1EI1A 4JASA 4CWNA 3K98A 3BM9A 2YEHA 3SL2A 2H55A 1U0ZA 3OW6A 4WUBA 2BU6A 2XCMA 2YKIA 4EFTA 2FXSA 3QTFA 1BYQA 3GIGB 3OWDA 5CF0A 1YESA 3FV5A 5IN9A 1KIJA 2WI5A 3OPDA 2XDUA 2O1VA 4WUCA 2XDXA 5C93A 3PEHA 4GGLA 3Q5LA 4YKYA 2FYPA 1PVGA 3EHJA 3RLRA 4NH9A 3RLPA 5BOCA 1Y8OA 5FNDA 2BREA 4KSHA 3IEDA 4URMA 1GKZA 2YEIA 3HYZA 2O1UA 4DUHA 1Z59A 4GEEA 2C2AA 3ZKBA 3EKOA 2YKJA 2ESAA 4GFNA 1ZWHA 2XJXA 4XIQA 4BIUA 1YT1A 4XD8A 4EEHA 4R3AA 2IOPA 3T1KA 1I5BA 3Q5JA 1UYFA 1Y4SA 3R4NA 4HZ0A 2VWCA 4KFGA 4LWFA 2HKJA 4XCLA 3A0XA 4GQTA 2VCJA 1Z5AA 2YI7A 4H85A 1UY9A 5L3JA 3HZ1A 2YI0A
chains in the Genus database with same CATH superfamily
1TBWA 1QZRA 3B28A 1U2OA 3TUHA 4R1FA 2WEPA 3VHCA 2BU8A 4L93A 4XC0A 1S16A 5M4PA 5M4KA 1YETA 2YEAA 3B24A 4ASAA 2WI4A 2XD6A 4YKRA 1TH8A 5D7CA 3S5TA 1UYMA 2WEQA 3R92A 4JQLA 1QYEA 2JJCA 2YE9A 1UY6A 4YKTA 4R3MA 4AWOA 1UY8A 1THNA 2BRCA 3G7BA 1I58A 3VHAA 2ZDYA 4XKAA 1YS3A 3KE6A 2BU2A 4XIRA 4O04A 4O07A 4HXZA 1H7UA 4PRVA 3R4PA 1YSRA 4YKZA 3INWA 3D36A 4P8OA 5CPHA 4EGHA 4BIZA 3HEKA 2Q2EB 2XDLA 1MU5A 2YEBA 1A4HA 3CGYA 4B6CA 4CWSA 4EGIA 4ASBA 4B7PA 1GKXA 4BQJA 4MOTA 4LWHA 3U2KA 1Z5BA 1Z5CA 1B62A 1AJ6A 3GIGA 2WI7A 3O6OA 2FWZA 2YE8A 1US7A 1B3QA 1UYLA 2YGEA 2QG0A 3VADA 3HYYA 4H7QA 1BKNA 2ZBKB 3VHDA 4KQVA 3TZ0A 4XE2A 3A0WA 1TILA 2BYIA 2YEJA 1I5AA 3K60A 1I5DA 4XITA 3OWBA 4XDMA 1YC4A 5CTUA 2ZDXA 5J6AA 4CWRA 1ZW9A 3ZKDA 3CRLA 1NHJA 4P7AA 1ZXMA 3FT5A 2C1GA 5J71A 2YJXA 1IXMA 5CTWA 1YT0A 1S14A 1GJVA 3EKRA 2CGFA 2YKEA 3A0TA 1OSFA 2WI1A 3CGZA 1TC6A 3C11A 4CWOA 3DGEA 2WI6A 3T0HA 4XTJA 4W7TA 4XIPA 2IOQA 3JZ3A 2YE5A 3R91A 4AWQA 4YKWA 3GIEA 4UROA 4CWQA 4ASFA 4V26A 3U2DA 5CTYA 3A0ZA 3Q5KA 3MNRP 2YEEA 3BMYA 3WHAA 3ZXOA 4JAUA 3G75A 4HY6A 2HG1A 2YI5A 1AH8A 2YE4A 1Y8NA 5D7RA 4CE3A 2FTKA 4FMTA 1YERA 2HHIA 2XDSA 4GCZA 4PRXA 4CE1A 2PNRA 3LPSA 3R4OA 2H8MA 2BTZA 5FNCA 4HZ5A 4H81A 4XKKA 5GGZA 2YK9A 4L91A 3TZ4A 2QFOA 2BSMA 3H80A 4CE2A 5M4MA 3O2FA 2YJWA 2Q8GA 1UY7A 2C1IA 3EHGA 2Q8FA 4MB9A 2YE7A 2XX4A 4CWFA 2YEFA 4QPJA 1UYKA 3CWVA 5M4EA 3A0RA 4DZYA 3ZM7A 1UYCA 3ZXQA 2ZKJA 1R62A 1UYDA 4E00A 1ZXNA 3TZ5A 4AWPA 4O0BA 3K99A 2YI6A 3B25A 4HYMA 2UWDA 3T2SA 1JM6A 2XX2A 4QPKA 4L94A 4LWIA 4O05A 2HCHA 2YE6A 2GFDA 4MP2A 4KTNA 2XHXA 4Q20A 5M4HA 4MBCA 2WI2A 4EM7A 5D6PA 2O1WA 3B27A 1BGQA 5M4NA 1ID0A 2YECA 1NHIA 2QF6A 3QDDA 4L90A 2XHTA 4X9LA 4CWPA 2YEGA 3D0BA 3A0YA 4URNA 2BT0A 2CCUA 4HY1A 3TZ2A 2WI3A 3RKZA 5IDJA 2IORA 2JKIA 2BYHA 3G7EA 4FCQA 3GIFA 3R4MA 1F51A 5CTXA 2Q8HA 1H7SA 4URLA 3WQ9A 3H4LA 3RLQA 3LNUA 3TTZA 1KZNA 5F5RA 4LWGA 2BU7A 2XJJA 1AH6A 1QY8A 4HYPA 1Y4UA 1TC0A 4JAVA 4MPEA 2XHRA 2CCTA 4ZKIA 4ZVIA 1UYEA 4KSGA 4L8ZA 4PU9A 4EGKA 1EA6A 2E0AA 2YKBA 1UYIA 5F3KA 2IWXA 2XABA 5JENA 4LPBA 4EMVA 4BQGA 4E02A 2CH4A 2VW5A 2YGFA 4WUDA 2K5BA 3FT8A 4U7NA 2BU5A 3OMUA 2VCIA 4PL9A 