3A0TA

Catalytic domain of histidine kinase thka (tm1359) in complex with adp and mg ion (trigonal)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
152
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 56
structure length 152
sequence length 152
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0tA00
4MP2A 1ZXNA 1YSRA 4ASBA 1Y8OA 4YKXA 4EGHA 4HZ5A 4XC0A 1BKNA 5J6AA 3TZ4A 3TZ5A 4KP4A 2BU5A 2VCJA 3D36A 5D6PA 4R1FA 2XJXA 4W7TA 4R3AA 4NH7A 3G75A 3G7EA 4MPEA 2XDLA 4EEHA 3PEJA 2ZDXA 4B7PA 1TILA 2O1VA 2YE5A 1TIDA 3R4NA 4B6CA 2IOQA 1UY8A 1BXDA 1AH8A 1YSZA 3RKZA 4H85A 4L91A 2BU6A 1UYIA 3EKRA 2XX2A 2YJXA 4BQGA 2XJJA 3IEDA 1UYEA 4L8ZA 5D7CA 1UY9A 4YKRA 4BAEA 2BZ5A 2YE9A 3VHDA 4X9LA 4ASAA 4WUCA 1MX0A 4AWOA 2CGFA 3R4PA 3G7BA 4H7QA 2Q8FA 2YEFA 1UYDA 1TC0A 4EM7A 1EI1A 4U7NA 4JQLA 2CCSA 2IOPA 2WEQA 2BREA 2CCTA 1Y8PA 2YE8A 4CE3A 3FT5A 3HYZA 4PL9A 1US7A 2YEBA 5L3JA 4HYPA 1NHJA 2CG9A 2FWYA 5FNFA 4CWTA 4U93A 4I5SA 4JAVA 3INXA 2VWCA 4DUHA 3EKOA 2H8MA 1QZRA 1GKZA 3ZKBA 5GGZA 4GFNA 5FNDA 1YS3A 1QY8A 1GJVA 5CTWA 3C11A 4FPPA 4V26A 2CCUA 4WUDA 2VW5A 3K60A 4CWQA 2WI6A 4XTJA 2FXSA 3CWVA 4CWRA 4ZKIA 2BTZA 4URMA 4QPJA 4O04A 1UYKA 3R92A 3GIGA 4E02A 5IDMA 5M4PA 1KZNA 1UYCA 2QF6A 3Q5KA 2XJGA 4JASA 2YEEA 3ZXOA 4L94A 1I5AA 2WI2A 2XHTA 3KE6A 1I59A 4DZYA 4PRVA 3A0XA 1H7UA 3OWBA 3GIFA 2YKEA 5IN9A 2YECA 4YKWA 1YT2A 2ZBKB 4XDMA 3MNRP 4CWOA 4LPBA 2YKBA 2WI1A 4XCJA 3B25A 2YK9A 2JKIA 3ZXQA 4EGIA 2YI5A 4AWPA 4HY6A 1BGQA 3R4MA 2XCMA 4MB9A 5BODA 4CWFA 2YEAA 2BU7A 1GKXA 1U0ZA 4XE2A 1I58A 5FWKA 4LWIA 3A0ZA 3B26A 2WI5A 2YE3A 2YE7A 3O0IA 4MBCA 3EHHA 4URLA 3Q5JA 4KSGA 1S16A 4YKQA 2PNRA 2QG2A 2K5BA 4H81A 2O1UA 2QFOA 4AS9A 1PVGA 4XITA 3K99A 3T0ZA 4BIUA 3U2DA 1AMWA 5F5RA 4WUBA 1I5BA 1TH8A 3EHFA 5IDJA 3HHUA 1ID0A 2WEPA 2HKJA 1THNA 2XD6A 1I5CA 1UYMA 4HZ0A 3TZ2A 2HCHA 1YC1A 3GIEA 3RLQA 1R62A 1H7SA 2YGEA 2BRCA 2FYPA 1UYFA 2Q8HA 4P7AA 4R3MA 4UROA 2H55A 3HYYA 3VHAA 4ZVIA 1QYEA 4EMVA 4JAUA 1L0OA 4MP7A 1Y4SA 4QPKA 3HZ1A 3LPSA 2XDSA 3SL2A 4XCLA 4L90A 2UWDA 2O1WA 2XDXA 4PU9A 2WI3A 1UY6A 3ZKDA 1YT1A 4BIZA 1S14A 4XKKA 1JM6A 4GQTA 1YT0A 2XABA 4YKYA 5CTUA 4CWNA 2WERA 3BM9A 1B62A 2IORA 4HY1A 1KIJA 1AH6A 3A0WA 1A4HA 2YI7A 5F3KA 3B28A 4O07A 2YE4A 2YKIA 3U2KA 3CRKA 5M4MA 3WHAA 1AJ6A 5FNCA 2WI7A 2ZKJA 1ZW9A 3INWA 1TBWA 1YC4A 3OMUA 3U67A 3FT8A 1UYHA 3HEKA 2BYHA 2ESAA 3T10A 3R91A 3TTZA 4CWPA 2IWUA 3OPDA 2Q2EB 4GCZA 3LNUA 2VCIA 4MPNA 4EGKA 3A0YA 2XHXA 2XHRA 1YETA 3TZ0A 2BT0A 4I3HA 3QDDA 2AKPA 3TUHA 5M4HA 5CF0A 3O2FA 4CWSA 4XKAA 4CE2A 2YEGA 4LP0A 2XDUA 1Z5AA 3D0BA 4YKZA 2E0AA 2GQPA 3D2RA 4EFUA 5D7RA 2YKCA 3NMQA 4NH9A 2GFDA 4XIPA 2EXLA 1Z5CA 3GIGB 2XK2A 4FCQA 3RLRA 2XX5A 4MOTA 2WI4A 4ASFA 4CE1A 2BU2A 2BYIA 1BYQA 1ZXMA 4XD8A 1NHHA 1TC6A 2BSMA 5BOCA 4BQJA 3A0RA 2YEJA 4HYMA 5D7DA 1YERA 1B63A 5CPHA 5C93A 3QTFA 4XKOA 2YGFA 4KFGA 4KTNA 2Q8IA 2YKJA 2YE2A 2YEIA 4KSHA 4HXZA 3ZM7A 3T1KA 4FCPA 3T2SA 4LWEA 2ZDYA 4MPCA 1EA6A 3FV5A 4Q20A 5M4NA 4HXWA 4K4OA 5CTXA 4O0BA 3C0EA 3B27A 2CH4A 1YESA 3R4OA 1Z59A 3JZ3A 4YKTA 3OWDA 1UY7A 4E01A 3HZ5A 4V25A 4FCRA 3VADA 4XIQA 1I5DA 1Y8NA 2XX4A 3Q5LA 3B24A 3CRLA 3VHCA 1B3QA 4U7OA 4YKUA 3EHJA 4AWQA 1NHIA 4E00A 5M4EA 3A0TA 2XDKA 3H80A 3T0HA 2C2AA 4URNA 4P8OA 2YI6A 4O09A 2YE6A 2JJCA 5CTYA 5J71A 2YGAA 3RLPA 1UYLA 4KQVA 2HG1A 3CGZA 4LWGA 4FMTA 1OSFA 4LWHA 5D6QA 1Z5BA 4L93A 3CGYA 2BU8A 1MU5A 2YK2A 3DGEA 2YJWA 1AM1A 3K97A 2YEHA 2QG0A 3BMYA 4PRXA 4GEEA 5M4KA 4ASGA 1UYGA 2Q8GA 4EFTA 3O6OA 4GT8A 3OW6A 4NH8A 4O05A 2IWSA 3EHGA 2YEDA 2FWZA 1Y4UA 3K98A 3WQ9A 4BXIA 2IWXA 4LWFA 2YI0A 3H4LA 3PEHA 4GGLA 1ZWHA 1YC3A 4XIRA 1U2OA
