3A0UA

Crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
b'MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDLSSWAADEYVVKSFNFDELKEKVKKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a0uA00
2N9UA 5DLEA 2LIVA 5PNTA 3TX6A 5CNMA 2CD7A 5JNTA 2JRLA 3BREA 1JLKA 1L5ZA 5EWLB 1C4WA 3CG4A 1K68A 4XFKA 1SXGA 5B3JA 3I5AA 3I45A 2QXYA 3DGEC 3LTEA 1CHNA 4O5AA 3QK7A 1E2BA 1FSPA 1DP4A 2XDYA 3LKVA 4ML3A 5I4CA 4WXEA 1ZY2A 1URPA 4EYGA 3O1JC 4Z9BA 1VKRA 2R48A 2JBAB 3OM1A 3RVNA 4RK5A 3QLUA 3OLWA 4KK4A 4MQFB 3BRQA 4N47A 1AB6A 4F8JA 4ZMRA 1EWTA 2H0AA 4LX8A 5FWYB 1NXTA 2FN8A 2FMKA 3N6VA 1ZGGA 4YR7A 1M2EA 1QNLA 4ETMA 1ISRA 3NHMA 3SAJA 5JS1A 4KPYA 1XHFA 5F64A 1JX6A 1JYFA 2MSWA 5TE9A 3S99A 5EWMB 4G0MA 3QLTA 2IPMA 1Z2DA 2FXIA 4YO7A 5KQMA 4MYRA 5EWJA 3QEMA 4RZSA 4S05A 2OENG 2WB4A 1P6QA 5FWYA 2IKSA 3N53A 3H5WA 3H75A 4H3HB 5KI6A 4MPTA 1D1PA 3H5LA 5KQLA 3D8UA 4MLDA 4W5OA 1IIBA 4GNRA 2GBPA 3H1FA 1NATA 2RGYA 2E4UA 3D02A 3N0XA 2MYTA 5GQSA 4JB2A 4RY9A 2HSGA 1BDIA 4XXHA 1W25A 4MR8B 5DGCA 5IEBA 4N76A 2A9RA 2PL9A 1AB5A 1PUXA 3F7NA 3IP6A 3CG0A 4RKRA 2R47A 2CHEA 2M98A 3MYYA 3SG0A 5JNUA 1E6MA 5GOTA 5IUJC 2L19A 4JA2A 4XLTA 4MLCA 1TLFA 2E4ZA 5HM6A 3KS9A 1ZAYA 3TO5A 2KYRA 3QELB 4F11A 4KREA 4L85A 5TPWB 3Q9SA 3F73A 2PUDA 4LZLA 5TQ0A 3HS3A 3KYIB 4NICA 1VLZA 1LJUA 2WJWA 3JTEA 4JOQA 1DRJA 4MS1B 3OQOA 1YS6A 4JP1A 1U2PA 2FEKA 2QSJA 1P6UA 4EY3A 4NV3A 3Q15C 2QW1A 1ZITA 3EAFA 2L17A 2NT4A 1Z26A 2FLWA 3I42A 4LE2A 1Z16A 2ZAYA 2FN9A 1JWLA 3A10A 3RVJA 1WETA 4NCBA 4ZMSA 3H1GA 3HSYA 4JB0A 1A2OA 1ZGZA 2FQWA 3EJWA 4TLLB 4Z4GA 3HM9A 1ZVVA 4M88A 1PEAA 3EGCA 1ZN2A 3T95A 6ABPA 3E3MA 4RK6A 4NCAA 3RVRA 1FFSA 4PZ0A 3JS5A 2HPHA 4LDAA 2V0NA 2OQRA 5DTEA 2WY2D 4XAQA 3OM0A 3RH0A 4G0OA 1ABEA 1RXIA 1PEYA 1GUDA 4G86A 3N0RA 4MRMA 3LUJA 1JBEA 3H1EA 3NNDA 4RXMA 1VRVA 4OBBA 1QP7A 5FWXA 1SXIA 2HQBA 4KQCA 3M6MD 4RY8A 1UDRA 3UKJA 9ABPA 2MSKA 3EULA 2W42A 2VUIB 1E6KA 3CLKA 3EQZA 5FBHA 2JK1A 1FFWA 1GLGA 1NY5A 3MMNA 4UHKA 5HKOA 4N03A 2WJAA 4GPAA 3MA0A 2NUBA 3SQNA 4HNSA 1KRXA 1YK1A 3FFWA 2PUCA 5BQ3A 7ABPA 3IDOA 4W5QA 6CHYA 2FTKE 2PAFA 2E4WA 2JVJA 2PJUA 3HEBA 4OLAA 1RPJA 1LK0A 3GL9A 3HV2A 2FW0A 1U04A 4LE0A 3HO1A 4EVRA 4O1HA 3NNNA 3OQMA 3OMWA 4KVFA 2RDMA 3H6HA 3IPAA 3ROFA 1JF8A 1R8JA 5FBKA 1USGA 3EQ2A 1P2FA 3MQ4A 4RK0A 1Z15A 3MM4A 4KRFA 1JHZA 3OLVA 3H5TA 4G0XA 4PYRA 3F6CA 1BDHA 1A04A 2VYCA 3KCNA 4Q6WA 3B2NA 1QP0A 3LUFA 2H3HA 5ABPA 1MVOA 1MB3A 1YMUA 2FKAA 1ZH4A 2PL1A 2QR3A 3QEMB 4RK4A 5EWJB 4XARA 3QLVA 4YV7A 1JFSA 3P9YA 1VPWA 3HK2A 4TN5A 3T8YA 1JDNA 1U8TA 2E4VA 2LPMA 3JVDA 1M2FA 4Z4FA 3LOPA 4Q7EA 1DBQA 4RK7A 5JNVA 4YCSA 4MR7A 1H9CA 2CWDA 2F8TA 4Z4IA 1Z13A 2NT3A 1APBA 4ZJPA 1RZRA 4LDZA 4P1ZA 1NXPA 3ILHA 4QYMA 3DLBA 3EDCA 1YK0A 5D2CA 1SXHA 3FGZA 4RV5A 4KK3A 4RDCA 1EWVA 3NHZA 5IUNC 2FEPA 4RS3A 2HQOA 3EODA 3VNBA 1JFVA 4FE7A 4QICA 3CZCA 3Q7SA 3E61A 4Z9AA 4IF4A 3OLXA 5CNIA 4S04A 3DGFC 3M9XA 1ZHHA 3HDGA 3M9WA 1B00A 3LKBA 1NXWA 3SNKA 1BAPA 5TQ0B 2YHAA 1YMVA 4F3TA 4RXTA 1YTUA 4EYOA 1QQBA 1NXXA 4W5RA 1DZ3A 3N0WA 2RJOA 3BRSA 4RK1A 3T6KA 3KSMA 2O20A 3RVMA 4MQEA 1A0OA 4Q6BA 4FE4A 3OO0A 3FFXA 3R0JA 4EYQA 1SRRA 1ABFA 2JCGA 3NBMA 1YS7A 2IOYA 1BVHA 2IYNA 2FMFA 3OLYA 2BGGA 2X7XA 3JY6A 2WWVD 5BRJA 4LE1A 3KTOA 1DBPA 4W5NA 5KC9A 4OLBA 4Z0NA 3GRCA 3O21A 2MYNA 5BR1A 5B3JC 1Z17A 2QVGA 1PHRA 1DG9A 1D4ZA 4IGAA 1QO0D 4DN6A 4RWEA 4DADA 2PUGA 1U2QA 3CZ5A 2NZVG 3BBLA 1LBHA 3RVOA 4N41A 3O74A 3O2SB 3G85A 4EGSA 3LUCA 2MSLA 1Z18A 4WXMA 3QEKA 4N0PA 3TMYA 3QLUC 4JASB 4F06A 3HJFA 2IPLA 4MRMB 3RVLA 3HCWA 3T38A 3IPCA 3TB6A 2FQYA 5FWXB 5CNJA 1P8AA 3GA5A 3IP7A 1CYEA 4D74A 1ZDMA 4PICA 2PUBA 1MIHA 4QPJC 4FB4A 1JH9A 2QU7A 3UUGA 1DCFA 1T34A 2WMYA 2HJ9A 2FVYA 2R25B 4KZKA 1OXBB 2FEWB 4YWHA 1DC8A 4D6YA 4DQDA 5JNWA 1DBWA 1U0SY 3H5OA 4YGXB 4W5TA 2M1ZA 2AYZA 2GI4A 3LMKA 4L4UA 3O2JA 4PEVA 4YRZA 5TPZD 1EHCA 4RKQA 2E4YA 4IILA 3GBPA 3FFTA 3HDVA 5TQJA 2I6FA 2FQXA 4KQ9A 1GUBA 5HQJA 4MR9A 3CS3A 1Z2EA 3MF4A 5IUKC 4PE5B 4YP9A 2PUAA 2P4UA 3O1HB 1DC7A 2LBPA 5KWSA 3KLNA 3A0RB 1K66A 2ZWMA 4QYWA 5IBQA 3H6GA 1E6LA 1JFTA 2FLKA 3DBIA 3CKMA 5T7BA 5KQGA 4MR7B 4EVSA 3HVRA 2FMHA 5C5EA 4KFCA 3MIZA 4OTZA 1D5WA 1EFAA 3DLHA 4MS3B 3DZDA 3FDFA 4YS6A 2VK2A 3O75A 2B4AA 3C97A 4D6XA 3ILYA 3LUDA 2JVIA 1KGSA 1XWWA 4KMRA 2GWRA 2A9QA 5CNKA 4ZPJA 1Y1LA 2CHFA 2QVCA 4WT7A 1DRKA 3QX8A 2PUFA 2QZJA 3A3KA 1HEYA 5TPZA 1TMYA 3CFYA 4MAAA 4LRQA 2L18A 2QV0A 4OG2A 3N8IA 3W9SA 3CTPA 3SM9A 2FMIA 1F51E 5DKFA 5IC5A 1KRWA 1EAYA 4CBVA 1JL3A 3KLOA 4MS3A 5IX8A 3GBVA 4XASA 5E3JA 2PKXA 4G0ZA 1C0EA 4ZYLA 4HYEA 1QKKA 3Q41A 1M5UA 2PLNA 4WZZA 4EVQA 3GT7A 3FMVA 4ETNA 1RNLA 5JNSA 1FQWA 2F8SA 4MQEB 1TM2A 2B1JA 3O2QB 1YIOA 5EWLA 1KMIY 4RU1A 3GWGA 3LUHA 3LFTA 4E7OA 1ZH2A 4NQRA 1FFGA 1QMPA 3HZHA 2MYPA 2AYXA 3O1IC 1MB0A 2VUHB 3QX9A 4G0YA 4O1IA 3RVPA 3CNBA 3OQNA 1LBIA 1TVMA 2FSPA 3KYJB 4OATA 1DCKA 5CHYA 4E7PA 2JBAA 1ISSA 2GX6A 5JS2A 1L5YA 1USIA 2IPAB 3OLZA 5IULC 1YVUA 4MQFA 4RSMA 1CEYA 2YHBA 2JVKA 5BRAA 3JPWA 3HUTA 3OO1A 4G97A 4TMYA 3K9CA 3LUGA 3ROTA 5DCLA 4HNQA 3Q7RA 3KHTA 2LP4Y 5IEJA 