3A0UA

Crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDLSSWAADEYVVKSFNFDELKEKVKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Response regulator
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a0uA00
3O1JC 3R0JA 4RY0A 5JNRA 2IPMA 1EHCA 3I5AA 1BVHA 1YMUA 4MLDA 4ETIA 4W5RA 3HK2A 3EODA 4MS4A 5IBQA 2CWDA 2GWRA 4IMJB 3DGEC 3T8YA 2E4WA 3H1FA 5HQJA 1ISSA 1Z25A 3TO5A 4N0PA 5FWYA 1KGSA 2ID9A 5FBHA 5C5CA 1D5WA 1A2OA 2DRIA 4QPJC 4Z4IA 4RXUA 2FQWA 3S99A 2FMHA 1CHNA 4DN6A 4Y9TA 1JX6A 1FQWA 3B2NA 2JCGA 2PMCA 4KFCA 1USIA 3OM1A 4Q6WA 3N0XA 4N0QA 1NATA 3OLVA 1AB6A 3TB6A 4RY8A 4P1ZA 5HM6A 1A0OA 3CKMA 1BDIA 4KK4A 5HKOA 3CZCA 2L18A 1ZN2A 2VYCA 3KCNA 1XWWA 4RK4A 3H5OA 4YS6A 5FWXB 1C4WA 1U2PA 3QELB 3IP6A 3I09A 1Z12A 1AB5A 2WWVD 5JNVA 2PLNA 1Z13A 2LUOA 4XASA 1QQAA 2MYTA 1W25A 2WJAA 3FDFA 3KYJB 1SRRA 4DADA 3ROTA 2PAFA 1QP4A 3JS5A 3FFTA 1EWKA 3OLXA 3KHTA 3KS9A 1M2EA 3QX9A 4CBVA 3K9CA 4EYGA 2LBPA 3H6GA 4RK7A 1BDHA 1SD5A 2ZAYA 3BRQA 1W9HA 1DRJA 2OENG 3CZ5A 1NTRA 4HNQA 8ABPA 5GQSA 2IDMA 1JL3A 2B4AA 2MYUA 3JY6A 1MVOA 3N53A 3O21A 5KI6A 3GBPA 4IGAA 1U8TA 3IP7A 4O1IA 4D6XA 3SNKA 1JDPA 1NXVA 3QLVA 3JTEA 3CHYA 4RDCA 2PKXA 3H5LA 2MYNA 5KC9A 3MYYA 1E6MA 2FLWA 4G0QA 5DCLA 1JLKA 3M9WA 3N0WA 1ZHHA 2IYNA 3HDVA 1L5ZA 5CNIA 3LUCA 2WY2D 3LUAA 4KQCA 2L19A 3RVSA 4NQRA 4QYMA 3M9XA 2GBPA 4ZPJA 3BBLA 3HCWA 4YRZA 5ED4A 3C3KA 4KREA 3H6HA 2P4UA 5B3JC 4MQEB 5JNWA 3N0RA 1JYFA 3KLNA 5BRJA 3ROFA 5HSGA 1DBPA 3A0UA 1LBHA 4IMIB 2TMYA 3Q7SA 2JK1A 1BAPA 1MB0A 2GX6A 3HSYA 3NHMA 5IX8A 1M2FA 2PL1A 1QP7A 4N76A 1KMIY 3OMXA 4WUTA 4ZMSA 2GKGA 5KC8A 4W5NA 4MGEA 2E4ZA 1P8AA 1USGA 5CNKA 2P9HA 3IPCA 1K66A 4YGXB 5TE9A 5TQ2B 3LFTA 4LE1A 4L4UA 2NUBA 1GUDA 3OM0A 4RV5A 2H0AA 3KSMA 3A0RB 5CNJA 3UUGA 2KYRA 4RU1A 3HVRA 1HEYA 1PEAA 4TLLB 3QELA 5EWMB 2CD7A 2FTKE 3HUUA 4RZSA 5PNTA 2HSGA 3N8IA 2BGGA 5GOTA 4QYWA 3EGCA 5JNTA 1EWTA 1E2BA 4ETMA 1YMVA 4KMRA 1KRWA 1PHRA 2IKSA 3HM9A 5DKFA 4GNRA 5KQGA 5TQ2A 1KRXA 1MB3A 1Z15A 3UK0A 3RVOA 2I6FA 2R47A 5DTEA 9ABPA 4W5QA 4F3TA 1DCMA 3N6VA 1QMPA 2FVYA 3EJWA 3OMWA 3JPYA 1DBWA 4ML3A 4RY9A 4B09A 4W5TA 3QEMB 4MQFA 4G0ZA 1U2QA 4S05A 4NCBA 4YCSA 1RPJA 1ZGGA 2QU7A 3CU5A 1LK0A 3KKEA 2FQYA 4TMYA 7ABPA 1QP0A 1NXWA 2B1JA 2QVCA 2VUIB 2FEKA 2MYPA 3CG0A 4RXTA 3TMYA 1NXTA 4G0XA 5CNMA 5KWSA 5BRAA 2R4QA 4MPTA 3RVPA 2L2QA 1QQBA 4LE0A 2F8SA 4M88A 2A9RA 2VK2A 1P6QA 3W9SA 4MR7A 3VNBA 5KQMA 4MR8A 5TPWA 4MQFB 4O5AA 2IPNA 3JPWA 5JNSA 2PUCA 4UHJA 4Z4FA 1JFTA 3FFWA 2O20A 5TQJA 2HPHA 4MR9B 3L6UA 1YTUA 4RKRA 2FLKA 3OQMA 5TPZA 4LZLA 3ILHA 1M5TA 1DG9A 4YWHA 1U04A 3NBMA 1TVMA 1MAVA 2R25B 4RK0A 1Z2DA 3CTPA 3LUJA 3MQ4A 4XXHA 4KNYA 2RJOA 1GLGA 3F73A 1DRKA 1PNRA 4JB0A 5KQLA 3GV0A 1JF8A 1JFSA 1ZITA 4OLBA 3QLUC 4PICA 4HNRA 1NY5A 4KVFA 2JBAA 4QICA 3LTEA 1IIBA 3N75A 3HO1A 4WXEA 1E6LA 3IDOA 3O1HB 1VKRA 1FFSA 2IOYA 3C6QA 3LUKA 3L49A 3UKJA 1CEYA 3SQNA 2PUAA 1ZVVA 1JYEA 2L17A 4FB4A 1RZRD 1GUBA 3G85A 5C5EA 1I3CA 4LDZA 1D1PA 1EWVA 4EVQA 2JB9A 4ETNA 3BILA 4WZZA 2ZWMA 1LJLA 1YIOA 3MF4A 3GL9A 4ZJPA 1NXPA 3LOPA 1PUXA 3NNNA 4MRMB 3QEKA 5IUJC 3H5IA 3EDCA 2ID7A 1A04A 2HQOA 2IPLA 3HDGA 1YK1A 3MA0A 5DGCA 3RVKA 5IEJA 2E4YA 3I42A 4N47A 3A10A 3DLBA 2LP4Y 3O1IC 4Z9AA 3HXMA 5FWYB 3KG2A 2CHFA 4RXMA 1JHZA 2PUBA 3RVNA 1YVUA 4XARA 3E3MA 2JVJA 1GCAA 1ZGZA 4MQEA 4Z99A 1WETA 5T3YA 1TJYA 3HJFA 2FN8A 4LDAA 2A9PA 3EAFA 1P6UA 3LUFA 4H3HB 1LBIA 2FXIA 1S8NA 3K4HA 1JH9A 4O1HA 3KJXA 1BA2A 3DLHA 3CLKA 3FGZA 2H3HA 4IILA 5JS2A 4F12A 4EYKA 2FMKA 4YO7A 4JB2A 4Z4HA 2FN9A 1BDJA 2RJNA 4JA2A 3URMA 1J56A 3EQZA 2XDYA 3O74A 1ABEA 3KTOA 2PUDA 3RVMA 1DCFA 6CHYA 2QSJA 4UHKA 4ZMRA 3OO0A 4MS1A 1VRVA 4OLAA 1R8JA 2A9QA 2E4XA 5FBKA 1JDNA 4G0MA 3O2JA 4EUKA 4H3KB 4Q6BA 1TMYA 2WRZA 2QW1A 4FE4A 2JVKA 3O2SB 4NICA 2RGYA 1QO0A 4EVRA 4WXMA 4JOQA 2X7XA 4G0OA 4MR8B 5TPWB 3Q15C 4D74A 1Z17A 1M5UA 4XFKA 3BREA 3RVQA 4FE7A 4YV7A 3RVJA 1DP4A 3OQNA 5D2CA 1ABFA 2FEPA 3NNDA 1GCGA 2WJWA 3SY8A 1QNLA 4EVSA 3O2QB 2AYZA 4MAAA 4WT7A 2FMIA 4RWEA 4MS3A 4G86A 3OQOA 5EWJA 2PL9A 3QK7A 1URPA 3VNAA 1VLZA 3D8UA 3Q41A 4KV7A 5JS1A 4YP9A 4LE2A 4LX8A 4EYOA 1JBEA 4H60A 3QLTA 3QX8A 4XLTA 2V0NA 3NNSA 3JVIA 4G0PA 1ISRA 4E7PA 3E61A 4P98A 5B3JA 4Z4CA 4Z9BA 5EWLB 1B00A 2PUFA 1RXIA 4RSMA 3FMVA 4L85A 1OXBB 3Q7RA 4KK3A 3H5WA 4MS1B 3EQ2A 2R48A 1ZH2A 2QXYA 1NXXA 1T34A 4G97A 4XAQA 1H9CA 4OG2A 1DC7A 3Q7TA 3LUHA 3GBVA 5FWXA 1XHFA 1F4VA 3GWGA 1E6KA 3OO1A 3RVRA 3OLWA 2JRLA 5TQ0B 2W42A 2PUGA 4PYRA 2NT3A 3P9YA 4JASB 3IPAA 4OATA 1Z16A 1YS7A 4W5OA 1D4ZA 2F8TA 1XHEA 5ABPA 4JP1A 1RZRA 4JAVC 3CS3A 2JBAB 4OBBA 1DCKA 5BR1A 1PNTA 5DLEA 3KLOA 3Q9SA 4MR9A 3QLVC 1NXOA 1FFWA 1NXSA 3LUGA 4PE5B 4Q7EA 3T38A 2A9OA 4F11A 1MIHA 4MS4B 1UDRA 5JNUA 2M1ZA 3RQIA 4RK6A 3SG0A 1PEYA 3M6MD 2MSLA 2FEWB 2FQXA 3CRNA 3G1WA 4EY3A 1Z26A 3OLZA 5F64A 2FMFA 3H75A 3HEBA 3DBIA 3GYBA 3LUDA 3DGFC 4KPYA 2HQRA 4KQ9A 3H5TA 5TPZD 4RK5A 3F6PA 1DZ3A 1ZESA 2JVIA 3T6KA 2AYXA 4HNSA 4MR7B 1QO0D 1ZDMA 4EYQA 2LIVA 2NZVG 5IULC 4F8JA 2CHEA 4D6YA 3GRCA 1ZY2A 3IP9A 1D2AA 1Z18A 3TD9A 3SAJA 3TX6A 4N03A 1Y1LA 6ABPA 3EULA 