chains in the Genus database with same CATH superfamily
4MP2A 1ZXNA 1YSRA 4ASBA 1Y8OA 4YKXA 4EGHA 4HZ5A 4XC0A 1BKNA 5J6AA 3TZ4A 3TZ5A 4KP4A 2BU5A 2VCJA 3D36A 5D6PA 4R1FA 2XJXA 4W7TA 4R3AA 4NH7A 3G75A 3G7EA 4MPEA 2XDLA 4EEHA 3PEJA 2ZDXA 4B7PA 1TILA 2O1VA 2YE5A 1TIDA 3R4NA 4B6CA 2IOQA 1UY8A 1BXDA 1AH8A 1YSZA 3RKZA 4H85A 4L91A 2BU6A 1UYIA 3EKRA 2XX2A 2YJXA 4BQGA 2XJJA 3IEDA 1UYEA 4L8ZA 5D7CA 1UY9A 4YKRA 4BAEA 2BZ5A 2YE9A 3VHDA 4X9LA 4ASAA 4WUCA 1MX0A 4AWOA 2CGFA 3R4PA 3G7BA 4H7QA 2Q8FA 2YEFA 1UYDA 1TC0A 4EM7A 1EI1A 4U7NA 4JQLA 2CCSA 2IOPA 2WEQA 2BREA 2CCTA 1Y8PA 2YE8A 4CE3A 3FT5A 3HYZA 4PL9A 1US7A 2YEBA 5L3JA 4HYPA 1NHJA 2CG9A 2FWYA 5FNFA 4CWTA 4U93A 4I5SA 4JAVA 3INXA 2VWCA 4DUHA 3EKOA 2H8MA 1QZRA 1GKZA 3ZKBA 5GGZA 4GFNA 5FNDA 1YS3A 1QY8A 1GJVA 5CTWA 3C11A 4FPPA 4V26A 2CCUA 4WUDA 2VW5A 3K60A 4CWQA 2WI6A 4XTJA 2FXSA 3CWVA 4CWRA 4ZKIA 2BTZA 4URMA 4QPJA 4O04A 1UYKA 3R92A 3GIGA 4E02A 5IDMA 5M4PA 1KZNA 1UYCA 2QF6A 3Q5KA 2XJGA 4JASA 2YEEA 3ZXOA 4E72A 4L94A 1I5AA 2WI2A 2XHTA 3KE6A 1I59A 4DZYA 4PRVA 3A0XA 1H7UA 3OWBA 3GIFA 2YKEA 5IN9A 2YECA 4YKWA 5JENA 1YT2A 2ZBKB 4XDMA 3MNRP 4CWOA 4LPBA 2YKBA 2WI1A 4XCJA 3B25A 2YK9A 2JKIA 3ZXQA 4EGIA 2YI5A 4AWPA 4HY6A 1BGQA 3R4MA 2XCMA 4MB9A 5BODA 4CWFA 2YEAA 2BU7A 1GKXA 1U0ZA 4XE2A 1I58A 5FWKA 3A0ZA 4LWIA 3B26A 2WI5A 2YE3A 2YE7A 3O0IA 4MBCA 3EHHA 4URLA 3Q5JA 4KSGA 1S16A 4YKQA 2PNRA 2QG2A 2K5BA 4H81A 3S5TA 2O1UA 2QFOA 4AS9A 1PVGA 4XITA 3K99A 3T0ZA 4BIUA 3U2DA 1AMWA 5F5RA 4WUBA 1I5BA 1TH8A 3EHFA 2C1GA 5IDJA 3HHUA 1ID0A 2WEPA 2HKJA 1THNA 2XD6A 1I5CA 1UYMA 4HZ0A 3TZ2A 2HCHA 1YC1A 3GIEA 3RLQA 1R62A 1H7SA 2YGEA 2BRCA 2FYPA 1UYFA 2Q8HA 4P7AA 4R3MA 4UROA 2H55A 3HYYA 3VHAA 4ZVIA 1QYEA 4EMVA 4JAUA 1L0OA 4MP7A 1Y4SA 4QPKA 3HZ1A 3LPSA 2XDSA 3SL2A 4XCLA 4L90A 2UWDA 2O1WA 2XDXA 4PU9A 2WI3A 1UY6A 3ZKDA 1YT1A 4BIZA 1S14A 4XKKA 1JM6A 4GQTA 1YT0A 2XABA 4YKYA 5CTUA 4CWNA 2WERA 3BM9A 1B62A 2IORA 4HY1A 1KIJA 1AH6A 3A0WA 1A4HA 2YI7A 5F3KA 3B28A 4O07A 2YE4A 2YKIA 3U2KA 3CRKA 5M4MA 3WHAA 1AJ6A 5FNCA 2WI7A 2ZKJA 1ZW9A 3INWA 1TBWA 1F51A 1YC4A 3OMUA 3U67A 3FT8A 1UYHA 3HEKA 2BYHA 2ESAA 3T10A 3R91A 3TTZA 4CWPA 2IWUA 3OPDA 2Q2EB 4GCZA 3LNUA 2VCIA 4MPNA 4EGKA 3A0YA 2XHXA 2XHRA 1YETA 3TZ0A 2BT0A 4I3HA 3QDDA 2AKPA 3TUHA 5M4HA 5CF0A 3O2FA 4CWSA 4XKAA 4CE2A 3CYGA 2YEGA 4LP0A 2XDUA 1Z5AA 3D0BA 4YKZA 2E0AA 2GQPA 3D2RA 4EFUA 5D7RA 2YKCA 3NMQA 4NH9A 2GFDA 4XIPA 2EXLA 1Z5CA 3GIGB 2XK2A 4FCQA 3RLRA 2XX5A 4MOTA 2WI4A 4ASFA 4CE1A 2BU2A 2BYIA 1BYQA 1ZXMA 4XD8A 1NHHA 1TC6A 2BSMA 5BOCA 4BQJA 3A0RA 2YEJA 4HYMA 5D7DA 1YERA 1B63A 2C1IA 5CPHA 5C93A 3QTFA 4XKOA 2YGFA 4KFGA 4KTNA 2HHIA 2Q8IA 2YKJA 2YE2A 2YEIA 4KSHA 4HXZA 3ZM7A 3T1KA 4FCPA 3T2SA 4LWEA 2ZDYA 4MPCA 1EA6A 3FV5A 4Q20A 5M4NA 4HXWA 