4F12A 3HUUA 4Z4HA 2MYUA 3CRNA 3KJXA 3C3MA 1QPZA 5EWMA 2ID7A 5T3YA 3G1WA 4MGEA 5HSGA 1S8NA 1I3CA 3Q7TA 3CU5A 5TQ2B 1D2AA 1NXOA 2IDMA 4WUTA 1D1QA 2IPNA 2J48A 1NTRA 4HNRA 3C3KA 2NZUG 1M5TA 2PMCA 3TD9A 5ED4A 3H5IA 1Z12A 2PUEA 1OXKB 1J56A 1SD5A 1NXSA 2L2QA 4MS4B 4RXUA 3RQIA 4ETIA 2GKGA 1W9HA 4RY0A 4KNYA 2R4QA 3QLVC 3I09A 3LUKA 3IP9A 1LJLA 3N75A 1GCAA 3A0UA 3SY8A 4MR8A 5TQ2A 4N0QA 2E4XA 3CHYA 1PNTA 4IMJB 4IMIB 3L49A 4IRXA 1QP4A 1QQAA 3K4HA 4MR9B 4H60A 3JPYA 4MS4A 3KG2A 1Z25A 3QELA 3RVQA 1JYEA 4Z4CA 5TPWA 3BILA 4B09A 3LUAA 2Q5CA 1DJMA 1XHEA 3C6QA 3HXMA 1BDJA 3VNAA 3L6UA 1GCGA 1JDPA 2WRZA 4MS1A 3RVSA 1QO0A 5KQPA 3C3WA 3URMA 4KV7A 2RJNA 1TJYA 3OMXA 4G0QA 4Y9TA 2DRIA 4Z4EA 3GV0A 1PNRA 3H5VA 2ID9A 1RXEA 1F4VA 5KC8A 4YLEA 5JNRA 2PE5A 2A9PA 2TMYA 1USKA 4WWHA 4H3KB 4JAVC 4Z99A 1DCMA 3GYBA 4G0PA 2A9OA 4EUKA 4TLMB 2HQRA 1EWKA 4P98A 4EYKA 3NNSA 3F6PA 5C5CA 2LUOA 1ZESA 3KKEA 3UK0A 3JVIA 8ABPA 2JB9A 1NXVA 3IP5A 1BA2A 1MAVA 3RVKA 1RZRD 2P9HA 4UHJA
chains in the Genus database with same CATH superfamily
2G88A 2HA4A 3W3AA 2JRLA 2F3UA 4A2CA 5I4KA 1AV7A 4AZ0A 3WGGA 1L5ZA 2FFBA 5E38A 4AY5A 5L3ZA 3BGWA 1IZ0A 4ATNA 4J0FA 5F1OA 3NOOA 1QVZA 3WDSA 5L3QA 1M34B 2GN1A 3NOVA 5EIHA 2OCBA 4WESB 1C3EA 2IH2A 4D3SA 2XE6A 3MTDA 2JGAA 4QASA 5K0BA 2WZBA 1CLEA 1YL5A 4P8RA 1OCEA 3FSRA 5ALXA 1N6IA 1GGJA 2DBVO 4GM4A 1I8TA 1BRTA 1WSWA 5AUQA 5C31A 3FBTA 5J4LA 1W5TA 2M2IA 3E05A 5ULLA 3N0TA 6YASA 3VBEA 1B43A 4WV3A 4KK4A 1NVVR 1Z4LA 1E98A 3K16A 5JZOA 1WCWA 3EWAA 1UBJS 1IPEA 3A04A 3AOEA 1BE1A 3L1JA 3D3QA 4IX1A 3R3JA 2OGUA 5EUQB 1HE1C 3GG9A 1R66A 1ZCBA 2CLFB 1NMYA 3EZFA 4FFLA 1HURA 1K7FB 2QN8A 3MMZA 4FBGA 2ZJZA 4NLLA 2VPPA 4S1TA 3C24A 1XHFA 2W8ZA 3O8DA 3UVEA 4ZD6A 5K45A 4C78A 2FLVA 4EZIA 4JL5A 4OI4A 1GGHA 1JR3A 5JXIA 2CUTA 4YRIA 1FJXA 4YJKA 5KSWB 4NZYA 3IUSA 2G6TA 4AKEA 3EMBA 4CMAA 3DT8A 4G1VA 2GTIA 3R6LA 4LJ6A 2V5VA 4OUKX 5DB4A 1S0UA 1R9JA 3HV0A 1UDCA 3TQFA 1W36C 4KP7A 3H5LA 4C7KA 4MLDA 3QFSA 1FDUA 1GUYA 5TVGA 2BTQB 1TM5E 3LV8A 1IM8A 3GFVA 3SBEA 4DLAA 3QYAA 2WTEA 5CLFA 1EP2B 1ZBQA 4S24A 5AW0A 4RL6A 4DV6B 1JRLA 2RGYA 1QOPB 1V3QE 3ZR4B 5EP4A 3S2SA 4LF4B 3C5WP 3ZCQA 5K0LA 3L92A 1RVV1 2G17A 3GNTA 4C0HA 3QU4A 2HJVA 1E1KA 1TK3A 3DR3A 3LDFA 3ZTWA 1IEWA 1E1CB 2R47A 2M98A 4R7ZA 4PQRA 3OKPA 5GONB 5DZSA 4K28A 4QGHA 4XLTA 1GL3A 4FD3A 3UBTA 3UG7A 2D2VA 1E7YA 1JLLB 2HMTA 4HYTA 2WYOA 1FCJA 2KYRA 2KS6A 4HMOA 3C14C 1J07A 2XXAA 3FTCA 1MRSA 5TPWB 3P2YA 3W9UA 4IMPA 4CG0A 4AN1A 3AFIA 5K0NA 1U6JA 2CGEA 4HAVA 5HS6A 2RGGA 2IHTA 1AN9A 1LJUA 3KKNA 2GSWA 3PICA 1VGQA 3QMMA 4JOQA 5F76A 3K70D 2CV0A 2NVWA 4HT3B 1UQRA 3OZRA 5EXPA 4GPEA 4RPIA 1QHFA 5G1PA 4E2FA 2VA9A 1RWQA 4BQRA 2OTCA 1OYYA 2RFLA 3NTXA 4M9QA 4R1SA 3MCZA 4KVZA 4JBXA 2FN9A 2ZYHA 1J1IA 3JYPA 1JG4A 2XSZA 4ILEA 5T4FA 5B6IA 4DPKA 3WYNA 1ZGZA 1NMZA 1SBHA 2ZRDA 4QOEA 4WKOA 4C6TB 2NTEA 2NXEA 2WUWE 1XP5A 3VR5D 1BNCA 3IYLW 2XYGA 2ZW9A 3DLIA 2IZ5A 3FUVA 1BRMA 4N9QA 3RSZA 5ALNA 2AOTB 1CY2A 1JFFA 5FTMA 4G3XA 2ROQA 4A8TA 2AVNA 5LR6A 1Q0TA 3GJTA 3GLGB 1L8AA 2PU7A 3K30A 4LDAA 4OYHA 4KI0A 1L7BA 3X1JA 3ME5A 1NVEA 5DWQA 3W5VA 3L8YA 3TLGA 2Q6TA 2PBZA 3ITDA 1NQUA 3GVCA 2F4VB 4G0VA 5D01A 5T67A 2PNFA 3PGA1 4CM4A 1P0IA 1WS6A 1IEQA 1C3OA 3FW1A 4P9NA 1UMBB 1V45E 3NNDA 1R00A 4L5IA 1NOKA 5FWXA 1U1FA 5B64A 4KO2S 1UDRA 4UFPA 4YYZA 4C1BA 3H3JA 2BIFA 2EFJA 3KWLA 3NGXA 4JDPA 1N5RA 2G3YA 2LVBA 1T4CA 3SQOA 3DL4A 4BB0A 1M54A 3L5KA 3TTYA 3CJQA 3VAZA 1QHNA 1Z6GA 1LY1A 3UH0A 2HRZA 1KU6A 3KSAC 2DTXA 2D7JA 3V7NA 2VJMA 3Q85A 3K0EA 4IYRA 4EITA 3RAEC 2DECA 4KKXB 1SVOA 1ZPDA 4H59A 4B35A 1NE7A 4DWWA 3FKQA 2BRUC 1QDLB 3OQMA 3IPAA 1JQ3A 3H99A 3HCNA 3NASA 4MCIA 1RXVA 1DKUA 4XVHA 4BNWA 4D82A 2DR2A 3FDIA 1IN1A 3W05A 4XWYA 2J0UA 3MJ4A 3SHWA 4X8LA 1GNSA 2X2PA 3VU0A 3PGLA 1AK1A 4J0EA 2AZ4A 2FF5A 1YRBA 4CKCB 1RKVA 3BJRA 1QP0A 4FFDA 2XKJE 4RFVA 4Q00A 1BKSB 3NEYA 1WUJS 3MRVA 1XMQB 4DV2B 2X6TA 1L1QA 5BYAA 4XARA 4ACAA 1JAXA 1BSVA 2ZI3A 4YRNA 1BVYF 2C5LA 4D4GA 4V39A 1R64A 3IOCA 2VHXA 1QYVA 1DBQA 3RF7A 1QGZA 3MWGA 2PT9A 4D8WA 4YCSA 2ODTX 2JFFA 2F8MA 4OMDA 4A6EA 3KUCA 4L0CA 4QOHA 4OD0A 1RZRA 2CBGA 4LDZA 3O8OB 1EVKA 3TX2A 3WXBA 5DF1A 1EEXB 2H2IA 1Y9EA 3EDCA 2WQZA 5I5EA 3KXLA 4MHSA 4E6PA 4PY2A 3JR3A 2D5AA 3QKUA 4WASA 4KK3A 4BFUA 4MIEA 4DIEA 5IUNC 3TLCA 1XZ8A 2CVZA 1MZVA 1OI2A 1UZUA 1CE8B 1WG8A 4MHOA 4N3BA 4Y2SA 4EP1A 2RHHA 1NC1A 2QIOA 3CZCA 3Q7SA 2PFGA 3F5QA 1PKEA 1E62A 3T7KA 1F4LA 4EVIA 5IDXA 3RJ9A 1NXWA 3H2KA 3C5HA 3USES 3ENVA 4QREA 4KQGA 2VRBA 4HNAA 1DWOA 1XPUA 2YHAA 4X71A 3IOYA 1QNFA 4YR9A 2YV3A 1FU8A 4IZIA 3QOWA 2Z2ZA 5J63A 4UTPA 4BX8A 1LRKA 3D7RA 3VMMA 3COYA 3KALA 1KQGA 4LF7B 3P71T 1J90A 4TYPA 2ZTHA 2H1SA 1ADJA 3V1LA 1V11A 2HGZA 4AP6A 4B3XA 1PR6A 2ILTA 3W1EA 5EJ5A 2X8JA 3K9FC 2Z9BA 2PWYA 3KT8A 1W47A 4G65A 1RM5A 4S3MA 4D3FA 1Z2PX 4HPXB 3H5NA 2NU6B 1L7MA 4Y2VA 3RU3A 2GM4A 1EP9A 5JVDA 2WWRA 3UPDA 3ZJYA 4N48A 3U09A 3EZYA 4JJEA 3ZWCA 1HK7A 1QX4A 2JJ8A 2O0LA 3AILA 3ETDA 3FWHA 4QA9A 3OJLA 5DWDA 1GV0A 1KH2A 4CTNA 3DKKA 4C08A 3ESQA 2DERA 2PLAA 2NZVG 3FDZB 1BJTA 1Y8QB 3B8HA 