1CYEA 1YS6A 1ZH4A 4MLCA 2YHAA 5EWMA 3GT7A 1EAYA 4NCAA 3HV2A 3RVLA 3D02A 4RKQA 1EFAA 5IUNC 1DJMA 2HQBA 4DQDA 5E3JA 2LPMA 1OXKB 4NV3A 4HYEA 2QVGA 4EGSA 4MRMA 2IPAB 1DC8A 3QEMA 5CHYA 4S04A 2VUHB 1SXIA 3CNBA 4RS3A 4WWHA 3MM4A 4KZKA 4ZYLA 4TLMB 3DZDA 4MYRA 5T7BA 1RXEA 3O75A 5IC5A 2QV0A 1VPWA 3LKVA 2GI4A 1SXGA 4IRXA 1FSPA 3MIZA 2PUEA 4Z0NA 2NZUG 5IUKC 4Z4EA 2FKAA 2FW0A 3RH0A 3C97A 3JVDA 3C3WA 1K68A 2PJUA 2RDMA 3HZHA 3QLUA 4TN5A 1F51E 2HJ9A 1YK0A 2MSKA 2YHBA 3HUTA 3I45A 4G0YA 3FFXA 3F6CA 5BQ3A 3GA5A 2FSPA 4IF4A 3LMKA 2Q5CA 1TLFA 3ILYA 3T95A 1TM2A 5KQPA 1Z2EA 1DBQA 5TQ0A 2QR3A 5I4CA 4RK1A 1L5YA 3SM9A 1APBA 2J48A 3KYIB 1LJUA 1P2FA 2E4UA 3BRSA 1USKA 4F06A 1FFGA 2OQRA 2WMYA 3IP5A 1ZAYA 1JWLA 4MS3B 3LKBA 3C3MA 4GPAA 4PZ0A 2M98A 2E4VA 1RNLA 1U0SY 1SXHA 2QZJA 1QKKA 3HS3A 5EWLA 4E7OA 1JFVA 3H5VA 4OTZA 3MMNA 4KRFA 2PE5A 3OLYA 3H1EA 3NHZA 3CG4A 2MSWA 4PEVA 4N41A 2N9UA 4YLEA 4YR7A 1C0EA 5EWJB 3A3KA 1QPZA 4Z4GA 1D1QA 5IEBA 3F7NA 2NT4A 3CFYA 2WB4A 3H1GA 4LRQA
chains in the Genus database with same CATH superfamily
2OBFA 4AIRA 4BGDA 3GPCA 3TSCA 4YXWA 1G5TA 3VU3A 4GVPA 4HDAA 3ZBPA 1E0SA 3TZQA 1U31A 3HJTA 3DV0A 4TN1A 3DHNA 2CWDA 2FPLA 3BJRA 4KR3A 2WBLC 3UC5A 1SB8A 1W1IA 1H9AA 1RLMA 3DE1X 1T3ZA 2ZYGA 3EXFA 1UWLA 3L8GA 4CMJA 4HZGA 1R3DA 2VVTA 2C3UA 2WIBA 4INPA 2FPWA 4L07A 4LCJA 4QA9A 5GONA 13PKA 5IVHA 1D6JA 4HDCA 1S7GA 4BECA 1XJQA 1D1TA 4YJGB 3KAKA 4X8MA 1V4BA 2FWRA 5TMDA 3V9PA 5ISMA 4NCKA 3PKIA 3KHUA 5DTRA 3M5DA 2F17A 4Q4LA 2Q2QA 4U5QA 3SX0A 5T5QA 2GBLA 4G5FA 3UB2A 1RLUA 2QD4A 5FR1A 3V7FA 4HWTA 3ZWPA 2WSIA 1FPMA 3CZCA 2GILA 4X1OA 1IWPB 1D9ZA 2RHWA 4IFBA 1JQDA 5BOSA 3QOXA 1L3CA 4XJSA 3K6SA 3DG9A 3NHKA 1JIQA 1Z12A 4XWYA 1OLOA 3LIPA 2PMEA 4G1CA 5JNVA 1FNNA 1OX4A 4IQ4A 5AMXA 4FNAA 2P9BA 4FDUA 4AG6A 3EA0A 3G1TA 2WJGA 4LHSA 1IL0A 4MCIA 1LSUA 1YHNA 2G6TA 3AY6A 1QG4A 4I55B 3ETLA 1M2EA 1JN0A 2FG5A 2VA8A 3O8DA 4Q4CA 4UCWA 5IXSA 3MWJA 4O4LA 1K9SA 3E03A 2JLAA 2C78A 2CXUA 1OBFO 2B7BA 3CZ5A 1DG3A 1EX7A 4L8VA 3QXJA 3QVXA 3NEJA 1C7FA 1IHPA 1S8OA 3ETHA 5U4XA 1TQ4A 2W2QA 4PN7A 1Y4ZA 2CLKB 1T0UA 2G9VA 3K2QA 4PX5A 3OQ6A 4D4KA 1U8TA 4CMEC 2AF4C 2ACKA 7AT1A 2BGKA 2OZLA 3DDHA 3PCXA 3UCEA 5AXDA 3GK3A 5HFAA 5K4AA 4UNQA 4TM8A 1C3OA 1E92A 2DWCA 3KSZO 2YZ7A 1FU7A 1PNQA 1Y6RA 4BOYA 3VKWA 3U4IA 3LPAA 5DCUA 2VTEA 3O3MB 5T8KC 1ENOA 2I3DA 3FWPA 4KAJA 4KQMA 1D2MA 3AV3A 3FUCA 3VJMA 1EDOA 4RF2A 3AXTA 3LUAA 1NLYA 2TYSB 3PP8A 4ND2A 4JEMA 1NBWB 5JCOA 3STYA 4YUWA 5ED4A 1CEEA 2IUEA 4WE3A 4XTCS 5L3VA 3U60B 4KREA 4F71A 2PL3A 4RCVA 2WICA 1G9SA 3N0RA 2BJVA 4N6OA 4J2TA 2IEZA 3TTXA 1P9NA 1FLVA 2X4IA 2XB4A 3ZY4A 1QZXA 2QRLA 3Q7SA 3GW8A 1MB0A 3HSYA 4LY9A 5JCJD 3U19A 3NVDA 3MTAA 2VJKA 2A59A 2QW0X 4WUTA 1V1RA 1MO4A 4KWIA 4GP9A 4ZZ0A 2E4ZA 3G2JA 1LW7A 2ZETA 2FZ4A 4LOIA 1VE7A 5FH9A 3QBTA 2ZJ5A 4PYNA 1XWFA 4BJ3A 5DVZA 4IDHA 3R1IA 1VIYA 4PG4A 5LR6A 2FI1A 4QVGA 4TQAA 1EP1B 1TJ5A 3QMMA 4Q9IA 4JBWA 2H1FA 2BCEA 3RYHB 1A9RA 3UA4A 4BDTA 2GTIA 2FZKA 1WHTA 1JLHA 1WDKA 4OXRA 4RIGA 5K3CA 1T2NA 1U2SA 1YQQA 3PZBA 3G0DA 2P9TA 4C3OB 4P33A 5A4JA 1XJWA 5HTOA 5PNTA 4N5DA 3Q11A 4B2YA 2V5UA 2AI1A 1NW4A 2P79A 1CVRA 2W8BB 2YJZA 3DEKA 3FDIA 3JQBA 2EW8A 1OQAA 4HQFA 4LGCA 4UC0A 2QQ5A 3WDLA 4BBJA 2IYQA 1TEVA 3HXQA 2FPGA 2QZSA 5LLSA 4OFXA 4DQLA 1NBIA 4DMCA 5KJ1A 3O1LA 5KQGA 4B80A 1X94A 3C39A 2JGDB 3D4OA 3Q40A 4S2UA 2HBZA 1XDGA 2FPIA 2I6FA 2VPQA 1V3VA 3MSCA 4I99A 2FGKA 2J0EA 3KIPA 1GPLA 1Z6ZA 4GAEA 4KE8A 3PI7A 4S0XA 3P94A 4MVJE 1MO5A 2HEIA 1L1FA 2YASA 1RSZA 1TZKA 2O52A 2LCQA 4J9VA 3RE1A 4W5TA 4JFAA 4URVR 4V1CA 3EW9A 5CDFE 4G0NA 3N0TA 4NDAA 5JSHA 2ST1A 1KU6A 3SXUA 4D26A 1OV6A 1VIAA 3NYQA 2Y1FA 4LUCA 4O3MA 3CNHA 2ZTVA 3UGTA 1Z0IA 2R1VB 2JFZA 3PK0A 7ABPA 3NO4A 3HV0A 2RHBA 5CYGA 2B1JA 1VHWA 4L9SA 1JAIA 4C0WA 4ER0A 1BWRA 4ZAZA 4P83A 821PA 2IOFA 2ZVQX 5J5CA 1Y82A 3HKBB 3V7UA 2L2QA 4G4JA 1EM6A 1X7YA 1H8EA 2O2HA 4FYMA 4JQZA 4XD2A 4XUEA 2FF5A 2X1MA 3M6AA 5CG2A 5KQMA 1XT6A 4RV9A 3OEHA 4Y2GA 4KPFC 1I32A 2ZYWX 1T91A 4U6QA 4UHJA 5KJEA 1FNMA 2XF8A 2B5WA 3QVVA 4FW8A 4O25A 3ROGA 2OPBA 2Q1TA 2VPXA 4Z3OA 2ZSAA 4C0HA 1CJKC 3AHEA 2EATA 3QA9A 3B2EA 4ZCIA 4CKWA 1UP7A 3OQMA 1II0A 1OH8A 3ILHA 4O4IF 4RPKA 1DG9A 1WWKA 9MHTA 1M6WA 1T13A 4TQ9A 2XTMA 5A4KA 5DNCA 4RVHA 3UIEA 5KYYA 5CYPA 4AMUA 2OBNA 2VI5A 2C7QA 1GPAA 5IDXA 1VPEA 3PNYA 3DMFA 4MWGA 3TBKA 1B6TA 1E2GA 1YJCA 1OD6A 4JC0A 1EM8A 5GY7A 4EF5A 3HFJA 2B34A 2OVBA 4V38A 1H0SA 3MT7A 4LFAB 1ICIA 1QF7A 1V8FA 3V2UA 1KI1A 4E51A 3ED1A 5A5VA 2EZ4A 1XL1A 4PIPA 4CM8A 1G20A 1L5MA 3IUQA 2B1GA 3KQUA 1IPEA 3MCWA 2IZ7A 3PEEA 5EYPB 3CB4A 5AVKA 3DWFA 3CEJA 3RUHA 4HFMA 1KYZA 3ZYCA 1SC1A 1EUCB 1MV5A 4PQGA 1V16A 2OBXA 3QF7A 1L7RA 2E9SA 1NBME 2N1BA 2R4UA 4HG2A 4QKQA 1PVOA 1O5OA 2PT5A 3OE5A 2XDQA 3K73O 4FK8A 3RD5A 5EIAA 3BICA 3IAHA 4K2HA 1ZM9A 2XVMA 4FYXA 1GTG1 3B78A 4L74A 4QLOA 1YS1X 2SKCA 5GOZA 2OFFA 4HLNA 2ZDHA 4B9EA 4Q3OA 1K0UA 1Y63A 4CEHA 3JYNA 2X8WA 2AZDA 1LTQA 2PRJA 4BBPA 2R86A 8LDHA 1J90A 3E22B 3P9XA 4Z53A 1NVXQ 4OQEA 1J2JA 1BVYF 4G4SO 1A4XA 4E4TA 1BX3A 1HKUA 2C31A 2B8EA 2WFMA 4CM5A 2VAPA 