4K4OA 5CTXA 4O0BA 3C0EA 3B27A 2CH4A 1YESA 3R4OA 1Z59A 3JZ3A 4YKTA 3OWDA 1UY7A 2FTKA 4E01A 3HZ5A 4V25A 4FCRA 3VADA 4XIQA 1I5DA 1Y8NA 2XX4A 3Q5LA 3B24A 3CRLA 3VHCA 1B3QA 4U7OA 4YKUA 3EHJA 4AWQA 1NHIA 4E00A 5M4EA 3A0TA 3LMMA 2XDKA 3H80A 3T0HA 2C2AA 4URNA 4P8OA 2YI6A 4O09A 2YE6A 2JJCA 5CTYA 5J71A 2YGAA 3RLPA 1UYLA 4KQVA 2HG1A 3CGZA 4LWGA 4FMTA 1OSFA 4LWHA 5D6QA 1Z5BA 4L93A 3CGYA 2BU8A 1MU5A 2YK2A 3DGEA 2YJWA 1AM1A 3K97A 2YEHA 2QG0A 3BMYA 4PRXA 4GEEA 5M4KA 4ASGA 1UYGA 2Q8GA 4EFTA 3O6OA 4GT8A 3OW6A 4NH8A 4O05A 2IWSA 3EHGA 2YEDA 2FWZA 1Y4UA 3K98A 3WQ9A 4BXIA 2IWXA 4LWFA 2YI0A 3H4LA 3PEHA 4GGLA 1ZWHA 1YC3A 4XIRA 1U2OA 1IXMA
chains in the Genus database with same CATH topology
4MP2A 1ZXNA 1YSRA 4ASBA 1Y8OA 4YKXA 4EGHA 4HZ5A 4XC0A 1BKNA 5J6AA 3TZ4A 3TZ5A 4KP4A 2BU5A 2VCJA 3D36A 5D6PA 4R1FA 2XJXA 4W7TA 4R3AA 4NH7A 3G75A 3G7EA 4MPEA 2XDLA 4EEHA 3PEJA 2ZDXA 4B7PA 1TILA 2O1VA 2YE5A 1TIDA 3R4NA 4B6CA 2IOQA 1UY8A 1BXDA 1AH8A 1YSZA 3RKZA 4H85A 4L91A 2BU6A 1UYIA 3EKRA 2XX2A 2YJXA 4BQGA 2XJJA 3IEDA 1UYEA 4L8ZA 5D7CA 1UY9A 4YKRA 4BAEA 2BZ5A 2YE9A 3VHDA 4X9LA 4ASAA 4WUCA 1MX0A 4AWOA 2CGFA 3R4PA 3G7BA 4H7QA 2Q8FA 2YEFA 1UYDA 1TC0A 4EM7A 1EI1A 4U7NA 4JQLA 2CCSA 2IOPA 2WEQA 2BREA 2CCTA 1Y8PA 2YE8A 4CE3A 3FT5A 3HYZA 4PL9A 1US7A 2YEBA 5L3JA 4HYPA 1NHJA 2CG9A 2FWYA 5FNFA 4CWTA 4U93A 4I5SA 4JAVA 3INXA 2VWCA 4DUHA 3EKOA 2H8MA 1QZRA 1GKZA 3ZKBA 5GGZA 4GFNA 5FNDA 1YS3A 1QY8A 1GJVA 5CTWA 3C11A 4FPPA 4V26A 2CCUA 4WUDA 2VW5A 3K60A 4CWQA 2WI6A 4XTJA 2FXSA 3CWVA 4CWRA 4ZKIA 2BTZA 4URMA 4QPJA 4O04A 1UYKA 3R92A 3GIGA 4E02A 5IDMA 5M4PA 1KZNA 1UYCA 2QF6A 3Q5KA 2XJGA 4JASA 2YEEA 3ZXOA 4L94A 1I5AA 2WI2A 2XHTA 3KE6A 1I59A 4DZYA 4PRVA 3A0XA 1H7UA 3OWBA 3GIFA 2YKEA 5IN9A 2YECA 4YKWA 1YT2A 2ZBKB 4XDMA 3MNRP 4CWOA 4LPBA 2YKBA 2WI1A 4XCJA 3B25A 2YK9A 2JKIA 3ZXQA 4EGIA 2YI5A 4AWPA 4HY6A 1BGQA 3R4MA 2XCMA 4MB9A 5BODA 4CWFA 2YEAA 2BU7A 1GKXA 1U0ZA 4XE2A 1I58A 5FWKA 4LWIA 3A0ZA 3B26A 2WI5A 2YE3A 2YE7A 3O0IA 4MBCA 3EHHA 4URLA 3Q5JA 4KSGA 1S16A 4YKQA 2PNRA 2QG2A 2K5BA 4H81A 2O1UA 2QFOA 4AS9A 1PVGA 4XITA 3K99A 3T0ZA 4BIUA 3U2DA 1AMWA 5F5RA 4WUBA 1I5BA 1TH8A 3EHFA 5IDJA 3HHUA 1ID0A 2WEPA 2HKJA 1THNA 2XD6A 1I5CA 1UYMA 4HZ0A 3TZ2A 2HCHA 1YC1A 3GIEA 3RLQA 1R62A 1H7SA 2YGEA 2BRCA 2FYPA 1UYFA 2Q8HA 4P7AA 4R3MA 4UROA 2H55A 3HYYA 3VHAA 4ZVIA 1QYEA 4EMVA 4JAUA 1L0OA 4MP7A 1Y4SA 4QPKA 3HZ1A 3LPSA 2XDSA 3SL2A 4XCLA 4L90A 2UWDA 2O1WA 2XDXA 4PU9A 2WI3A 1UY6A 3ZKDA 1YT1A 4BIZA 1S14A 4XKKA 1JM6A 4GQTA 1YT0A 2XABA 4YKYA 5CTUA 4CWNA 2WERA 3BM9A 1B62A 2IORA 4HY1A 1KIJA 1AH6A 3A0WA 1A4HA 2YI7A 5F3KA 3B28A 4O07A 2YE4A 2YKIA 3U2KA 3CRKA 5M4MA 3WHAA 1AJ6A 5FNCA 2WI7A 2ZKJA 1ZW9A 3INWA 1TBWA 1YC4A 3OMUA 3U67A 3FT8A 1UYHA 3HEKA 2BYHA 2ESAA 3T10A 3R91A 3TTZA 4CWPA 2IWUA 3OPDA 2Q2EB 4GCZA 3LNUA 2VCIA 4MPNA 4EGKA 3A0YA 2XHXA 2XHRA 1YETA 3TZ0A 2BT0A 4I3HA 3QDDA 2AKPA 3TUHA 5M4HA 5CF0A 3O2FA 4CWSA 4XKAA 4CE2A 2YEGA 4LP0A 2XDUA 1Z5AA 3D0BA 4YKZA 2E0AA 2GQPA 3D2RA 4EFUA 5D7RA 2YKCA 3NMQA 4NH9A 2GFDA 4XIPA 2EXLA 1Z5CA 3GIGB 2XK2A 4FCQA 3RLRA 2XX5A 4MOTA 2WI4A 4ASFA 4CE1A 2BU2A 2BYIA 1BYQA 1ZXMA 4XD8A 1NHHA 1TC6A 2BSMA 5BOCA 4BQJA 3A0RA 2YEJA 4HYMA 