3A2LA 1NQVA 1IQUA 2E9SA 4MUAA 2YOHA 5K3BA 1QR2A 1AUVA 3PFHA 1WQ1R 3UMVA 2MSLA 3DE0X 421PA 3JWJA 1H2YA 2PL5A 2W6JA 3QLUC 1U65A 2MTBA 3PZBA 4IXNA 1SQFA 2B37A 2NTNA 2P2CA 1JEJA 2X9QA 4CKEB 1GP2A 1CUXA 4KE9A 3IP7A 4A91A 2WYVA 2Z8XA 3FHCB 2C58A 2PUBA 2P79A 2WKSA 3GFFA 2FR8C 4BMZA 2QU7A 3KQLA 1H0RA 3GAFA 3FWNA 3GEBA 4MIOA 3NHFA 3ZW9A 4AJ1A 1BN6A 4Y1FA 1LNZA 5E4TA 1Q3KA 2AN3A 3CVXA 3TCNA 4PHGA 5ALJA 4JC0A 1GSAA 4ERNA 1UJMA 3GRUA 2EP8A 1O95C 4BWGA 2N46A 1EZ1A 4OU4A 1L4UA 2HV9A 2OE2A 3E9NA 2EKPA 5B7PA 2E1RA 5BQ5A 4DIDA 1ZCAA 4I46A 3TTWA 3DB1A 3EF3A 3EISA 1GUBA 3NAGA 4YJ3B 1EIWA 1ZH8A 1WZUA 3B48A 1MF7A 3RJMA 4BP9A 3DOFA 5LQNA 1C8LA 3AKYA 3GLHB 4K88A 4DKXA 2ARKA 5JVDF 2QXTA 4DMCA 3LHFA 1YZLA 2D6FA 5LBIA 2H06A 4TRJA 2CYBA 1KHHA 3B5IA 3IJ5A 1TCVA 3KETA 1UKEA 4WCFB 1QVVA 4IS2A 3KPYA 4XZ3A 2B7CA 2ACEA 5DE3A 4DOMA 4W7HA 4PLWA 1OBVA 1JJVA 1XVLA 4IGEA 3U26A 1K7XB 2I1WA 4R1MA 4JBYA 4D4MA 5JNLA 2O2EA 4B9AA 3I52A 2VP0A 3BM5A 3HPRA 3TUJC 2GPWA 1IZYA 4XVUA 3KIPA 1C7EA 3OQIB 5GWXA 4A5OA 4WZAA 2PZFA 2JI6A 4O33A 4ZPJA 2VRCA 5FPSA 4YQZA 2NUAB 2NMVA 3UOWA 2VTVA 5LDDC 5LUAA 3T1YB 5JFTA 4HNHA 2H6EA 3DBLA 4E08A 2YMPA 3QVTA 3I1JA 3ZHTA 1V5IA 1RRCA 3JRNA 4OG2A 3F71A 1TX4B 1TYBE 2QG6A 4HFNA 3ZTYA 3W8NA 1V39A 1F51E 2AXQA 3TDNA 1GDDA 2GNPA 4KYTA 2BE9A 1TA4A 4UEKA 2WLSA 4HRXA 4HXYA 4P38A 4BP3A 1C0EA 1U9CA 2YJGA 2LCQA 1IBRA 1RM4A 3SKYA 5AVYA 4ZODA 4JI2B 4WZZA 4RPGA 2IYYA 2J67A 4FFPA 3DMFA 4HHEA 4UREA 1FQKA 1SU6A 2CUKA 2FSHA 2PH5A 2FSVC 3GT7A 4JQZA 1ULZA 3Q87B 3H11A 5CM2Z 1JH8A 1H1LB 2GR9A 2Q3JA 2WEKA 1BW9A 4Q39A 2QJFA 4M60A 2L0XA 5HCNA 1J5EB 1YQGA 4ICIA 4NOMA 4LVNA 1Q7BA 5GTDA 3KSDO 2FSPA 2JNWA 4BVGA 5J59A 1WQ3A 4OFBA 4N9WA 1MQ9A 1DCKA 5AJHA 2XB8A 1WWKA 1JV2B 1ZA2A 3HUDA 5EXEA 5K8VA 4WE3A 3SQXA 4DMKA 1L2TA 2ZIZA 5B37A 5IULC 2PXHA 3WQBA 1R6UA 1QWSA 1UAYA 4FK8A 1D3AA 5FOXA 4UNNA 4D44A 1JA0A 4H7HA 2CBZA 1FXSA 2DFDA 3IKVA 3CUWA 1T4DA 4AICA 5DM0A 2C0CA 4BV2A 2QUZA 1NP3A 1XX6A 2GRUA 2QW0X 1LQUA 3D6MA 4XYGA 5EIBD 3WBBA 5K09A 3U60B 5K8LA 1FSFA 2HEIA 2HQSA 3ILXA 1VG0B 2PUVA 4ARCA 1O5OA 1RJDA 3Q7EA 2DBYA 3DXFA 1BX3A 3QPWA 3UA3A 4BNDB 3UOGA 4X60A 3NP9A 4BNFA 4Q7QA 2BM8A 1KRHA 1MABB 1JHDA 2HN9A 3AXTA 2WTMA 3CU5A 4BFVA 2JKVA 2WP8J 1S2OA 4KN8A 5TRTA 3TOSA 3SMQA 4AS1A 1IUKA 3AI1A 4PLYA 5GZ6A 3PKJA 1F8GA 2OBXA 3EYAA 4NV1A 4P4GA 4HAWA 4TXHA 4YP1A 1ZCZA 4GX1A 4X61A 5FLYA 4C03A 1F14A 1VSVA 1NNSA 2H65A 3QUTA 3R44A 1AQYA 1F60A 3T9FA 1YZNA 4LMRA 1HT1E 4CL8A 4LNUA 4YC7A 1IWPB 2QM0A 1OYWA 3IP9A 3VR5H 5B2FA 3GN2A 1WXHA 1MEJA 3NH6A 1N1MA 5TQ2A 1Q7CA 2FFQA 1H22A 1FFXB 1L1EA 1CZUA 3MJFA 1RPNA 2OXCA 2XODA 4MUNA 4RW0A 1EA5A 1IHXA 1PNTA 2NOAA 1Z35A 3G9QA 4IRXA 4QU9A 5ALSA 4B2IA 3E23A 3EUEA 4OHUA 1IBLB 1SD2A 1BDBA 4F2WA 5GINE 4P7GA 5JSYA 2G0TA 1N7GA 2C2OA 2YQZA 4DXDA 2EHJA 4MS4A 1WY5A 2HIGA 1GTL1 1TM7E 2BMEA 1KMHA 2V7UA 2WYHA 4OXQA 3TLAA 5IF9A 3KQKA 3UAOA 1AMNA 4MMYB 5CG2A 3SC2A 1W5FA 5CDFA 2V4ZA 1Y6RA 5I8ZA 4BLRA 1C1YA 1MNQA 1WLYA 4TROA 3WISA 2W2MA 1H6DA 1R50A 3V1MA 3V4PB 1G0NA 1JNXX 1T8TA 1V1RA 2REQB 1PJAA 3PUYA 4HWSA 1E5XA 4I1RA 4R81A 4CMHA 4XW2A 3BJIC 4KV7A 4TV9B 3T06B 4DIUA 1IXSB 1KP3A 3EEBA 3VTZA 3QU2A 2ASVA 3IAEA 3OLQA 4UEWA 5G4LA 2C2YA 1OXTA 1LZKA 1W85B 2Q5JA 4A6XA 1YC2A 5ADWA 3E5MA 2VDPB 1LI7A 2PRZA 2FUKA 2JIRA 1QF9A 2TMYA 4MRRA 5DFAA 3D6JA 2XAUA 4TXLA 4K3VA 1DCMA 2W8BB 4LY6A 4RTQA 4BZQA 4JUBA 4OSPA 1GQYA 4PX9A 1JSCA 5AK6A 3EQ7A 4L5CA 2BMDA 5C5CA 1H4VB 5JH7A 5AJUA 4DXAA 2XWJI 2G1JA 3BTSA 1F0YA 2PGNA 2R8YA 1PWYE 3OHMA 4HDMA 1RMYA 2WINI 3F74A 4RTPA 2BM0A 4EMUA 4RTJA 3R20A 4MV3A 1UBCA 5C51B 2D2XA 3M6LA 4P5DA 5B1DA 1ISHA 3AB8A 5AKIA 2CMDA 2WILA 4L4ZA 2XCUA 4KSCA 5DGHA 3PJFA 5FULA 3ZIUA 1KAQA 3IOBA 4ZARA 1GR1A 1RI5A 1XGKA 2N9UA 2ODEA 5TEWA 1MRZA 3T94A 3DUFB 1Q0ZA 3E22B 5JNTA 2E5LB 2AG1A 1UKAA 4ARVA 1EFKA 2C7GA 3VBCA 2FPKA 4YLGA 4HAIA 3N2IA 3NBAA 4CLHA 1K68A 2CDCA 5I48A 1V4VA 4W82A 4TSRA 5DMXA 4B43A 2I33A 3I5AA 4B33A 4P0QB 1NR1A 4B79A 4CMGA 2ZTLA 1CHNA 5ESRA 4PNEA 3NU1A 4NYIR 1NF2A 2ZYIA 3EIWA 3HZRA 5BSEA 1P45A 4GVPA 5I9LA 3S5UA 3HCDA 4K3UA 2YQ5A 4GE0A 5AKGA 3RJZA 4QGAA 1ULBA 1XCOA 5A2QA 2VS1A 5AQ1A 1IJEA 4KQFA 3OLWA 3ORQA 3BRQA 5J47A 1QH0A 4LX8A 1EFVB 3GJZA 4ZQBA 1VIVA 3HB1A 1UDXA 3THYB 2GB4A 1E2EA 2HWWA 1Y63A 2C0QA 3IDZA 1PVVA 2F48A 5FTNA 2I8LA 3ZCTA 2COKA 2HF8A 1J0DA 3R5XA 4XUGB 4YAIA 2YNMA 2R65A 3MTBA 1UMKA 2B92A 1XRPA 2Y0CA 3CUYA 2RB4A 1BS1A 5AW4A 5KO2A 1I7DA 4OP1A 5JH7F 2UYGA 3FMGA 2XWBF 5KHLB 4RTRA 5TY0A 4ADSG 4A36A 3M5DA 3M6VA 3JQDA 4MUMA 3SYNA 2I55A 2KHZA 2OKCA 2Z4RA 3K6SA 4BMOB 3U0BA 2Z6UA 4M55A 1D1PA 3G88A 4JS0A 4Y0VA 2QVYX 1KFBB 2JIDA 3QXJA 2Q4EA 1KI3A 1L9KA 2CLSA 1Z0SA 4CE6A 4YACA 4DLUA 1L1FA 4ZVNA 2LDBA 1M2NA 2AMVA 1M8PA 3N0XA 4KAAA 4N3NA 4BEWA 1AF7A 4QL3A 4PSAA 4ZALA 1VP3A 2XXJA 5CXUA 4N76A 5F3RA 1M83A 1JHXA 2O7SA 5D6NA 1AB5A 3SE7A 2OORA 2EIHA 1E79A 5CBPB 2XADA 1DAHA 5E9AA 5G0SA 3IV9A 4UHFA 3VYUB 2CLEB 2E4ZA 3QWHA 3AETB 3JQCA 4RLHA 1YWGO 2VEOA 1Y42X 1N2JA 5DYWA 2IS2A 4AK9A 5E1BA 1M5RA 4DGQA 1K63A 4FFBB 3EGXB 3H4IA 1PJSA 5DGTA 5U1PA 4J90A 