2JANA 4H0FA 1GGNA 1MAWA 2X2FA 4AJIA 3TI9A 1QE3A 1Z73A 3SFTA 2VQEB 2QTWB 1KI9A 2NAPA 2XTJA 1GDDA 1E2QA 3ZZUA 3BJMA 4EJ2A 4EEKA 1RABA 1CY6A 1TM4E 5ARBA 4IZ6A 1GTVA 2GEUA 2VHCA 3I6YA 1NZDA 5FUBA 2FQ1A 3OX2A 4NPCA 3UB3A 5A3JA 1JKMA 1N77A 2A9PA 3EAFA 5KDOA 1R6AA 3GJ6A 1Z8FA 4P34A 1UK8A 2B5OA 2PZLA 2XPCA 1BA2A 1NOIA 2XCSB 1AO3A 2OV6A 2QYHA 5CXUA 2K2QB 1X7GA 2C7VA 2YFYA 4FB5A 4Z54A 1XLVA 2FMKA 3QUQA 2I22A 5AO9A 2D2VA 5D6OA 5FA5A 5FOTA 1KE1A 4NG5A 4AFNA 4BQQA 1E2FA 4H1UA 5BPHA 1DELA 4IIBA 2Q3CA 2BHRA 3N86A 2CFRA 4CDNA 3NBAA 3IE1A 1CKEA 2HMWA 2ZI4A 5AHWA 3DHYA 1QANA 1P7WA 4GEKA 3NHJA 2OBYA 4XH9B 3FTNA 5I7WA 4J43A 4ZP1A 5JCJA 1J2RA 4U9IS 4ZJUA 5KVAA 3LHFA 2JVKA 4ODIA 4FC6A 3E7FA 3U1VA 2G0TA 1TM1E 4RO0A 1C9JA 3AL2A 4UXHA 2AN9A 4MR8B 4Y9SA 2AK3A 1WXFA 1I4WA 2V54A 5HQTA 5HOQA 2J0QA 1A97A 2C8JA 2P2SA 2GZ2A 2ID4A 1X9IA 1J1ZA 1I1HA 3CV3A 1KK1A 1VXRA 2VKQA 2B8TA 3D4NA 3MAAC 3NNDA 4FHCA 4R1SA 1I7QB 1BXGB 4R2KA 3C74A 3ZXSA 3KWFA 2VHYA 4MWBA 1CUYA 2QRGA 4UAGA 4C6RA 5AM3A 4MAAA 3U3KA 1RP7A 1ZJJA 3NHWA 3ZW8A 3RUEA 1FYEA 3TQQA 5LQDA 3AVXA 2I1LA 4C78A 2HV8A 1Z2CA 2PL9A 1JWAB 1N7GA 2BDTA 4AJKA 4CT4B 1PT9A 4FYIA 4ND1A 1W36C 3Q41A 1O8BA 4OBXA 2I8LA 3I9NA 4LX8A 1CQJA 5BW4A 1JTEA 3S44A 3HLYA 1THTA 2XIQA 1QJ4A 2O7SA 1ISRA 1ODIA 2VDUE 4AY4A 2ZAGA 5J2UA 3H83A 3KSBC 4QEKA 3VAYA 5DU2A 4EG0A 1BE0A 1RCUA 1WEKA 3PSHA 2HW8A 3C3EA 1M5RA 2WWHA 3LBIA 2H29A 2VYFA 3ZQJA 3WGMA 3ST7A 2OCAA 4FEYA 2Z6UA 1F1BA 1X1QA 3BMOA 1KI6B 1T34A 2IKQA 2PWBA 2XE4A 1TB4A 2CLMB 3IT0A 1HYGA 1E4YA 5JO9A 3GLFE 2A5LA 1P4AA 2H65A 4QTZA 4XB1A 1DIOB 1OSNA 2FPMA 2AG1A 1QGDA 1TQ6A 1V1JA 3AF5A 4BNWA 1VHDA 2SHKA 3MJVA 3O8LA 3TDNA 3F4BA 1NFFA 4CQMD 4LF6B 4KN8A 1EX1A 3HO8A 2W2KA 5CIQA 5DN6A 3WRVA 1S1MA 2AI3A 5CA1F 1XQ1A 1Y6JA 1G8GA 2HDNB 4FFVA 1S8AA 4UM7A 1IM8A 1DCKA 1CUVA 1YH3A 5DLEA 1E7SA 4LI0A 3IPYA 4UBMA 3ZGVA 4CODB 1B1CA 2VP3A 3U4HA 3CJTA 3OJOA 3C8ZA 4RY2A 4YPFA 1AUOA 4F11A 2VS1A 2HMSA 1IFXA 1CB0A 1OYOA 3B8HA 2QD1A 2OY0A 1A7AA 3WOHA 3O8OB 3G17A 3SXJA 1D6MA 2WHRA 3HE3A 2DFTA 3LFUA 1ETHA 2FSGA 2UYGA 1NVEA 2JRCA 3OLZA 3MMPA 2FV8A 1F0YA 3VDQA 5MGBA 2ODTX 4D8TA 2YVAA 2QP4A 3X44A 5A6VA 1LUAA 2JVIA 3MJTA 2BM0A 1R4NA 3WLQA 3LXRA 4L16A 3TXXA 1I36A 1NVBA 2YJ5A 2FRXA 2O3JA 1E5DA 3AO0B 3BTSA 5COQA 4PAOA 2KHZA 1DX6A 3GUHA 1ZK1A 3DEHA 4EMTA 3IO3A 3GRCA 3SWWA 1SC9A 2WJ6A 1UEIA 4R83A 2OB1A 3NRCA 3Q0IA 1NMYA 2GM9A 4R1MA 1DV2A 2B4TO 5FPHA 3M3PA 1AV6A 1N7HA 2PCJA 2AG6A 4L9RA 1KXZA 5EP3A 4C5AA 4EHDA 4DCPA 4BNXA 2MOKA 1K4KA 4RKQA 1VKNA 4FUQA 1DJMA 3OIGA 4E09A 3GFVA 2XMSA 3W4JA 3VVCA 2HB6A 3RU3A 3PGA1 1HX7A 2OMEA 3CZPA 4UFPA 1EIWA 3GRVA 1E89A 4Q4JA 2QJOA 2VUHB 3NEYA 4C2BA 1H93A 3UWSA 1I01A 2JFFA 5B64A 2J41A 1G3QA 1K8ZB 1ZRSA 1UOEA 3CXUA 4Z9FA 5F35A 3C4JA 3X2SA 2YC4C 2CB0A 2VJAA 2IWHA 3M49A 3NFRA 2NZUG 5EXEA 5G0VA 3K0HA 3WFIA 5EUMA 1VMAA 4KODA 4PZ9A 5EMNA 3PI6A 4HNAB 3KT6A 1MENA 5E2IA 3P52A 4JGBA 3UT6A 3C5VA 1RXWA 4M7RA 3F7OA 2XITA 4ALNA 4ZQIA 4GOKA 3IO5A 1Y89A 4N9QA 2V7QD 3BSYA 1QRAA 4KO4S 3HWWA 4ONEA 2DFDA 3ILYA 4ZGGA 4YRIA 5I01A 4P08A 1YZTA 1QQ6A 1L5YA 3KYIB 1VHLA 2QIPA 2GCIA 1G21A 1NBAA 1T5OA 2YFHA 2Z0MA 4JJ6A 1GNTA 3BTVA 4Z0HO 3FUTA 5FWNA 3RFXA 1SVUA 2RKWA 1FMFA 1LRJA 4Y2SA 3GLIB 2W83A 4LY0A 4UMDA 3U3DA 3OZGA 1SK9A 3A9UA 4FI3F 1U99A 5FO0A 4M49A 3AIMA 4PRYA 4NE9A 4MUKA 4EGCB 4OTZA 2C3PA 3E7XA 4EBFA 1FMJA 1OI4A 4QO8A 5LDGA 1KFBB 1KVQA 4FFNA 4M7WA 4JWKA 4HQNA 4TV8A 3TQHA 3RRXA 5BR7A 3P26A 1SUCA 4YJHB 1EUDA 4R8KA 3VR5H 1OJLA 4NRDA 1UKEA 1L8OA 2HUPA 1P9RA 3UJ9A 4PLHA 3MPUA 4ZTBA 4AM8A 1XPRA 2DTEA 4FILA 5EP4A 3S29A 1EFTA 4B6GA 4HNTA 4RY0A 4EX7A 1JJ7A 2A9VA 1YS9A 1I6WA 3BBPA 3K6KA 4MPRA 5JXWA 1JHDA 2Z57A 3AILA 1ZBDA 4Y1RB 4HSEA 4I19A 4ETIA 3HB7A 4L7VA 1S9HA 2WW8A 2YV5A 4BP1A 1U6KA 5SYNA 3UAXA 2W2OA 3H0EA 3RFVA 4MKHA 1L4LA 4JBNA 1GGVA 4N8EA 4EARA 3LCCA 4BO4A 2UVQA 3DO8A 1JTFA 2CEAA 2DRIA 2YH2A 3OQPA 2Q5FA 4I4TB 5ILGA 3ZWOA 5I9TA 4IQ0A 5JPCA 2QBYA 1VBMA 3IE0A 5EQTA 5K8IA 4YP7A 2RBKA 2SCUB 1Q84A 3UANA 4IGKA 1GA1A 4RY8A 3WP1B 1SUSA 3OICA 4MK4A 3ROQA 3CF4G 2DSNA 4M8IA 1J4AA 3MT0A 4YJ2B 1QHHB 2VYCA 3ELYA 3E9CA 3FYTA 4HP8A 4U8GA 4E46A 5BSHA 3W5SA 3AEKA 1VJGA 1A9TA 3IXQA 3FTFA 2J5BA 2MWMA 2Y6VA 4ZICA 2GRAA 2QENA 3IKJA 1PYGA 3EZGA 4MRNA 4R05A 3JVVA 4X93A 1XYYA 4MV6A 4W99A 2WWVD 5IN4A 3ANSA 2GUWA 5BQXA 2ZRQA 4RSHA 5G1NA 2BF4A 1GPYA 3DV2A 2FG7C 1VG0B 3JS5A 1YASA 1TA9A 3OLXA 4RZ3A 3WIOA 1PFVA 2CXOA 3MXTA 4OHUA 4G84A 1OF1A 1BE6A 2SECE 4RTKA 3R8FA 4F2PA 3I9MA 5BN3B 1NTRA 3HP4A 5HWSA 2ZYRA 5B1DA 2P41A 1J07A 1G8AA 2ZW9A 3NIWA 4IIJA 4C0QC 4FDMA 2OB2A 4E5MA 3BD7A 3V9AA 3O84A 1I14A 4GBMA 4EO7A 5JCZA 3K5WA 3L7YA 5GJWC 5AVVA 1E0JA 1NNLA 3MG9A 4GYJA 1M2JA 1YNOA 2Q45A 4N6GA 1Z45A 5H16A 4EY4A 2VNJA 4U7DA 4G85A 1T2CA 3RHSA 2FLWA 4JODA 4A6DA 2WF8A 5DCLA 2C9ZA 2DKFA 4JBGA 2IX3A 3ZKAA 4XYMA 4JLWA 3BXFA 1M72A 5KWVA 3ZDZB 1WZNA 1SKMA 3TM5A 1NW9B 1RYMA 4Z7NB 3SSMA 1NRXA 1K7XB 3KSRA 3N0VA 4WJZA 4AY2A 3HSSA 3GNLA 3HWRA 5BWNA 2XQJA 4LF8B 2ZBRA 4F2DA 2REQB 1ZD5A 3D3NA 5AI8A 3STHA 4PC3A 3FWKA 1G0NA 4L0QA 2P65A 1GZSA 