3A0UA

Crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDLSSWAADEYVVKSFNFDELKEKVKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a0uA00
1JDNA 3UKJA 2OENG 3C6QA 3OM1A 2JVIA 4JASB 2HQOA 2PUDA 2WMYA 1ZDMA 4F06A 5KQGA 3N0WA 3LUGA 3ILHA 4RY0A 4KK4A 2FTKE 3KSMA 4ETIA 3K4HA 2QVCA 3RVOA 1ISSA 4L85A 1M5TA 3HS3A 3B2NA 5I4CA 1ZH2A 1LBHA 4DN6A 3QELA 2QVGA 1Y1LA 2ID9A 3EAFA 4MR9A 5EWLB 4WZZA 1DZ3A 5ED4A 2IYNA 3TB6A 2FSPA 3GV0A 4LDAA 2AYZA 4KPYA 3QLVC 2HQBA 2GKGA 4Q6WA 5IUNC 1ZGZA 4KQ9A 3L6UA 1M2FA 4FE7A 2FQWA 2KYRA 4JAVC 3RVQA 1P6QA 1GCAA 1SXGA 2YHAA 1JHZA 2HQRA 4MLCA 3RVKA 3KKEA 3C97A 3Q9SA 2PKXA 3O75A 1WETA 1NXPA 3HXMA 4RK7A 4G0YA 4TN5A 5IEBA 4O1HA 3IPAA 1PHRA 4W5OA 3RVSA 1FFSA 1MB0A 1A04A 2GWRA 1QMPA 5BR1A 2PUGA 2WWVD 4O1IA 4YWHA 3CNBA 2IPMA 3N0XA 1E6MA 4FE4A 4G0XA 4QYWA 3A0UA 4XFKA 4D6XA 2CHEA 2JVJA 1TMYA 4N76A 1Z15A 4XASA 4RXMA 2PUCA 3NNDA 4GPAA 1MAVA 4TLLB 4ETMA 4IMIB 4LRQA 4KZKA 3OLXA 4YV7A 1QP0A 5IEJA 4G97A 1EWVA 3O2JA 4JB2A 3JVIA 1NXVA 4N0QA 4Z9AA 4LDZA 4RU1A 5JNUA 5JS1A 4LZLA 4WT7A 1QP7A 5TQ2B 2JRLA 3EQZA 3QLTA 1VKRA 1VPWA 4NCBA 1Z16A 3LUHA 3LUCA 3H5WA 5EWMB 3W9SA 2HSGA 5EWJA 2DRIA 4CBVA 1BVHA 3FMVA 1UDRA 2WB4A 4RY9A 3A10A 3SNKA 2RJNA 4IF4A 1DG9A 4E7PA 1DCFA 4QICA 2HPHA 5TE9A 4S05A 2A9RA 3HDVA 5CNKA 3HK2A 1D5WA 1EWKA 1FFWA 4Z99A 4EYKA 3N8IA 4O5AA 1KGSA 5IBQA 3TD9A 3NHZA 2N9UA 2I6FA 2FLWA 3HDGA 1NXSA 1YMUA 3JTEA 3OMXA 1F51E 2QSJA 5FWYB 4ZMSA 4P1ZA 4LE2A 4MR7B 2V0NA 1YS7A 3MA0A 1NATA 2L18A 6ABPA 3SQNA 3TMYA 4RXTA 5JNWA 1APBA 4RK5A 1RNLA 2JBAB 2FN9A 2LPMA 1ZY2A 1GUDA 2HJ9A 3IP6A 3O1JC 4KVFA 4MS4B 1U0SY 1GLGA 1Z18A 2F8TA 1QPZA 2FXIA 3Q7TA 3FDFA 1BDIA 1LJUA 1DCMA 3H1EA 4N0PA 1YS6A 3LTEA 4EY3A 2L2QA 8ABPA 2PMCA 1JLKA 3K9CA 5IUKC 4MLDA 3FFTA 4OG2A 2PAFA 3RQIA 9ABPA 4XLTA 3CKMA 1JYFA 3HUTA 3OLWA 1YIOA 3CZ5A 1QQAA 3LUFA 5TPWA 3DLHA 2RGYA 4MQFA 2IKSA 3QELB 1EFAA 2QW1A 2R47A 4S04A 3CG4A 5B3JA 1A0OA 2AYXA 2PL9A 4MR9B 3URMA 3MF4A 4ZJPA 1JX6A 3C3KA 3O2QB 5IULC 1TJYA 3BILA 2PL1A 1YK1A 1D1QA 3HSYA 3JS5A 4MS3A 4WWHA 1KMIY 4YLEA 1DJMA 3N75A 4MR8A 3P9YA 4XXHA 3QX8A 4W5TA 1QP4A 1ISRA 1JL3A 5TQJA 1K68A 3C3MA 5JS2A 2PE5A 5KQLA 1OXKB 2RDMA 1YK0A 4OTZA 4YO7A 3HM9A 4MQEA 1CYEA 4FB4A 2RJOA 2MYTA 4UHJA 1QO0D 2JK1A 3VNBA 1PEYA 1Z26A 1A2OA 1NXOA 2FMHA 3JY6A 4QYMA 4D74A 3F7NA 1L5ZA 3O21A 5CHYA 1Z13A 2NT4A 1P6UA 3CFYA 1XHEA 3O74A 5FBKA 1MB3A 1GCGA 2QZJA 1ZGGA 3LOPA 3M9XA 3DLBA 3BREA 3H6GA 2YHBA 3GBPA 5FWXA 1DBQA 1PNTA 1ZITA 3OLYA 2F8SA 5HSGA 1JDPA 1JFSA 3HJFA 4MRMB 4TMYA 3KLNA 4B09A 4KV7A 2E4XA 3Q41A 2FEWB 3JPWA 5DTEA 3OQNA 1ZAYA 2L17A 3BRSA 3T8YA 3L49A 4Z0NA 3ILYA 3GL9A 2GX6A 3CZCA 1D2AA 3H1FA 3QEMA 4PEVA 3IP5A 4M88A 4NICA 1SD5A 4YRZA 4OLAA 1QNLA 3RVRA 4MS1A 2MSWA 1RXIA 3T95A 3KHTA 4EVRA 3KJXA 3OMWA 1U8TA 3RVPA 1W9HA 3S99A 1RZRD 5KQPA 1E6KA 3CRNA 5ABPA 2NUBA 3C3WA 3RVNA 4OATA 3T6KA 1Z2EA 2CWDA 4EGSA 3H5IA 1R8JA 2NZUG 3SY8A 4ML3A 1Z17A 2R48A 4XARA 2FMIA 3GRCA 3KTOA 4Q7EA 3LUKA 3RVLA 4RK1A 4Z4FA 4L4UA 4YCSA 4Z4EA 4YR7A 2JB9A 5F64A 3OQOA 3ROFA 2P9HA 4G0PA 5JNTA 3N53A 3GA5A 3H5LA 4Z9BA 5DGCA 2CHFA 3FGZA 3OO0A 5BRJA 3D02A 4UHKA 4IGAA 1LBIA 5JNSA 3HZHA 2PUAA 4MGEA 1HEYA 1U04A 4IRXA 1QKKA 4RY8A 1Z25A 4JA2A 3O1HB 5PNTA 2MYUA 2M98A 1ZN2A 4ZYLA 3CLKA 4HNRA 3LKBA 2ID7A 3G85A 1TVMA 3DGEC 3VNAA 2NZVG 1ZVVA 1L5YA 3G1WA 4D6YA 2ZAYA 1RXEA 4YP9A 3FFXA 1J56A 3Q15C 1LK0A 1FSPA 1YVUA 4H60A 3IDOA 1JF8A 2E4WA 4LE1A 1DRJA 3QLUC 2E4YA 4F12A 4RXUA 5TPWB 2LUOA 4MQFB 4KQCA 1I3CA 2MSLA 3HUUA 5KC8A 5KWSA 2R4QA 2A9QA 3H75A 4JOQA 1DP4A 3UUGA 3GBVA 3OM0A 2FN8A 3MIZA 6CHYA 1ZH4A 4RKQA 4MS3B 1YMVA 1JBEA 2LIVA 1B00A 4G0OA 1DBWA 1AB5A 5T3YA 2MYPA 3QLVA 3LUAA 3TO5A 1BAPA 2H3HA 1MVOA 5HQJA 1EAYA 3FFWA 2X7XA 3IPCA 3LUJA 3F6CA 1USGA 3O1IC 3A3KA 3I42A 4RSMA 1IIBA 1PUXA 4H3KB 4Q6BA 4EYQA 3JVDA 5KQMA 2E4ZA 3RVMA 2ZWMA 1S8NA 3BBLA 4MPTA 5FWXB 1TLFA 3I09A 3KS9A 5TQ0A 1D4ZA 2FMKA 4JB0A 3E3MA 4RKRA 1JFVA 3CU5A 4W5RA 1LJLA 4Z4GA 2MSKA 2QU7A 2JCGA 2QV0A 2O20A 3EGCA 3LFTA 1DC8A 2OQRA 1JWLA 1P8AA 4MR7A 5GOTA 1YTUA 4RK4A 4RK6A 