4E01A 1AMWA 4I5SA 1YT2A 2XK2A 4XCJA 4AS9A 3HHUA 5D7DA 5FWKA 4V25A 3INXA 4MPCA 1YC3A 4FCRA 4KP4A 1MX0A 4EFUA 1B63A 2YEDA 2IWSA 5IDMA 4U93A 4LP0A 1AM1A 4MP7A 5D6QA 3HZ5A 2YKCA 2YE2A 4K4OA 4NH7A 4MPNA 4XKOA 3C0EA 4U7OA 1TIDA 3D2RA 3B26A 3U67A 4FCPA 2AKPA 2Q8IA 4ASGA 2WERA 1I5CA 2CG9A 4BAEA 4YKXA 2YE3A 3O0IA 4I3HA 2GQPA 4YKUA 4BXIA 2CCSA 1NHHA 4O09A 1L0OA 1Y8PA 4YKQA 3CRKA 2XDKA 2IWUA 1YSZA 1UYGA 1I59A 3T0ZA 3LMMA 5BODA 5FNFA 4LWEA 4FPPA 2FWYA 2YGAA 1BXDA 3NMQA 3EHHA 1UYHA 2BZ5A 4NH8A 2EXLA 3T10A 2XX5A 2YK2A 3K97A 4HXWA 4E72A 2XJGA 3EHFA 3PEJA 4GT8A 4CWTA 1YC1A 2QG2A 1EI1A 4JASA 4CWNA 3K98A 3BM9A 2YEHA 3CYGA 3SL2A 2H55A 1U0ZA 3OW6A 4WUBA 2BU6A 2XCMA 2YKIA 4EFTA 2FXSA 3QTFA 1BYQA 3GIGB 3OWDA 5CF0A 1YESA 3FV5A 5IN9A 1KIJA 2WI5A 3OPDA 2XDUA 2O1VA 4WUCA 2XDXA 5C93A 3PEHA 4GGLA 3Q5LA 4YKYA 2FYPA 1PVGA 3EHJA 3RLRA 4NH9A 3RLPA 5BOCA 1Y8OA 5FNDA 2BREA 4KSHA 3IEDA 4URMA 1GKZA 2YEIA 3HYZA 2O1UA 4DUHA 1Z59A 4GEEA 2C2AA 3ZKBA 3EKOA 2YKJA 2ESAA 4GFNA 1ZWHA 2XJXA 4XIQA 4BIUA 1YT1A 4XD8A 4EEHA 4R3AA 2IOPA 3T1KA 1I5BA 3Q5JA 1UYFA 1Y4SA 3R4NA 4HZ0A 2VWCA 4KFGA 4LWFA 2HKJA 4XCLA 3A0XA 4GQTA 2VCJA 1Z5AA 2YI7A 4H85A 1UY9A 5L3JA 3HZ1A 2YI0A
chains in the Genus database with same CATH topology
1TBWA 1QZRA 3B28A 1U2OA 3TUHA 4R1FA 2WEPA 3VHCA 2BU8A 4L93A 4XC0A 1S16A 5M4PA 5M4KA 1YETA 2YEAA 3B24A 4ASAA 2WI4A 2XD6A 4YKRA 1TH8A 5D7CA 1UYMA 2WEQA 3R92A 4JQLA 1QYEA 2JJCA 2YE9A 1UY6A 4YKTA 4R3MA 4AWOA 1UY8A 1THNA 2BRCA 3G7BA 1I58A 3VHAA 2ZDYA 4XKAA 1YS3A 3KE6A 2BU2A 4XIRA 4O04A 4O07A 4HXZA 1H7UA 4PRVA 3R4PA 1YSRA 4YKZA 3INWA 3D36A 4P8OA 5CPHA 4EGHA 4BIZA 3HEKA 2Q2EB 2XDLA 1MU5A 2YEBA 1A4HA 3CGYA 4B6CA 4CWSA 4EGIA 4ASBA 4B7PA 1GKXA 4BQJA 4MOTA 4LWHA 3U2KA 1Z5BA 1Z5CA 1B62A 1AJ6A 3GIGA 2WI7A 3O6OA 2FWZA 2YE8A 1US7A 1B3QA 1UYLA 2YGEA 2QG0A 3VADA 3HYYA 4H7QA 1BKNA 2ZBKB 3VHDA 4KQVA 3TZ0A 4XE2A 3A0WA 1TILA 2BYIA 2YEJA 1I5AA 3K60A 1I5DA 4XITA 3OWBA 4XDMA 1YC4A 5CTUA 2ZDXA 5J6AA 4CWRA 1ZW9A 3ZKDA 3CRLA 1NHJA 4P7AA 1ZXMA 3FT5A 5J71A 2YJXA 5CTWA 1YT0A 1S14A 1GJVA 3EKRA 2CGFA 2YKEA 3A0TA 1OSFA 2WI1A 3CGZA 1TC6A 3C11A 4CWOA 3DGEA 2WI6A 3T0HA 4XTJA 4W7TA 4XIPA 2IOQA 3JZ3A 2YE5A 3R91A 4AWQA 4YKWA 3GIEA 4UROA 4CWQA 4ASFA 4V26A 3U2DA 5CTYA 3A0ZA 3Q5KA 3MNRP 2YEEA 3BMYA 3WHAA 3ZXOA 4JAUA 3G75A 4HY6A 2HG1A 2YI5A 1AH8A 2YE4A 1Y8NA 5D7RA 4CE3A 4FMTA 1YERA 2XDSA 4GCZA 4PRXA 4CE1A 2PNRA 3LPSA 3R4OA 2H8MA 2BTZA 5FNCA 4HZ5A 4H81A 4XKKA 5GGZA 2YK9A 4L91A 3TZ4A 2QFOA 2BSMA 3H80A 4CE2A 5M4MA 3O2FA 2YJWA 2Q8GA 1UY7A 3EHGA 2Q8FA 4MB9A 2YE7A 2XX4A 4CWFA 2YEFA 4QPJA 1UYKA 3CWVA 5M4EA 3A0RA 4DZYA 3ZM7A 1UYCA 3ZXQA 2ZKJA 1R62A 1UYDA 4E00A 1ZXNA 3TZ5A 4AWPA 4O0BA 3K99A 2YI6A 3B25A 4HYMA 2UWDA 3T2SA 1JM6A 2XX2A 4QPKA 4L94A 4LWIA 4O05A 2HCHA 2YE6A 2GFDA 4MP2A 4KTNA 2XHXA 4Q20A 5M4HA 