4RIFA 3O4HA 5FOWA 4Q16A 5LU9A 4M2LA 5E6SB 1RMYA 4FMDF 4UEKA 3WO1A 3FJ1A 3SGLA 1D8AA 1DEXA 2C2HA 4ZQBA 4CNBA 2H4FA 5KC8A 3NIBA 2Z4RA 3G2PA 1J5EB 4L0CA 1FW6A 3CH6A 3OAAD 4EW6A 2P67A 3IPCA 2UZ1B 2O6HA 3AUJB 2XLBA 1C3LA 2DQSA 3FCCA 3SE0A 1OZGA 3QVKA 3EF0A 3EYAA 1U9IA 4ZT7A 3V42A 2SBTA 3OEEA 5B6PA 3HVKA 3KSMA 1AGPA 2R5WA 4UU8A 3OFKA 2AFHE 1HEYA 3PLNA 3RS3A 1HT3A 3CKKA 4MV5A 5HUHA 3IEUA 3MTBA 3BEDA 3QFHA 3WRXC 4HH0A 5IF9A 1KAQA 4CV0A 1D7AA 1ORVA 4I3HA 4B7XA 4DY4A 4QSMA 2G8NA 2BFEB 4ENTA 1TRKA 3Q7EA 4DR4B 1FA9A 1M0EA 1G2PA 3D6NB 4Q3LA 5JNTA 4KR2A 4FHEA 2OCPA 4U2EA 4KMRA 4EKGA 2IKSA 4FE3A 3CVUA 1JW9B 1YDMA 4KGVA 3HM9A 5AP9A 2F55A 3L6DA 4QUIA 3VX3A 5A4FS 1T6ZA 3JWGA 4D25A 4HSGA 3VZRA 4HEA6 3N6VA 1QWSA 3AXSA 4AN4A 2VSOA 5JMPA 1FXWF 1GUAA 5I9BA 1IZ9A 2OEPA 3FTPA 3JQEA 4RNDB 4UHCA 3BGVA 4V0LA 2QX4A 3IQIX 3OLQA 3WLAA 2FW9A 1JFFB 3DMNA 4UFOA 5CDFA 3AI3A 5BUZA 5LOVF 3T1TA 4QOHA 2AKAB 5SYAA 4DTIA 3D2AA 1ZGGA 3CU5A 4TT3D 1P0QA 4BEVA 4E15A 4WKNA 4Q0MA 3DW3X 4MHOA 3WIUA 4EF4A 5ADUS 5JECA 4NPAA 4MYSA 1ULSA 2JJ1A 4OFWA 4QOFA 3TSAA 3LT1A 4LYEA 4DR3B 3T35A 3VPBA 2YS6A 2Z09A 1GG2A 2GXSA 6ADHA 1MFZA 1WDMA 3DW1X 4JX9A 3RIMA 2CMGA 1Y1RA 4LE0A 3ZS9A 3FY4A 4GOXA 2QLTA 2PX4A 2NU9A 1K89A 5I9MA 3T9AA 2BP7B 3LK6A 1UDCA 2A8YA 4V3BA 3FCYA 3PKZA 4Z4FA 3F7TA 2JJ2D 3WGZA 4CQLB 4I4IA 4CL3A 3S8YA 3IODA 5K3FB 3R0QA 5G41A 5C9ZA 3OOWA 1VL8A 3OX1A 2PCLA 1AUXA 1RWOA 2DLDA 2XWQA 3P9KA 4S1TA 4F85A 2OAEA 3MXOA 2BKLA 3EZFA 3L7LA 4WUVA 3OT5A 4ZOEA 2R25B 3BE4A 4CF3A 1QG6A 3MQ4A 2DUUA 3OZCA 2Q4RA 3ICPA 1GLGA 2V6IA 4MARA 3SQWA 2OILA 3UK7A 4B4DA 1TU4A 4RMIA 3VKVA 3KEFA 3NI2A 1DTWB 3V4RA 1OXTA 1XNJA 2QYSA 3CQ9A 1OA0A 3RFUA 4EI2A 3GGSA 4GR4A 3ZI0A 3DLBA 5EPOA 2H4YA 1GNPA 5E95A 2PX6A 1VYVA 5IVIA 4U2FA 2RAPA 2RHMA 4RF3A 5BOVA 2BT4A 2QPTA 3PDHA 1BRMA 1U7DA 4IVNA 4ZQFA 1RJFA 1L5HB 1P3JA 2RH8A 2FRVA 1CFJA 2OV3A 4D42A 1G7RA 5I8PA 5JAZA 2WLSA 3OD5A 3IUEA 3ANMA 3AJDA 1FNBA 1NFRA 1VB3A 5EE5B 3SQNA 4PNZA 3UKJA 4BZXA 4D41A 4LJ4A 4EUSA 3GI1A 4MJXA 1XI2A 1BOFA 4K9KA 1OWNA 5TMEA 4QVKA 2CUNA 2BSXA 4EVQA 2WIGA 4I6JA 5ELXA 1JHVA 3JQAD 4B3GA 1FBNA 2DWQA 4KSCA 4HGYA 4YQEA 3VPFA 1DEKA 2RB4A 5BUQA 5DT2A 2LWIA 3RM3A 1B42A 1C1XB 1P0IA 4IZHA 1E5LA 1U8FO 4RVCA 3USCS 4PHTA 3ZI7A 3FDJA 2OXIA 3KYBA 3VPCA 1NA5A 2DQYA 2Q27A 4HUJA 2ZPAA 1J8QA 3D5EA 4AD8A 2LP4Y 2GFHA 2QL6A 1DO2A 4KN6A 3N8HA 2QX7A 3JASB 4AXBA 3EY4A 1SXPA 3B36A 5DFAA 4XDYA 2H08A 1IMJA 1RWQA 1Z07A 5LL6P 3OQVA 2GJKA 3GQVA 1Q7BA 1YA4A 4R9UC 2MMGA 4QATA 1N92A 1HI9A 4M0PA 5KREA 3IEXA 4CM9A 2C5EA 1PK7A 3DEFA 4EY6A 1EI9A 1EUQA 2BTQA 3GJQA 4P81A 4RTMA 2BMEA 2QTFA 2W2MA 3I2KA 4OJMX 3ZDBA 1OU4A 1IRIA 3H2HA 5AJVB 1DX9A 4LWQA 2VXOA 2PBLA 1UCFA 1YU9A 4Y1FA 2YNMA 4GHWA 3OCJA 4LZAA 4MW5A 2FEAA 4WNAB 4PXAA 3W5HA 4TTVA 3T3IA 2XVZA 2XMCA 4G1BA 3UQZA 1FFDA 3ZDYB 3DLHA 3LPMA 4TKVB 3C43A 3O3NB 1UM9B 4TXLA 3ZU5A 2WD7B 3IKLA 3IDFA 3TD2A 1K6EA 4I5GA 3EQZA 1GYQA 4X0EA 1GTL1 2CDBA 5CT8A 4K8RB 4P53A 2ZSEA 3WWCA 3O31A 4AYWA 4EZIA 1LQTA 3TVDA 5JD5A 2OSBA 2WM3A 3EIXA 3Q12A 4UHKA 4D4JA 5HFJA 3W5JA 4FFBA 4ZMRA 3OO0A 2BEJA 5ECGC 1P19A 2IOQA 3SYNA 2IV7A 4IXMA 1KR2A 2N3ZA 3GD7A 4CETA 1DDOA 2PM8A 4K03A 1FXSA 5C7OO 1TMYA 3EF1A 5CTJA 3RV4A 3TDKA 3B6ZA 3MMZA 4RF4A 1QHFA 1Z39A 4GO1A 1AZWA 1UINA 1F38A 3OKAA 4TZKA 4WBNF 3W77A 3GFRA 2ADOA 2BP7A 1HZZA 3ER6A 2DHDA 1M7BA 2F1KA 1O77A 3U31A 1COZA 1EE9A 4R8LA 4XFKA 5AVYA 3ORYA 3BREA 1FX0A 4L8YA 4I8IA 4KV9A 7MDHA 4JUDX 3D0RA 2D8MA 4OHXA 5K99A 1JG6A 1CHDA 4IX9A 5L3ZA 3VM6A 4FTWA 1U2DA 2GEKA 5ADVA 2Y1GA 2HK8A 1UMCA 2FE4A 3GLRA 4G86A 3AP3A 2R6R1 3V55A 1CQPA 2M32A 4FOOA 3S4YA 1TECE 3IVMA 2YXNA 4PCVA 2O0MA 4PRLA 4RM3A 4FLMA 4O2BF 2PUHA 1G5QA 1VCMA 1JFFA 4MW6A 5D86A 4E22A 1N6OA 2FH5B 1VP9A 5LM3A 2QR2A 1G6HA 4L5IA 5LQSA 5DX1A 1IYZA 1RKVA 1U2ZA 3HKBA 4E21A 1XCLA 2PMBA 1A2BA 1QQ7A 1GL3A 1Q0PA 3LQRA 4Q9KA 4QDJA 2HJSA 4KK3A 4LVUA 2F64A 3WNDA 2E82A 1N0VC 2PIDA 1K6MA 4PYMA 1QHNA 4HLQB 1H22A 2FPOA 4KE9A 5FWXA 1DT3A 4DWOA 1NM5C 5LQKA 3EFOB 3OLWA 1MBZA 2GA9A 2C9OA 2OGTA 2Y6UA 4NZZA 2OR3A 3KR2A 2W98A 3ZV4A 3W05A 4BNFA 4CDMA 2NP7A 1WCYA 1CV2A 1C41A 2HEGA 2NT3A 2P2NA 4KFSA 3IPAA 4COKA 1U02A 1YS7A 4TKLA 5DWVA 2V1XA 3COYA 4H0CA 1JU3A 2F8TA 3R76A 4F3YA 3K9HA 4O0LA 1KBQA 2BHLA 3UAWA 2DPMA 3IQFA 2PG3A 2X1LA 3PB3A 3DL2A 1QS0A 3ECAA 5A4DA 1TQDA 1C9YA 1IDN1 4DG8A 3RW9A 2VP0A 4W1PA 2J5RA 3Q9SA 1H1LA 4DM3A 3O38A 3KVVA 3T99A 4XWGA 2HA4A 5EZYA 1FFWA 3V80A 4ENQA 4V39A 1UFQA 1SKBA 4KWEA 2PGLA 1XTIA 3LNCA 2WAYA 3E23A 4QAJA 2CLHB 5FBQB 5LUBA 2GQ0A 3ICEA 3CZQA 4J2OA 3NHUA 4G36A 2DPYA 2CJFA 4RZQA 3C6MA 3D6JA 4EY3A 1FLDA 2RI6A 4S1PA 5F64A 1VJ0A 3HEBA 3Q3HA 1YE5A 3IP1A 1CZKA 5FYDA 1ACMA 1AURA 6LDHA 1JQEA 3G7NA 4QOEA 2X42A 3V1YA 2IHVA 4B5KA 3K09C 1U3TA 2J0UB 1ORDA 1MW8X 1JZQA 2REBA 5J9FA 2ZTHA 5A9RA 2LIVA 2AC2A 5HJ5A 2PWPA 3TAUA 1T8UA 1JXMA 1N3LA 1ZJ5A 1CETA 1DQPA 1SIBE 1FW8A 2FXVA 3W79A 4QUEA 1YI0A 1EAYA 3RVLA 3WGYA 5G3YA 4ZEVA 3R6GA 5JJLA 2JGNA 4WOJA 3B70A 5KSOA 1KWGA 5F4BA 2C92A 3EDOA 4Q34A 5CB4B 4OGFA 1VHQA 3EGVA 1VI5A 5D5QA 3FMPB 4DMRA 4DPKA 3K70B 