5D7DA 1YERA 1B63A 5CPHA 5C93A 3QTFA 4XKOA 2YGFA 4KFGA 4KTNA 2Q8IA 2YKJA 2YE2A 2YEIA 4KSHA 4HXZA 3ZM7A 3T1KA 4FCPA 3T2SA 4LWEA 2ZDYA 4MPCA 1EA6A 3FV5A 4Q20A 5M4NA 4HXWA 4K4OA 5CTXA 4O0BA 3C0EA 3B27A 2CH4A 1YESA 3R4OA 1Z59A 3JZ3A 4YKTA 3OWDA 1UY7A 4E01A 3HZ5A 4V25A 4FCRA 3VADA 4XIQA 1I5DA 1Y8NA 2XX4A 3Q5LA 3B24A 3CRLA 3VHCA 1B3QA 4U7OA 4YKUA 3EHJA 4AWQA 1NHIA 4E00A 5M4EA 3A0TA 2XDKA 3H80A 3T0HA 2C2AA 4URNA 4P8OA 2YI6A 4O09A 2YE6A 2JJCA 5CTYA 5J71A 2YGAA 3RLPA 1UYLA 4KQVA 2HG1A 3CGZA 4LWGA 4FMTA 1OSFA 4LWHA 5D6QA 1Z5BA 4L93A 3CGYA 2BU8A 1MU5A 2YK2A 3DGEA 2YJWA 1AM1A 3K97A 2YEHA 2QG0A 3BMYA 4PRXA 4GEEA 5M4KA 4ASGA 1UYGA 2Q8GA 4EFTA 3O6OA 4GT8A 3OW6A 4NH8A 4O05A 2IWSA 3EHGA 2YEDA 2FWZA 1Y4UA 3K98A 3WQ9A 4BXIA 2IWXA 4LWFA 2YI0A 3H4LA 3PEHA 4GGLA 1ZWHA 1YC3A 4XIRA 1U2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MP2 A;  1ZXN A;  1YSR A;  4ASB A;  1Y8O A;  4YKX A;  4EGH A;  4HZ5 A;  4XC0 A;  1BKN A;  5J6A A;  3TZ4 A;  3TZ5 A;  4KP4 A;  2BU5 A;  2VCJ A;  3D36 A;  5D6P A;  4R1F A;  2XJX A;  4W7T A;  4R3A A;  4NH7 A;  3G75 A;  3G7E A;  4MPE A;  2XDL A;  4EEH A;  3PEJ A;  2ZDX A;  4B7P A;  1TIL A;  2O1V A;  2YE5 A;  1TID A;  3R4N A;  4B6C A;  2IOQ A;  1UY8 A;  1BXD A;  1AH8 A;  1YSZ A;  3RKZ A;  4H85 A;  4L91 A;  2BU6 A;  1UYI A;  3EKR A;  2XX2 A;  2YJX A;  4BQG A;  2XJJ A;  3IED A;  1UYE A;  4L8Z A;  5D7C A;  1UY9 A;  4YKR A;  4BAE A;  2BZ5 A;  2YE9 A;  3VHD A;  4X9L A;  4ASA A;  4WUC A;  1MX0 A;  4AWO A;  2CGF A;  3R4P A;  3G7B A;  4H7Q A;  2Q8F A;  2YEF A;  1UYD A;  1TC0 A;  4EM7 A;  1EI1 A;  4U7N A;  4JQL A;  2CCS A;  2IOP A;  2WEQ A;  2BRE A;  2CCT A;  1Y8P A;  2YE8 A;  4CE3 A;  3FT5 A;  3HYZ A;  4PL9 A;  1US7 A;  2YEB A;  5L3J A;  4HYP A;  1NHJ A;  2CG9 A;  2FWY A;  5FNF A;  4CWT A;  4U93 A;  4I5S A;  4JAV A;  3INX A;  2VWC A;  4DUH A;  3EKO A;  2H8M A;  1QZR A;  1GKZ A;  3ZKB A;  5GGZ A;  4GFN A;  5FND A;  1YS3 A;  1QY8 A;  1GJV A;  5CTW A;  3C11 A;  4FPP A;  4V26 A;  2CCU A;  4WUD A;  2VW5 A;  3K60 A;  4CWQ A;  2WI6 A;  4XTJ A;  2FXS A;  3CWV A;  4CWR A;  4ZKI A;  2BTZ A;  4URM A;  4QPJ A;  4O04 A;  1UYK A;  3R92 A;  3GIG A;  4E02 A;  5IDM A;  5M4P A;  1KZN A;  1UYC A;  2QF6 A;  3Q5K A;  2XJG A;  4JAS A;  2YEE A;  3ZXO A;  4L94 A;  1I5A A;  2WI2 A;  2XHT A;  3KE6 A;  1I59 A;  4DZY A;  4PRV A;  3A0X A;  1H7U A;  3OWB A;  3GIF A;  2YKE A;  5IN9 A;  2YEC A;  4YKW A;  1YT2 A;  2ZBK B;  4XDM A;  3MNR P;  4CWO A;  4LPB A;  2YKB A;  2WI1 A;  4XCJ A;  3B25 A;  2YK9 A;  2JKI A;  3ZXQ A;  4EGI A;  2YI5 A;  4AWP A;  4HY6 A;  1BGQ A;  3R4M A;  2XCM A;  4MB9 A;  5BOD A;  4CWF A;  2YEA A;  2BU7 A;  1GKX A;  1U0Z A;  4XE2 A;  1I58 A;  5FWK A;  4LWI A;  3A0Z A;  3B26 A;  2WI5 A;  2YE3 A;  2YE7 A;  3O0I A;  4MBC A;  3EHH A;  4URL A;  3Q5J A;  4KSG A;  1S16 A;  4YKQ A;  2PNR A;  2QG2 A;  2K5B A;  4H81 A;  2O1U A;  2QFO A;  4AS9 A;  1PVG A;  4XIT A;  3K99 A;  3T0Z A;  4BIU A;  3U2D A;  1AMW A;  5F5R A;  4WUB A;  1I5B A;  1TH8 A;  3EHF A;  5IDJ A;  3HHU A;  1ID0 A;  2WEP A;  2HKJ A;  1THN A;  2XD6 A;  1I5C A;  1UYM A;  4HZ0 A;  3TZ2 A;  2HCH A;  1YC1 A;  3GIE A;  3RLQ A;  1R62 A;  