5DLEA 1W25A 5E3JA 4Y9TA 1AB6A 5FBHA 4EVQA 5IX8A 4NCAA 4W5QA 3CTPA 3EJWA 3OLZA 3LMKA 4N47A 4PYRA 2L19A 3EODA 4Z4IA 3M6MD 5DCLA 4EUKA 2Q5CA 4ETNA 1NXWA 2MYNA 2VUIB 3NHMA 5JNVA 2BGGA 4RZSA 1QO0A 1JH9A 4KFCA 3QK7A 3N6VA 4G86A 4Z4CA 2LP4Y 7ABPA 1URPA 5CNJA 1P2FA 4HNSA 3OLVA 4HNQA 4P98A 3CS3A 1ABEA 4PE5B 1XWWA 3Q7RA 4GNRA 1M2EA 3D8UA 2FEKA 3I5AA 2J48A 3HCWA 3KYJB 3RH0A 2VYCA 4E7OA 1CHNA 4EVSA 2E4UA 1JYEA 1TM2A 3KYIB 5KC9A 3F73A 4IMJB 4RK0A 5IC5A 5EWJB 3O2SB 1M5UA 2TMYA 1NTRA 2IOYA 3QLUA 1DBPA 1BA2A 1F4VA 4ZMRA 3HO1A 3R0JA 4XAQA 3UK0A 2NT3A 3MMNA 5C5CA 3H6HA 3HV2A 4QPJC 3ROTA 1RZRA 4RWEA 5B3JC 1DCKA 4PZ0A 5DKFA 3RVJA 4KK3A 2FQXA 2PLNA 5HM6A 2IDMA 5BQ3A 4EYOA 4WUTA 1FFGA 1EHCA 1XHFA 5EWLA 3KLOA 4LX8A 3SM9A 4MRMA 1D1PA 4G0ZA 4TLMB 4Z4HA 3MYYA 5TPZD 3T38A 1E2BA 2FLKA 3GT7A 2GBPA 4YGXB 4KREA 1DRKA 1C4WA 1E6LA 4H3HB 2PUFA 2PUEA 2FQYA 3A0RB 3CHYA 3MQ4A 1DC7A 3F6PA 3H5VA 4G0QA 1GUBA 2CD7A 4OBBA 3I45A 3N0RA 3HEBA 2W42A 5CNMA 4RV5A 2IPNA 1OXBB 2XDYA 5JNRA 3MM4A 1SXIA 1RPJA 5TPZA 2WY2D 1K66A 4JP1A 3DZDA 1CEYA 5C5EA 2IPLA 2VK2A 3QEKA 5T7BA 1KRXA 4YS6A 1USKA 3H5TA 3KCNA 3JPYA 4G0MA 5HKOA 1PNRA 4KRFA 3E61A 3EDCA 2E4VA 5BRAA 2GI4A 5CNIA 2R25B 4WXMA 3BRQA 1NXTA 4IILA 4N41A 1H9CA 1ABFA 1USIA 3DGFC 1JFTA 4EYGA 4F8JA 3Q7SA 5TQ0B 2QXYA 4MR8B 3LUDA 1PEAA 1Z12A 3NNSA 2FVYA 4RDCA 2FEPA 3IP9A 4KMRA 5TQ2A 5GQSA 1BDHA 2PJUA 4MQEB 2WJAA 3SAJA 1SXHA 2FMFA 3QX9A 3GWGA 5EWMA 1SRRA 5IUJC 3GYBA 4RS3A 3NNNA 4MYRA 1KRWA 3EQ2A 3H1GA 3H5OA 3SG0A 1BDJA 2PUBA 4ZPJA 1FQWA 2IPAB 4KNYA 2FW0A 4NQRA 2VUHB 1U2QA 4NV3A 4WXEA 4F3TA 1T34A 5KI6A 3DBIA 4N03A 2B4AA 3CG0A 2H0AA 3KG2A 3M9WA 2A9PA 2M1ZA 3OQMA 2B1JA 4HYEA 1Z2DA 1ZHHA 3LKVA 3OO1A 1EWTA 4LE0A 4F11A 5FWYA 2WJWA 4DADA 2JVKA 3QEMB 2P4UA 4PICA 1QQBA 4DQDA 1MIHA 1ZESA 2A9OA 4OLBA 4W5NA 1VLZA 1VRVA 2LBPA 4MS1B 5D2CA 2FKAA 2JBAA 3TX6A 3IP7A 1U2PA 3HVRA 3EULA 1NY5A 4MAAA 1NXXA 3NBMA 4MS4A 1C0EA 2WRZA 2QR3A
chains in the Genus database with same CATH superfamily
3WAGA 2AMFA 1NQWA 4JBIA 4W63A 2WE7A 2QX9A 3AVPA 3B8EA 4QDXA 2I76A 5L3SA 2H2HA 3ST7A 2QAJA 2ZU6A 5J2TA 3L82B 4RY0A 3AGPA 4M89A 4JLJA 2X8BA 3GVHA 3K4HA 3NAZA 5ESDA 4JY7A 1PVDA 1WP4A 2BR4A 5THQA 4W5HA 2GN8A 4K2AA 1EFKA 4H0NA 4DN6A 1A9SA 4QD3A 1GPH1 4K1LA 4WKOA 2DLDA 4OM7A 4L4RA 5K3SA 3W8DA 3WRYC 3W7BA 5D3KA 5EIHA 3KYDA 5AJVB 1RWPA 2GKOA 4H7HA 2FPUA 5BP7A 2Q5LA 1N6IA 3OD1A 4RD0A 2GVDC 5KNDD 1CR2A 2Z4RA 3QU4A 1EP1B 2C9ZA 5HIMA 3MXTA 1ONBA 1I5OA 2UZ1A 1P61B 5K7SA 5KX5B 3D6AA 1OAOC 2VP9A 4KG7A 1NF8A 2TECE 4R40A 2H18A 1Z5GA 3JWIA 2B4RO 1QG0A 4DLRA 2I22A 3CBQA 3JVEA 1XRJA 3CIOA 4G23A 3WICA 1QRSA 5EYPB 1YACA 5IW8A 1PVOA 2Y3IA 1KH3A 1IUPA 2DP4E 4L4YA 5K0LA 4YVFA 4A0HA 4BVFA 2PKXA 1AV7A 3VH1A 4YV0A 4FD2A 2AMYA 1G0OA 5IEBA 1PHRA 4RCZA 2OBFA 1UM8A 2QW0X 1SQFA 1JXAA 3F47A 4QWMA 4AJLA 1T6ZA 1Z74A 1M74A 5CU7A 1II8B 4C5CA 2JCYA 3K09C 4N9WA 1RAGA 5FYDA 3FTFA 3OZFA 4I99A 3CR8A 3HXOA 1CQZA 3HR7A 5TS2A 3ES9A 1E6MA 2C83A 2CJPA 2PX4A 2QTNA 3RI3A 4QUDA 1OZAA 3DVAB 3IIJA 5E38A 4CKEA 4BLWA 5A4AA 1YA6A 2ZVDA 4PNPA 4N76A 2WZCA 5JEEA 2IDKA 4A4DA 1MD9A 3QVKA 3ZZNA 3WNBA 3ZCPA 4ZI5A 1YRQA 1U80A 1S9HA 1XZMA 1ZHFA 3OFVA 3SXJA 2V96A 2HCRA 5JI3E 3ZGNA 4Q1VA 4YDHB 3ESYA 1E7MA 1H2EA 4B83A 3DDSA 5EJ4A 1K7CA 2VNJA 2O8CA 3ADKA 2BJWA 3FCAA 4FVTA 2VYNA 1UPTA 5JDCC 1I5EA 4PC2A 1OKKA 5C4GB 1EFDN 4WN9A 5IVDA 3S5UA 3QG1A 3SNKA 2PU5A 2WUWE 2P69A 4XJSA 3BIOA 4S05A 2RG1A 4OXXA 1PJ8A 2CLFB 2QLMA 3NTLA 4UDXX 1HT0A 1MDBA 2C1EA 3OM8A 4NCNA 5AKHA 1GSOA 5DVZA 5FTMA 3PHHA 4X1YB 1YTLA 2A58A 3QVMA 1N9GA 2I6QA 4KYTA 4JMLA 4D8XA 3BD6A 4OSEA 5EMKA 2QSJA 1IJKA 1WUJS 2BSAA 1PDOA 1PZXA 1AZLA 2R8RA 5DLDA 2M6LA 3TL6A 3ANLA 1WW2A 3MA0A 3GAFA 5G0VA 3V46A 2PKQO 3WL7A 2DHRA 1DLJA 1WXXA 1EE1A 2V97A 3SQNA 3U3DA 4AP5A 4DMMA 1KP9A 1ANKA 5KYKA 5LC1A 2DQZA 2JASA 2NV2B 2EJTA 4LVOA 2VH5R 3N1UA 5CIQA 2VVTA 3HU2A 2BISA 1QPZA 4XM0A 2PLFA 3X1KA 1GM5A 5BY2A 3KB8A 2FQ1A 1UMDA 5KNBA 3D2LA 1G8KA 4KDFA 5LBUA 3B78A 2I4IA 3TD2A 1MZVA 4OQNA 2B4TO 3Q85A 4XLLA 4OUDB 2O07A 4AG5A 4C1NA 2R8EA 4FR5A 