4MBCA 2WI2A 4EM7A 5D6PA 2O1WA 3B27A 1BGQA 5M4NA 1ID0A 2YECA 1NHIA 2QF6A 3QDDA 4L90A 2XHTA 4X9LA 4CWPA 2YEGA 3D0BA 3A0YA 4URNA 2BT0A 2CCUA 4HY1A 3TZ2A 2WI3A 3RKZA 5IDJA 2IORA 2JKIA 2BYHA 3G7EA 4FCQA 3GIFA 3R4MA 5CTXA 2Q8HA 1H7SA 4URLA 3WQ9A 3H4LA 3RLQA 3LNUA 3TTZA 1KZNA 5F5RA 4LWGA 2BU7A 2XJJA 1AH6A 1QY8A 4HYPA 1Y4UA 1TC0A 4JAVA 4MPEA 2XHRA 2CCTA 4ZKIA 4ZVIA 1UYEA 4KSGA 4L8ZA 4PU9A 4EGKA 1EA6A 2E0AA 2YKBA 1UYIA 5F3KA 2IWXA 2XABA 4LPBA 4EMVA 4BQGA 4E02A 2CH4A 2VW5A 2YGFA 4WUDA 2K5BA 3FT8A 4U7NA 2BU5A 3OMUA 2VCIA 4PL9A 4E01A 1AMWA 4I5SA 1YT2A 2XK2A 4XCJA 4AS9A 3HHUA 5D7DA 5FWKA 4V25A 3INXA 4MPCA 1YC3A 4FCRA 4KP4A 1MX0A 4EFUA 1B63A 2YEDA 2IWSA 5IDMA 4U93A 4LP0A 1AM1A 4MP7A 5D6QA 3HZ5A 2YKCA 2YE2A 4K4OA 4NH7A 4MPNA 4XKOA 3C0EA 4U7OA 1TIDA 3D2RA 3B26A 3U67A 4FCPA 2AKPA 2Q8IA 4ASGA 2WERA 1I5CA 2CG9A 4BAEA 4YKXA 2YE3A 3O0IA 4I3HA 2GQPA 4YKUA 4BXIA 2CCSA 1NHHA 4O09A 1L0OA 1Y8PA 4YKQA 3CRKA 2XDKA 2IWUA 1YSZA 1UYGA 1I59A 3T0ZA 5BODA 5FNFA 4LWEA 4FPPA 2FWYA 2YGAA 1BXDA 3NMQA 3EHHA 1UYHA 2BZ5A 4NH8A 2EXLA 3T10A 2XX5A 2YK2A 3K97A 4HXWA 2XJGA 3EHFA 3PEJA 4GT8A 4CWTA 1YC1A 2QG2A 1EI1A 4JASA 4CWNA 3K98A 3BM9A 2YEHA 3SL2A 2H55A 1U0ZA 3OW6A 4WUBA 2BU6A 2XCMA 2YKIA 4EFTA 2FXSA 3QTFA 1BYQA 3GIGB 3OWDA 5CF0A 1YESA 3FV5A 5IN9A 1KIJA 2WI5A 3OPDA 2XDUA 2O1VA 4WUCA 2XDXA 5C93A 3PEHA 4GGLA 3Q5LA 4YKYA 2FYPA 1PVGA 3EHJA 3RLRA 4NH9A 3RLPA 5BOCA 1Y8OA 5FNDA 2BREA 4KSHA 3IEDA 4URMA 1GKZA 2YEIA 3HYZA 2O1UA 4DUHA 1Z59A 4GEEA 2C2AA 3ZKBA 3EKOA 2YKJA 2ESAA 4GFNA 1ZWHA 2XJXA 4XIQA 4BIUA 1YT1A 4XD8A 4EEHA 4R3AA 2IOPA 3T1KA 1I5BA 3Q5JA 1UYFA 1Y4SA 3R4NA 4HZ0A 2VWCA 4KFGA 4LWFA 2HKJA 4XCLA 3A0XA 4GQTA 2VCJA 1Z5AA 2YI7A 4H85A 1UY9A 5L3JA 3HZ1A 2YI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBW A;  1QZR A;  3B28 A;  1U2O A;  3TUH A;  4R1F A;  2WEP A;  3VHC A;  2BU8 A;  4L93 A;  4XC0 A;  1S16 A;  5M4P A;  5M4K A;  1YET A;  2YEA A;  3B24 A;  4ASA A;  2WI4 A;  2XD6 A;  4YKR A;  1TH8 A;  5D7C A;  1UYM A;  2WEQ A;  3R92 A;  4JQL A;  1QYE A;  2JJC A;  2YE9 A;  1UY6 A;  4YKT A;  4R3M A;  4AWO A;  1UY8 A;  1THN A;  2BRC A;  3G7B A;  1I58 A;  3VHA A;  2ZDY A;  4XKA A;  1YS3 A;  3KE6 A;  2BU2 A;  4XIR A;  4O04 A;  4O07 A;  4HXZ A;  1H7U A;  4PRV A;  3R4P A;  1YSR A;  4YKZ A;  3INW A;  3D36 A;  4P8O A;  5CPH A;  4EGH A;  4BIZ A;  3HEK A;  2Q2E B;  2XDL A;  1MU5 A;  2YEB A;  1A4H A;  3CGY A;  4B6C A;  4CWS A;  4EGI A;  4ASB A;  4B7P A;  1GKX A;  4BQJ A;  4MOT A;  4LWH A;  3U2K A;  1Z5B A;  1Z5C A;  1B62 A;  1AJ6 A;  3GIG A;  2WI7 A;  3O6O A;  2FWZ A;  2YE8 A;  1US7 A;  1B3Q A;  1UYL A;  2YGE A;  2QG0 A;  3VAD A;  3HYY A;  4H7Q A;  1BKN A;  2ZBK B;  3VHD A;  4KQV A;  3TZ0 A;  4XE2 A;  3A0W A;  1TIL A;  2BYI A;  2YEJ A;  1I5A A;  3K60 A;  1I5D A;  4XIT A;  