4LF6B 1ULHA 1NIPA 3G2OA 4TT8A 1X3LA 5FTJA 5K99A 3U4QB 1U5BA 5EPOA 3T7AA 4C1NA 1J0XO 2WJWA 3S7TA 3SZLA 1OWMA 3ZJ4A 1VMDA 2ZVQX 3PRYA 1L7AA 1II8A 1EXVA 1SHLA 1TM1E 2WOOA 3D7SA 5FOUA 1HR0B 2Y6UA 3FYSA 4RCZA 3OFNA 5CXQA 3K0CA 4FDMA 2P2GA 5K05A 3QPVA 4TTIA 1Y89A 4EBBA 1L7EA 1WETA 1MO5A 1C0IA 1XQWA 1FJHA 1ACMA 4XOIA 3AIIA 1ODSA 2XMZA 1MV8A 2I34A 4JKOA 4KIWA 3RCBA 3DHEA 4JX9A 4KFSA 4NDAA 4LC1A 3M8KA 3FXAA 3EH2A 1HEIA 1Q0UA 1Q83A 3IVMA 1SC9A 3HKCA 3MFYA 2GXUA 2O8BB 1RWKA 1W94A 4Q1AA 5DULA 5FI0B 3T1VA 721PA 1YMQA 1YQEA 4ALNA 4KL8S 4PCVA 3VZCA 3WGNA 1DT5A 4GF5A 4P0TA 1NWHA 3ABSB 4X20A 3Q8WA 3QNUA 3G0HA 5DT2A 5KOHB 4JT2A 1BX1A 1P60A 2AHRA 4DLSA 3T5BA 1TK9A 2WJZB 3L8MA 2A1IA 4BUZA 3QVGA 1WDWB 3PQDA 4RM2A 3WI7A 2ZUFA 2HWXA 5AH0A 1VE1A 4V0SA 3X1MA 4DLKA 3GIDA 5DT9A 4PYLA 4JYPA 3DVRX 5AI4A 1KEVA 2HQBA 3M6MD 4EJFA 4XFDA 4BRZA 2LD4A 4R3NA 4MP8A 5FBHA 2AC4A 3MMNA 3UV3A 5DI3A 1OKKA 1SIOA 5ALYA 3KZVA 5CB4B 1Q0LA 3LJKA 4KXWA 2NO0A 1C8VB 1KRXA 2GD1O 1GU7A 1KI6B 2ZS8A 1EGMB 4MWTA 5CVJA 5JROA 1BEUB 1JKJA 7ABPA 1FVHA 1QYRA 6CHYA 4MUIA 1P4AA 3SS7X 5EMMA 5TEVA 3GL9A 3NKVA 4LE0A 3RAPR 1F0KA 1XEXA 4YV0A 4NVRA 1UJBA 3NNNA 4FUQA 4K0KB 2Y6VA 5DV9A 3K20A 3MFQA 1AO0A 5ANRB 3RI3A 4L9WA 2CCJA 2RHTA 2LXNA 3MT0A 5G1NA 3ZNQA 1XCLA 5CG1A 4H27A 2FG7C 3ZXIA 1G17A 2QTTA 2XNJA 2I6XA 5HIMA 3RRBA 3OEHA 4ARIA 4Q6WA 2BBTA 4H6PA 3L6DA 3MJTA 4UPVA 1J2YA 1RAFA 1ONBA 5AKJA 2J1LA 5A4IS 2DSTA 3O84A 3VO1A 2AR0A 3ZWBA 4IRUB 4V0ME 3VNQA 1NBAA 4U2CA 3PQ2A 5EVJA 3EZ6A 1I1NA 1GPBA 3LOPA 4EHFA 2RK6A 1MQAA 1LLCA 3WHPA 2FCAA 3AI3A 3C6BA 3CF6R 1TA0A 3AEQA 3KD2A 4JH0A 1NYRA 1NXPA 4RFLA 2Y0DA 3KAQA 4OXRA 3ICWA 3PXCX 3R7BA 3DKRA 4XWGA 1HDIA 1OFVA 4DCGA 5KVVA 1K75A 5FLXA 5LZ9A 4RS3A 1R0XA 1JSXA 1L8XA 2BFMA 3S29A 2V7QA 3G7NA 3ONVA 2ZRNA 1XVIA 2QQFA 1P75A 4RVHA 1CRQA 3D4IA 4U8HA 4RFSB 3ZCVA 1DAKA 1ZHHA 4R2JA 2K87A 3MWDA 4A03A 1B00A 4RQUA 1ILWA 2GLTA 5BXQC 1HA3A 3NTOA 2PU5A 1KSHA 2ZSIA 4DIBA 4EEZA 1Z3CA 1YMVA 4X8MA 2GHIA 1YTUA 3Q9NA 4G9EA 3TTUA 1O58A 1YDWA 2ZJFA 2ZYSA 3NUZA 5DSTA 1NXXA 4AN4A 1BCRA 4RLFA 1KJYA 1BFDA 1NASA 1XCBA 2RJOA 2Z04A 3KTAA 4WNYA 1TQ8A 1UK8A 3AZQA 3VYTB 5G40A 1PCXA 2PZEA 2QOEA 2VLIA 3OFSA 1GITA 3BA6A 4LC9A 3J7AC 1OYVA 4DQLA 3KJIA 2W98A 1RRMA 4EZEA 3W4IA 2GZRA 2ZI9A 2OCKA 4QBFA 1LPSA 1WHTB 4Q4HA 3OLYA 1HEUA 4F9TA 1Y5NA 7AT1A 4ON9A 2ZWVA 2GTHA 2WLTA 1UH5A 3I0MA 3MJEA 2WWVD 4JJZA 2BHLA 3TBHA 3UCEA 2GDZA 3N05A 5BRJA 1S2MA 2CFOA 2MYNA 4JI1B 3F8SA 3L4SO 5GJVC 1X80B 2C2MA 1QKJA 4FMCF 1PX0A 3ILVA 4UE6A 3OUTA 4BV3A 1HF3A 1OXVA 5J3JA 3G5MA 5AUOB 1E4EA 3FCCA 2CB0A 1K89A 1NUPA 1QIJA 1Y1PA 2W11A 3AUAA 3C4QA 2D2FA 3DKPA 2VSXA 1COZA 2C3PA 4JLWA 5E9JA 1K3UB 2WR8A 1H3FA 1P1RA 5IJXA 2CE2X 3TMYA 1R0BA 5FPKA 1OPXA 3V5NA 4A8PA 4UMFA 4PIVA 2J9ZB 4D9IA 4DA4A 2ZWIA 5FHRA 3Q72A 3IE0A 2DMRA 3IR7A 4EG1A 4HNVA 5C4MA 3LZDA 3N2KA 5CEJA 5TVKA 2WUVA 1WDKA 3AWIA 2B5VA 4GFDA 2P69A 2FQYA 4GQBA 4XYMA 1KZ6A 4BNVA 1P8AA 3L0PA 3V8EA 2BFFA 1RBYA 3PF8A 4JCOA 4WNAA 2IV3A 1N2OA 1QGAA 2QUHA 4OMFG 1ACLA 3M89A 4BX0A 4YASA 5INTA 5FNVA 3RG8A 4IZOA 4ZO4A 2UUOA 5I9IA 1GSOA 5EMNA 3TWOA 3BD9A 1J2EA 1DC8A 1PJ3A 1JR2A 1M7GA 1U0SY 1OZGA 1UKZA 2B8EA 1UJ4A 1EXMA 3G0GA 2Y92A 4LGVA 3R5KA 4XX0B 2IP4A 3OPMA 3IEMA 1O5TA 4B4UA 4CV0A 3MBKA 4F46A 1JVNA 1P7WA 1M6VA 3M34A 3LK7A 4RKQA 1LVHA 3C3DA 2H1LA 5TQJA 1EWRA 1Y4AE 1NURA 5T5QA 5M34A 1YBMA 1UJ5A 5ECWA 5TX7A 4US2R 1GTVA 4KR7A 2BGUA 1IBMB 2DWCA 3NOQA 5LLSA 4Z3OA 1GCOA 5CX4A 3OOYA 4JT4A 3COJA 1XAJA 3A1FA 3E8SA 4KQXA 4TL7A 2BI8A 2P4UA 3PFBA 2PRSA 3PKIA 3IPYA 1C7FA 3QJGA 4NJMB 1PQUA 5CBKA 4B8ZA 3B70A 4RD2A 2R5FA 1ND5A 2ODWA 6REQB 1ZCFA 4TLBA 3PR2B 2RGRA 5TARA 2YR0A 3N76A 5JC8A 5CVCA 2RC6A 4GI1A 4L0QA 1CCWA 2X0FA 2UVDA 1ZMXA 2DBZA 4OTZA 5HZGA 3EXAA 3WIBA 1R6XA 4FKMA 3C97A 3BF7A 4N8SA 3S2UA 4ND5A 4Z51A 1FYWA 2DH6A 4AY4A 4OJQA 3UWOA 4KMRA 3IIMA 4B6JA 2OGWA 1UBLS 2A4KA 1W30A 4A8JB 2WUFA 5KYUA 1WXFA 1U3UA 3ENQA 1UKVY 3LX6A 3AF0A 4IIEA 1ATIA 1LPBB 5FNVF 3IJEB 4NOLA 2O50A 1ZZEA 4ZZIA 1ADFA 3GD5A 3JQBC 3JASB 1GNTA 1IOVA 5JOQA 5CA1B 1S4QA 3KPJA 4EA6A 4X3CA 4UM9B 1QRTA 3GPCA 5LP6C 3TNFA 3ISTA 1SZJG 2BLLA 4AJOA 3R4CA 5KYTA 4Q66C 2CJXA 2PGJA 1FPQA 1XL0A 3TE7A 3W79A 3R0QA 5IT0A 1Z6TA 3UFXB 3HXOA 1PR3A 2A7XA 3KO8A 1UPFA 2ODNA 4C29A 4FYMA 1TGVA 1PT7A 3IS3A 2LKCA 1NG9A 1QDEA 2O8DB 4O8CA 2FPUA 1FFHA 2EX1A 1G20E 1HGXA 1KVUA 3QV1A 4CG1A 4EHNA 2VUHB 1U2ZA 1T5LA 4BVKA 5HMMA 3HMKA 2FPPA 2Q4DA 4GE3A 3AUUA 5MGBA 3GLTA 2IIQA 3BKWA 4XE5A 2QD5A 4NRDA 3TS1A 3WC4A 1EBFA 2E5FA 3L8HA 3JAKA 1L5YA 3ZWMA 1GA1A 2I67A 3TQCA 2GVDC 3N8HA 3EVCA 3SFVA 4FD2A 2HYDA 2QN7A 2IXBA 3KB6A 4E33A 3HUTA 3X1WA 2EF1A 2Y1WA 3QF4B 4LPSA 4N6NA 4X1YA 3KVRA 2UZ4A 2ZREA 5EERA 2VFAA 4B47A 4HL6A 5JXHA 4O3MA 1YZVA 3ABRB 1U0FA 1AH2A 1EDOA 4C21A 5JSZB 3ZE0B 3N74A 2J6IA 4PG8A 2NGRA 3OCJA 2AR9A 2YHIA 3FNEA 1T26A 2AQ8A 1QQTA 2JI7A 4L9AA 3AXSA 1Y5MA 4M0PA 4UULA 4HK4A 2JIPA 1PGOA 5F2NA 2JD0A 1ZK2A 4NU6A 1AHNA 2PKEA 4Z1OA 1F2TB 2Y0PA 4MCAA 1HG1A 3V4FA 2PUEA 3BE4A 4B3TB 4EFMA 5CEFA 1P7PA 3HN2A 4GMXA 1CR6A 3M4JA 4KIJA 4BC1A 4C0XA 