2Z3WA 1ZK0A 3IO3A 4TTVA 4JJAA 2I6TA 5IUKC 3W7VA 2HU5A 4LJAA 4J7CA 2RONA 1G6OA 2ZAOA 3EZXA 2I6GA 4WOCA 3AR7A 4FC6A 3OFSA 4XLTA 3TZHA 4YR9A 2GTHA 4KIFA 5HKKA 4BMDA 1JR3D 2IT1A 3BMQA 4CLRA 1H5NA 1V43A 3S3TA 1UPUA 3IQDB 4LI0A 4QOGA 1E2LA 4LYDA 5KCMA 1BWQA 4BNDA 3FBWA 3PYLA 1V5WA 3R7FA 4E14A 1XCLA 2JBHA 3F3KA 3HSYA 2V4MA 1MQ9A 1U3VA 1TAUA 5AJZA 1NOJA 3OESA 2C5AA 5FI3A 2Q3DA 2EJUA 5CDHA 3KETA 4J6FA 1FDOA 1X8JA 3Q6IA 4QBGB 5L7YA 1YF3A 2EW8A 4R0VA 3AHDA 1UK6A 1PJCA 4WVLA 2BM1A 4BNVA 4A5OA 1RAHA 1PJAA 1CZHA 3C3CA 1DSSG 1A2OA 3JY6A 1T1SA 2Y27A 1DC4A 1T2VA 2J4FA 2GM9A 5FBKA 4BO0A 1UXIA 3SHTA 1SWWA 1IXKA 3IT2A 3E82A 4R4JA 1XAJA 4BUCA 4LOLA 4JI2B 2OR3A 5FULA 1GARA 1DIOB 3EQ9A 1V5IA 2R60A 2XMDA 3HKEA 4F9TA 4IR7A 3PLNA 1FOEB 2AR7A 1F2VA 4TMYA 1HQKA 1W59A 3PUZA 3E84A 4M1ZA 4DBVO 2VWPA 1HYQA 1P7CA 1UBGA 3FYUA 1ZJ6A 3RUPA 1ZGCA 1H6AA 1O8BA 3OTWA 1ZW6A 5ANRB 3WQRA 2YOGA 1GG5A 1RRCA 3CUKA 1QNLA 3D2CA 4F2PA 4GP6A 4FGUA 2H17A 3OEHD 1AT1A 3E5NA 3T95A 2VDRB 1RLMA 4RKFA 3KELA 3SIWA 1H8EA 4O8ZA 1XPOA 2JAXA 1U8TA 3FYSA 5TEVA 3ZZMA 1AKTA 4U7GA 4ZO8A 2OWDA 1FLAA 3CRNA 5FNVF 2FXVA 3GFFA 1R6VA 5A5VA 4RIEA 2RGCA 1X87A 2CJWB 3QYPA 1YQDA 4D7AA 2JFVA 5DHSA 1WXEA 3ESAA 1LUAA 3BTSA 5JH7B 2ZRCA 5K2OA 2R48A 4LDPA 1G41A 3EUWA 3NVDA 1E2NA 2PPLA 3N74A 3ROXA 4K81B 4DUGD 4URYR 2RCYA 2H0QA 1Z5UA 4ARVA 1XZQA 4YR7A 3MAAC 1YASA 1BE8A 2PV0A 1QS0A 2EZ4A 2VKQA 1EEXB 2WKQA 3DE3X 3Q3GE 3CB2A 2HRQA 4M36A 4YV1A 4HO1X 4TZ0A 3BFKA 5F1YA 1E99A 4N6NA 1RM0A 2F3UA 4U2KA 2PTHA 1JU4A 1O6BA 1WUKS 1NNUA 1M72A 1QBGA 3L8HA 2PT7A 3AF1A 5GGXA 4FKZA 4RVFA 4GKKB 2ZTSA 3D02A 1E9FA 4J75A 4IJWA 5TGZA 1HSOA 2HCJB 1LQ2A 2HTFA 5D7BA 1ORIA 4QAQA 3D6HA 4BNTA 1P60A 2QRVA 3D3QA 3X1XA 1VKOA 4BFTA 4M9CA 3MCAA 4YQEA 4HLNA 4PR0A 4EHKA 1E2FA 4I4NA 3G9UA 4CV2A 1UBKS 1Z4NA 4DRXA 2QIPA 1U3TA 2LZ0A 2G17A 3RKUA 5BN4A 1RRKA 1I32A 1IFXA 1YONA 3H8SA 1P81A 3MAJA 1ZNQO 2WJJA 5E95A 4LA4A 1R4NA 4WXPA 3G1WA 3DO6A 3KFVA 3SICE 3ZZUA 1A1VA 1QRTA 3B3GA 2A88A 4KO2S 1H2XA 5EIBC 4RPHA 1QOPB 2BLLA 3RJ9A 4JVMA 3CINA 2D0OB 1I94B 4V1CI 3G7SA 3GUYA 4XWGA 1N5MA 5HDQA 5HTOA 3ZBQA 1XDZA 3E8SA 1DG1G 4GPEA 1PLJA 4O2RA 3VHXB 3H4VA 5GJWC 1JSZA 3ZGLA 3TEMA 3WLMA 3H75A 4IXTA 2FWRA 3E58A 2G9NA 2I8LA 3GPCA 2WJHA 4MUEA 2JJ1D 2TYSB 4HXGA 3O95A 3T5BA 3SBEA 4V1CB 5E1MA 2D00A 4BNXA 2HBQA 3G2MA 5FKJA 3NBQA 4UM5A 4LXHA 4M6WA 9MHTA 3DLAA 3NIFB 5JTUA 2JLCA 1G1MA 2R5NA 3GY0A 3T35A 3U7RA 5BYKA 5LD2B 1RWVA 4HRYA 5FA8A 4A91A 3QSGA 4AO6A 4KACA 2DFDA 2R11A 4LV5B 5KQMA 3L4SO 3IVCA 2CW5A 1JB1A 1P19A 1X7YB 1NLMA 3GLUA 3TOXA 1KJZA 1H2ZA 1VJGA 2HZ7A 4TV9F 4L7QA 2CB0A 4Z0HO 5JANA 5DP2A 3HEAA 3I09A 1U7UA 4TT3A 3CWZA 1WU8A 3NRJA 3IE2A 2VF8A 2JIQA 1VBKA 1U3CA 3FD8A 1TCAA 2QLJA 3K1TA 3R44A 4FYIA 4UNPA 3VNQA 2JZNA 5AI8A 4DCOA 1J1ZA 2YMLA 4WOKA 4X9XA 3FSEA 3TKLA 2H1IA 4JU8A 4MR7A 5ECGC 4IBOA 2QXUA 5EP4A 1PV4A 2JCVA 1FSGA 1PT8A 1W34A 1M0EA 4D0SA 2P9JA 2Z56A 1QO7A 1GLVA 3IJRA 5CJJA 1N36B 2G5PA 2Q3CA 2WKWA 4N47A 5HZMA 3GJ7A 4HCJA 5FOVA 1H2WA 2L19A 4YJ2B 3SS8A 5K4AA 5B30A 2I87A 5DCLA 1JHQA 3DLIA 4CQLA 5CH3A 3DCJA 3T1HB 2REOA 2AEMA 1SXJE 1XYYA 1YDFA 3MFYA 3AIOA 4FOPA 3ENNA 5F1KA 3TBKA 5DLYA 2GK6A 4DLZA 2JGNA 5FL7D 1KAOA 1GNRA 3OPYI 5EHZA 2WG1A 3ZWNA 4H6WA 3OU7A 2WFAA 3I92A 2QP9X 7ABPA 1BWSA 4DYHA 5GZ3A 1UWKA 2P9EA 2JLAA 1G4UR 2RGXA 4X8OA 2RCNA 4ND3A 4PE5B 2Q1TA 4XVUA 1Y42X 2BBTA 1X80B 4JH0A 3RKRA 3C98A 3U40A 1U0JA 1WUIS 2ZBFA 2JFOA 3KYJB 3OPYB 4Q05A 3TIFA 2OBMA 3K30A 3L18A 3SKXA 2BFEA 4D3YA 1P1IA 4XIFA 3H0KA 4RIFA 5DPMA 4AKTA 3ASZA 1CY2A 1UPXA 3IUPA 2Z3ZA 1GT6A 3AUTA 3A25A 1OC4A 5JJ5A 1GP2A 1RZUA 3T4PA 4KR9A 1CUEA 2YDYA 5I3CA 5KDOA 5I7AA 1T2AA 2R1TA 3P9NA 3U4GA 3L7BA 5JXWA 3HO1A 4LHEA 3QU5A 4DAOA 5AKXA 1XMJA 2B5WA 1GZVA 2W2NA 2WSSD 2WJPA 3DFMA 3LT5A 4AY6A 3CNLA 1HNXB 2FEXA 2IXAA 5MN5A 3WQHA 1WPGA 3HJUA 4RWEA 1UBJS 3T34A 2C4TA 2PLNA 3JAWB 3NS7A 4YMIA 5BQ3A 1EJ6A 2F1KA 3K1AB 3I04M 4XSHA 1E7WA 3LLCA 3P19A 3MZ0A 1VMEA 1HT1E 3VBCA 2HJSA 3EQ7A 3RRZA 1CEXA 2B20A 2V7BA 2AQ8A 2YJ6A 4FYHA 3T38A 1JG2A 2ZSEA 4OL9A 2NPOA 