1NPTO 1FVHA 5AQ1A 4ZVQA 4LRWA 3QMPA 1Z74A 4N18A 3V8RA 4PQRA 2VPIA 2ZS8A 4W9NA 4XX0B 4BCDA 3LBYA 5L4SA 3THYA 4PO9A 4NX2A 3A3YA 3KJHA 4UVHA 3TQOA 1UJBA 4NI5A 3K94A 1ZN7A 3ONVA 4JQOA 1QOPB 2HJ9A 2J0VA 1KS9A 2MSKA 2I03A 4DBLC 1YR2A 5HDQA 3ONWA 3DLIA 2ZTUA 1XRLA 1ZU4A 4X6UA 4CLXA 2P1RA 2C07A 4HFNA 4U7JA 3W4KA 4RLQA 4CF7A 1OXVA 3GFBA 4MITA 3ZN2A 4KDCA 1AA9A 2CZCA 2V7UA 1NI3A 2BEWB 1RAEA 4NFYA 5THXA 3WDMA 2WTUA 2FLVA 1FFGA 2CZQA 4FMCF 4JZKA 5DLPA 4ZT6A 3LKBA 1JKFA 2ASEA 4HAXA 1KQGA 4GZ5A 4J0JA 4COOA 3LL7A 3SBXA 4YYZA 3O83A 5TARA 2ZP1A 3EGXA 4AZVA 3ELUA 3CZMA 5AW4A 3CUSA 2GNOA 1WZ2A 3BS4A 3TPZA 1ISFA 1C29B 2O3SA 4ANFA 1W85A 1E18A 1CS0B 1VKOA 4ILKA 4Q4JB 2GH1A 3A1TA 3SF8B 2WVGA 3RAPR 3V8MA 3VMFA 2Q28A 3ABZA 1HETA 4KQXA 1KK3A 4L08A 1T8WA 1HH4A 3VVLA 5JVDF 2GHQA 2MT9A 1SU6A 1NVMB 4MP3A 1RR6A 3P2MA 3TN7A 1GTZA 2A78A 2Z5FA 5LIPA 4OXIA 4PG6A 5K0CA 1EPUA 1MJFA 4IDFA 4UPDA 2Z6AA 5ALTA 2O54A 4W5RA 2ZATA 1MX9A 2X8JB 4LDRA 1LV8A 2JFQA 1G1MA 1HZZC 3FPAA 1UP6A 3P1JA 5EPEA 1P18A 1QSGA 3L04A 1HGXA 3B7PA 4ACBA 4BTVA 3L02A 5FWYA 4K05A 3IT1A 5IANA 4DV1B 5U4QA 4IG4A 1N5RA 4IM7A 3D3WB 4DRXB 2VAXA 1P73A 1XLWA 3QJYA 5EZSA 1FQWA 5DLQC 3DOUA 4CCWA 3GP8A 3U7FB 5ER6A 2CXNA 3D7NA 1ONSA 3QLJA 1Z4OA 4RWZA 3IEKA 1GITA 4O2AB 4P1ZA 4PAQA 1TDJA 3WNZA 5HM6A 1E4OA 3D3JA 5CDUA 1YWGO 3T5AA 3KJNA 3IGFA 2A30A 1AQUA 3PUKA 3ZDQA 5EJGA 4Z51A 4H7KA 1TO2E 5AXCA 1U0OC 1T8RA 3RF7A 4GXRA 3B6EA 2P75A 3EB9A 3EWSA 4GW3A 4DW8A 4UTOA 3O9VA 3I4LA 2LUOA 2REOA 4WFJA 2PKYX 2YXBA 1BQ3A 3AEUA 1RKQA 3C15C 3L6OO 4MMXB 3OZFA 4Q4HB 3WLMA 5HF8A 1TU3A 4BB6A 5KINB 2E6UX 3W6NA 3ZNPA 1T2AA 2A92A 2A2ZA 2HF9A 3QX9A 4CBVA 2LBPA 1JU9A 1W93A 3KD3A 2IFTA 4C7BA 1YQEA 4DCTA 4REMA 4HAWA 3UK6A 1GFWA 1XR3A 2IXFA 2XQKA 3QSGA 1WHSA 2Q3LA 3Q3IA 4I6EA 1RBQA 3NETA 4LJ9A 4PFQA 2EERA 1ZKDA 3L6CA 4HNQA 4J7AA 2W2VA 4OPMA 4NENA 1OT3A 8ABPA 5AI4A 1FSSA 1E1CB 1GJRA 2ZPUA 1RAAA 2IXEA 5KI6A 3U13A 4IGFA 3VR2D 4XB6B 3KQPA 2QKYA 4JI3B 4TMVA 2PXAA 2RGCA 3EVNA 1JDPA 3DS8A 3P97A 2AJBA 3QLVA 3UK2A 2VXBA 3JTEA 3CHYA 4REOA 4ARZB 4B34A 4PS0A 4MV3A 4LNAA 4E5UA 2GJSA 3H11B 3IEIA 3IUJA 3BRWA 3O94A 1DAHA 2C1XA 5FOUA 3COWA 4FLFA 1UMDA 5K3BA 1T3SA 4XPIA 2X6QA 2QLNA 2CL5A 4MUNA 3BXZA 4HXFB 4KQCA 5FKJA 3SHVA 1IQ0A 1W0JD 3HN2A 3I53A 1AHPA 3PGKA 5AOBA 3FLBA 4WRRA 1RMTA 3MWLA 1GVNB 3H4MA 3H6HA 3QPVA 4FBLA 5FUYA 2QS9A 1WB9A 4Z86A 3MWFA 4KEAA 2H59A 4B3DA 3PTZA 2AX3A 1E1RA 1ODSA 3ANLA 4B17A 2OHXA 1QOZA 2BEVA 2CKDA 2NXEA 4HPXB 3RVDA 2JK1A 3SNHA 1OH5A 1HYQA 1HLFA 2FZWA 4KMMA 2F1OA 1QP7A 4ZZ2A 1NUAA 1NKTA 1JHXA 1YJAA 2MIIA 3AKDA 4OQDA 1ACLA 1BWQA 1NUHA 2PX8A 2C83A 4HS9A 4E07A 2R79A 4J90A 3QX3A 1L5RA 3LZCA 4IYJA 4A2PA 4TLAA 2TMKA 1I1OA 4FHDA 3DBOB 4B81A 1GUDA 4P3YA 3ZGLA 2C9CA 3MERA 2XT9A 5C8VA 4CZ2A 4LQLA 3RTAA 3UNXA 3U4CA 4CKEA 2XB6A 1CQIB 5IT0A 4PGFA 3VO8A 3FSRA 1IXYA 3BAZA 4AZTA 5TJHA 3UXYA 5B30A 2XXAA 3VDXA 4IKEA 4WKGA 4CLDA 3ADOA 2ZPTX 4US2R 2VR1A 4A2CA 4P4LA 3K1ZA 4RLSA 4G01B 3EWIA 3NG1A 1YSCA 4MAMA 1ZVJA 1HE4A 2CDCA 3P27A 3S1SA 1EWTA 5LZ4A 1GNLA 1YMVA 1ZNWA 4II3A 2AVNA 1FMLA 2H2GA 4GQAA 4DC9A 2RJ3A 2Q2VA 1W88A 1YRYE 4BTEA 4HOYA 4F93B 1H6AA 4OF4A 1HL3A 2JLVA 1D0IA 1I30A 3ABQB 3NJRA 1MC4A 1AD2A 1UXJA 1NM5A 1EQUA 4ZAWA 3S2IA 1OC2A 5AVTA 4EG6A 3EJWA 4Z3KA 3U16A 3H1AA 1YE8A 4F4DA 2XUIA 1M34B 1NOJA 2DFLA 3PEVA 3FRHA 3GEMA 4X7BA 5JAOA 2AEEA 2FPXA 1KMMA 4LI3X 3OIWA 4WX2B 3D3EA 1OZAA 3TGWA 1I4TD 4H31A 3H11A 4PR3A 2G4CA 7ADHA 2A1UB 1GQSA 4Q3AA 3ESCA 3I6BA 2GD0A 1TFUA 1A9YA 3EG5A 2YHUA 1C1DB 1YB7A 4Q39A 1IEVA 2D13A 3VA7A 2QK4A 4AJOA 4JYCA 2GRUA 3X1YA 4URFA 4QAQA 2PKQP 3ESXA 1KO8A 5CD9A 3SE7A 1G4UR 1I0IA 2Z08A 5TPWA 1KZ7B 4TSRA 4O5AA 3SF8A 3DC2A 4JUIA 4P2BA 4U7FA 4JI4B 5JH7F 2W2TA 1SVLA 3A4VA 4XYGA 4UULA 2FJ0A 3H05A 2V9CA 4JVLA 4ARAA 3EGIA 4DLRA 4HO1X 1SUFA 5FBVB 5M29A 2YQ4A 4HB2A 1PKEA 3HKCA 1G6OA 2CCKA 1G8MA 2DGDA 4PZYA 1JSRA 3FVRA 2QLMA 4EYSA 1V4VA 1P9OA 3KWJA 5JV5A 2W6PA 3AEXA 2CGEA 4QPCA 1TJPB 4BP3A 5JZOA 2QE7D 2Y1WA 4LJ5A 1VKJA 4N5LA 5ITVA 2FMTA 4LJLA 4P3NA 3LX5A 3EVBA 3Q7IA 1PJBA 4GEGA 1QB7A 5KSWB 1JFSA 1YQ9A 3QBEA 5T57A 3ZE9A 1SZJG 2O1SA 1UBUS 4DIMA 4XWOA 2FFHA 2W2LA 3LTEA 2CXPA 2OLJA 1DLJA 2MINA 2V74B 2QZPA 3ZOZA 4B3CA 2C7OA 5EI5A 1NAIA 3AW9A 3KEMA 3OF3A 3C6QA 3GZJA 4C89A 4YIHA 4QHSA 2FQQA 5JNRA 5LP6C 1J39A 4JHLA 3L1VA 5DHSA 2Q6VA 5EKTA 1OFVA 3G85A 4WDRA 5CBKA 3K8YA 5C18A 4P0PB 1NW3A 3MWGA 4XDGA 2PL5A 2XT6A 3PX2A 4W8OA 1W46A 4YIKA 4GOJA 4OHWA 5DGDA 1LJLA 1L5FA 4CG2A 4FFRA 4MRMB 1TQHA 3KT0A 3OIDA 5DK4A 4LJAA 1K3TA 2ZROA 3DOEA 1M8GA 2BM1A 4J1NA 2IXTA 3MA0A 3TINA 3VOAA 4J7CA 3VZPA 1GSIA 2P90A 2CLOB 2ZE7A 3ESYA 4FGSA 4TS4A 1N8NA 1EHIA 2VRCD 2ZM6B 4RYDA 4CKBB 1FFYA 4FQ8A 4OHZA 1ZRMA 1MIOA 2YXDA 3EDYA 1KQOA 1ZEMA 4BLUA 3ICWA 3L5OA 1DXQA 1W85B 5G4LA 4CFYA 2A7QA 3AM3A 1RHKA 3NKLA 1ZGZA 3CVOA 1AK1A 1W4AA 2ERYA 3FUVA 3M2TA 1OHHA 2W6CX 3QJGA 2GN2A 1P80A 1ULHA 4K0RA 4DBLE 5EJ7A 1A72A 5K3SA 2J9GA 1N78A 2I4LA 3CSDA 2V8BA 4P3KA 5AVXA 4Y2RA 2VJMB 4AG3A 4E32A 5B58T 4AZWA 2FHSA 1ULTA 4GSKA 4PRKA 1N3YA 3VYSB 4O1MA 4DJ5X 4R1TA 1JJIA 