1H7S A;  2YGE A;  2BRC A;  2FYP A;  1UYF A;  2Q8H A;  4P7A A;  4R3M A;  4URO A;  2H55 A;  3HYY A;  3VHA A;  4ZVI A;  1QYE A;  4EMV A;  4JAU A;  1L0O A;  4MP7 A;  1Y4S A;  4QPK A;  3HZ1 A;  3LPS A;  2XDS A;  3SL2 A;  4XCL A;  4L90 A;  2UWD A;  2O1W A;  2XDX A;  4PU9 A;  2WI3 A;  1UY6 A;  3ZKD A;  1YT1 A;  4BIZ A;  1S14 A;  4XKK A;  1JM6 A;  4GQT A;  1YT0 A;  2XAB A;  4YKY A;  5CTU A;  4CWN A;  2WER A;  3BM9 A;  1B62 A;  2IOR A;  4HY1 A;  1KIJ A;  1AH6 A;  3A0W A;  1A4H A;  2YI7 A;  5F3K A;  3B28 A;  4O07 A;  2YE4 A;  2YKI A;  3U2K A;  3CRK A;  5M4M A;  3WHA A;  1AJ6 A;  5FNC A;  2WI7 A;  2ZKJ A;  1ZW9 A;  3INW A;  1TBW A;  1YC4 A;  3OMU A;  3U67 A;  3FT8 A;  1UYH A;  3HEK A;  2BYH A;  2ESA A;  3T10 A;  3R91 A;  3TTZ A;  4CWP A;  2IWU A;  3OPD A;  2Q2E B;  4GCZ A;  3LNU A;  2VCI A;  4MPN A;  4EGK A;  3A0Y A;  2XHX A;  2XHR A;  1YET A;  3TZ0 A;  2BT0 A;  4I3H A;  3QDD A;  2AKP A;  3TUH A;  5M4H A;  5CF0 A;  3O2F A;  4CWS A;  4XKA A;  4CE2 A;  2YEG A;  4LP0 A;  2XDU A;  1Z5A A;  3D0B A;  4YKZ A;  2E0A A;  2GQP A;  3D2R A;  4EFU A;  5D7R A;  2YKC A;  3NMQ A;  4NH9 A;  2GFD A;  4XIP A;  2EXL A;  1Z5C A;  3GIG B;  2XK2 A;  4FCQ A;  3RLR A;  2XX5 A;  4MOT A;  2WI4 A;  4ASF A;  4CE1 A;  2BU2 A;  2BYI A;  1BYQ A;  1ZXM A;  4XD8 A;  1NHH A;  1TC6 A;  2BSM A;  5BOC A;  4BQJ A;  3A0R A;  2YEJ A;  4HYM A;  5D7D A;  1YER A;  1B63 A;  5CPH A;  5C93 A;  3QTF A;  4XKO A;  2YGF A;  4KFG A;  4KTN A;  2Q8I A;  2YKJ A;  2YE2 A;  2YEI A;  4KSH A;  4HXZ A;  3ZM7 A;  3T1K A;  4FCP A;  3T2S A;  4LWE A;  2ZDY A;  4MPC A;  1EA6 A;  3FV5 A;  4Q20 A;  5M4N A;  4HXW A;  4K4O A;  5CTX A;  4O0B A;  3C0E A;  3B27 A;  2CH4 A;  1YES A;  3R4O A;  1Z59 A;  3JZ3 A;  4YKT A;  3OWD A;  1UY7 A;  4E01 A;  3HZ5 A;  4V25 A;  4FCR A;  3VAD A;  4XIQ A;  1I5D A;  1Y8N A;  2XX4 A;  3Q5L A;  3B24 A;  3CRL A;  3VHC A;  1B3Q A;  4U7O A;  4YKU A;  3EHJ A;  4AWQ A;  1NHI A;  4E00 A;  5M4E A;  3A0T A;  2XDK A;  3H80 A;  3T0H A;  2C2A A;  4URN A;  4P8O A;  2YI6 A;  4O09 A;  2YE6 A;  2JJC A;  5CTY A;  5J71 A;  2YGA A;  3RLP A;  1UYL A;  4KQV A;  2HG1 A;  3CGZ A;  4LWG A;  4FMT A;  1OSF A;  4LWH A;  5D6Q A;  1Z5B A;  4L93 A;  3CGY A;  2BU8 A;  1MU5 A;  2YK2 A;  3DGE A;  2YJW A;  1AM1 A;  3K97 A;  2YEH A;  2QG0 A;  3BMY A;  4PRX A;  4GEE A;  5M4K A;  4ASG A;  1UYG A;  2Q8G A;  4EFT A;  3O6O A;  4GT8 A;  3OW6 A;  4NH8 A;  4O05 A;  2IWS A;  3EHG A;  2YED A;  2FWZ A;  1Y4U A;  3K98 A;  3WQ9 A;  4BXI A;  2IWX A;  4LWF A;  2YI0 A;  3H4L A;  3PEH A;  4GGL A;  1ZWH A;  1YC3 A;  4XIR A;  1U2O A; 
#chains in the Genus database with same CATH topology
 4MP2 A;  1ZXN A;  1YSR A;  4ASB A;  1Y8O A;  4YKX A;  4EGH A;  4HZ5 A;  4XC0 A;  1BKN A;  5J6A A;  3TZ4 A;  3TZ5 A;  4KP4 A;  2BU5 A;  2VCJ A;  3D36 A;  5D6P A;  4R1F A;  2XJX A;  4W7T A;  4R3A A;  4NH7 A;  3G75 A;  3G7E A;  4MPE A;  2XDL A;  4EEH A;  3PEJ A;  2ZDX A;  4B7P A;  1TIL A;  2O1V A;  2YE5 A;  1TID A;  3R4N A;  4B6C A;  2IOQ A;  1UY8 A;  1BXD A;  1AH8 A;  1YSZ A;  3RKZ A;  4H85 A;  4L91 A;  2BU6 A;  1UYI A;  3EKR A;  2XX2 A;  2YJX A;  4BQG A;  2XJJ A;  3IED A;  1UYE A;  4L8Z