3OWB A;  4XDM A;  1YC4 A;  5CTU A;  2ZDX A;  5J6A A;  4CWR A;  1ZW9 A;  3ZKD A;  3CRL A;  1NHJ A;  4P7A A;  1ZXM A;  3FT5 A;  5J71 A;  2YJX A;  5CTW A;  1YT0 A;  1S14 A;  1GJV A;  3EKR A;  2CGF A;  2YKE A;  3A0T A;  1OSF A;  2WI1 A;  3CGZ A;  1TC6 A;  3C11 A;  4CWO A;  3DGE A;  2WI6 A;  3T0H A;  4XTJ A;  4W7T A;  4XIP A;  2IOQ A;  3JZ3 A;  2YE5 A;  3R91 A;  4AWQ A;  4YKW A;  3GIE A;  4URO A;  4CWQ A;  4ASF A;  4V26 A;  3U2D A;  5CTY A;  3A0Z A;  3Q5K A;  3MNR P;  2YEE A;  3BMY A;  3WHA A;  3ZXO A;  4JAU A;  3G75 A;  4HY6 A;  2HG1 A;  2YI5 A;  1AH8 A;  2YE4 A;  1Y8N A;  5D7R A;  4CE3 A;  4FMT A;  1YER A;  2XDS A;  4GCZ A;  4PRX A;  4CE1 A;  2PNR A;  3LPS A;  3R4O A;  2H8M A;  2BTZ A;  5FNC A;  4HZ5 A;  4H81 A;  4XKK A;  5GGZ A;  2YK9 A;  4L91 A;  3TZ4 A;  2QFO A;  2BSM A;  3H80 A;  4CE2 A;  5M4M A;  3O2F A;  2YJW A;  2Q8G A;  1UY7 A;  3EHG A;  2Q8F A;  4MB9 A;  2YE7 A;  2XX4 A;  4CWF A;  2YEF A;  4QPJ A;  1UYK A;  3CWV A;  5M4E A;  3A0R A;  4DZY A;  3ZM7 A;  1UYC A;  3ZXQ A;  2ZKJ A;  1R62 A;  1UYD A;  4E00 A;  1ZXN A;  3TZ5 A;  4AWP A;  4O0B A;  3K99 A;  2YI6 A;  3B25 A;  4HYM A;  2UWD A;  3T2S A;  1JM6 A;  2XX2 A;  4QPK A;  4L94 A;  4LWI A;  4O05 A;  2HCH A;  2YE6 A;  2GFD A;  4MP2 A;  4KTN A;  2XHX A;  4Q20 A;  5M4H A;  4MBC A;  2WI2 A;  4EM7 A;  5D6P A;  2O1W A;  3B27 A;  1BGQ A;  5M4N A;  1ID0 A;  2YEC A;  1NHI A;  2QF6 A;  3QDD A;  4L90 A;  2XHT A;  4X9L A;  4CWP A;  2YEG A;  3D0B A;  3A0Y A;  4URN A;  2BT0 A;  2CCU A;  4HY1 A;  3TZ2 A;  2WI3 A;  3RKZ A;  5IDJ A;  2IOR A;  2JKI A;  2BYH A;  3G7E A;  4FCQ A;  3GIF A;  3R4M A;  5CTX A;  2Q8H A;  1H7S A;  4URL A;  3WQ9 A;  3H4L A;  3RLQ A;  3LNU A;  3TTZ A;  1KZN A;  5F5R A;  4LWG A;  2BU7 A;  2XJJ A;  1AH6 A;  1QY8 A;  4HYP A;  1Y4U A;  1TC0 A;  4JAV A;  4MPE A;  2XHR A;  2CCT A;  4ZKI A;  4ZVI A;  1UYE A;  4KSG A;  4L8Z A;  4PU9 A;  4EGK A;  1EA6 A;  2E0A A;  2YKB A;  1UYI A;  5F3K A;  2IWX A;  2XAB A;  4LPB A;  4EMV A;  4BQG A;  4E02 A;  2CH4 A;  2VW5 A;  2YGF A;  4WUD A;  2K5B A;  3FT8 A;  4U7N A;  2BU5 A;  3OMU A;  2VCI A;  4PL9 A;  4E01 A;  1AMW A;  4I5S A;  1YT2 A;  2XK2 A;  4XCJ A;  4AS9 A;  3HHU A;  5D7D A;  5FWK A;  4V25 A;  3INX A;  4MPC A;  1YC3 A;  4FCR A;  4KP4 A;  1MX0 A;  4EFU A;  1B63 A;  2YED A;  2IWS A;  5IDM A;  4U93 A;  4LP0 A;  1AM1 A;  4MP7 A;  5D6Q A;  3HZ5 A;  2YKC A;  2YE2 A;  4K4O A;  4NH7 A;  4MPN A;  4XKO A;  3C0E A;  4U7O A;  1TID A;  3D2R A;  3B26 A;  3U67 A;  4FCP A;  2AKP A;  2Q8I A;  4ASG A;  2WER A;  1I5C A;  2CG9 A;  4BAE A;  4YKX A;  2YE3 A;  3O0I A;  4I3H A;  2GQP A;  4YKU A;  4BXI A;  2CCS A;  1NHH A;  4O09 A;  1L0O A;  1Y8P A;  4YKQ A;  3CRK A;  2XDK A;  2IWU A;  1YSZ A;  1UYG A;  1I59 A;  3T0Z A;  5BOD A;  5FNF A;  4LWE