3LDGA 5FRDA 1R66A 4XIJA 3M2PA 5AH0A 1SBTA 4L3VA 4X1IA 1GCOA 4YV1A 5DI3B 2VNKA 4EHFA 3IELA 1DRUA 2CBZA 1Y7LA 1Z2NX 3F97A 2L69A 4FYVA 5ENDA 2L82A 4ARBA 4ZVUA 4U02A 4RTRA 3IIEA 5HMMA 3GGPA 2CYCA 2GPBA 3ZQ4A 2RGRA 2M6SA 3HA3A 5ETJA 4XX0A 1ESMA 3KVYA 3OURA 3ZY2A 4DNQA 1GAXA 3O2JA 3P0EA 2DCUA 3TZHA 3FUXA 1XJ0A 1OIVA 3CX6A 3LLMA 1JKIA 3EYWA 2GD2A 1U4SA 3GRPA 3O0DA 4IIGA 3TWOA 2C2ZA 3VU9B 4EB6B 3GO4A 4I66A 3ZWWA 5C8ZA 3RRFA 2RGYA 1N5DA 5AW8A 4PBSA 1ATIA 1BG6A 2QQ0A 4OHBA 4DA9A 4UM9B 4YMLA 5IKOA 1DTEA 1PZMA 4LRTB 1ESZA 2CK3A 1IQUA 5T6BA 3B5JA 5HXAA 3QM1A 4NOLA 3BSWA 4NH4A 4QZVA 1RJ9A 1V43A 1UJCA 1XKTA 4HWSA 2WJWA 3KEGA 4GKVA 1DU4A 1FMTA 1Q1ZA 1W2WB 3AR5A 4JFRA 3T9BA 3GLGA 1FJ2A 2MSCB 2DFPA 2GEJA 4EGAA 3I9V6 2O59A 3NC4A 3EIQA 3HB1A 3HHPA 4HRYA 3VR5D 3OQOA 4CEIA 2QJFA 2D0OB 2WIAA 1ZVKA 1URPA 1ORTA 3U62A 3OFVA 1AK2A 3NV7A 4FYYA 4RLHA 1CNFA 1TOAA 3BK2A 3DC7A 4LE2A 3U6BA 3TF5A 2E49A 2JBHA 4H60A 3F8TA 2A0FA 3ZBTA 2HH9A 2XMBA 3F5FA 2B30A 1EVQA 3AHIA 4RHCA 5GONF 4CIVA 3LWBA 4Q12A 4BU1A 2RCNA 5EHZA 2P9ZA 1I4OA 1IXRC 5EWLB 1ZI8A 2EP5A 4AS2A 2HZBA 2VTKA 2D8AA 5EOVA 1ZVQA 5FBWB 3ZY6A 2IDJA 1CF2O 1ESDA 2ZZKA 3OFSA 1M75A 2FPGB 1RTKA 3DVAA 4WBSA 1Y1PA 4G97A 5BV7A 3Q9UA 3TQIA 4EM6A 3D8NA 1VIMA 1KJWA 2C88A 1E6KA 2GCGA 3QI2A 5E6UA 2I2DA 3VGPA 2NUPA 2ASVA 5DBGA 3AT1A 4PHFA 4KIJA 4JYAB 1QB8A 2PUGA 3A7EA 4O4LB 1ZJYA 4UTZA 5DNWA 1IB0A 1OHHD 1K8XB 1ZEJA 3HMQA 4ITUA 2DKNA 2DZDA 2LV8A 2ORED 2VT7A 2BGUA 1GN8A 3DCYA 3O47A 3Q1KA 4IFIA 1JAHA 1P17A 3EXHB 2FZCA 4YR9A 2OXEA 1UKAA 2DTXA 3JU3A 4NEQA 3ZHSA 4BMSA 3UHOA 5G0SA 4BVAA 3J7AC 1GN9A 4HGRA 1FFBA 4WLFA 3EFOA 4TKZA 1P1IA 2BPOA 3P0FA 5A5FA 3QXGA 5L40A 1UDRA 3ZQUA 3IESA 3WBJA 2QPOA 1MIOB 2Y1OA 1QRUA 2WQZA 5JWRA 4WNAA 1E3JA 5DO9A 1SUAA 3M6MD 5ALJA 1G8FA 2BMAA 1HT1E 3PTLA 1T15A 1WS6A 4NVRA 3AI1A 4DA4A 1OBHA 1I8TA 1MG0A 5A06A 5K8UA 2D1SA 3ANTA 1NWHA 2PS0A 3FPGA 1L4MA 4LYFA 3VZDA 2VPZA 3G2MA 3E82A 4PQEA 4Y1GA 5EP1A 4AWXA 4JT2A 3C3DA 3CX3A 3QPAA 2NACA 3DVLA 2DB3A 2WPDA 2YCLA 5CLIA 2G25A 1QO0D 3R3YA 3DE7X 4B3IA 3VH3A 3O8CA 3FNFA 2P5TB 1OX6A 3CZRA 3MTQA 5LPNA 2WLTA 2AS0A 2J3IA 3TX6A 2H51A 4N03A 4WOKA 3DWGA 1QHEA 5TJ9A 4B40A 3QNUA 4FXOA 4C03A 2QUJA 2V4MA 4EEXA 5LP6A 5IKMA 3SIRA 4LJRA 5A71A 4ETWA 1XTVA 1G8YA 4H1HA 2BDUA 1ZI9A 1IZ0A 3KZVA 4CJXA 3ZBQA 3RIXA 4MW0A 2RMKA 2VWPA 1P0FA 1BNCA 2IX9A 3BXGA 4LHZA 5FPQA 3SHOA 3UAVA 3NYIA 1UBFA 2ZI6A 2ZT6A 3T12A 2GTHA 3VH1A 3X1DA 2R8XA 3I34X 3EEQA 3K72B 1FJXA 3LY7A 1SXIA 1VJ5A 2EW1A 2Y1EA 4D0LB 2KBEA 3H7AA 5IC6A 1RIFA 2OZVA 3DM9B 1QGED 2WM8A 2DWPA 2ZI3A 2QX6A 5IN5A 2I7TA 2PMFA 1YDWA 2EXXA 2VDNB 4MTLA 5COAA 2NTNA 4YMUA 5HIKA 2WF7A 2YHIA 2Z1DA 5FTKA 4Z0NA 4Z4EA 1MZPA 1GP2A 3FPCA 3I4CA 3IXLA 3JQGB 5H02A 3NVKI 4EY8A 2GJ8A 3PNMA 2V7QA 3QTBA 4TLDA 1W1WA 3ZWQA 3ETJA 4PC1A 5CK5A 3SSOA 2VHZA 3MNFA 3WE7A 2IUUA 1EDDA 1N6LA 1MRSA 3DOJA 4EYEA 5F1PA 1TYBE 2A0XA 1H42A 4UEQA 1CIVA 4R98A 3SYTA 3Q87B 4YJFB 1XO1A 4XYEA 3WAKA 2BL4A 1CR1A 4DNXA 1C4KA 1NG9A 2R00C 2RGUA 1C30B 5BNIA 1DIGA 2PZBA 5IBCA 3TL2A 2FW7A 3QEOA 1QVWA 4QJ4A 2HMVA 3H1BA 4OVKA 4YRBA 2G1AA 2V7GA 4E5NA 2ZAIA 2PEYA 3HR4A 5AJYA 6NULA 1A8HA 2Q2NA 1QPGA 2F4VB 1QKKA 3HS3A 1XAIA 1AQIA 1P5ZB 4P36A 2PKRA 2BC9A 2IS1A 1NDHA 4DM7A 3TQRA 3KQWA 1VCOA 3V4OA 1E3WA 1VBFA 3H84A 4LY3A 3DE2X 3PYMA 2R6DA 4H4CA 3DZIA 1Q5PA 4CR7A 2VHEA 1QHGA 1ESEA 5CB0A 2VF7A 2OFWA 1C0EA 1FJHA 1P2TA 1QPZA 3NM4A 4OHMA 3F7NA 5KNLA 3H1GA 2JLRA 2EFJA 2VSNA 2MHCA 2LDBA 2B2XA 2ZUBA 2W6OA 1ZCZA 3D6TB 3R0JA 1J99A 4DLAA 4EHJA 4Q7QA 5I47A 4M3NA 2O8FB 1EHCA 1JNYA 1Y80A 2WJ4A 4TMKA 3ICQB 1GPDG 2WC1A 3AFNA 4EGFA 2X3YA 3IR7A 2Q1UA 4YJKA 3ZCSA 1PR5A 421PA 5F78A 1A95A 5CX1B 2GAAA 4KUHA 3TTYA 1SPBS 2H2DA 4GZ6A 1ISSA 3R3JA 4JMLA 3RYTC 4DOMA 3DR3A 1EVEA 3FUUA 1BU5A 3BIJA 3RGGA 4MRAA 3OA2A 1YA6A 1MMFB 1XZLA 2CUKA 3RCBA 3JD3A 2RGDA 4OHYA 5AM0A 1VLQA 3GZTB 1JX6A 2CNLA 1SBIA 4RIIA 1M10A 4KFCA 3E35A 5KTOA 3BX1A 5M3BA 1DTSA 2Z98A 4AB1A 3BB4A 1X7HA 1XDSA 4S0ZA 1D07A 5E2AA 5H0IA 2CFTA 2WNIA 1T2VA 3CYFA 1H2YA 2II6A 1FFEA 4IS3A 2Q5QA 3DZBA 2KI5A 4KGZA 2B4RO 4RJLA 3KCNA 2EW2A 4NXMB 4GPEA 4EJMA 1EEXB 1W0JA 1AKTA 2H2WA 4MO9A 1I4DD 2AMJA 4FR2A 5IAEA 3SC2A 3F1KA 4D4HA 1YQUA 3KOYA 1NBMA 4J4TA 1R8SA 1QZUA 3IOBA 3PXDA 4DKJA 1SXJB 3P0HA 1M1YB 4JBIA 4ROSA 1RE1A 2VPWA 1U9CA 3I2HA 2ZU6A 1N4AA 1WV0A 3FFTA 1LSOA 1WDLA 3EC7A 3FGOA 1YBMA 3WI7A 1F7VA 1KJQA 2JFUA 1ZMBA 1J0EA 1TAQA 4K46A 5C3UA 3SFVA 3H19A 1X7ZB 5EJMA 1HE1C 3DFIA 4FGJA 5JO0A 4LYHA 1XMQB 1QHYA 3A6LA 4HQOA 2I29A 3LW8A 4HC4A 5J40A 1SVMA 4XPIB 4BBZA 4IKPA 1ZJZA 3JTMA 4J0HA 2XGJA 4B2PA 1DKLA 3F8WA 3IV7A 2YICA 3AY0A 1Z6XA 3PFKA 3UG7A 4K9MA 4D6XA 4A27A 2A5FA 3UYKA 4WK2B 3UFBA 4PZPA 2ZI5A 4D0SA 3T1OA 4U2KA 1YZLA 1XRPA 4RDCA 3OZEA 3H5LA 2MYNA 3HA7A 3UV7A 3M3HA 2EAUA 2C42A 4RTNA 2AFVA 1U3WA 4M9CA 2Q3HA 4IO1A 3NT4A 5E4TA 4ZU3A 2NUTA 4QT4A 1ULBA 3NOQA 3IBYA 2P27A 4FD3A 2ODPA 2Z2KA 3BJZA 3M70A 5HK8A 3X43A 4JI2B 1JEJA 4RPHA 1LBTA 1F0NA 2HBRA 3AYZB 1W8IA 2G5PA 3WKEA 3ZK7A 2QTHA 3F3MA 4KIWA 2GYUA 4ZPJA 3ZX4A 1NIJA 2VUTA 2P69A 4R1UA 4MUBA 