A;  5D7C A;  1UY9 A;  4YKR A;  4BAE A;  2BZ5 A;  2YE9 A;  3VHD A;  4X9L A;  4ASA A;  4WUC A;  1MX0 A;  4AWO A;  2CGF A;  3R4P A;  3G7B A;  4H7Q A;  2Q8F A;  2YEF A;  1UYD A;  1TC0 A;  4EM7 A;  1EI1 A;  4U7N A;  4JQL A;  2CCS A;  2IOP A;  2WEQ A;  2BRE A;  2CCT A;  1Y8P A;  2YE8 A;  4CE3 A;  3FT5 A;  3HYZ A;  4PL9 A;  1US7 A;  2YEB A;  5L3J A;  4HYP A;  1NHJ A;  2CG9 A;  2FWY A;  5FNF A;  4CWT A;  4U93 A;  4I5S A;  4JAV A;  3INX A;  2VWC A;  4DUH A;  3EKO A;  2H8M A;  1QZR A;  1GKZ A;  3ZKB A;  5GGZ A;  4GFN A;  5FND A;  1YS3 A;  1QY8 A;  1GJV A;  5CTW A;  3C11 A;  4FPP A;  4V26 A;  2CCU A;  4WUD A;  2VW5 A;  3K60 A;  4CWQ A;  2WI6 A;  4XTJ A;  2FXS A;  3CWV A;  4CWR A;  4ZKI A;  2BTZ A;  4URM A;  4QPJ A;  4O04 A;  1UYK A;  3R92 A;  3GIG A;  4E02 A;  5IDM A;  5M4P A;  1KZN A;  1UYC A;  2QF6 A;  3Q5K A;  2XJG A;  4JAS A;  2YEE A;  3ZXO A;  4E72 A;  4L94 A;  1I5A A;  2WI2 A;  2XHT A;  3KE6 A;  1I59 A;  4DZY A;  4PRV A;  3A0X A;  1H7U A;  3OWB A;  3GIF A;  2YKE A;  5IN9 A;  2YEC A;  4YKW A;  5JEN A;  1YT2 A;  2ZBK B;  4XDM A;  3MNR P;  4CWO A;  4LPB A;  2YKB A;  2WI1 A;  4XCJ A;  3B25 A;  2YK9 A;  2JKI A;  3ZXQ A;  4EGI A;  2YI5 A;  4AWP A;  4HY6 A;  1BGQ A;  3R4M A;  2XCM A;  4MB9 A;  5BOD A;  4CWF A;  2YEA A;  2BU7 A;  1GKX A;  1U0Z A;  4XE2 A;  1I58 A;  5FWK A;  3A0Z A;  4LWI A;  3B26 A;  2WI5 A;  2YE3 A;  2YE7 A;  3O0I A;  4MBC A;  3EHH A;  4URL A;  3Q5J A;  4KSG A;  1S16 A;  4YKQ A;  2PNR A;  2QG2 A;  2K5B A;  4H81 A;  3S5T A;  2O1U A;  2QFO A;  4AS9 A;  1PVG A;  4XIT A;  3K99 A;  3T0Z A;  4BIU A;  3U2D A;  1AMW A;  5F5R A;  4WUB A;  1I5B A;  1TH8 A;  3EHF A;  2C1G A;  5IDJ A;  3HHU A;  1ID0 A;  2WEP A;  2HKJ A;  1THN A;  2XD6 A;  1I5C A;  1UYM A;  4HZ0 A;  3TZ2 A;  2HCH A;  1YC1 A;  3GIE A;  3RLQ A;  1R62 A;  1H7S A;  2YGE A;  2BRC A;  2FYP A;  1UYF A;  2Q8H A;  4P7A A;  4R3M A;  4URO A;  2H55 A;  3HYY A;  3VHA A;  4ZVI A;  1QYE A;  4EMV A;  4JAU A;  1L0O A;  4MP7 A;  1Y4S A;  4QPK A;  3HZ1 A;  3LPS A;  2XDS A;  3SL2 A;  4XCL A;  4L90 A;  2UWD A;  2O1W A;  2XDX A;  4PU9 A;  2WI3 A;  1UY6 A;  3ZKD A;  1YT1 A;  4BIZ A;  1S14 A;  4XKK A;  1JM6 A;  4GQT A;  1YT0 A;  2XAB A;  4YKY A;  5CTU A;  4CWN A;  2WER A;  3BM9 A;  1B62 A;  2IOR A;  4HY1 A;  1KIJ A;  1AH6 A;  3A0W A;  1A4H A;  2YI7 A;  5F3K A;  3B28 A;  4O07 A;  2YE4 A;  2YKI A;  3U2K A;  3CRK A;  5M4M A;  3WHA A;  1AJ6 A;  5FNC A;  2WI7 A;  2ZKJ A;  1ZW9 A;  3INW A;  1TBW A;  1F51 A;  1YC4 A;  3OMU A;  3U67 A;  3FT8 A;  1UYH A;  3HEK A;  2BYH A;  2ESA A;  3T10 A;  3R91 A;  3TTZ A;  4CWP A;  2IWU A;  3OPD A;  2Q2E B;  4GCZ A;  3LNU A;  2VCI A;  4MPN A;  4EGK A;  3A0Y A;  2XHX A;  2XHR A;  1YET A;  3TZ0 A;  2BT0 A;  4I3H A;  3QDD A;  2AKP A;  3TUH A;  5M4H A;  5CF0 A;  3O2F A;  4CWS A;  4XKA A;  4CE2 A;  3CYG A;  2YEG A;  4LP0 A;  2XDU A;  1Z5A A;  3D0B A;  4YKZ A;  2E0A A;  2GQP A;  3D2R A;  4EFU A;  5D7R A;  2YKC A;  3NMQ A;  4NH9 A;  2GFD A;  4XIP A;  2EXL A;  1Z5C A;  3GIG B;  2XK2 A;  4FCQ A;  3RLR A;  2XX5 A;  4MOT A;  2WI4 A;  4ASF A;  4CE1 A;  2BU2 A;  2BYI A;  1BYQ A;  1ZXM A;  4XD8 A;  1NHH A;  1TC6 