A;  4FPP A;  2FWY A;  2YGA A;  1BXD A;  3NMQ A;  3EHH A;  1UYH A;  2BZ5 A;  4NH8 A;  2EXL A;  3T10 A;  2XX5 A;  2YK2 A;  3K97 A;  4HXW A;  2XJG A;  3EHF A;  3PEJ A;  4GT8 A;  4CWT A;  1YC1 A;  2QG2 A;  1EI1 A;  4JAS A;  4CWN A;  3K98 A;  3BM9 A;  2YEH A;  3SL2 A;  2H55 A;  1U0Z A;  3OW6 A;  4WUB A;  2BU6 A;  2XCM A;  2YKI A;  4EFT A;  2FXS A;  3QTF A;  1BYQ A;  3GIG B;  3OWD A;  5CF0 A;  1YES A;  3FV5 A;  5IN9 A;  1KIJ A;  2WI5 A;  3OPD A;  2XDU A;  2O1V A;  4WUC A;  2XDX A;  5C93 A;  3PEH A;  4GGL A;  3Q5L A;  4YKY A;  2FYP A;  1PVG A;  3EHJ A;  3RLR A;  4NH9 A;  3RLP A;  5BOC A;  1Y8O A;  5FND A;  2BRE A;  4KSH A;  3IED A;  4URM A;  1GKZ A;  2YEI A;  3HYZ A;  2O1U A;  4DUH A;  1Z59 A;  4GEE A;  2C2A A;  3ZKB A;  3EKO A;  2YKJ A;  2ESA A;  4GFN A;  1ZWH A;  2XJX A;  4XIQ A;  4BIU A;  1YT1 A;  4XD8 A;  4EEH A;  4R3A A;  2IOP A;  3T1K A;  1I5B A;  3Q5J A;  1UYF A;  1Y4S A;  3R4N A;  4HZ0 A;  2VWC A;  4KFG A;  4LWF A;  2HKJ A;  4XCL A;  3A0X A;  4GQT A;  2VCJ A;  1Z5A A;  2YI7 A;  4H85 A;  1UY9 A;  5L3J A;  3HZ1 A;  2YI0 A; 
#chains in the Genus database with same CATH topology
 1TBW A;  1QZR A;  3B28 A;  1U2O A;  3TUH A;  4R1F A;  2WEP A;  3VHC A;  2BU8 A;  4L93 A;  4XC0 A;  1S16 A;  5M4P A;  5M4K A;  1YET A;  2YEA A;  3B24 A;  4ASA A;  2WI4 A;  2XD6 A;  4YKR A;  1TH8 A;  5D7C A;  3S5T A;  1UYM A;  2WEQ A;  3R92 A;  4JQL A;  1QYE A;  2JJC A;  2YE9 A;  1UY6 A;  4YKT A;  4R3M A;  4AWO A;  1UY8 A;  1THN A;  2BRC A;  3G7B A;  1I58 A;  3VHA A;  2ZDY A;  4XKA A;  1YS3 A;  3KE6 A;  2BU2 A;  4XIR A;  4O04 A;  4O07 A;  4HXZ A;  1H7U A;  4PRV A;  3R4P A;  1YSR A;  4YKZ A;  3INW A;  3D36 A;  4P8O A;  5CPH A;  4EGH A;  4BIZ A;  3HEK A;  2Q2E B;  2XDL A;  1MU5 A;  2YEB A;  1A4H A;  3CGY A;  4B6C A;  4CWS A;  4EGI A;  4ASB A;  4B7P A;  1GKX A;  4BQJ A;  4MOT A;  4LWH A;  3U2K A;  1Z5B A;  1Z5C A;  1B62 A;  1AJ6 A;  3GIG A;  2WI7 A;  3O6O A;  2FWZ A;  2YE8 A;  1US7 A;  1B3Q A;  1UYL A;  2YGE A;  2QG0 A;  3VAD A;  3HYY A;  4H7Q A;  1BKN A;  2ZBK B;  3VHD A;  4KQV A;  3TZ0 A;  4XE2 A;  3A0W A;  1TIL A;  2BYI A;  2YEJ A;  1I5A A;  3K60 A;  1I5D A;  4XIT A;  3OWB A;  4XDM A;  1YC4 A;  5CTU A;  2ZDX A;  5J6A A;  4CWR A;  1ZW9 A;  3ZKD A;  3CRL A;  1NHJ A;  4P7A A;  1ZXM A;  3FT5 A;  2C1G A;  5J71 A;  2YJX A;  1IXM A;  5CTW A;  1YT0 A;  1S14 A;  1GJV A;  3EKR A;  2CGF A;  2YKE A;  3A0T A;  1OSF A;  2WI1 A;  3CGZ A;  1TC6 A;  3C11 A;  4CWO A;  3DGE A;  2WI6 A;  3T0H A;  4XTJ A;  4W7T A;  4XIP A;  2IOQ A;  3JZ3 A;  2YE5 A;  3R91 A;  4AWQ A;  4YKW A;  3GIE A;  4URO A;  4CWQ A;  4ASF A;  4V26 A;  3U2D A;  5CTY A;  3A0Z A;  3Q5K A;  3MNR P;  2YEE A;  3BMY A;  3WHA A;  3ZXO A;  4JAU A;  3G75 A;  4HY6 A;  2HG1 A;  2YI5 A;  1AH8 A;  2YE4 A;  