4ZEWA 3S8EA 3N6RA 2BE7A 3PNLA 4MQEB 4Q4HA 2LIPA 1V4NA 5GV8A 2W7TA 2PO7A 2JGKA 2AD1A 5HSGA 3KJQA 1TAGA 1US8A 3D4LA 4IMIB 5LXTA 2XRZA 2A9FA 4F9FA 3TQSA 4IIJB 4AK9A 5BSWA 1ODJA 2IP4A 3W8EA 1FIUA 4LY6A 3T4UA 3OOJA 4DIBA 5D6NA 1QFSA 2FP4A 1SCBA 4WEOA 4G1EB 2BFCA 1F2TA 3D59A 5A03A 1XZQA 4ZOCA 4A2QA 2GXQA 1RRCA 3EH2A 3PYXA 4PLFA 1LPNA 5FOVA 1TZCA 2C5FA 4K87A 3TUIC 5FUMA 2C3MA 2EGUA 4PLCA 4WZBA 5AESA 2IH2A 1RDFA 2NUBA 2GXUA 2IU3A 1AMUA 4KKVA 1ND6A 5GJCA 3RYIA 4BVBA 2TSYB 1I3KA 1RZ3A 1QM5A 2NG1A 2VNSA 1EAMA 3N70A 5IAJA 3VHRA 4Z5XA 3BTOA 2V59A 2ZYVX 3OUUA 3QKTA 1KVSA 2O5RA 4ED9A 1XZFA 2W58A 1ZM7A 2IZ1A 5IZCC 4DUGD 1HK7A 4GPZA 1ZO8A 4ETMA 1KRWA 1TK2A 3Q9LA 2PFSA 1IJFA 4FOTA 4TL6A 2VOJA 1SC3A 5E6RB 1F2UB 4D0NA 4EK9A 2VPTA 4ZI2A 4DV4B 4PFKA 4CI0B 1E2PA 1QK3A 2EJWA 2Q49A 1E9DA 3EDRA 1E2KA 3HJGA 4ECEA 3IS3A 3DAYA 1VC2A 5FT9A 1Y6ZA 2I3GA 2AJTA 2RB5A 2FVYA 2JLXA 1DBWA 1R9JA 2QLLA 4RY9A 3LCMA 4U9UA 3QQ5A 1L7XA 1GUZA 3A06A 3C3AA 3ZX5A 1AO0A 4JVNA 3IVRA 4QPPA 1VRWA 2H63A 2A1TR 2GM3A 1U5AA 5CBPA 4LX0A 3RRBA 2H7YA 5CJ2A 3KKEA 2J0UA 4YA6A 3TTSA 4FX2A 4V1CI 1YB5A 5I51A 1RFLA 3JRNA 2HRRA 5EIFA 6AT1A 3TMYA 3FYSA 3JQ9C 4G0XA 4OJYA 1M2HA 5CRIA 5KWSA 1Z29A 3FXAA 3L8FA 3NDPA 3OCWA 1D2GA 1DQSA 2F8LA 3I92A 4MULA 2V4ZA 2CL0X 3ZVNA 3L41A 3FKQA 3PNKA 4ENUA 4BQNA 1UK7A 4IS2A 2JHCA 2WP8J 3I0MA 1AXGA 5IKEA 3O9ZA 2EJCA 1Y7IA 1ZSVA 1JPJA 2QG4A 4RVNA 2BR4A 2QROA 3GFTA 5KKNB 1I94B 2Z1MA 1ISHA 4Y7CA 3CNEA 4RHEA 4F2WA 1SEVA 3L6UA 1T9CA 1MB4A 4BNLA 4LZLA 3REFA 1AKNA 5JBNA 4OB6A 1ZR2A 1HZJA 1U04A 1QTIA 2YW9A 3EE6A 4UUBA 1ODFA 3GG2A 5E6RA 1QRDA 2QTGA 1U90A 3GRFA 3FAKA 4C1BA 2VSQA 1Z2DA 1KYVA 1E9AA 1YJQA 3FVVA 1QJCA 5F7OA 1KI4A 3MCUA 3OFNA 5J47A 3EPHA 2UXCB 4JELA 3H97A 1JF8A 3OE7D 4K6KA 3VXKA 1GILA 5K8VA 4Q1CA 4RVGA 1SCKA 1MN6A 3M4JA 3OOSA 4WACA 2RGBA 2AOUA 2XQIA 4ZIRA 3WGNA 3JQRA 3QHPA 2H9IA 5ALLA 5B53A 3VPHA 5JXJA 1IIBA 3RYIB 1T36B 3IFSA 4WXEA 4E11A 1U9YA 3IDOA 2N42A 2SCUA 3AJAA 3L7NA 1US8B 1SHJA 5HF6A 3CKLA 2WKQA 2O8DB 1J8YF 1R4MB 4JOBA 4GE3A 2ZTLA 3CUKA 3UM9A 3BJIC 1PT8A 4ZFNA 1I5OA 3B1YA 3MYRA 1XQ9A 4ZXFA 2PGDA 4MGIR 4KWTA 3O4FA 3CWQA 3U5ZB 3U6KA 1EWVA 3CX4A 4QRIA 4U7TB 2B4QA 4UEOA 3KOUA 2O4UX 4DV5B 1TYZA 2ODAA 4HAZA 1S3IA 1YT5A 2H2HA 3K96A 3LX4A 1JBQA 2EP8A 4LJ6A 4WINA 1KDVA 2TMGA 4DJFC 4DLYA 3IP3A 2HA6A 1VSUA 3H5IA 2XBUA 2ZGVA 3HCFA 3F0TA 3MAGA 2M6KA 4OUKX 4WFQA 5E4JA 3AX6A 1IHUA 4L7QA 4KQKA 4MCHA 4EJFA 4ZYTA 1ZUWA 1TVEA 4CTMA 3N58A 2BKVA 1YBVA 3H99A 3UT5A 1J09A 1GGMA 4PONA 5CYOA 3OECA 1I3OA 4LC1A 4QPNA 1W36D 3ZD6A 2UVDA 3AYXB 4OXNA 4XFJA 2OFOA 3C3YA 3CRW1 4LV6A 4QBKA 1E6WA 1T4CA 2WUFA 4ZA2A 4JLKA 4MEAA 1NJFA 4E5DA 3OZRA 4QUJA 1XQWA 4IOLA 3NIFB 3AGQA 2JIPA 4JSTA 4EIWA 5HZMA 4MA5A 3NIGB 1Q20A 1KFJB 1SCQA 4R81A 1Q7CA 3ABRB 4H7EA 2HGSA 2UUOA 4K28A 4W7IA 5F33A 3UV3A 3G8AA 2C99A 3AJ8A 5HA5A 3RNLA 1JEYB 2Q7XA 3QGMA 4EA9A 2NO9A 1WXHA 4BXOA 1B73A 1YACA 2RGGA 2YJ4A 3EVTA 3K4HA 4QYSA 1RT9A 1HG1A 2PZFA 1IRXA 5DWQA 5EE1A 2IXBA 4S1OA 5DP1A 1JSLA 4PX9A 4ZHSA 3I6ZA 1NLMA 4R16A 4X7MA 3UJHA 5ALEA 4JB2A 5ES3A 2FN9A 3EASA 3LU1A 2J30A 3R5FA 4LWOA 2FP4B 1TUBB 1DT5A 5F9HA 2QAGC 3ET5A 1ZGJA 3EVGA 2G1PA 3KTOA 2XRYA 1G8HA 1PWZA 1G55A 1PRYA 2Y0CA 3CN9A 1QYIA 4DXAA 3CVWA 2A9QA 5FBKA 1ZMXA 5ALZA 1E3QA 2OCKA 2OESA 3NC1C 4FZRA 3N8DA 2NSYA 3FG9A 4NICA 4QRDA 4OSPA 3ZE1B 3IX7A 1XU4A 2WSSD 3C98A 3ID6C 1NQOA 3SI7A 4D9BA 1RTTA 2WM2A 4QWMA 3PNQA 1TF5A 2XLCA 1B8NA 1OLUB 3KZXA 3I39X 3GPLA 1FLAA 4J07A 1SBNE 4GRAA 2D7CA 2VHJA 5KOHA 3E27A 4B79A 2ZJOA 1WP9A 3LHIA 3ZQKA 3HJUA 2VOEA 4MIEA 4K5QA 4BLWA 3ITNA 3I61A 1P31A 2ZSDA 1MABA 1RI5A 2M1XA 5FUXA 1YKGA 2GN1A 5DNAA 1BQEA 3AF1A 1J0BA 4P35A 3TR5A 4PYIA 1P2GA 2N0SA 3B85A 4BX8A 3KAJA 3QHQA 3JVIA 3GRAA 2HYDA 1IG3A 2AKYA 4EX6A 1XVAA 1CJTC 5BP7A 2HNKA 4CWAA 3MLBA 4TSFA 4JXZA 3R5XA 5G0UA 5AW6A 1RQXA 1Z4LA 2GVNA 1J2UA 5M7EA 4QU5A 4RNCA 3BULA 4YDQA 2OPHA 4DC1A 5LOVA 4YLGA 4A6EA 1JXOA 3ABIA 4DA0A 1JIXA 3IBFA 1I4EB 4K3VA 3SC2B 2CYBA 3OKPA 2P0EA 3IMEA 4UUAA 4B6FA 5LJIA 4YJFA 2LXNA 4B7AA 4EEZA 1ZW6A 2OCBA 2KWIA 2P9YA 2P62A 2VG8A 3H5NA 4BFUA 5KTRA 3SF0A 1BJKA 3AHHA 3I01M 2J4DA 4TMXA 2NZYA 3UBMA 1C30A 1Z5OA 2MR5A 3WY9A 1TYCA 3WWYA 1CUGA 4IIYA 5DJ5A 3J81k 2XRMA 3VJKA 1EVLA 4CM1A 2UKDA 5HIJA 2D4HA 1EVKA 1Q0QA 1VJ1A 1K6XA 3E58A 3SVLA 1OH6A 5BR1A 5CW1A 3FNEA 3Q3VA 5ES4B 5FJIA 2ENWA 2QPLA 1SVOA 4UMVA 4B48A 1VI2A 4WZBE 4BFVA 1N36B 1Z5WA 1P2UA 3W7AA 5B4UA 2ARKA 4BP9A 4EPRA 3HADA 4IIXA 3A6EA 1L1EA 4LMBA 1QLHA 5J5VA 1UPAA 2RGNA 3AINA 4BRSA 1R0LA 5KPDA 4A9AA 1Q0ZA 3MTJA 3D81A 1A4RA 4NG4A 3R24A 2GBCA 2AG0A 3WNVA 2FK8A 3OP4A 5EQFA 4L72A 5IT4A 5DRYA 3BM5A 3R44A 1YHYA 2P3SA 1ZUNB 1E1LA 4LYJA 4UM9D 4YT2A 1BN6A 3R0VA 5FBLB 3PJRA 1CRLA 4MIYA 4F21A 4NK5A 2A58A 2B21A 3JX9A 4K81B 2ORIA 2YMQA 3HUFA 2PY6A 1DAOA 3DA8A 3GA0A 2NZVG 3LLVA 4XFDA 4XSHA 1E8NA 4X84A 1LI5A 1PHPA 3EEBA 2AQIA 5JDCC 2PWZA 4X7PA 3KZNA 1A5BB 3LW7A 1OMOA 4BJ1A 1GZ7A 3F9CA 2B36A 3HMKA 3K8QA 3ZTTA 1BXGA 1UANA 4UXJA 2W2LD 2E6KA 1LTKA 3DZHA 3GLUA 3G0BA 1L6RA 1Q50A 3HGMA 3ORQA 3HZZA 3PWTA 4GD3Q 4J4HA 