1HDCA 1C9JA 4LRSB 1J49A 2HNKA 3OSZA 1ORWA 5DOZA 1JU9A 1KHTA 3REGA 4OQDA 2PX5A 4PZ9A 2G9ZA 3V4RA 4GEGA 1MD9A 3UW3A 1I14A 1T0IA 5LD2C 1V5EA 3IKLA 2K7ZA 4RDIA 1XTUA 3I28A 4BDSA 1XUOA 4DLTA 4M37A 5HTOA 2G1UA 5FYDA 5K03A 2WIAA 2O52A 2GUGA 5A03A 4UBKA 3LBYA 1IN7A 1QP4A 1QQAA 3N2EA 5HRUA 3NVMB 3LCJA 2GAIA 4JNKA 2PGLA 2FSFA 1Q7GA 4U0KA 4DCNA 5ITZB 3A31A 2ADMA 3D7LA 4GO1A 3RB8A 1B6GA 3JAMA 1U7ZA 1EDEA 4I9FA 4ESVA 4B3FX 3FZEA 521PA 1EFCA 3P0IA 1E8NA 2J3MA 4H16A 2PLWA 3R3SA 1KVRA 1P4SA 4FNAA 5E6RA 5TT0A 4UATA 3FSGA 5FCDA 2R85A 4G0QA 4ZZ0A 2R6HA 4XH9B 1PTJA 1T25A 2AOUA 3AEYA 3PFNA 3X2SA 5JV5A 5JTTA 2I2BA 3HYSA 2EW8A 3PUIA 4HY3A 3RASA 3GEPA 1XCGB 4GZ6A 1KDRA 5KC8A 4FINA 4FR5A 4JZYA 3KAKA 2QSYA 3NRBA 1T1SA 3D7NA 1OYOA 1A71A 1USKA 1ZOPA 2FQQA 2GF2A 3QVWA 4WHMA 3HY6A 4Z99A 1B6RA 3PLNA 5AJVB 3QVKA 5ALUA 2O14A 1MV5A 2COEA 5DK6A 2O23A 3EDQA 3F6PA 2LUOA 5AYVA 3K94A 4LOAA 4XDYA 1M6YA 1FP7A 3JVIA 4RGQA 4EY4A 5MFPA 8ABPA 1NXVA 1ZHFA 4PG7A 3RVKA 2HUNA 4QNRA 2AR7A 4PZUA 4BFTA 2QBYA 3NGMA 1KFCB 1H9BA 3OZGA 3Q11A 5IAOA 1MX3A 4ZCIA 3W6OA 4MVJD 2H9AA 3IIIA 4RENA 2FH5B 2OC9A 4DSOA 5AXAA 1E2FA 3QJYA 5BW4A 4JR1A 2WVJA 4BO4A 2BL4A 3B2QA 1ZHOA 4ND4A 2FJPA 5A6VA 4WJLA 2V4MA 2WOJA 1W2HA 3AHIA 4WIAA 3P97A 1HZZC 2WTAA 1QYXA 1V5FA 1E32A 1ZMTA 3PENA 1Q2UA 1DELA 3N2LA 3OQBA 3OZCA 3LQFA 5T64A 1FLNA 1CT9A 5EP3A 5I9MA 4DWOA 1MT0A 4ZVMA 1FX1A 3S44A 2ZWOA 2ERCA 1VJGA 4LXIA 4WXEA 1SCJA 4UNPA 4X90A 3D2AA 3Q3EA 4M3NA 4EYGA 5JI3E 2XNDA 4MV8A 1LS1A 4HDRB 2R48A 5GJCA 4K9RA 4I4LA 1XHLA 4I9UA 1JDZA 2UYYA 1BWQA 2QPLA 4I8XA 1IMJA 3KOYA 5B3KA 1HYBA 2O2DA 1AB6A 5SYAA 1SZDA 3WKEA 1I6LA 1N33B 3KQTA 1AQ6A 1CETA 3PPIA 2F9MA 4HC4A 2ZVDA 1DE0A 2GJSA 3MPOA 4WESA 3H8VA 1MP0A 4P4SB 1MAWA 2GYUA 5JFOA 3Q8LA 2MMGA 1Z5GA 1XOIA 2H1RA 3RAGA 1W4BA 3OQ6A 5J9FA 2B0CA 5ALOA 2VRWA 1QH8B 4C0WA 5KNCA 4EB0A 3I62A 4NK5A 4HVLA 3WL8A 1Z2DA 1C3JA 4IIUA 4B34A 3ZJVA 4MYRA 3WWZA 1GSIA 3CR3C 3ROXA 1KBOA 2G9RA 2OBMA 3D43A 3IAM6 1BHJA 2H2AA 2XT0A 3D2CA 2Q8PA 3PC6A 3IDAA 2EZ4A 2G67A 3ILSA 1VC2A 1EQUA 4RACA 1A5TA 5G0WA 5ICFA 4ZVSA 3IEVA 2O4CA 2Q21A 3PC3A 3U17A 5HKKD 4UE2A 3T7DA 3DV2A 1OBCA 3IQIX 2HMVA 4AMUA 3WP0A 1U0LA 4BQQA 3NZEA 1UAGA 1G4HA 4RD6A 2V03A 2QT0A 4M8IA 5EZ5A 5HPYB 2C5GA 3BRWA 3PEUA 5AHOA 4AXXA 3ORSA 1WHSA 1VL8A 1ZRSA 1ZN7A 1G3RA 3IURA 3VOTA 1HKHA 2RHMA 4ASUD 1T6ZA 3F5MA 5IHXA 2PTHA 2FYTA 5G53C 5GOTA 3BCUA 2ZZMA 1PQPA 2AFRA 2L19A 2YN4A 5IJZA 3GP3A 5ECGC 5GJBA 3IMFA 2R4TA 2RHJA 4CF4A 1OJ7A 2BTQA 3QELB 1DKOA 1DSSG 4YXWA 2VXYA 3OTQA 5A7HA 4CCYB 1B1AA 1A9XB 3ESXA 4W1PA 2NUTB 3GGGA 3FOWA 2WA1A 5BNFA 1C9KA 3WKBA 5JARA 5K8CA 1ONOA 3F6RA 3G5AA 3NETA 3OCCA 4LHXA 1KYQA 4H4CA 2BUAA 1PWHA 2DQYA 1I1QB 4Q05A 4BNKA 1U4SA 5LPNA 1CR2A 2GKOA 3HBAA 1WMDA 1VA4A 2C07A 4BB5A 3SIRA 5LQRA 4GYWA 4Y6OA 1M8KA 3A1DA 5GONA 1RLTA 3VNUA 3G6KA 1OX4B 5DHFA 1FSGA 3L1KA 5C32A 1ENZA 2WIJA 3H7AA 4F4JA 4LE2A 2ZAYA 1UBMS 4N1AA 3ZQJA 3ESYA 2F9LA 5ILOA 3ECAA 5HM8A 4ZCMA 1G8FA 1W59A 5IN4A 1W5AA 2HBZA 1T8RA 4LV5B 4RHYA 3T5TA 3TAXA 4B6PA 3M5WA 2IF0A 3WY9A 2ZJ4A 2NU8A 1XZIA 3CH6A 4KAJA 3HXKA 3ERCA 3ORYA 3NWPA 1X15A 2E89A 4TPKA 4B8WA 4A0FA 4NCAA 4B40A 3UMRA 3S1SA 1EUZA 2OO7A 2Z3WA 2J08A 1EDDA 4G4SO 2DSNA 1A8QA 2EAUA 3SQDA 1LWOA 1E3EA 2D5BA 1M1YE 2AXNA 1ZG3A 2XGOA 1JT9A 4IXWA 1EFTA 2YXBA 3CGGA 3WWYA 1SD1A 1E6EA 2XB6A 2ZYVX 2RONA 2QLJA 4JP5A 4LXXA 5CVEA 3GLIE 4LJRA 1L0BA 4MCJA 3STWA 5LC1A 3EULA 3B82A 5EJ7A 4Y2JA 5F77A 1JJFA 5JZ9A 4TTVA 1XTIA 2P9FA 3M1YA 1WBDA 5JHGB 2GCPA 2ZIAA 1U80A 1WEKA 1X1DA 2ALJA 2ATXA 2XUGA 1WB4A 3GOQA 3MJRA 3SQNA 1F8YA 1NBIA 4II3A 1QAMA 3CINA 2PKRA 4BO2A 4F3KA 1V3VA 1X42A 4B3GA 1YB2A 1UMBA 3LQYA 5CT9A 4C4YA 3RIYA 1KTVA 3KD3A 4JENA 4O1HA 3DM9B 3M82A 5GONF 3NIWA 3OA0A 1R3UA 5AJWA 4HVCA 1SUPA 5K0JA 4R9SA 3KTDA 4RK0A 4RTOA 5FP0A 3VZSA 3IEUA 5EHZA 1H3NA 4UHBA 4CWAA 4Q3DA 5B58T 4R7GA 1UKCA 3SIWA 3B2NA 2INGX 1WTCA 2H1VA 5ABPA 2XMCA 2C4KA 4C4AA 2CHUA 1IMOA 1EZZA 1ZNQO 4CF7A 3NXKA 2XWSA 4B81A 1Z2OX 4FHDA 2PBLA 4ZTUB 3TM5A 2F43B 2R9VA 3JVDA 3QJ5A 4DSUA 3QP9A 1I6MA 5EIBC 1R6VA 3F49S 4QQRA 5J5AA 4MR7A 3O8RA 2BGJA 4U9HS 3C39A 5AO9A 1KI9A 4F38A 2OYSA 1APBA 3F0TA 3PE6A 4J7UA 4IJMA 4OHWA 2EKDA 4QUIA 2KE5A 3CEHA 1QRSA 1IOZA 1NZDA 4D0GA 5A6SA 2R8BA 2P7IA 4NJEA 1SXHA 3FGZA 3QTBA 1DC6A 4K87A 3V1KA 4BYMA 5IDQA 4OQ4A 2CYAA 1W34A 5GGXA 3V42A 4QGSA 4BVLA 2AQIA 2I99A 3EODA 1MH9A 2PD6A 3L84A 4QTUB 4TT3A 4B5LA 5EQFA 1Z5NA 1UZNA 2CFTA 4FEAA 2F55A 3I73A 4BMDA 1NA5A 3HDGA 1X6VA 5DXFA 4ZVRA 1JE0A 2F9FA 3CCBA 4ZAYA 1OIWA 1P1JA 1WAMA 3E70C 1VLHA 1VLVA 2IP1A 2V3VA 3BWVA 3INNA 3M0EA 4ZGBA 1PJBA 2R7LA 3LC2O 1X94A 1CY1A 5TQ0B 1FP2A 2VA8A 4RXTA 2XCTB 2B4TO 1JFTA 2GZ3A 4FFWA 4F3TA 1UZLA 5EXTA 5KTKA 1T2UA 1B8VA 2R1ZA 3FTFA 2HHLA 1U7UA 3BRSA 5TV2A 5C3MA 1CE8A 1J8YF 2VDLB 3QMWA 2HJRA 4L0DA 2HXYA 2ADFA 3IULA 2WNHA 3TW8B 3B6ZA 2H52A 1I30A 2AG8A 3BL6A 1C30B 3GC6A 3JWGA 1UBGA 3PGKA 4RGBA 1ABFA 1ZSNA 4V1CI 1VKJA 3JYLA 4YJFA 4JI7B 3WK6A 3MLBA 1HI9A 3URKA 5M7EA 3ZHRA 1KQOA 5IT4A 2HHHB 3QU7A 4LE1A 1OBHA 2DY1A 2IZ1A 1DBVO 2RB5A 4R2LA 3VMFA 