1Y8N A;  5D7R A;  4CE3 A;  2FTK A;  4FMT A;  1YER A;  2HHI A;  2XDS A;  4GCZ A;  4PRX A;  4CE1 A;  2PNR A;  3LPS A;  3R4O A;  2H8M A;  2BTZ A;  5FNC A;  4HZ5 A;  4H81 A;  4XKK A;  5GGZ A;  2YK9 A;  4L91 A;  3TZ4 A;  2QFO A;  2BSM A;  3H80 A;  4CE2 A;  5M4M A;  3O2F A;  2YJW A;  2Q8G A;  1UY7 A;  2C1I A;  3EHG A;  2Q8F A;  4MB9 A;  2YE7 A;  2XX4 A;  4CWF A;  2YEF A;  4QPJ A;  1UYK A;  3CWV A;  5M4E A;  3A0R A;  4DZY A;  3ZM7 A;  1UYC A;  3ZXQ A;  2ZKJ A;  1R62 A;  1UYD A;  4E00 A;  1ZXN A;  3TZ5 A;  4AWP A;  4O0B A;  3K99 A;  2YI6 A;  3B25 A;  4HYM A;  2UWD A;  3T2S A;  1JM6 A;  2XX2 A;  4QPK A;  4L94 A;  4LWI A;  4O05 A;  2HCH A;  2YE6 A;  2GFD A;  4MP2 A;  4KTN A;  2XHX A;  4Q20 A;  5M4H A;  4MBC A;  2WI2 A;  4EM7 A;  5D6P A;  2O1W A;  3B27 A;  1BGQ A;  5M4N A;  1ID0 A;  2YEC A;  1NHI A;  2QF6 A;  3QDD A;  4L90 A;  2XHT A;  4X9L A;  4CWP A;  2YEG A;  3D0B A;  3A0Y A;  4URN A;  2BT0 A;  2CCU A;  4HY1 A;  3TZ2 A;  2WI3 A;  3RKZ A;  5IDJ A;  2IOR A;  2JKI A;  2BYH A;  3G7E A;  4FCQ A;  3GIF A;  3R4M A;  1F51 A;  5CTX A;  2Q8H A;  1H7S A;  4URL A;  3WQ9 A;  3H4L A;  3RLQ A;  3LNU A;  3TTZ A;  1KZN A;  5F5R A;  4LWG A;  2BU7 A;  2XJJ A;  1AH6 A;  1QY8 A;  4HYP A;  1Y4U A;  1TC0 A;  4JAV A;  4MPE A;  2XHR A;  2CCT A;  4ZKI A;  4ZVI A;  1UYE A;  4KSG A;  4L8Z A;  4PU9 A;  4EGK A;  1EA6 A;  2E0A A;  2YKB A;  1UYI A;  5F3K A;  2IWX A;  2XAB A;  5JEN A;  4LPB A;  4EMV A;  4BQG A;  4E02 A;  2CH4 A;  2VW5 A;  2YGF A;  4WUD A;  2K5B A;  3FT8 A;  4U7N A;  2BU5 A;  3OMU A;  2VCI A;  4PL9 A;  4E01 A;  1AMW A;  4I5S A;  1YT2 A;  2XK2 A;  4XCJ A;  4AS9 A;  3HHU A;  5D7D A;  5FWK A;  4V25 A;  3INX A;  4MPC A;  1YC3 A;  4FCR A;  4KP4 A;  1MX0 A;  4EFU A;  1B63 A;  2YED A;  2IWS A;  5IDM A;  4U93 A;  4LP0 A;  1AM1 A;  4MP7 A;  5D6Q A;  3HZ5 A;  2YKC A;  2YE2 A;  4K4O A;  4NH7 A;  4MPN A;  4XKO A;  3C0E A;  4U7O A;  1TID A;  3D2R A;  3B26 A;  3U67 A;  4FCP A;  2AKP A;  2Q8I A;  4ASG A;  2WER A;  1I5C A;  2CG9 A;  4BAE A;  4YKX A;  2YE3 A;  3O0I A;  4I3H A;  2GQP A;  4YKU A;  4BXI A;  2CCS A;  1NHH A;  4O09 A;  1L0O A;  1Y8P A;  4YKQ A;  3CRK A;  2XDK A;  2IWU A;  1YSZ A;  1UYG A;  1I59 A;  3T0Z A;  3LMM A;  5BOD A;  5FNF A;  4LWE A;  4FPP A;  2FWY A;  2YGA A;  1BXD A;  3NMQ A;  3EHH A;  1UYH A;  2BZ5 A;  4NH8 A;  2EXL A;  3T10 A;  2XX5 A;  2YK2 A;  3K97 A;  4HXW A;  4E72 A;  2XJG A;  3EHF A;  3PEJ A;  4GT8 A;  4CWT A;  1YC1 A;  2QG2 A;  1EI1 A;  4JAS A;  4CWN A;  3K98 A;  3BM9 A;  2YEH A;  3CYG A;  3SL2 A;  2H55 A;  1U0Z A;  3OW6 A;  4WUB A;  2BU6 A;  2XCM A;  2YKI A;  4EFT A;  2FXS A;  3QTF A;  1BYQ A;  3GIG B;  3OWD A;  5CF0 A;  1YES A;  3FV5 A;  5IN9 A;  1KIJ A;  2WI5 A;  3OPD A;  2XDU A;  2O1V A;  4WUC A;  2XDX A;  5C93 A;  3PEH