A;  2BSM A;  5BOC A;  4BQJ A;  3A0R A;  2YEJ A;  4HYM A;  5D7D A;  1YER A;  1B63 A;  2C1I A;  5CPH A;  5C93 A;  3QTF A;  4XKO A;  2YGF A;  4KFG A;  4KTN A;  2HHI A;  2Q8I A;  2YKJ A;  2YE2 A;  2YEI A;  4KSH A;  4HXZ A;  3ZM7 A;  3T1K A;  4FCP A;  3T2S A;  4LWE A;  2ZDY A;  4MPC A;  1EA6 A;  3FV5 A;  4Q20 A;  5M4N A;  4HXW A;  4K4O A;  5CTX A;  4O0B A;  3C0E A;  3B27 A;  2CH4 A;  1YES A;  3R4O A;  1Z59 A;  3JZ3 A;  4YKT A;  3OWD A;  1UY7 A;  2FTK A;  4E01 A;  3HZ5 A;  4V25 A;  4FCR A;  3VAD A;  4XIQ A;  1I5D A;  1Y8N A;  2XX4 A;  3Q5L A;  3B24 A;  3CRL A;  3VHC A;  1B3Q A;  4U7O A;  4YKU A;  3EHJ A;  4AWQ A;  1NHI A;  4E00 A;  5M4E A;  3A0T A;  3LMM A;  2XDK A;  3H80 A;  3T0H A;  2C2A A;  4URN A;  4P8O A;  2YI6 A;  4O09 A;  2YE6 A;  2JJC A;  5CTY A;  5J71 A;  2YGA A;  3RLP A;  1UYL A;  4KQV A;  2HG1 A;  3CGZ A;  4LWG A;  4FMT A;  1OSF A;  4LWH A;  5D6Q A;  1Z5B A;  4L93 A;  3CGY A;  2BU8 A;  1MU5 A;  2YK2 A;  3DGE A;  2YJW A;  1AM1 A;  3K97 A;  2YEH A;  2QG0 A;  3BMY A;  4PRX A;  4GEE A;  5M4K A;  4ASG A;  1UYG A;  2Q8G A;  4EFT A;  3O6O A;  4GT8 A;  3OW6 A;  4NH8 A;  4O05 A;  2IWS A;  3EHG A;  2YED A;  2FWZ A;  1Y4U A;  3K98 A;  3WQ9 A;  4BXI A;  2IWX A;  4LWF A;  2YI0 A;  3H4L A;  3PEH A;  4GGL A;  1ZWH A;  1YC3 A;  4XIR A;  1U2O A;  1IXM A; 
#chains in the Genus database with same CATH homology
 4MP2 A;  1ZXN A;  1YSR A;  4ASB A;  1Y8O A;  4YKX A;  4EGH A;  4HZ5 A;  4XC0 A;  1BKN A;  5J6A A;  3TZ4 A;  3TZ5 A;  4KP4 A;  2BU5 A;  2VCJ A;  3D36 A;  5D6P A;  4R1F A;  2XJX A;  4W7T A;  4R3A A;  4NH7 A;  3G75 A;  3G7E A;  4MPE A;  2XDL A;  4EEH A;  3PEJ A;  2ZDX A;  4B7P A;  1TIL A;  2O1V A;  2YE5 A;  1TID A;  3R4N A;  4B6C A;  2IOQ A;  1UY8 A;  1BXD A;  1AH8 A;  1YSZ A;  3RKZ A;  4H85 A;  4L91 A;  2BU6 A;  1UYI A;  3EKR A;  2XX2 A;  2YJX A;  4BQG A;  2XJJ A;  3IED A;  1UYE A;  4L8Z A;  5D7C A;  1UY9 A;  4YKR A;  4BAE A;  2BZ5 A;  2YE9 A;  3VHD A;  4X9L A;  4ASA A;  4WUC A;  1MX0 A;  4AWO A;  2CGF A;  3R4P A;  3G7B A;  4H7Q A;  2Q8F A;  2YEF A;  1UYD A;  1TC0 A;  4EM7 A;  1EI1 A;  4U7N A;  4JQL A;  2CCS A;  2IOP A;  2WEQ A;  2BRE A;  2CCT A;  1Y8P A;  2YE8 A;  4CE3 A;  3FT5 A;  3HYZ A;  4PL9 A;  1US7 A;  2YEB A;  5L3J A;  4HYP A;  1NHJ A;  2CG9 A;  2FWY A;  5FNF A;  4CWT A;  4U93 A;  4I5S A;  4JAV A;  3INX A;  2VWC A;  4DUH A;  3EKO A;  2H8M A;  1QZR A;  1GKZ A;  3ZKB A;  5GGZ A;  4GFN A;  5FND A;  1YS3 A;  1QY8 A;  1GJV A;  5CTW A;  3C11 A;  4FPP A;  4V26 A;  2CCU A;  4WUD A;  2VW5 A;  3K60 A;  4CWQ A;  2WI6 A;  4XTJ A;  2FXS A;  3CWV A;  4CWR A;  4ZKI A;  2BTZ A;  4URM A;  4QPJ A;  4O04 A;  1UYK A;  3R92 A;  3GIG A;  4E02 A;  5IDM A;  5M4P A;  1KZN A;  1UYC A;  2QF6 A;  3Q5K A;  2XJG A;  4JAS A;  2YEE A;  3ZXO A;  4L94 A;  1I5A A;  2WI2 A;  2XHT A;  3KE6 A;  1I59 A;  4DZY A;  4PRV A;  3A0X A;  1H7U A;  3OWB A;  3GIF A;  2YKE A;  5IN9 A;  2YEC A;  4YKW A;  1YT2 A;  2ZBK B;  4XDM A;  3MNR P;  4CWO A;  4LPB A;  2YKB A;  2WI1 A;  4XCJ A;  3B25 A;  2YK9 A;  2JKI A;  3ZXQ A;  4EGI A;  2YI5 A;  4AWP A;  4HY6 A;  1BGQ A;  3R4M A;  2XCM A;  4MB9 A;  5BOD A;  4CWF A;  2YEA A;  