4DA7A 3DMYA 2HFKA 4OX9B 4G23A 2OV3A 3JQGA 2IFTA 4ZZ3A 1JIQA 3LXRA 4N5HX 4IYJA 2DTDA 5FA6A 3SR3A 3U6BA 5EHNA 3EFHA 5KYGA 1GV1A 2HWYA 4NKRA 4YJGA 2NXWA 2ET6A 3DTTA 2NZYA 4A23A 4QHSA 5FJJA 3CZ5A 2XMPA 1IN5A 4Q9HA 3BHIA 5FBLB 2NPFA 3BJMA 4Q3KA 1M67A 1SPBS 5KJ1A 3QG5A 1K6JA 2FGKA 2VR1A 3PVCA 1JKFA 2IK8A 1COWA 1X3SA 4GC5A 4ITRC 4L4XA 3EGVA 1QZUA 3KJFA 1DU4A 5CM9C 5CFLA 2XKBA 4P31A 2CV1A 3C3AA 2DUMA 3OIFA 1TNDA 3V4OA 3DEZA 1NHGA 5EMJA 3IQEA 1HQDA 2J9FA 2YXEA 3P9RA 4I5DA 1PL6A 4PSCA 2IV2X 3UHOA 3TSZA 2WUGA 4I0WB 2IBMA 4HR7A 3OJEA 1MAHA 3VSCA 3SYRA 3TSCA 2Y0BA 4C4TA 3WGMA 5ERYA 5JUWA 1CQIA 2DZDA 1JH9A 3V8RA 1RRPA 2CY0A 4FM9A 1N2ZA 4WK4B 2HHJA 2EZ9A 1UUFA 2PGDA 4FHZA 4PYOA 3ZLUA 2R6R1 2QI9F 4JJKA 4MVJG 1Z4PX 3TQIA 5AVWA 3S81A 1UADA 4RNDB 4PYIA 3IH5A 2YFKA 2XMQA 5B7NA 2GZAA 2M1ZA 1JA1A 4QRIA 1EP3B 1PIWA 2DR3A 2GI4A 4V0RA 4Z7OB 5TMPA 2QTNA 4UM5A 2ZUTA 3WLMA 1OASA 1EDZA 2VHTA 1UWLA 4M7OA 1HDZA 1QJCA 2RHOA 1Q0SA 4IILA 1EFPB 3D8NA 3QUBA 4XPZA 5JATA 2VSNA 1DJPA 3N2GA 4HXEB 1IH8A 4XTCS 4D2IA 1U7TA 4L5AA 4JELA 2IW1A 3H8SA 3PUZA 3E1SA 1PS9A 4MVJH 4TWJA 1FS4A 3T3DA 4NECA 4RQBA 4S2UA 3QKWA 3DONA 1PUJA 3RIXA 1DDGA 3PITA 3WLTA 1FTQA 3QMVA 1AIPA 2X14A 3QKIA 3WGUA 1ZW6A 3QOYA 3SZ3A 1KMNA 2ZANA 221PA 1QR6A 1G5RA 1ZR4A 1NW3A 2WJPA 5KQGA 2H17A 3KQYA 3HVRA 4CMBA 4EB8A 5C5EA 4YJ3A 2YS7A 4Q3NA 3ETCA 2I6UA 4HQ0A 4F4HA 3R3YA 1DBIA 3PXBA 2PL3A 2BMJA 2J5KA 3I9JA 3SEFA 4G0UA 3ZHOA 1CR1A 3AV3A 3CX6A 3VPBA 5GOZA 1KGSA 5CNKA 3UXEA 3KQUA 3UB2A 1NJ1A 2H63A 2PVPA 2NO1A 3C0KA 1FVOA 3CVJA 3KEMA 4H77A 1V6CA 2XCIA 4OP3A 4WLEA 5CXSA 5AVKA 2QVZX 1XEWY 4F72A 3T5AA 4PC6A 1HNNA 1U1DA 1M2GA 5IF3A 2FMIA 4BNIA 1V16B 5B1YA 3F6YA 4ZGWA 5LQMA 1K98A 1KYZA 5FOVA 2YXDA 3AC0A 4ZHSA 3ER8A 2OXFA 1VLQA 3GJ6A 3RS9A 5BOSB 1JMYA 1M2OA 1SNYA 4G0ZA 1WLSA 5JISA 2WHYA 4HYEA 2R8XA 1EWYA 3R3WA 2J0SA 3OQIA 2IYTA 5IZ4A 1K9SA 5D51S 4ABYA 3HCRA 3F46A 4HGQA 5JNSA 3UWMA 1I4EB 2AEFA 1ZQ9A 3K09C 2C7QA 5EWLA 3VH4A 4OL9A 1VBFA 3LUHA 1EH5A 4KWHA 1NVUQ 3RFFA 1THMA 3H17A 3MCTA 4LHVA 5KNDA 5HZMA 1B2LA 2VOEA 3HVUA 1X19A 2AFHE 4EY8A 4M8SA 2NVUB 2JLYA 4RPKA 4G0YA 1JQLB 2W22A 2X77A 3Q7IA 4BO8A 5EHIA 1H0KA 1VHLA 2AZTA 3A9SA 1KQ3A 1N2CE 3VH2A 1GUAA 3SI7A 3O31A 3V1UA 4CRWB 3FOFC 2GXAA 4HH0A 2R6GA 1UBOS 3GQBA 4BASA 2GJKA 4PGAA 3OJOA 5FL7D 5LL6P 1RQRA 3FUCA 3O0DA 1EVIA 3OLZA 5FJIA 4XSGA 1JG1A 4MQFA 1XTBA 4MEJA 5L6MB 4XB6B 3EFEA 4M22A 2F6RA 4OXNA 2FCRA 4YJ3F 4OM7A 4AF6A 2QLFA 1LGYA 4G97A 3B1ZA 4LY9A 4TMYA 4L4SA 3FB1A 3DHWC 4LGMA 1QGED 4TL9A 4RTNA 3ROTA 3UIEA 2ZJ8A 2HKIA 2ZIXB 3HJTA 3CF2A 3QTLA 1X38A 1Y34E 2IC5A 3E9ZA 2H4ZA 4Z4HA 5JO0A 4DA0A 1XQ1A 5IJ0B 3F2VA 2K5UA 4KHZA 5ELXA 2Q41A 4TWIA 4BNLA 2OFFA 3AIMA 1YRWA 5T3YA 3KYCB 4FQ5A 5B3AA 3KAJA 1WMBA 2JIQA 1NR7A 1M7BA 5FWAA 1RJGA 1E77A 5IBRA 3KQSA 4O0MA 3TI7A 2B8TA 4C07A 2RD2A 2GEFA 4EB6B 4HNRA 1X7GA 2IZZA 1Z2NX 1P9LA 1R37A 2J87A 3GG2A 4RULA 3Q8MA 1E5LA 3KSUA 1X7DA 2OYRA 1NXSA 4KLNA 5JQWA 4MICA 2CKMA 1G7TA 1HT2E 4KWEA 3L7AA 4L8LA 4NENB 5DN6A 1AUPA 2B9VA 1V3TA 1ZS9A 5DRYA 5WRFA 1EHIA 3A32A 1JUDA 1MW8X 3MZ0A 3AUJB 2WJJA 1JB9A 2YWXA 3ANTA 3OEEA 4KAXA 4RF3A 4TLCA 3TSWA 4LK2A 1L5KA 1TCAA 2XYRA 1Y3CE 4H7EA 2DB3A 3IC5A 4GAEA 1K92A 2QRHA 4IMJB 1OTYA 1X9IA 2H31A 5KUTA 3G68A 5K3DA 3FYUC 5CHEA 1VKHA 2BFAA 1ODJA 3ZHXA 4EPXA 2F00A 3R3VA 3EC1A 3PSHA 5JCJD 4G5FA 2ZBRA 4GLLA 1CZNA 4C4ZA 5EE3A 1HNZB 4JFRA 1DDOA 1O94D 2ZJ5A 4LDJA 3TQRA 5THXA 1VJTA 2Q5HA 3CKYA 2O57A 1NJ5A 2BMFA 3WLLA 3I2KA 3V7WA 1GZ4A 5CLHA 4PPFA 2CNOA 4RVGA 13PKA 2B4KA 4QJIA 4JNCA 3VISA 1Z39A 2WIGA 3OWXA 1CJBA 3VC1A 2FMUA 2GXSA 1RXEA 3H16A 5AW3A 2HSJA 4JLKA 3IUEA 4ZOBA 2PYIA 5FR2A 4RO0A 3VR4A 2DFVA 4LIPD 4OK6A 1C1XB 4CTOA 4G0PA 2CMKA 2H7CA 1T36A 3R2JA 2O7QA 1BDMA 4KYUA 3VKVA 3AF5A 1N3YA 4P98A 4NZPA 4RQTA 2M6KA 3I2JA 2YWEA 1Z0DA 2VZLA 1E2HA 1RXSA 2QU8A 1VI6A 3UK0A 4I1IA 4A7PA 2GO7A 3C5CA 3EMVA 2ZRBA 1PT5A 2A1UB 3BWDD 3PCRB 1VJ5A 5C34B 1W85A 1MXHA 1NSYA 3UCXA 3CVUA 1DGQA 3LNCA 1CF9A 1C2TA 1UCFA 2XWPA 2ZRCA 1JR3D 2C8KA 3M6FA 3NALA 3QFTA 2IXGA 1G2QA 2BELA 1XV5A 1MLDA 4EJSC 4YDRA 1YRYE 1KBQA 1GPWB 2P9JA 1ZZGA 2LV8A 3NPAA 1YHNA 3AW8A 3C1TA 5CCBA 4MTLA 3W8DA 3S28A 4YUYA 4KMMA 1K7YA 1SKQA 4O5AA 2HBQA 3N3AC 4Z0HO 3CPEA 9ATCA 3WLPA 3PYXA 2IYOA 1NVVQ 1QVAA 4CEJA 2J5QA 4BMYA 4JJ8A 2ZG6A 1ZRNA 1I9GA 3HL4A 3ZWXA 1W73A 1NBMD 1O1YA 3IXLA 2ONZA 3CYFA 3C4VA 1UXJA 4KX5A 4UCWA 2IHJA 2D74A 2XNHA 5JWHA 4KVGA 4HLDA 5JDIA 4Y2GA 1MXFA 2R8PA 2RHBA 2J9XB 3OPYA 4Q37A 4TX1A 5GIOE 2JFOA 3UJDA 2XYQA 2X5JO 1O9GA 1CJUC 4CT5A 5E1OA 3GUCA 4GX2A 4JA0A 3SAJA 3AM1A 5ALPA 4ER5A 4KPYA 1VFPA 3DZFA 3L0OA 1VIAA 3DE5X 2RGEA 1KPGA 3FROA 4XIFA 5LZ5A 3UJCA 5L3VA 4I3GA 2ZIUB 2QX7A 1NULA 2A5FA 2DPGA 4LVCA 4IH1A 2H2HA 3ER9A 1E5TA 2R8ZA 4YMVA 5CCEA 5EWJA 1TJ5A 1E59A 2VJNA 3OX1A 4JLPA 2OENG 2JAUA 2FAXA 2R62A 4DQUA 1LDGA 1RKXA 4FYYA 2Y0EA 1TRKA 2CEAA 4H3HB 3GK3A 2WZDA 2CUNA 5JCZA 1TA9A 3BXXA 4IH9A 3WBFA 5CX1A 1NI4B 1WXQA 3HWRA 2WVAA 4M53A 1QFMA 2JZCA 1TF5A 1H2BA 2CDRA 4OIFA 1P1FA 1IAQA 4PQFA 2JDIA 3O9VA 1NATA 4TTRA 2XSZD 3RC2A 1N5OX 5KQSA 