3S8MA 2D6FA 3QKUA 2EKBA 2DP4E 2QTVB 3QUAA 3MB5A 4PYQA 2CDNA 4AULA 1L7QA 2AQ8A 3K16A 1QH1B 4F60A 2Y77A 5HYVA 3IAFA 3C1OA 1M1UA 3UTCA 3D4PA 1TYEB 1K7SN 1RRKA 3DAFA 3K09A 2I2FA 4C5CA 4DV0B 2C4UA 4GZ3A 4QECA 2QV0A 1X9GA 2H5LA 4BQSA 3HI6A 1YAJA 1JR3D 3BJEA 4RC9A 2WJ3A 2WFAA 3WISA 3ZHRA 4HHEA 1OE0A 1WY7A 2C3OA 3AKYA 1UBMS 3N2EA 1JVNA 4M99A 2R1VA 1VJTA 2CVHA 2VSXA 5EMJA 3WMRA 4K6MA 4ENPA 5JCXA 4D0RA 1IHOA 4KJZA 2GN6A 1P62B 3V7NA 3HU5A 1W36B 2DXIA 2JEYA 3GFSA 1MR3F 4WKOA 3R6LA 5BV2P 1CZOA 1X1DA 2AMVA 1E7RA 2GSDA 3C7CB 1AE1A 3R0IA 3ZWYA 4DDKA 4E1AA 5AKLA 2YC2C 4RD4A 4L4RA 1IUNA 4KKXB 4TVBA 4TSKA 1I33A 3RLFA 1BJRE 1KA9H 1NMEA 2ORWA 3EGEA 1VPTA 3PX3A 1JWLA 2VF2A 2HAEA 3TYXA 4JOSA 5HX7A 2ZZNA 3V3KA 2QI9C 2R6CA 3EUAA 1T6NA 1SXHA 2REQA 4CKWB 3GLQA 2PH7A 3ZLVA 1HORA 4X90A 2EBFX 2CLFB 3E5MA 5KOHB 3E84A 3DKPA 3KPYA 4GLLA 3D1LA 5ALNA 3WL8A 4EA8A 3IEMA 2CMFA 4Q05A 3GH1A 3R4CA 1XELA 2FRDC 4MUFA 1OU0A 1CFZA 2RHRA 3RYHA 1YRQA 1MC8A 1RYNA 4NY1A 5CT6A 1TUGA 4LDNA 4CL0A 4Z4GA 2VLIA 4OLHA 3TLBA 4WDQA 2NT4A 2I1WA 2XOEA 5G1OA 4WY2A 3VUFA 3ZKWB 4WCDA 1DEAA 3LPCA 1IXKA 1R12A 4PGAA 3TQCA 3OH8A 3IQEA 1VP3A 4TKUA 2YZKA 4MS4A 4BO3A 1TUEA 3W04A 4C4SA 1P1FA 2R6ZA 5K0ZA 4G26A 1BYIA 1NE2A 1QH0A 4GWLA 1QCCA 2A5JA 4AUEA 1D5WA 2ZIEA 3ZH2A 3T3OA 4NEHB 3HB4X 3ZNQA 3MJCA 2VRWA 4I1RA 5CLFA 5IYZF 4Y9TA 5L7YA 4B84A 4FNGA 4DCSA 3B2NA 1PZHA 2XDAA 4NZ9A 1USIA 4WD3A 2V3VA 4PNHA 1LVHA 1P5FA 1NURA 4XM2A 1L5LA 1AB6A 2D3WA 4Q3EA 1SD1A 3BSSA 3CE6A 5TS2A 2CMDA 1ZUD1 4EFMA 4Q1AA 5A02A 1Z08A 4OGLA 4U1RA 4DLXA 2IYXA 4MLZA 2QV7A 4PYOA 1UKCA 1XWWA 3TGLA 1WZCA 2QRUA 1U2PA 2PMWB 2Q1YA 3CCFA 1SCNE 3PR1A 3B38A 1LV7A 1SM4A 3GRYA 2D5IA 3I09A 1UJ6A 1YCFA 3CH4B 3KLPX 4PX3A 2COUA 3DQQA 2JAPA 2BBSA 3KTAB 4MTCA 3RAEC 4CPDA 4UTRA 4PTLA 2ATCA 3ROTA 1YZNA 2AT1A 3NVMB 5FHQA 3H6GA 2C2BA 3S3TA 1FBTA 3CMCO 2VPYA 2AR7A 3PIDA 3TKAA 3OQIA 4BASA 5DV9A 2ZJ7A 1DRJA 2R84A 4M60A 4BKQA 1IBCA 2HOQA 5IKPA 2FSIA 3I32A 4X91A 4ALLA 1GRNA 3I6MA 3O21A 4CU5A 5MN4A 4JLVA 3TUZC 1OCEA 3H0CA 2INGX 4OY3A 2YWXA 3G89A 4FFBB 4V0MA 5AIAA 1UFVA 2Z3VA 4BFTA 2JFOA 4DDHA 4LXQA 1XKQA 2EJVA 4B4VA 4HYYA 1H6CA 2FAXA 1CBUA 3DH0A 3G0IA 4WFIA 5ARDA 4GG1A 4XYLA 4MVJG 2WUEA 4G0QA 1JLKA 2ZRNA 1F9EA 4QXRA 4RIEA 1ZHHA 2C4VA 3AB3A 2X76A 3NBYC 4D97A 2OD9A 4I3FA 3ZIUA 5KU7A 1HT0A 3ZV7A 4YCLA 2FX2A 4MINA 5LDDC 3LVFO 4AKEA 4M1OA 1ID8A 3TSWA 4F56A 3ESDA 4F04A 1S2IA 1DQNA 3D4IA 2DM6A 2O2GA 4KPUB 1SUPA 1O5IA 3AONB 5ERYA 4MQ6A 2GBPA 2C5AA 4GF5A 1B26A 2YIDA 3GJTA 3ELWA 3HCWA 2V7VA 3U4GA 1NLFA 4HEQA 1M6NA 5EIWA 1A98A 2DERA 3SQOA 2QE7A 2Y0EA 1MEOA 5CCDA 3GJ5A 3VO2A 1JYFA 1ZHOA 4GMKA 1JVBA 5H3LA 4N39A 1LBHA 1VG8A 1XD8A 3MD0A 3A1CA 5CM8B 5M2QA 2CKMA 3P96A 5EMKA 2Y99A 2PL1A 3JARB 5I4KA 4XM0A 4Q3BA 4A1FA 3N07A 4L5JA 3KQLA 4GR9A 1X1AA 2C59A 5DMXA 4J4BA 1EWYA 4NXNB 1RAIA 4MW1A 5HBRA 1I6LA 1H9BA 3A70A 5J1SB 1XZAA 3IPRA 2I6GA 3F6RA 1EB8A 1TQ2A 3OZIA 4AP6A 2IF2A 2ZR7A 1AIPA 2J85A 2QN2A 2XB9A 5DTMA 3QUTA 1Z38A 4MVXA 3TXYA 1JDTA 3HVRA 4DHWA 4CMGA 4IIHA 3AHCA 3RVBA 5ICSA 2DOKA 3WTBA 5IH3A 5HF5A 1RMQA 2WP0A 3H65A 1TQ8A 1II9A 4XGNA 1Q7RA 3GVHA 2BVNA 3DAGA 5D1NA 5FUQA 1SOMA 2W5UA 3W7VA 1TZ2A 5B3LA 3ZVLA 5KOYA 1DAIA 1PHRA 2AEJA 1QIKA 4I0WB 3SZUA 1DINA 3X1ZA 1IOLA 3AEYA 2OAGA 3FMIA 1X0VA 4R01A 2C2XA 3L9WA 2G6BA 3NTUA 3ZDRA 1WBDA 2ECOA 4XR4A 2PO5A 1KO7A 1PS8A 4OHRA 4F3TA 3QLEA 4BFWA 1YR7A 2PSHA 4WERA 1NF2A 2NO1A 2K2WA 1ZINA 1GZ4A 4RVFA 4EKYA 2FSVA 3QEMB 5KPJA 1COWA 3GGOA 4E88A 5KYUB 5K9ZA 1ADCA 4PLYA 4Y6GB 3OEED 3PHHA 5AIBA 8GPBA 5C0OE 5BYKA 3F5QA 2QVCA 1X7WA 2RHHA 5CPBA 1NQVA 3GRZA 4TXNA 3D0QA 4O2BB 1H3NA 2VK4A 4IHAA 3ZHXA 4MRVA 1OY1A 4DY6A 4F91B 1H4VB 3KUKA 2HIMA 1M9NA 2XT0A 5AI9A 3VSBA 1FF9A 1LI4A 3O8OA 3ILXA 4L3WA 4WMLA 3DTNA 4BWGA 1W5FA 3PJEA 3UENA 2DLCX 4KOEC 1ENYA 3WYGA 4X1YA 3R74A 2XKBA 1EDBA 1QP8A 1RYBA 2QMUA 2V5AA 3E2IA 3EZ9A 2AIRA 4LSZA 3AW8A 1JEAA 2QDXA 4RKRA 3PQ4A 5BSVA 3NTVA 3D8RA 2R60A 3A1FA 3L82B 2EEZA 4J3NA 2IHUA 3U0BA 1T26A 4R2HA 1Z5PA 2OC4A 2PQ6A 2X13A 5IG2A 5KWEA 1JBKA 5BWCA 2GBGA 3FHJA 1T0PA 4QDOA 5DM60 5FQOA 3D7SA 4GZLA 1GL9B 4MIOA 1YIDA 5GVRA 4A0RA 3HVUA 4MP6A 4MQMA 5E7QA 3T1NA 2QN7A 5JTTA 3F73A 5EAIA 1FUIA 4FOLA 3LF2A 3BRCA 1G6Q1 2NGRA 3U1TA 3QLUC 4PICA 1E1QA 1YJXA 3MJHA 3U0VA 2BELA 3OCCA 4JGGA 1ST2A 2OWEA 2P3QA 3N75A 4P7KA 1RC8A 2X5XA 3ODGA 3T4PA 3HC7A 1THZA 5AUQA 2HWXA 1PJLA 2F1IA 1P6XA 1Q3TA 3BFJA 1A1VA 4WKCA 1KPIA 2JPDA 4IWNA 1R6XA 2ADMA 1WMAA 3GUYA 3DZKA 5I7RA 4RULA 5HR5A 4OLJA 3VQTA 4MKGA 4DEYA 2ZRMA 1GPUA 2XH8A 3DP7A 4RGVA 5JYEA 1IQPA 2V3WA 3GCZA 3FDZA 1NYTA 4NCJA 5BSFA 4CTNA 2ATXA 5LWQA 3E18A 2HUNA 4RKWA 4NV1A 3OPNA 3QPBA 1UPTA 1YIOA 3KKNA 4JP8A 2VNAA 1WB6A 2BAGA 1DAGA 4XJVA 2E85A 3RSQA 4ZJPA 2IEGA 2DKOA 4B3JA 3WHIA 1TZJA 5B3AA 1SD2A 2C5SA 3T7TA 3L7IA 2XZPA 3KTFA 4D5GA 4KMSA 2ZJAA 3MOSA 2B0JA 1VB5A 3QKRB 3QU7A 4QQFA 5HUQA 2Y0DA 2J45A 2J5KA 3D3WA 5ALYA 4DLSA 4POOA 3GROA 3D1JA 5KDLA 3P0JA 2HX1A 2VHXA 4UBOA 1AMOA 3C3JA 3AK4A 3KXPA 1YRHA 2DR0A 2PD6A 4KR6A 3K32A 5JVDB 1R0CA 4O4IA 4QWWA 4XVUA 2I91A 2AI2A 3H1TA 4F97