2BU7 A;  1GKX A;  1U0Z A;  4XE2 A;  1I58 A;  5FWK A;  4LWI A;  3A0Z A;  3B26 A;  2WI5 A;  2YE3 A;  2YE7 A;  3O0I A;  4MBC A;  3EHH A;  4URL A;  3Q5J A;  4KSG A;  1S16 A;  4YKQ A;  2PNR A;  2QG2 A;  2K5B A;  4H81 A;  2O1U A;  2QFO A;  4AS9 A;  1PVG A;  4XIT A;  3K99 A;  3T0Z A;  4BIU A;  3U2D A;  1AMW A;  5F5R A;  4WUB A;  1I5B A;  1TH8 A;  3EHF A;  5IDJ A;  3HHU A;  1ID0 A;  2WEP A;  2HKJ A;  1THN A;  2XD6 A;  1I5C A;  1UYM A;  4HZ0 A;  3TZ2 A;  2HCH A;  1YC1 A;  3GIE A;  3RLQ A;  1R62 A;  1H7S A;  2YGE A;  2BRC A;  2FYP A;  1UYF A;  2Q8H A;  4P7A A;  4R3M A;  4URO A;  2H55 A;  3HYY A;  3VHA A;  4ZVI A;  1QYE A;  4EMV A;  4JAU A;  1L0O A;  4MP7 A;  1Y4S A;  4QPK A;  3HZ1 A;  3LPS A;  2XDS A;  3SL2 A;  4XCL A;  4L90 A;  2UWD A;  2O1W A;  2XDX A;  4PU9 A;  2WI3 A;  1UY6 A;  3ZKD A;  1YT1 A;  4BIZ A;  1S14 A;  4XKK A;  1JM6 A;  4GQT A;  1YT0 A;  2XAB A;  4YKY A;  5CTU A;  4CWN A;  2WER A;  3BM9 A;  1B62 A;  2IOR A;  4HY1 A;  1KIJ A;  1AH6 A;  3A0W A;  1A4H A;  2YI7 A;  5F3K A;  3B28 A;  4O07 A;  2YE4 A;  2YKI A;  3U2K A;  3CRK A;  5M4M A;  3WHA A;  1AJ6 A;  5FNC A;  2WI7 A;  2ZKJ A;  1ZW9 A;  3INW A;  1TBW A;  1YC4 A;  3OMU A;  3U67 A;  3FT8 A;  1UYH A;  3HEK A;  2BYH A;  2ESA A;  3T10 A;  3R91 A;  3TTZ A;  4CWP A;  2IWU A;  3OPD A;  2Q2E B;  4GCZ A;  3LNU A;  2VCI A;  4MPN A;  4EGK A;  3A0Y A;  2XHX A;  2XHR A;  1YET A;  3TZ0 A;  2BT0 A;  4I3H A;  3QDD A;  2AKP A;  3TUH A;  5M4H A;  5CF0 A;  3O2F A;  4CWS A;  4XKA A;  4CE2 A;  2YEG A;  4LP0 A;  2XDU A;  1Z5A A;  3D0B A;  4YKZ A;  2E0A A;  2GQP A;  3D2R A;  4EFU A;  5D7R A;  2YKC A;  3NMQ A;  4NH9 A;  2GFD A;  4XIP A;  2EXL A;  1Z5C A;  3GIG B;  2XK2 A;  4FCQ A;  3RLR A;  2XX5 A;  4MOT A;  2WI4 A;  4ASF A;  4CE1 A;  2BU2 A;  2BYI A;  1BYQ A;  1ZXM A;  4XD8 A;  1NHH A;  1TC6 A;  2BSM A;  5BOC A;  4BQJ A;  3A0R A;  2YEJ A;  4HYM A;  5D7D A;  1YER A;  1B63 A;  5CPH A;  5C93 A;  3QTF A;  4XKO A;  2YGF A;  4KFG A;  4KTN A;  2Q8I A;  2YKJ A;  2YE2 A;  2YEI A;  4KSH A;  4HXZ A;  3ZM7 A;  3T1K A;  4FCP A;  3T2S A;  4LWE A;  2ZDY A;  4MPC A;  1EA6 A;  3FV5 A;  4Q20 A;  5M4N A;  4HXW A;  4K4O A;  5CTX A;  4O0B A;  3C0E A;  3B27 A;  2CH4 A;  1YES A;  3R4O A;  1Z59 A;  3JZ3 A;  4YKT A;  3OWD A;  1UY7 A;  4E01 A;  3HZ5 A;  4V25 A;  4FCR A;  3VAD A;  4XIQ A;  1I5D A;  1Y8N A;  2XX4 A;  3Q5L A;  3B24 A;  3CRL A;  3VHC A;  1B3Q A;  4U7O A;  4YKU A;  3EHJ A;  4AWQ A;  1NHI A;  4E00 A;  5M4E A;  3A0T A;  2XDK A;  3H80 A;  3T0H A;  2C2A A;  4URN A;  4P8O A;  2YI6 A;  4O09 A;  2YE6 A;  2JJC A;  5CTY A;  5J71 A;  2YGA A;  3RLP A;  1UYL A;  4KQV A;  2HG1 A;  3CGZ A;  4LWG A;  4FMT A;  1OSF A;  4LWH A;  5D6Q A;  1Z5B A;  4L93 A;  3CGY A;  2BU8 A;  1MU5 A;  2YK2 A;  3DGE A;  2YJW A;  1AM1 A;  3K97 A;  2YEH A;  2QG0 A;  3BMY A;  4PRX A;  4GEE A;  5M4K A;  4ASG A;  1UYG A;  2Q8G A;  4EFT A;  3O6O A;  4GT8 A;  3OW6 A;  4NH8 A;  4O05 A;  2IWS A;  3EHG A;  2YED A;  2FWZ A;  1Y4U A;  3K98 A;  3WQ9 A;  4BXI A;  2IWX A;  4LWF A;  2YI0 A;  3H4L A;  3PEH A;  4GGL A;  1ZWH A;  1YC3 A;  4XIR A;  1U2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...