4HNGA 3VC2A 1X92A 4KJZA 4EH1A 1WCXA 3DQPA 3EVZA 4MKIA 4YJHB 1VHTA 1VL0A 1TYDE 3IP6A 1QG6A 2SICE 4Y8VA 3CG0A 4RKRA 4AZWA 1K2VN 2VN8A 3D3EA 3ZHYA 4J16A 3MJHA 2A92A 3LQ2A 5IUJC 3WRYC 5EY5B 1TI7A 1S8OA 3I9OA 4ZU6X 1Q11A 4QKQA 2RHWA 4NMLA 3HUFA 1ZNXA 4YO8A 3HJGA 1V6AA 3TGLA 4TL8A 1C4KA 1SY7A 3TLKA 3GGDA 5J5CA 5LQSA 5EIXA 2G70A 1MX5A 4GECA 3RS3A 4CMIB 1EM8B 3ZWVA 1ZGCA 1LTQA 1C2YA 1MEOA 3DOUA 4MB0A 4MS1B 4TWAA 3VJMA 1IJFA 1UK6A 3T4PA 1RQPA 1YS6A 5EJ9A 1U2PA 1WJGA 4M1WA 4OH1A 1DWUA 2BFDB 3ASVA 4J0GA 4IEFB 1SUEA 2V9CA 4RIIA 1Z8FA 2WJ6A 2FKNA 3MAGA 2NNWB 5DI9A 1T8SA 2WWIA 1XDUA 2AFIB 2O8EB 3UCFA 3GRFA 5BUZA 1Z16A 5FBWB 3SJ7A 1Y3BE 1XRSB 1E6WA 4RJLA 1KPHA 4YY3B 1JJBA 2VYFA 1JXOA 2CFRA 1QYWA 1G60A 3B3GA 4CNBA 1ZVVA 1YOVA 4KXQA 1PEAA 1KYTA 4ER6A 1OGYA 4TZ6A 2M6LA 3UJHA 1UBSB 2A5LA 4R0MA 1A9PA 1DBRA 1RI4A 3OTGA 4DUGA 1LBSA 2W4IA 5AVZA 3V8BA 3RVRA 1ZRHA 1THTA 4HUJA 1P77A 2FI1A 4N49A 3FZGA 1E96A 1V96A 3BSYA 2IIVA 4TV8A 4XAQA 3HACA 2B35A 3JARA 5FOTA 1E1RA 4NV0A 3SR4A 3OWOA 4DMMA 4B17A 4F45A 1MFZA 2VPQA 2RAUA 1O0SA 5CXXA 1QHIA 4Z53A 5FEUA 4JYZA 1TB4A 3A11A 4ONEA 3I4LA 5BSRA 4B7ZA 1TVEA 4MGKR 1XZPA 3UKJA 4PX5A 1Y9ZA 1BQEA 1A7AA 2XCOA 5AK0A 2YV1A 2O8BA 1LI4A 3DTVB 3CLKA 4F5WA 1JTEA 4Q9JA 1JJIA 1YZQA 2XW6A 1JVSA 1CQPA 2R7AA 3E9CA 3ZQ6A 3U40A 4WZBE 1A8PA 1CNFA 1EP1B 4F9EA 4ZDWA 1LK5A 3UXMA 2ZYWX 4RSHA 1JU3A 2E4WA 2JVJA 5D3KA 1TMKA 1AMOA 4JN6B 5CR9A 1QYCA 3A6KA 3E8XA 4IJ6A 2BEUB 1X7YB 2O3TA 3L40A 3UW1A 2AH5A 3OMWA 5TNXA 1Y81A 3DHVA 4C0KA 4PYQA 1Y1RA 1S9HA 1QHXA 2B5WA 3Q4GA 1UBUS 4TN1A 5FBKA 3ES9A 2ZXFA 1YQ9A 3FVVA 2WFZA 3I2FA 4M7WA 3W2FA 2GAJA 2P0AA 1T10A 1K7EB 1N0HA 2FE4A 4ZYWA 1ZWKA 5KX5A 4JWKA 3WSWA 2LE0A 1K8RA 4UMEA 1BDHA 4R2MA 4NYJQ 1UDAA 1SKYE 4C3VA 2C82A 1QHHA 3LUFA 2IDZA 4K0RA 4MV4A 1E5VA 4KR3A 1YMUA 1MB3A 3R6TA 4DGSA 1ZCJA 4P35A 4WKGA 4NAVA 3RTAA 3HK2A 1JFSA 2G4VA 3NEJA 5BSTA 3RV3A 4TN5A 1NJ2A 2XQIA 4UASA 4CDRA 1M1XB 2Q3BA 2BV3A 3GA7A 3K32A 4RPHA 1CUYA 2WZQA 2J4CA 2O7NA 4HFRA 4TGLA 3KQHA 4JEIA 4TV8F 1XC7A 5FAXA 4Q15A 3E7WA 3PI7A 3LOQA 5FDFA 1Z06A 1SA0B 2ZDQA 4F0JA 5BYBA 4DV3B 4LX0A 3VTAA 3VVBA 1YHYA 1SCDA 3GXBA 2IUUA 4YPFA 2E21A 2OCPA 4XOUA 5E2BA 1Z8NA 4F4FA 1AUOA 1B8OA 4UD6A 2PYZA 1YR2A 4LXQA 2AD5A 3DLBA 1DARA 4QELA 1VG1A 1YQWA 4Q9LA 1F6BA 5F2EA 1ZU4A 3NCHA 3ZV6A 3G2LA 3ELYA 1TT7A 1ZKDA 2PRYA 3C7DB 3CCFA 2B21A 4Q3EA 3BXZA 3K8ZA 4R1PA 5IVPA 3K4PA 2DVMA 1P2TA 2M32A 3PSAA 4Q3AA 4WN9A 3AKCA 4BZZA 3CBQA 1GUFA 5D1HA 4AKTA 4B7AA 3GIWA 2G25A 1Q92A 1U7HA 2JH9A 1XTPA 3JV7A 5EVCA 4HWRA 4UMDA 5IKEA 4I4TB 2QR2A 1V9SA 2WTXA 1NIJA 1ESZA 1ZD9A 1II0A 2HIMA 3SSNA 3T9AA 3KSMA 5DTQA 2O3RA 2JRCA 4HDCA 4KUEA 1T3TA 2G07A 3GNLA 5YASA 1YSCA 2GN6A 3MJVA 4Z9YA 3CT4A 3N7AA 3DE2X 4A82A 1MPXA 4RFSA 1L7OA 2G9UA 2VF7A 3ABIA 1FX0A 5C3UA 2PEZA 4HF7A 4OGWA 2RC5A 5GV8A 5JD5A 2OHGA 2Q2QA 2O06A 3NO4A 2AEMA 4KH0A 1JIXA 1GL9B 1ZUNA 4NULA 2BEWA 3HA5A 3SX0A 1A4IA 1U2DC 5K5EA 1RLUA 3M49A 4IM7A 5B3JC 1ZQ1A 4OGGA 1P3Y1 4EO9A 1XZGA 3MC1A 1IB0A 1LDEA 3UK6A 3TVTA 3HBJA 4QQFA 4RWEA 3U7EB 3LPNA 1KNXA 2ZRFA 3IP1A 4LYFA 3BBLA 4W5WA 2A2ZA 4BV8A 1K86A 3MTQA 1H6CA 1BH2A 1CFJA 1V0JA 3BGSA 1WHTA 2BFBB 1GQSA 3FWYA 3LZ6A 5SY9A 1IJKA 4HWPA 1W75A 1JZTA 3N7UA 3C6XA 3PQEA 1ICIA 1R4MB 1R10A 1TW3A 4KGZA 4KN6A 4YCDA 3TPCA 3KQOA 3UF0A 3W3AH 2WM2A 3AQIA 4UXJA 1OAAA 2F3TA 1Z4JA 3C6MA 4RF5A 4KIUA 5L6LB 1XDZA 1X80A 5CNJA 2O5RA 3HFSA 1JP7A 2W58A 2C8JA 4CM6A 3HXLA 1MIHA 3PB3A 1NXQA 3OE7A 3JXEA 5FO1A 3RSOA 3G2MA 4KSBA 2Z1DA 4OK5A 1Z38A 3OC0A 4MQLA 1J7JA 1T8UA 3H4TA 1Z63A 3P2JA 4CLOA 3UJ7A 4DWVA 3P20A 1DOZA 1YB1A 3P9IA 3ZXYA 5KTRA 4J2TA 2OWEA 4YGXB 3ET4A 5F7JA 4P93A 2VRCD 1Q3HA 1JJ7A 3PVZA 1X70A 3H1PA 1RRVA 3ND7A 3MJDA 2EX4A 1E9AA 1PQYA 2ZT8A 3O2JA 4OXIA 2DKNA 1O9BA 3CIFA 2BD0A 5A9RA 1AF4A 2GMWA 1PDOA 1ACJA 1JHOA 1VOTA 2C9DA 2I6FA 4EKNB 2HBYA 1EJ0A 1AKRA 3QI2A 3R4VA 4IGFA 4NHOA 5AI8A 3L7JA 1YBFA 3SXUA 3TE6A 3ZW8A 2GM9A 3DKVA 1KAOA 2AI2A 5DU2A 4C5CA 1PW7A 2IBTA 2HWUA 2KSQA 4WXYB 1SBCA 1NF9A 2W2XA 1SVMA 3KLNA 5BNTA 4XX0A 1WPGA 1X77A 4ARZB 4DDHA 1KBZA 3EBLA 5G41A 2HCBA 5HZKA 2G82A 5JSHA 3FWZA 4XYBA 2YFQA 3ONDA 2ZRPA 3MERA 5C7YA 2WE7A 4KAFA 2C4WA 4UFOA 2FNAA 3F3YA 2ZPTX 4W1SA 2IS6A 3DLHA 4YS6A 3I39X 2VK2A 3TZCA 3PCTA 3RUAA 1BC5A 5LZ4A 1S01A 3VX3A 2QMOA 5E6SB 3HB5X 3NPMA 4KQEA 2GCOB 1JDJA 1N9ZA 3DAHA 1N6PA 3MPUA 2DR0A 3HBFA 2HI0A 3RFTA 3QEAZ 1R4NB 4DCUA 4XJXA 1P4JA 5DYNA 2VP2A 5TGZA 2V7TA 1ZO8A 2O5VA 4FTWA 4G89A 3GLFA 1ZUD1 4I7EA 1NAHA 4Z6KA 3FHTA 1BXGB 1XLWA 2HO5A 2CJPA 2X8AA 3B78A 3DZIA 4LOKA 4R1QA 3R5TA 4UEQA 2CNWA 1PG2A 3K7EA 5C9ZA 1S2IA 3WYBA 4S35A 3GJSA 1I6WA 3MLAA 4DDTA 2HTEA 3U48A 2HLPA 4EF4A 1OB5A 1Y1SA 1F2DA 1RWVA 4PXAA 3DV0A 2BKEA 4EL0A 1P1KA 5CEEA 1TKCA 1XRNA 3ZGOA 2VATA 1N5IA 3D5TA 3DBHA 4FYXA 1KDZA 3W5SA 1UOQA 4AJIA 3MBOA 1ZH0A 1LTHR 1K6XA 1LSSA 1NP7A 2FZLA 4NQRA 3UAGA 4KODA 2AWNA 2ZS9A 2ZUVA 4XDGA 3RVPA 1ZKMA 3OQNA 4DZRA 3VJRA 1FU4A 2JLQA 2VHUA 2DLCX 1JQJC 1D2GA 4KXXA 4QM7A 3W6UA 1FVFA 3HH8A 4E70A 4I9HA 4W6ZA 2BTOA 1U99A 3FRHA 3CC8A 5H4GA 4RWZA 4BV9A 4QYIB 5I7EA 4V1CB 