2ZQYA 4H31A 4MV4A 2UU9B 1WXDA 4YK7A 3LCUA 1FCJA 3EXEA 3HA3A 4C2UA 4N0MA 4ZYZA 1M34B 4BVJA 3IVAA 1UOPA 4HPJB 2Y1WA 1Z3IX 4MI6A 4AZSA 1Z82A 2M2IA 1TVKB 5F5XA 3A1TA 4UCQA 3IRVA 3HWX1 3OJXA 2QW8A 1K66A 2OGTA 4JP1A 3JWJA 1N92A 2R1ZA 3BIJA 2MSCB 2X0KA 2FWJA 4UBOA 4F3NA 3IGFA 1FP2A 4HLUC 4Y2YA 2IV7A 4BMZA 2V55B 2FH5B 4MW0A 4RYLA 1G55A 3KM0A 1E66A 5C32A 3CCCA 2RAUA 3EDCA 1ILEA 2BGUA 4D44A 2XD4A 3EFBA 3O7WA 5AKGA 5K2MA 2YIMA 3PXGA 1XRSB 3JYOA 5KYXB 3VH2A 4RD1A 1C8KA 1F0YA 2DVMA 4LZAA 2CV2A 4N41A 1RI2A 3KSRA 1GYQA 3H17A 3PQCA 4YJDA 4EYGA 4ZYYA 5JIBA 3Q7SA 4MW7A 3FX2A 2FN4A 3GQBA 5IH7A 1FL9A 1NI4B 1XZFA 3DFUA 3LP6A 2II6A 2EKQA 2EP7A 1RM3A 5IKMA 4JLSA 4EPTA 2Q0QA 2PAAA 1Y1TA 2WJAA 5LXTF 1GD1O 3U3XA 1W2GA 3RRXA 2OUIA 1TKCA 3E2IA 3G68A 5K3BA 3AO0B 2A84A 3M4NA 3PLRA 1MV5A 3S1SA 4OMFG 5YASA 3JQ8B 4CCWA 4NZPA 4H15A 5KJFA 2C04A 2XWPA 2FW0A 1UP4A 1Q77A 2VUHB 3JATB 2PBZA 1IYZA 4AB1A 4HDNA 3ZY5A 4C4SA 4DLBA 4I1UA 1CVRA 3ET4A 3AERB 3LHFA 1P7WA 1MF7A 3OO1A 3W6ZA 1QH8A 3BAFA 4UTOA 4QGBA 1KXZA 4TXHA 5M5BA 1RM4A 5EXDA 4DADA 3S8EA 1E1RA 2ONCA 5BN3B 4GAEA 1L1RA 4ITRC 4EG5A 1XAGA 1FMLA 1FP6A 2P4UA 3OEYA 1IZZA 4W5NA 2WU0A 3GLHE 1J8YF 1ZM7A 3K96A 3OOHA 2GGSA 4HQRA 3EVDA 3ROPA 5BMVB 3IESA 1ZH0A 2OLKA 1J0AA 1E0KA 4Q4AB 3OCUA 2WNHA 4KIJA 3OG9A 4JJFA 2RHOA 1EGMB 3JSAA 2YV2A 3KOMA 1M83A 3JVVA 4IZIA 5F5LA 1FFEA 2X13A 4XI9A 2NU7A 4UUBA 3HCDA 4MJLA 2C9CA 3GFVA 4JWKA 1USVA 5DHTA 1GZ4A 4C7KA 4PNEA 4BTVA 4KTVE 5ER6A 5KYUA 3WK4A 5ALNA 3IC5A 2FR0A 5LU8A 2UVQA 1I1QB 2JG3A 2CUKA 3G2JA 2WF6A 1BX1A 1AUPA 3ZY3A 4CM9D 1XTIA 5I01A 5H9WA 1G8PA 3VDMA 4R7ZA 1Y1LA 2X9GA 4B82A 3P0JA 3PPVA 1O9HA 3EAFA 4I3GA 2R6R1 1D2MA 5ECDA 4F84A 2XJ9A 1IPEA 3GLHB 4AI6A 1KR2A 3ENWA 2EDCA 5J47A 3GJTA 4KPYA 4TUYA 2H5IA 5EG5A 1O08A 3RADC 3MGKA 1OR8A 1YOVB 4YT8A 4HZGA 5JS7A 1CDZA 4EB3A 4R7GA 5IJ9B 1WBDA 2JLQA 4UM7A 1A5AB 2C0PA 3HBAA 3TOZA 2GDZA 1HDRA 2AHRA 4QU5A 3HRIA 5CDYA 1E60A 4JAVC 1HH4A 2H11A 4D4MA 1RPZA 3C3BA 3WMGA 2H2DA 2QE7D 2YL2A 3PUVA 3PVCA 4OFZA 3MK31 1INLA 3NH9A 1QF6A 3EH2A 4KH0A 5I7HA 2OVBA 1E58A 5KX5F 1WETA 4WKGA 4PV7A 4ZXPA 4DB2A 3UVEA 4IDHA 1GAEO 3ZE9A 4RPGA 3DTNA 2H5JA 2IODA 1SWVA 2GZ1A 2EC5A 2BGTA 4OCZA 4S1TA 3ZWVA 2PUGA 4DCPA 1M3SA 3JW8A 2XW6A 3KQUA 5JAUA 4YWHA 3CNBA 4M1KA 3RU9A 3DZJA 2YJTD 2BY4A 1FPMA 4BBZA 3BK1A 3G88A 2C42A 5JARA 3EXHB 1A98A 2HLNA 3A0UA 3PKZA 3LY5A 1G5FA 2GO7A 4RPJA 5AOBA 1T2CA 5FRDA 4D6XA 4NYJQ 3R5KA 3Q7EA 2B1QA 1GRNA 4LRQA 5EQDA 4MKHA 1PR0A 4GC5A 4OB8A 2B8JA 2E85A 2V9CA 4C4XA 3GUVA 3KO8A 3CA8A 4MV7A 3NC1C 3DD1A 2A3NA 4IGFA 1AKWA 3MWYW 1H2FA 3SEFA 1MX5A 3AV0B 3EEQA 1W49A 3RASA 1VKRA 3VR2D 4YMUA 1VPWA 3PDHA 1KVQA 4MVJD 1YJ5A 4WK6A 1JZSA 4YJ3B 4YASA 4YMWA 3LX4A 1N5DA 1TLTA 1Z45A 1M1YA 2HMYB 2PL5A 1T26A 1QORA 2WB4A 1P0IA 3FKSD 1OW3B 3OICA 4AG3A 1SHZA 2AFHA 4IJUA 3SSAA 1MJNA 1B73A 1XD2A 4URFA 3W9UA 1QDLB 2CYBA 2W6ZA 4IJ5A 4E09A 1TCBA 5F52A 2BVNA 1UEIA 1WDLA 4PHFA 3W9BA 1EM6A 1KQFA 4DCCA 4Z99A 2VK1A 3QVLA 1M8PA 4ILEA 4GR9A 1I5RA 2JGDA 5FUXA 1X9IA 4FFBB 4LOHA 1P1FA 4Y6RA 1Q1ZA 4HN9A 3TD9A 3TE6A 4YRQA 3ENKA 4MIEA 1AY0A 3OMXA 1NXSA 2XAAA 3UHAA 4BMXA 4P36A 4F92B 4OQEA 5FWYB 2G4LA 1WF3A 4FT4A 5D3MA 2EP5A 2XTMA 3G9XA 1U5CA 4C4PA 4YIHA 4J0FA 3G5UA 4TKZA 1N7GA 4REMA 4FX5A 1RRFA 3QLJA 2J5KA 1JQBA 3ZXYA 1GDDA 2VWHA 5J1TB 1NJ2A 1OZHA 1CEQA 2NUAA 2IQ5A 2R97A 3CO0S 2FUEA 3KQKA 3WRYA 1K08A 3CVOA 1GLGA 2JIRA 3WK7A 2ATVA 2E9SA 2FPGB 1G7RA 2NTEA 3FUTA 3PQ4A 4ACBA 2QK4A 3BJEA 4AQDA 4NH4A 2ANCA 5B3AA 1X8XA 1SOUA 1U3DA 3GEGA 1QRAA 1TJNA 1VE9A 3S28A 3K9CA 4B0PA 5HUJA 5KPJA 1USWA 2BI8A 3VJKA 1O97C 1UZMA 3CKMA 4CEHA 2FI1A 5FPSA 2PLWA 4J6EA 1JAYA 5G0SA 4QTUB 2QW1A 5TDHA 3ZW8A 3FYDA 1OTHA 3I12A 1Q1NA 2XX3A 4LDNA 4M8KA 2ZJ4A 3ZCSA 3EXIB 1JX6A 3A4LA 2P0YA 1TJYA 4PW0A 5HZGA 2CNKA 1PWXA 2P2SA 1E7RA 4KN6A 4MS3A 3PGKA 4YCAA 3RUDA 3N75A 4UBJA 3QI2A 4IPTA 3BB4A 5MDHA 2AI3A 1BU5A 1P5HA 1WCIA 4ZDJA 1Z7YA 1RKUA 2YZ2A 4WKPA 3WG9A 2QRMA 3WFIA 2QTHA 5JQWA 1J2RA 5KOJB 3HM9A 5JLJA 2GHQA 3GOQA 2Y0PA 4A6PA 2PZBA 5SYMA 5ES4B 5I4KA 5AI9A 