A;  4GGL A;  3Q5L A;  4YKY A;  2FYP A;  1PVG A;  3EHJ A;  3RLR A;  4NH9 A;  3RLP A;  5BOC A;  1Y8O A;  5FND A;  2BRE A;  4KSH A;  3IED A;  4URM A;  1GKZ A;  2YEI A;  3HYZ A;  2O1U A;  4DUH A;  1Z59 A;  4GEE A;  2C2A A;  3ZKB A;  3EKO A;  2YKJ A;  2ESA A;  4GFN A;  1ZWH A;  2XJX A;  4XIQ A;  4BIU A;  1YT1 A;  4XD8 A;  4EEH A;  4R3A A;  2IOP A;  3T1K A;  1I5B A;  3Q5J A;  1UYF A;  1Y4S A;  3R4N A;  4HZ0 A;  2VWC A;  4KFG A;  4LWF A;  2HKJ A;  4XCL A;  3A0X A;  4GQT A;  2VCJ A;  1Z5A A;  2YI7 A;  4H85 A;  1UY9 A;  5L3J A;  3HZ1 A;  2YI0 A; 
#chains in the Genus database with same CATH homology
 1TBW A;  1QZR A;  3B28 A;  1U2O A;  3TUH A;  4R1F A;  2WEP A;  3VHC A;  2BU8 A;  4L93 A;  4XC0 A;  1S16 A;  5M4P A;  5M4K A;  1YET A;  2YEA A;  3B24 A;  4ASA A;  2WI4 A;  2XD6 A;  4YKR A;  1TH8 A;  5D7C A;  1UYM A;  2WEQ A;  3R92 A;  4JQL A;  1QYE A;  2JJC A;  2YE9 A;  1UY6 A;  4YKT A;  4R3M A;  4AWO A;  1UY8 A;  1THN A;  2BRC A;  3G7B A;  1I58 A;  3VHA A;  2ZDY A;  4XKA A;  1YS3 A;  3KE6 A;  2BU2 A;  4XIR A;  4O04 A;  4O07 A;  4HXZ A;  1H7U A;  4PRV A;  3R4P A;  1YSR A;  4YKZ A;  3INW A;  3D36 A;  4P8O A;  5CPH A;  4EGH A;  4BIZ A;  3HEK A;  2Q2E B;  2XDL A;  1MU5 A;  2YEB A;  1A4H A;  3CGY A;  4B6C A;  4CWS A;  4EGI A;  4ASB A;  4B7P A;  1GKX A;  4BQJ A;  4MOT A;  4LWH A;  3U2K A;  1Z5B A;  1Z5C A;  1B62 A;  1AJ6 A;  3GIG A;  2WI7 A;  3O6O A;  2FWZ A;  2YE8 A;  1US7 A;  1B3Q A;  1UYL A;  2YGE A;  2QG0 A;  3VAD A;  3HYY A;  4H7Q A;  1BKN A;  2ZBK B;  3VHD A;  4KQV A;  3TZ0 A;  4XE2 A;  3A0W A;  1TIL A;  2BYI A;  2YEJ A;  1I5A A;  3K60 A;  1I5D A;  4XIT A;  3OWB A;  4XDM A;  1YC4 A;  5CTU A;  2ZDX A;  5J6A A;  4CWR A;  1ZW9 A;  3ZKD A;  3CRL A;  1NHJ A;  4P7A A;  1ZXM A;  3FT5 A;  5J71 A;  2YJX A;  5CTW A;  1YT0 A;  1S14 A;  1GJV A;  3EKR A;  2CGF A;  2YKE A;  3A0T A;  1OSF A;  2WI1 A;  3CGZ A;  1TC6 A;  3C11 A;  4CWO A;  3DGE A;  2WI6 A;  3T0H A;  4XTJ A;  4W7T A;  4XIP A;  2IOQ A;  3JZ3 A;  2YE5 A;  3R91 A;  4AWQ A;  4YKW A;  3GIE A;  4URO A;  4CWQ A;  4ASF A;  4V26 A;  3U2D A;  5CTY A;  3A0Z A;  3Q5K A;  3MNR P;  2YEE A;  3BMY A;  3WHA A;  3ZXO A;  4JAU A;  3G75 A;  4HY6 A;  2HG1 A;  2YI5 A;  1AH8 A;  2YE4 A;  1Y8N A;  5D7R A;  4CE3 A;  4FMT A;  1YER A;  2XDS A;  4GCZ A;  4PRX A;  4CE1 A;  2PNR A;  3LPS A;  3R4O A;  2H8M A;  2BTZ A;  5FNC A;  4HZ5 A;  4H81 A;  4XKK A;  5GGZ A;  2YK9 A;  4L91 A;  3TZ4 A;  2QFO A;  2BSM A;  3H80 A;  4CE2 A;  5M4M A;  3O2F A;  2YJW A;  2Q8G A;  1UY7 A;  3EHG A;  2Q8F A;  4MB9 A;  2YE7 A;  2XX4 A;  4CWF A;  2YEF A;  4QPJ A;  1UYK A;  3CWV A;  5M4E A;  3A0R A;  4DZY A;  3ZM7 A;  1UYC A;  3ZXQ A;  2ZKJ A;  1R62 A;  1UYD A;  4E00 A;  1ZXN A;  3TZ5 A;  4AWP A;  4O0B A;  3K99 A;  2YI6 A;  3B25 A;  