2R1VB 4M0LA 5FI1B 4DJFC 1NR5A 4I6GA 1I7LA 3EEIA 4MKZA 1VLLA 1VCHA 2BISA 2QDKA 3HGMA 4ZRNA 3ADCA 5EZQA 1OZHA 4JJ6A 1NSFA 2ZRLA 1JDSA 1GQOA 2YYYA 3LUGA 1ODIA 1QG0A 2VF2A 5DCLA 5F7ZA 4R2HA 5TDHA 4LJ9A 4JFAA 4R05A 4W7SA 3KHTA 4Y9UA 5ILGA 4AN0A 3HUUA 5AW2A 4YRMA 5B4TA 5IEJA 4JSYA 2IH4A 3GU3A 4X7MA 5EKDA 1WMSA 2CEKA 1Z83A 3UEOA 5EWMA 4FHEA 3FLMA 3GW8A 3HCAA 1Z4NA 2Y2VA 1S8NA 1JQDA 1QGDA 1V5WA 3PXXA 3ITNA 1Q1QA 3FI9A 3K73O 4NEQA 3KKZA 3ZGNA 4LFCB 5EHGA 3FD8A 5BNIA 4PR3A 3THWB 1OX6A 1QFZA 2VUSA 3PL1A 5AJXA 2RI1A 1J56A 1DXYA 1T9HA 4BGUA 2O19A 1P6XA 2O0HA 4TKUB 3JSAA 5JANA 4OMCA 1SHJA 2DWUA 5LMCA 2PA3A 3WWCA 1DHTA 2CJWA 3PC2A 4MGYR 3TGPA 1NDHA 1UJCA 3H05A 3SY8A 1GIAA 3CW9A 1CY8A 1XTJA 1P1HA 1PD0A 3FRJA 4HFMA 2IX9A 1JHMA 4RGVA 1V7QA 3WQRA 4OQPA 1FC0A 1CP2A 2VWGA 3QXGA 3P94A 4D4LA 1VZ3A 1RMQA 1OXMA 3SF8B 1OVMA 1U11A 5F1KA 1T3ZA 3ZGVA 3NT5A 2NZ8A 4KGDA 4OAOA 2EKLA 3ZYZA 2VAPA 1M8JA 1FS5A 2V7WA 2DE0X 2Q5CA 2XB4A 3KZMA 4ZANA 4DG5A 2HMWA 4UBLA 4PZCA 3VNAA 1N3IA 4DCVA 3HXMA 5E6UB 4YRJA 2EC5A 2YFYA 1AX9A 1WUIS 3C3WA 1IFXA 2WSLA 1GG9A 1IQRA 4TZ0A 4CN8A 4ZAXA 5K0TA 1VE7A 3KR2A 1FZQA 621PA 4XGIA 3NGLA 2FXVA 4QGGA 5I7FA 3K05A 2ID9A 1M9NA 2BUCA 2WKPA 2X41A 1F4VA 3E58A 3EF1A 5DW3A 5H70A 4IXMA 4UUMA 2DLNA 4WW0A 5CB8A 5I01A 3DZKA 1VG9B 4H3KB 5E1MA 4JAVC 1O9HA 1TVCA 4DLBA 4FEGA 3IB3A 4IPTA 5ALRA 3L1HA 4A0HA 1T43A 1U7OA 5JRDS 4UTXA 1RXYA 1VM6A 3SFTA 3N7TA 4ZJYA 2GBLC 1XQ9A 3NNSA 4RVFA 4TMKA 3KOOA 5KJCA 4LSWA 3BMOB 3UHJA 4HKTA 1VKZA 5BT8A 5K6AC 1FTNA 4LBZA 3KKEA 3FCAA 4I2NA 2PZ8A 4C22A 5C8VA 1JSRA 1NZJA 3DCNA 5GM1A 1P9WA 4FDAA 1T5BA 3NYRA 2YNMD 3BWXA 5ITSA 1T3SA 2HT1A 1RTTA 3A1UA 5BV8A 1ID8A 1T2VA 3CPHA 4FOTA 3GRVA 1A5ZA 4R51A 2H0RA 1DPFA 4NYIQ 2DUUA 2O48X 2VC2B 4M6WA 4BU1A 4K9LA 1FRFS 2ZI7A 5KYYB 3PE4A 3FNBA 2XHZA 1CV2A 3OCXA 2AV6A 1I7NA 1ODTC 3COSA 2Q5EA 5LBUA 2P2SA 1SB9A 3ISVA 3FETA 4ZPXA 3UQZA 4YMTA 2PQ6A 2BDEA 5LWQA 2IEYA 1PFGA 4BHTA 2OD9A 3C7TA 1CVLA 3NUQA 4IDHA 4C9BA 2I7TA 3GRYA 4MP6A 2BMAA 4MKFA 2V3WA 3RBZA 1YKFA 4M0MA 8ADHA 1TFRA 4YUXA 3EG5A 2GJAA 2QTMA 5CFRA 4URFA 1Z4IA 5K3FA 1OTXA 1ZVQA 2PSHA 2ZK7A 2KB0A 1NT2A 4IL5A 3OCUA 4AM8A 4Y2QA 3EXHA 2CZQA 3Q8KA 1EJ6A 2VHZA 4PZAA 4WN3A 4RJKA 1AGNA 2HLNA 4HH1A 1EBUA 4MV6A 3U1TA 4EJMA 4B45A 1I2DA 3ANNA 3K0AA 3MUOA 4WI1A 3KVOA 5KNBA 5C4IA 1SH7A 2RMKA 4N6GA 2RIRA 1JU4A 2G77B 2ZIFA 3H9QA 3DM5A 1JR3E 3RTBA 3NDBB 1GU1A 4J94A 5F9MA 4YCCA 2IYPA 5KIAA 1KOGA 2GCGA 3H9CA 3UUEA 1CC1S 4FUTA 4OB8A 3H42B 5DNAA 2JL1A 4BVHA 4D9BA 3K9GA 2XRFA 1SQ0A 4MKGA 1E3TA 3MK31 2BKLA 2O0KA 1K9VF 1B0ZA 3QVLA 2OGSA 2TYSB 3LPCA 1QH8A 2BEVB 3CE6A 1MKYA 1CRLA 1IXKA 1L5WA 1O7JA 3FNHA 2Q8QA 3GMTA 3LC0A 3SVLA 1W25A 4Y6GB 1FJGB 1AOXA 1U7PA 2P4SA 2AI1A 3OZUA 4PLGA 5BT9A 3KQNA 1O54A 3F4LA 1ZJ5A 4XRGA 1M6NA 1E6MA 2QZSA 3DCYA 3NHLA 4GQIA 3SYLA 5DM1A 1MT3A 1U3CA 2CL7X 2QTAA 4OFXA 1Y8RB 4EPVA 3L4BC 3DW3X 3F67A 1U3DA 5AKXA 3RRFA 2GRAA 3OIUA 2CLLB 2WDPA 5BMOA 4PLFA 3SYMA 2V7BA 4G56A 5G1OA 1IXRC 1VPLA 2R2AA 2ACVA 3IR5A 3FN4A 1LVUA 4L22A 3AYXB 3O47A 4LMBA 1QTNA 1NMQA 2DHEA 5T41A 1RXWA 2R79A 3JU3A 3F5SA 1OI7A 2XWQA 1FEZA 1E69A 3AFHA 3BE5A 2NIPA 3QBVA 5EFOA 3NWBA 1NQAO 3LCVB 1PFWA 4TMZA 3TJZA 1CUFA 5LNK6 3ZNNA 1SRQA 2YKGA 2IE8A 3VR1A 2Y1OA 1AVTA 1UBNA 2HA3A 2NYRA 4M9SA 3WRXC 4ZMSA 4A2QA 4KR6A 1PGQA 4ZHQA 4IINA 1Q1EA 2HNBA 2QGZA 4R69A 4U02A 5K0CA 3U56A 3N87A 3ZHZA 4RK6A 2NU9B 2ZVJA 4M1YA 3KOZA 1V8PA 2OT3B 4FX5A 4FILA 1M6HA 1SQ5A 1U0TA 2ZSAA 1RFGE 3ISJA 4M0DA 4ZZ2A 4DF3A 1P8JA 7MHTA 4GRAA 2PS0A 2V6BA 3VKFA 4B80A 4ZICA 5C7LO 3F90A 4HDNA 3GAAA 3A9CA 3OEHD 2H0QA 2NQ2C 4YCMA 4G86A 3TBKA 1Z9BA 1IUNA 3NYWA 4L51A 3EK2A 4LBYA 1XJWA 2ESRA 3FYCA 3ODGA 3KYBA 4MRMA 2AOWA 4ARUA 1ULAA 4PZLA 3RSQA 2G40A 1Y48E 3EHEA 5NLLA 4KQCA 3UAVA 2QVLA 4XKJA 1L5HB 1X2BA 3E2PA 4EUEA 1Q44A 1WX1A 3IO5A 5BN3B 2VUIB 5MN5A 2XF8A 2R96A 3AERA 1FDRA 1UEXC 3U4IA 3CNOA 3MJSA 2ATCA 2PZAA 2JFGA 3GGJA 3Q7QA 1A5AB 2RKBA 3OJWA 4GPAA 4UUBA 4M1KA 5FWNA 4L8VA 4X6XA 2XUOA 3FFWA 3TQHA 2FPLA 4QBGB 4BNNA 1D2EA 5FHQA 2GXQA 3RVDA 2PAFA 1SJ9A 4B83A 1KKLA 1UQUA 4PBTA 1A9RA 2P6MA 4OQFA 5A4DA 4G1BA 1Y6GA 4OLAA 1W1IA 2JIMA 3A05A 2GF9A 2V7QD 1M1NA 2B7BA 3AOGA 4DANA 4UHDA 4BBZA 2EXXA 3NJ4A 3TSOA 3OBIA 5K0FA 1CPYA 1VL1A 4EY7A 1P2FA 4RZHA 3JQFC 4U2KA 1ECBA 5HX7A 1D6JA 1HLDA 2CFSA 2PKYX 3BUSA 4RMJA 2J3JA 1E2KA 1YXMA 4ZHQF 2EV9A 3AUKA 1X1QA 1YNOA 1A04A 1T6NA 3R74A 1U90A 2XD9A 2Y1XA 3D3KA 3DBRA 3BDIA 3EGOA 1SBTA 5F1YA 1KQNA 1Q57A 1SHUX 2ZRMA 5AR1A 3NDRA 2GEDA 2PL1A 1AXEA 4Q12A 2R6ZA 1CR0A 3K71B 1FMJA 1TIBA 2E1PA 4D8UA 4X6LA 5IYZB 3ZX4A 5EJEA 2GASA 4TSFA 3JR7A 3JATA 3REQB 4JCCA 4EDHA 3WLJA 1NLYA 2IUSA 5F12A 1D4FA 2OG1A 4UVEA 2DQ4A 4JC4A 2I3AA 1CBUA 3U3KA 3A27A 3WYCA 2EVWX 2Q4OA 3TOCA 2NZ2A 2WAXA 2XLBA 1U2SA 3LX8A 4KOAA 1W49A 2OEPA 3G5LA 3NHZA 1R5BA 1JR4A 4GPZA 2W2OA 4WD3A 1OA1A 5CVUA 1R8QA 2O2XA 2HUPA 4MUJA 3OHSX 4GL4A 2PPVA 5I9TA 1Y7TA 2PGAA 4XR9A 2I7VA 3UB3A 3LHKA 2H54A 4FJ2A 3VR0A 4AULA 5KWVA 1R9GA 2XOKA 3VHXB 1E4YA 3LKBA 5BY2A 3H86A 2OCAA 3QI7A 5E8RA 1SU8A 3EVNA 2VAVA 3TRDA 2ZBDA