1X1DA 1E1QA 1LI5A 2C5FA 5DT9A 4TOIA 4C6HA 2NT4A 4DHEA 1WHSB 1CX9B 2RKWA 1UBNA 5JQGB 4RD3A 3S0JA 1ZITA 3DNPA 4D3XA 1K8XB 2C00A 1LK7A 3AUXA 1JDPA 5E6RB 4ZVNA 1SVNA 1DOZA 2QD2A 3PWTA 3T52A 4RIGA 3ZHXA 2P40A 4KV7A 4R7TA 2V7QD 4JI5B 3UJPA 1EFHA 2NUTA 2OGUA 1DARA 5DNCA 5AXCA 2RGDA 2HPVA 3EXAA 3HDYA 3OSZA 1DEXA 5JDCA 3JQGA 5DV9A 3SVLA 1AO3A 1CY6A 3RV3A 5TS3A 5BN1A 3T9CA 1CUFA 5IJXA 2W71A 2C5SA 3PWSA 3DM9B 4LQDA 3ZV6A 2CF5A 3AQ4A 3GOHA 1TM4E 3OWHA 1UBHS 4PM4A 3N28A 1E5QA 4PGHA 1O96A 3TOCA 1BEUB 3AR8A 3L02A 1IAVA 2DBQA 4ZHQB 4GI1A 2FW9A 1ZVKA 4Z2AA 1NJFA 3T5TA 3QRWA 5DYWA 1B8VA 1GXSB 4S3MA 3HKDA 1K98A 1UMCB 1BRTA 3BH6A 5E6SB 3C3WA 3VKGA 1KIMA 2SNIE 2W8ZA 1SPBS 2A92A 1KYVA 1NRJB 3ASVA 4S35A 4ER0A 4TL8A 4RE6A 3MBKA 1NBMA 2CMDA 3B1VA 3WKDA 2G25A 4NMHA 2FMIA 2R7LA 2D7CA 3KSUA 5M3BA 1LQUA 5FCDA 1G98A 4JXKA 3STUA 1JJ7A 2EKPA 3MT7A 1IN5A 3R5FA 4RK1A 1L5VA 1KDTA 3RNOA 4TTQA 3SQMA 4A1FA 4DSZA 1U7ZA 3HDHA 3I28A 2ZVPX 1U0OC 3GVCA 5L3ZA 5F1PA 5I8WA 5JH7F 2YUTA 1XMOB 3FCYA 2WYHA 3SR0A 1NHWA 1T6NA 4UVGA 1L7VC 2Y71A 4MW4A 3ZVMA 2R6DA 3AWDA 2JNWA 4XFJA 3KUXA 1Y37A 3T3MB 3O93A 4B73A 4RFSB 6REQA 2WA1A 3CPJB 4HVLA 4KLRA 2RMKA 4JA2A 4MA5A 5IJAA 2G1KA 3FPLA 3ZD7A 3KOWA 5DYTA 4E31A 1UJ2A 4RQBA 1LNZA 3UIEA 1WSWA 2I8CA 5HMLA 3BA6A 3GNTA 2XT9A 3G85A 4F5ZA 1AUVA 2IV2X 3LWZA 4RELA 4Z3KA 1WX1A 5JXHA 2CGEA 5KTRA 4R8LA 2BFFB 3U19A 3MCZA 2J08A 3TE7A 3QPAA 2I7VA 2DQYA 3GJZA 2GNOA 1P29A 1GKLA 1MW9X 3AW9A 5K0GA 1QGED 3KJQA 4LPSA 2AOUA 1JQ3A 2NO4A 4BMSA 3MHTA 5REQB 3HVHA 4MWSA 1I3LA 3O47A 4JOQA 1DEOA 3UWDA 3DE1X 1AHNA 2Q8QA 4MYDA 1P7YA 2H7CA 2GOYA 1L7AA 3KQYA 1RXSA 4BJ5A 5LQNA 3EBOA 1LSOA 2OY0A 4JJ7A 2Z2ZA 1DBWA 3WNQA 3D0RA 5DHRA 3PHJA 1BX3A 5A9SB 1NG9A 4HAZA 3QF4B 2J0UB 3U9LA 2NXEA 2HMSA 3WZLA 3AVOA 4O4LA 2E5LB 4P4NA 1JG3A 4MUYA 1PG5A 1Q5PA 3A7DA 1WSBA 5AUQA 5AK3A 4JJ4A 1FFYA 1Y7IA 2V5VA 4IYRA 1IIBA 3UH1A 1DU4A 2CNWD 3GDHA 3NM5A 3C7CB 1ZRMA 3ZEIA 4AJ1A 2PSSA 3WL5A 5AVUA 1RPTA 1EZ4A 2HMVA 4KL8S 3M6VA 4ABTA 2WTXA 2AG1A 1KKUA 4KQHA 4UPVA 4CF3A 4EL0A 2VEDA 1U3WA 3C74A 4W5RA 1TOAA 1OWOA 1X0XA 3DL7A 5AW8A 5AI5A 1AZTA 1V1JA 4K9RA 4Q24A 3U48A 1ZEMA 1ZUNA 1EXDA 1V37A 3UZUA 1C3VA 2OBBA 3OJ0A 2YRFA 1GT91 1L6RA 2C5EA 4DEYA 3KKQA 1JIJA 2BM8A 5IT5A 1M6HA 3OLZA 5ALTA 2WT9A 3FGNA 1I1OA 1PJRA 1SUBA 3LMKA 3N70A 3ND9A 3T4EA 1K63A 1MO3A 1UKVY 4GNKA 4B33A 4CQMD 1J49A 2NO1A 4AJEA 1XF1A 3L0SA 1MW8X 1LX7A 3OQVA 4RZSA 4Y6QA 3ZDBA 1XNJA 4ZAWA 3A4NA 4EKGA 1DIBA 4Y18A 2VWQA 3WNZA 2RGRA 5LP6A 4Y9UA 2IYFA 2OG2A 2BP7B 2BBOA 5CNJA 4YJ2F 5HR5A 2YOFA 1PGNA 2G1PA 1ZD1A 1E2QA 3OTHA 1LDBA 2BMVA 3FNQA 2NYRA 1U8UA 3HJGA 1ZFNA 4ZEWA 2XZOA 3DE7X 4GNRA 3MVEA 2REQB 4PHGA 3VX4A 3CSUA 4CM8A 3TXYA 2Z09A 2Q6IA 4HS4A 1PJLA 3AR9A 3PKJA 1A5TA 1EMDA 2H2FA 4RQTA 4ATNA 3R5SA 1L0BA 4IOJA 5C1DA 1Y98A 3U6KA 1LDYA 2VNSA 5G3YA 5KTYA 4NOKA 3BSYA 3QJGA 3DD5A 4CHTA 2G07A 3U4MA 1ORVA 3SF8B 1HFEL 3TL3A 3GROA 1S2NA 2A1IA 4HAXA 1JMVA 3K9QO 4R2KA 1Q11A 3IT0A 3W90A 4KHPB 1HM5A 3GRAA 3DTTA 3ROTA 3TLKA 4MX8A 5BR4A 2REBA 1L4MA 5K8VA 5TF0A 4UTPA 4C6TA 3KQMA 1YR8A 4JHLA 1JTFA 1JGTA 1RXYA 1MJGA 2G1AA 2WF7A 4NPAA 4KW7A 4C03A 4E32A 1POWA 3V1KA 1SFRA 5JHGB 1SD1A 4HWOA 4NATA 3DL4A 4QBFA 4EEXA 2GZMA 3DP7A 3IUQA 2Q6LA 1DC5A 3HP7A 3OZAA 5A03A 3PJRA 4PZEA 2QQ5A 3GT7A 1L5KA 1N2JA 2HDWA 4GFDA 4I3FA 1O94D 4L1KA 5DBHX 2ONJA 4KREA 5JJLA 2PD6A 4P93A 5KMGA 2I2XB 3MAGA 1Q91A 2CDNA 3ZNNA 3IKJA 3L7DA 1V11A 2Y1FA 4IIUA 4Y6LA 1RWBA 2C1ZA 2CBZA 2GVNA 4YJHA 5FWNA 5BXYA 1OI7A 2ZZNA 1CUVA 4YRFA 3FOZA 1MMFB 4YACA 1G2OA 2GVZC 4KO3S 3HCEA 3LPAA 1LS6A 1IOVA 3I8SA 3ML1A 4LNAA 5EUBA 2QTBA 4PSCA 4BNLA 3NEYA 4NCKA 1QGAA 2I6XA 1C3XA 2W6IA 3DZDA 4HV4A 1HKHA 1KYXA 2IPLA 4EMBA 6ADHA 1EFCA 1NVWQ 2RK6A 3PFFA 1CPYA 3T3GA 1QX3A 1JEQA 3AEQA 3VU3A 2J7PA 5L53A 4NPCA 5EIFA 3MTBA 5JBQA 2XEXA 1ISJA 5IM5A 4K6OA 4D81A 1ZS9A 1V8ZA 5AW6A 4FM9A 3BMOB 1PS9A 3OT1B 4FCCA 4QG7A 4WY2A 3RR2A 2FYTA 3W6UA 2GNPA 4L0CA 4B4WA 4BX3A 4CW7A 1T36B 4NL4H 5FEMA 4P4GA 4B80A 1I7SB 1XL1A 4KJXA 4Z7NB 4OF4A 2XRMA 2G5CA 5B57C 5JC8A 2BCJQ 4RDCA 