4HYM A;  2UWD A;  3T2S A;  1JM6 A;  2XX2 A;  4QPK A;  4L94 A;  4LWI A;  4O05 A;  2HCH A;  2YE6 A;  2GFD A;  4MP2 A;  4KTN A;  2XHX A;  4Q20 A;  5M4H A;  4MBC A;  2WI2 A;  4EM7 A;  5D6P A;  2O1W A;  3B27 A;  1BGQ A;  5M4N A;  1ID0 A;  2YEC A;  1NHI A;  2QF6 A;  3QDD A;  4L90 A;  2XHT A;  4X9L A;  4CWP A;  2YEG A;  3D0B A;  3A0Y A;  4URN A;  2BT0 A;  2CCU A;  4HY1 A;  3TZ2 A;  2WI3 A;  3RKZ A;  5IDJ A;  2IOR A;  2JKI A;  2BYH A;  3G7E A;  4FCQ A;  3GIF A;  3R4M A;  5CTX A;  2Q8H A;  1H7S A;  4URL A;  3WQ9 A;  3H4L A;  3RLQ A;  3LNU A;  3TTZ A;  1KZN A;  5F5R A;  4LWG A;  2BU7 A;  2XJJ A;  1AH6 A;  1QY8 A;  4HYP A;  1Y4U A;  1TC0 A;  4JAV A;  4MPE A;  2XHR A;  2CCT A;  4ZKI A;  4ZVI A;  1UYE A;  4KSG A;  4L8Z A;  4PU9 A;  4EGK A;  1EA6 A;  2E0A A;  2YKB A;  1UYI A;  5F3K A;  2IWX A;  2XAB A;  4LPB A;  4EMV A;  4BQG A;  4E02 A;  2CH4 A;  2VW5 A;  2YGF A;  4WUD A;  2K5B A;  3FT8 A;  4U7N A;  2BU5 A;  3OMU A;  2VCI A;  4PL9 A;  4E01 A;  1AMW A;  4I5S A;  1YT2 A;  2XK2 A;  4XCJ A;  4AS9 A;  3HHU A;  5D7D A;  5FWK A;  4V25 A;  3INX A;  4MPC A;  1YC3 A;  4FCR A;  4KP4 A;  1MX0 A;  4EFU A;  1B63 A;  2YED A;  2IWS A;  5IDM A;  4U93 A;  4LP0 A;  1AM1 A;  4MP7 A;  5D6Q A;  3HZ5 A;  2YKC A;  2YE2 A;  4K4O A;  4NH7 A;  4MPN A;  4XKO A;  3C0E A;  4U7O A;  1TID A;  3D2R A;  3B26 A;  3U67 A;  4FCP A;  2AKP A;  2Q8I A;  4ASG A;  2WER A;  1I5C A;  2CG9 A;  4BAE A;  4YKX A;  2YE3 A;  3O0I A;  4I3H A;  2GQP A;  4YKU A;  4BXI A;  2CCS A;  1NHH A;  4O09 A;  1L0O A;  1Y8P A;  4YKQ A;  3CRK A;  2XDK A;  2IWU A;  1YSZ A;  1UYG A;  1I59 A;  3T0Z A;  5BOD A;  5FNF A;  4LWE A;  4FPP A;  2FWY A;  2YGA A;  1BXD A;  3NMQ A;  3EHH A;  1UYH A;  2BZ5 A;  4NH8 A;  2EXL A;  3T10 A;  2XX5 A;  2YK2 A;  3K97 A;  4HXW A;  2XJG A;  3EHF A;  3PEJ A;  4GT8 A;  4CWT A;  1YC1 A;  2QG2 A;  1EI1 A;  4JAS A;  4CWN A;  3K98 A;  3BM9 A;  2YEH A;  3SL2 A;  2H55 A;  1U0Z A;  3OW6 A;  4WUB A;  2BU6 A;  2XCM A;  2YKI A;  4EFT A;  2FXS A;  3QTF A;  1BYQ A;  3GIG B;  3OWD A;  5CF0 A;  1YES A;  3FV5 A;  5IN9 A;  1KIJ A;  2WI5 A;  3OPD A;  2XDU A;  2O1V A;  4WUC A;  2XDX A;  5C93 A;  3PEH A;  4GGL A;  3Q5L A;  4YKY A;  2FYP A;  1PVG A;  3EHJ A;  3RLR A;  4NH9 A;  3RLP A;  5BOC A;  1Y8O A;  5FND A;  2BRE A;  4KSH A;  3IED A;  4URM A;  1GKZ A;  2YEI A;  3HYZ A;  2O1U A;  4DUH A;  1Z59 A;  4GEE A;  2C2A A;  3ZKB A;  3EKO A;  2YKJ A;  2ESA A;  4GFN A;  1ZWH A;  2XJX A;  4XIQ A;  4BIU A;  1YT1 A;  4XD8 A;  4EEH A;  4R3A A;  2IOP A;  3T1K A;  1I5B A;  3Q5J A;  1UYF A;  1Y4S A;  3R4N A;  4HZ0 A;  2VWC A;  4KFG A;  4LWF A;  2HKJ A;  4XCL A;  3A0X A;  4GQT A;  2VCJ A;  1Z5A A;  2YI7 A;  4H85 A;  1UY9 A;  5L3J A;  3HZ1 A;  2YI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...