4D02A 5GJVC 4CTNA 3FZNA 3AI2A 2H0RA 4DW8A 1QJ4A 3DV0A 5LMZA 3UV3A 1H6BA 3LQ4A 4R68A 2JFXA 3L7KA 4Q3KA 1EJBA 3G79A 1E3SA 3UG6A 1PI3A 1UBCA 2ONYA 3FCEA 3WL8A 2V7PA 4G07A 4DBLC 2IHNA 5EP3A 5L3RA 3MJ4A 4DIUA 4B74A 4FQ8A 3ABRB 4ZPJA 4POOA 1A8PA 1Y3FE 2FV8A 2W48A 3NAMA 1DRWA 2IPAB 3O9VA 1RWKA 1N7IA 4IZ6A 1KF0A 1YKSA 2BJVA 1LNSA 4RTLA 1GIAA 3A06A 1QHIA 2VDOB 1BMDA 3ONNA 2DWQA 2E7ZA 3A1CA 3MIIA 4O2BB 4IIFA 1N9KA 2E5WA 3AH8A 3WBJA 4DDHA 4L07A 1ADJA 3ANYB 1EVEA 3MMSA 5CT5A 2QSYA 2Q99A 5H5JA 4EY7A 4BU1A 1SXPA 4I2VA 3FTEA 1AM4D 1EVJA 1T2EA 3P8ZA 1VJDA 1DB3A 1NMYA 5DH9A 2EQBA 5GWXA 3W8NA 1CV2A 1EYZA 4LXYA 3U1BA 2H4HA 2NTJA 1ZC4A 2RI0A 2J8ZA 1GKKA 3ELWA 4MKRA 3UCXA 5FOSA 4WI1A 3UMYA 3C6QA 3VZDA 4GXTA 4NFSA 4OQXA 1Z5VA 3U4IA 1MFZA 1EK2A 4ZVLA 2XF2A 3AFNA 1EXVA 2CCJA 3I72A 1XFDA 1XA0A 3HWRA 1Z6GA 2WP8J 3KB6A 1N5LA 5ALJA 2UVPA 4EMTA 1XN1A 2W6JD 3TMAA 1G17A 3CRW1 3NFYA 1RRGA 3TNJA 1Z5NA 4Q9HA 4C87A 3VKHA 1GHTA 3B2NA 2CFSA 1RFGE 5LIRA 3V8PA 3VSDA 2DFLA 2Q4OA 4D9JA 1B2RA 1NF2A 1UODA 1U2DC 1HPLA 3L0YA 4MR9A 1J1IA 1PV1A 5EWLB 3V33A 5K3FA 1TM7E 4F1JA 1RHMA 4C1BA 1KOFA 1ADBA 2QN3A 4JLVA 4HLUA 5K0TA 1E3QA 2BEUA 2GA8A 5DYNA 2WABA 2FE1A 1KK3A 4KP7A 2OC9A 3EIFA 2FQWA 4PCUA 3BXXA 4CIAA 3BUSA 3OIFA 1KDRA 2GPSA 3L3BA 5IBRA 4EUFA 2MT9A 2NUPA 1QRRA 3G2KA 2OPBA 2F1HA 1IEQA 2QBYA 1QFZA 1BCRA 2W6MA 3EHDA 4MLCA 1JHZA 4N7MA 2XGSA 5DHPA 5LKRA 3FE2A 3B1KA 1C0IA 1ML4A 1AURA 1QHHB 4WW0A 1O0CA 2XVAA 3WB2A 1JI0A 4G0YA 1M2WA 3RLFA 3TTWA 2OAP1 3IPAA 5DBOA 4ZAXA 2F90A 4BVAA 3HO6A 1CY0A 1J20A 3LS2A 4LQLA 2GRAA 4R01A 3T1QA 7AT1A 3C3PA 1EFLA 4DDKA 4YY3B 2IIBA 2J33A 4O1IA 4XM2A 4CG0A 1H66A 2YN0A 2FFBA 5ALEA 3U13A 4DGQA 3D4OA 3N0XA 2HKIA 5DIZA 4ZJYA 5HIAA 1Q84A 1FIUA 1DEAA 3GXBA 4BGDA 4LK3A 4ES6A 3UC5A 2D0IA 1MAVA 3EVBA 1JMYA 4TLLB 2QZ4A 2XQFA 1LD3A 1R0KA 1TDJA 3TKYA 3UHFA 4NMMA 4YMTA 1JEDA 1K2VN 3EG9A 1QP0A 4JQCA 1RD4A 3CZRA 4I4TB 4TMKA 5AXAA 1T8TA 5JS1A 2FUG1 4HJRA 5D6OA 1UPCA 1QP7A 1P8JA 4GX1A 3DQQA 1VIAA 2MMCA 2GAAA 4M1QA 3LUCA 1CRQA 1DC6A 2HSGA 1W47A 1YB6A 3IKTA 5G4KB 2I03A 1I4TD 1L4BA 3QW4B 5CK4A 3HLTA 2IELA 1VKNA 3MJSA 3WSTA 3QWBA 2P5YA 2XHZA 4Q47A 1NMZA 2V03A 1O7JA 2QWXA 3KOUA 5AOAA 2L82A 2PT6A 5JEDA 2HBZA 1WY5A 3M3DA 1YHZA 4YJ3F 3WLEA 2D7JA 3P0EA 3R8CA 3BK7A 1LPPA 2IY9A 2OAEA 2XYRA 3G0BA 4XWTA 3EGDB 3PG5A 1XZAA 3P71T 3JASA 2OG1A 1D03A 4YRDA 1VFNA 2QENA 3R3WA 1YS7A 2BFOA 5AW9A 2JH8A 4KOAA 4R8VA 1F48A 2JAQA 4PFKA 4UBKA 2BGRA 5BQPA 4OHOA 3SU8A 4E12A 3EY9A 4Y2SA 3ZIAA 5KTTA 1CQIB 4DMFA 2NACA 3EZYA 4QRHA 3IP6A 3CNNA 3JAMA 2WD8A 4BO6A 1EX7A 3UOWA 1DWUA 2OV6A 4L9RA 1Z4KA 2HRCA 4UREA 4MEJA 1Z4LA 3JQ9C 3U3KA 1H4VB 2VDQB 1GPMA 4JUIA 1VBNA 3L7LA 3ET5A 3NZEA 4OFXA 4ARBA 1KO4A 3LPNA 3ECCA 2OHOA 4XUCA 3RC8A 3HXKA 3M9LA 2FVXA 1VG8A 3X2EA 1XQXA 1J8VA 2XKKA 3MC1A 1WUHS 4QARA 1PZMA 2OV4A 5DGHA 1WO8A 5TPWA 3SZRA 3WLSA 3ZY2A 1NJGA 1LDGA 2IKSA 2X2PA 1SG9A 2R47A 5L6LB 3ZWXA 5EHGA 4G2TA 3D0KA 4DAEA 3WAJA 1GNVA 4FMCB 2P9BA 4WKNA 5DP1A 3M5CA 1EIWA 3I8OA 4MJ3A 4KE7A 1JQEA 3ITNA 3BILA 1PEKE 4WWHA 3CTMA 3JYQA 1ABBA 5BNZA 2KMLA 2Y0BA 3L9XA 4MR8A 4R2LA 4XXHA 4YT5A 4RSGA 4NJMB 5TQJA 3C3MA 4C0LA 4S12A 4AL4A 3WRXA 4Z51A 4LXIA 1G19A 1RTKA 1XLTC 4OTZA 4JX8A 4GM4A 5CYPA 4J0QA 4PHCA 1MABB 1I7LA 1T35A 4N1AA 4Z9YA 1GA6A 2G76A 5FJJA 2FP4B 1NXOA 3NI2A 3L01A 3W1WA 3M83A 4B35A 5BSTA 3K9LA 4E5NA 1XJCA 1Z8FA 2XGOA 3DNFA 3M5DA 4ZQGA 4BNJA 4QDOA 4D9GA 1ZBDA 5HHTA 3DLBA 4KR3A 5ENVA 1JEYA 2BKEA 2C1XA 1OHHA 2D1RA 2GRUA 2OLJA 1RJEA 5BOSB 5HSGA 2VDWA 2XIQA 3TLZA 4F4DA 1L5OA 4PBRA 1HDOA 4LN1A 3JD1A 1E1MA 1DOAA 1Q7RA 1YQQA 4RFLA 3H3FA 3RC1A 5LM3A 2V1UA 2NP7A 4DEVA 5EE9A 1XELA 1ZGHA 4HQOA 1JLRA 1U7PA 2BWJA 2XUOA 1PFQA 1OBOA 2JCBA 2ZR8A 1ZM9A 2C29D 1QR6A 2EW1A 2WHEA 3I1IA 3M6LA 4PEVA 5GZ1A 2AKYA 1X3LA 2WIAA 2I2WA 2RAPA 2AJCA 1FUUA 2FPKA 1LF5A 1PZFA 2YXPX 3HCAA 2PL3A 3VPBA 3MJHA 1WMFA 3BGWA 5EZ6B 1AIPA 3KJXA 3HB0A 4DA7A 3RVPA 3RFFA 3QUAA 1HLFA 3OTIA 5FL3A 3W1EA 1JFRA 1U7DA 3IDAA 3NWEA 1Z34A 3INNA 4OATA 3RVNA 4CR8A 4L9WA 1VZ3A 2NU6B 4K9DA 3VA7A 2LR0A 4M8SA 3NHUA 2AT1A 1BHJA 4JNCA 4FTWA 4JI6B 3ZKAA 1N3YA 3BX1A 4UAVA 3SY8A 4B1FA 2P2DA 2XHEA 2W2OA 4GDMA 1SHTX 1U9ZA 1T2FA 2AG8A 2KM1A 1CE8A 4I50B 3KKZA 4BNNA 3KWMA 1C4XA 4PIMA 4X6LA 2F00A 4NESA 1KMHA 4TKVA 3ICQB 4BKOA 3EUFA 4WLFA 5AW3A 1NASA 1ZL0A 2CN1A 2P0EA 1OLXA 4KXMA 1CEEA 3OQOA 2VP2A 1CYDA 4BBPA 4D8VA 2E2WA 3OZTA 1E61A 3AM5A 2OZKA 2ZAIA 3ZWAA 4BNZA 1BMFD 3R9WA 2NV6A 1JWAB 1PKEA 1B15A 2W4QA 1NV9A 2IW3A 1PQ4A 2Z9BA 4OAPA 3C7TA 4Z9BA 2HO4A 4C0BA 1SPXA 2H7VA 2LCFA 4FNOA 5BRNA 1LBIA 3LYUA 4WQMA 3ZG6A 1N33B 2OZLB 2B61A 2NQTA 3R3JA 2BGMA 1HRKA 3COYA 4P58A 2GXAA 4ZAVA 3P2OA 3KJFA 3DBHB 3H04A 2H07A 3BEOA 4NZZA 4CGZA 3SC2B 3UTCA 1OXXK 1ZU4A 4TQAA 4B4UA 3HBLA 4KDCA 1KI6B 2LGJA 4HNRA 4JQZA 4X6UA 4ZQHA 4E11A 1O03A 3PHBE 3OKPA 5A62A 4IVPA 5I45A 1MH9A 2EJBA 2VNIA 4DC1A 2HAEA 3K0FB 4B3MB 1LZLA 4WD3A 3VHRA 1S2DA 5C0OE 1L5YA 1X7ZA 3UWOA 2PPVA 4Q3EA 1WF6A 3GRKA 2VJAA 3QFTA 1CUIA 2VSFA 4R84A 1TFRA 2OP0A 2W98A 3L0CA 4UCFA 1E18A 2WWFA 1JSRA 2W2MA 2JEYA 4MPRA 4RXUA 3FVWA 3ZWBA 2FW6A 4GX5A 2JGKA 3P4UA 4WGFA 4YRRA 2CXXA 2XVMA 5FPTA 3KTAA 2FN8A 3HA7A 3I6ZA 3ND7A 4I5GA 2UYQA 4KXUA 3WXBA 2B5VA 3LT1A 5AKKA 3KE8A 5EJ6A 3FNFA 3O8QA 1X42A 4TRRA 2KPOA 2NO9A 4YAEA 5CDSA 4NXNB 2H4JA 3KOZA 2EZ8A 5MGNA 3CEHA 5DXJA 6AT1A 2ASVA 2YC2C 4HWRA 1NYLA 4ECEA 1Y3AA 1U9YA 1U1EA 2WTUA 4K9PA 3RBXA 2BKUA 3RS2A 3E5RA 2WWHA 3RRYA 3CUEF 1I7PA 2Y9MB 3EXFA 4LMRA 1USGA 3O1IC 4EFLA 1R9JA 3OJCA 3OZVA 1VGQA 4Q6BA 2G08A 1HTTA 2GEDA 3MQ2A 4B76A 3EPHA 4WRRA 1GZ7A 3KZ1E 3BBLA 3WMWA 2GH1A 1P7ZA 2QEQA 3EWAA 4JODA 4HWPA 4OJMX 4RUKA 5AR1A 5IDVA 1IOZA 5TQ0A 1W4RA 2I3GA 4JKOA 4QYSA 1JQDA 1Q0ZA 2JARA 3IXMA 4XX0B 2BTQB 3L7YA 5IK2D 1UBSB 3J80A 2EGUA 4CZ2A 2H29A 4F86A 1TAGA 3R8FA 3USZA 1Z56C 2IQIA 5G2OA 1DAFA 3RTGA 1CD5A 2V6FA 3EGOA 4LJ4A 4RJTA 1I2DA 4RWZA 5DLEA 3PIRA 5E3JA 1YQUA 4Y9TA 4PSAA 1GTZA 1KRHA 3KB1A 3KTFA 1KPHA 3QV1A 1TGYA 2FN3A 3GK3A 4LFCB 4DL9A 2I4TA 1YZKA 4F4JA 5C4MA 1V96A 3K6SA 4FN4A 3BEDA 2PJZA 4LMAA 3D1LA 2MYNA 3HFGA 1ESNA 1J7KA 2PUJA 3F78A 1C3OB 1FW8A 5FOXA 1XI2A 1GL9B 3O9ZA 4E07A 1EM8A 2FPWA 4PSDA 4KFCA 3LWNA 3LYHA 2JPDA 1POXA 2A1TS 4JROA 4K6HA 1QC5A 3UGJA 4G86A 4QYTA 1TO6A 4QYIB 1G7CA 3VYSB 3F90A 1L7DA 3NBYC 3PQ5A 3FMIA 4IKEA 4R31A 3L41A 3L77A 2DZDA 5CT9A 3O8LA 3R7SA 3K1ZA 4I14A 3JQEA 5ITSA 3NDPA 1AX9A 2QZ9A 3U4QB 4NYIR 3OX4A 1ZMBA 3ELBA 1O4WA 4X92A 2XD9A 3NBXX 2FEKA 4GSKA 2XRFA 1ENPA 1KMCA 1FEZA 2F2TA 3MJRA 6LDHA 1A7JA 5J4YA 4TLEA 2A1UB 3PJGA 4GLBA 4JIMA 2J3DA 1ENOA 4U63A 2X7HA 4DV1B 2CT8A 4EPRA 2FWMX 3F74A 3MJCA 3BB3A 4J94A 3LYLA 3AUSA 1NTRA 5CA1B 1C7FA 3B1JA 4NJEA 3ROMA 1WZCA 4LWOA 1OD6A 1M54A 4EMUA 2WJ6A 2QSUA 4B9EA 4ZU3A 3TPCA 3V1NA 1LLFA 1G8YA 1R6BX 1I10A 2TRSB 2XUGA 3HPRA 5DYGA 1DCKA 5JV5A 2G6TA 2P9FA 4UHFA 1WZUA 3ICPA 1O95A 3FRJA 2W22A 1BU8A 3W3ZB 1EHCA 1FLDA 1I01A 4R05A 1U5BB 3VPSA 5CLLA 1F5SA 4XZ3A 5EJ9A 1C29B 2HM7A 2JAWA 1FJGB 2ZUTA 4J0HA 1K8QA 1RQGA 2NIPA 1YUMA 5EIAA 2WDZA 2IYAA 3CX7A 5INTA 1J9GA 1Z0DA 1SCAA 1M8GA 5ARBA 5KOHA 1FF9A 5LD2C 3CHYA 5FNVA 2FR8C 1LW7A 1RIIA 1U0HC 2QJRA 1N34B 1VE6A 2X0IA 5CX1B 3WYFA 1VM6A 1WTAA 3I45A 2PMEA 4UFPA 1VSVA 1W94A 4H7DA 3UWSA 1XNGA 3WIUA 2RHTA 3ZHTA 4UNQA 4EB6A 3AKZA 5JNRA 3THYB 4P7GA 1SHLA 2K5UA 1MB4A 1DFIA 4DE5A 1YXMA 1EFRD 1R66A 1UDBA 4FC7A 4J76A 5C5EA 4TZ6A 5BUSA 2WWWA 3AP1A 2XGGA 5BXQC 2VXYA 1PFKA 4P7BA 5HRAA 3VDNB 4GPIB 1A8QA 1GJRA 3AI3A 1FA9A 1NZFA 4C29A 3WB9A 2YDXA 3AR6A 5JW6A 1TVEA 2X86A 1K7XB 4UU7A 1TM3E 4FFNA 4ZT6A 5GJCA 2FHPA 3TLMA 5CNIA 1GG9A 1XKLA 1Y9ZA 4BXOA 2O8NA 3MMPA 3SK0A 3ZV5A 3OCVA 2F3TA 1REQA 2X9VA 4BO1A 3AY0A 4PINA 4OXNA 1FYXA 1U98A 1ZGAA 4JB8A 4IJVA 4BUJA 2O1SA 1QV7A 2MHCA 2PGOA 3IXQA 4I1RA 4KIUA 1EFPB 3LXMA 5DX1A 4Z1MA 2EWVA 5JAHA 4MGIR 2VNAA 4IQ0A 2N0SA 4I46A 4XLZA 5JAPA 4YRNA 3FM9A 3I1YA 3Q88A 3QY9A 2IH4A 1A9PA 1C1XB 3ESRA 1AHPA 3GRZA 2Y1DA 1R9NA 4RS3A 2Z2KA 2IE8A 5FOWA 1MT3A 3CN7A 3SYRA 1RU3A 4UNRA 2Q45A 5EGSA 1OI4A 2JH3A 1K2WA 4KNYA 5JRJA 1GGVA 2YBDA 2YVKA 1T34A 1VL1A 1TJ5A 4ENQA 2JLWA 3AR2A 4L73A 4W5JA 3SS7X 2C2OA 3ZLBA 3ZU3A 1MJ5A 1ZHHA 5SZHB 3WIEA 1J22A 3OBIA 2WJWA 2A3RA 4DB4A 2GCGA 4Y1RA 3HJNA 3NYWA 2YWHA 3PFCA 5DXFA 4PICA 3RQSA 4MKFA 2P79A 3TZEA 1TKBA 1AKYA 2A9OA 2R96A 2VL7A 2YXDA 3GLKA 3HJTA 4MS1B 2ISCA 4OHBA 5D2CA 3VKWA 3FETA 3L93A 4AWXA 1NURA 1VPEA 2BSXA 4HGRA 4MS4A 2ZJ1A 1NXXA 4NOLA 4PR3A 1KYQA 4DSNA 5TY0A 1UIRA 3WZ2A 1GQSA 2CXTA 3WYEA 1Y3IA 1B8PA 2J5QA 4FIZA 3GFQA 3FMOB 3KB2A 2QTGA 2PUDA 1BYIA 2D1TA 1MB9A 3VC3A 1Z4IA 3E81A 4C4TA 1J5XA 1ZINA 5AIBA 2VAMA 3LUGA 1LVGA 1B42A 1P2VA 2JJMA 3HWWA 4TV9A 4X61A 3TDKA 3DH0A 2PLAA 3R0QA 4L8VA 1ODFA 4QDZA 3UAVA 2OXRA 3UF0A 3PQ2A 2FZGA 2J3HA 4WBNA 4DJTA 3Q9NA 3G8DA 1VXRA 3O4VA 4RIIA 4TWZA 5JMWA 4FZJA 3WIBA 1YVDA 3N6RA 4QWWA 2IA5A 3O83A 2QVGA 4M54A 1UZUA 1J0CA 2FE4A 3AZPA 1KYIA 4ZDIA 5DZSA 3W2FA 5HS4A 2VHYA 1PU2A 2G80A 4KKXB 1F17A 2BL4A 4GOKA 4LF5B 4GYYA 5KYNA 3QA3E 3LPDA 1A97A 5ALPA 5JS6A 2JW5A 1X1EA 3OSUA 2OHIA 3PIIA 2NWQA 1DQPA 4IS2A 4PO8A 3VOSA 4NH0A 3ILSA 4TTIA 5HRUA 1NQTA 4G1BA 2C3YA 1HZZC 3EISA 5HE8A 1SCBA 3RTDA 1M0SA 2W2QA 1G16A 3E7WA 4PY2A 4CM5A 2HJRA 3RVQA 2VDUE 2ZSUA 4HVCA 4N5LA 3UPUA 1X38A 5HDBB 4A23A 4ANFA 4ESVA 2R65A 2VI5A 2DT8A 1U7TA 4AN0A 1MAAA 4Q3CA 4CU5A 2ZR7A 3UGKA 5AJHA 5T8KC 3EEOA 5T4HA 2D6FA 1V3TA 3NHKA 4JBLA 1T9KA 2DFVA 4ITUA 1DJLA 1Z7GA 3GJ4A 4IY1A 3ZDYB 4LJ5A 3NHWA 2G9ZA 4N7RA 2D3TA 4NBNA 2O8EA 1F9EA 4LDRA 3WX0A 3NANA 3G2LA 3ZE6A 5ITVA 3I61A 2RC6A 2HWXA 1ID8A 3PL1A 3B1YA 4LHWA 2RGNC 1FQJA 3FPCA 3Q8MA 1OSNA 4DCVA 1PO7A 2CHEA 2Q4RA 4GGOA 1T4CB 4CEJB 1Q6ZA 1ZCBA 4N5HX 2O2YA 4GPAA 3TINA 1NU8A 3QJYA 3OWOA 2Z2IA 3N5CA 1VIVA 3PNVA 4W1PA 3CM0A 3F3MA 3O2JA 2QYOA 2DJ5A 1FXSA 5K8IA 3V42A 2GAOA 3HO8A 4E5VA 2IITA 3HB9A 1XRQA 4MYTA 2ZR0A 4PZLA 4F60A 1R1DA 2P6UA 2JRLA 4LRTB 3WLRA 5CMLA 4C04A 1GR0A 3ND5A 4INZA 4ZAFA 3CMMA 2XNJA 1DTWA 1FSFA 1T29A 4N12A 2HA2A 1OT5A 5FQNA 1YDWA 1E1CB 1FY2A 2C4KA 1IY0A 2J9GA 4NBUA 1Q0SA 4RY9A 4OXYA 1JHMA 4WA7A 4CJXA 5IAKA 2J09A 4EAAA 2WD9A 3RVDA 1ST3A 1MPXA 1C3EA 1E2EA 4F8YA 3FBGA 1VJ1A 1A5BB 2NZ8A 3A6PC 1TZ2A 5EQFA 3IH5A 2RARA 4AIRA 4GI3A 4P9NA 1SOAA 1D8AA 3OTQA 1YMUA 4DA4A 5AXBA 4QM6A 1HYGA 4Y2HA 4HUTA 5KSWB 4HK4A 3RAPR 3MBIA 3LPCA 2KWIA 3WKCA 3ER9A 2L18A 1L8OA 3HY4A 4Q1DA 2QRPA 2X1HA 1SOWA 4TGLA 1RW4A 2F67A 2FN9A 4A2PA 3H5NA 1WL8A 2AFIA 3BWCA 3F6SA 3RJZA 1XZCA 3D2BA 3STVA 1U2DA 4A27A 3G8YA 1F2TA 4Y2UA 3T3HA 3GUUA 2ZI5A 3KT0A 4CHGA 3PDCA 3GO4A 5HA5A 5HXAA 5KPDA 4ZVRA 3TD6A 1TYZA 4CI9A 3M4JA 3P94A 3DHVA 1Z06A 4RPKA 4EL5A 2HA5A 1THGA 4U8GA 3EPPA 4P81A 1IE3A 5HKAA 1ETHA 4L5AA 2X0FA 2VOEA 3VSBA 2ZBPA 1SKAA 3EN0A 1GKYA 2ZJ0A 2WYVA 3CZ5A 1XJ5A 2W6QA 3DLHA 4KNWA 4UUQA 1DAMA 4MQ5A 2SECE 2HJHA 5B3JA 2Q6VA 5EJEA 5LXTA 3BHIA 3QV2A 3THSA 3KYDB 3KQOA 4KPUB 5FTWA 4MGZR 4M1SA 3HCRA 5EJMA 2ORWA 2VNKA 5KQRA 3IE1A 2Z6VA 4X62B 1D1QA 4EA7A 3PZBA 2XGJA 4M3NA 2HSJA 3N6XA 5C1BA 3QX8A 2IUEA 3IKMB 4CUJA 3E03A 1Z6YA 1TRKA 5ICGA 1AS3A 2ZK7A 1WR8A 2P9CA 4HH4A 4HDQB 4XSVA 2VUUA 2QGFA 4KLNA 5A71A 2W0SA 3TG2A 4HP8A 1DL5A 5D1NA 5BN5B 1PD1A 3LQYA 2E48A 3EXHC 5FTJA 1WIWA 3AU9A 4IVNA 4F21A 5JZMA 1P6UA 4MINA 5GVSA 3CLSC 4FFVA 1MB3A 1UKZA 3DMPA 1Z37A 2Z5FA 5KWIA 3MD0A 5AHXA 5J3JA 1OROA 1Q74A 4NK5A 1EP2B 1LPMA 3AJ9A 4G4JA 4OJNA 3CONA 1VA4A 4Q0MA 4EKEA 1RP7A 3HCFA 3K9GA 3TKAA 1E77A 4E0BA 4ZYXA 3H0EA 4KAFA 4S0ZA 2ZXUA 1WABA 3RWBA 4BO8A 1RQXA 4AJ9A 3IPXA 2FJ0A 3RSSA 1QQBA 2LXNA 2WTBA 2J9FA 4CKEB 2CDRA 4NZ9A 1HGXA 1WP9A 1O58A 3GRUA 3OKCA 2PEZA 3F96A 2O2HA 1PR4A 5CPFA 1YHNA 2O2JA 1E5DA 4W8HA 4YRPA 3IP8A 2HHHB 5AVRA 1EU1A 2XE6A 4XGQA 3PHCA 3RARA 2W2XA 5LXTB 1RBQA 3FSGA 1X7DA 3QVJA 4C78A 2QTTA 5AOVA 3MTGA 1P17A 4CTOA 3MGBA 3HDJA 3ZDFA 2O2GA 3LP5A 1FDVA 3OZRA 1H5UA 3S99A 3QENA 5IG2A 3WTBA 1X14A 3P9CA 2GWHA 3ZTWA 4F3KA 4C0HA 5JASA 4EGSA 3D4BA 4EG4A 4LEIA 2A35A 3SVZA 1NIPA 1CNEA 4MA0A 3KEQA 3NFRA 3OCCA 3KTOA 1PG0A 4Q7EA 4WN9B 4EPYA 5EKXA 1YFZA 4AQ7A 1LV8A 4BP8A 4Z4FA 3F7TA 4KWEA 4QOJA 2JB9A 2BUCA 1TIKA 1DAPA 1UKYA 1I33A 4ZRDA 5EN4A 1XD8A 3NWJA 2QYTA 2XB8A 3CZAA 1T9GS 3CW8X 3KP1A 3P7MA 3BZUA 3O92A 1WOMA 3LX8A 4GZMA 1X7GA 2HWUA 2IGBA 2A0UA 4DY4A 5JNSA 2YY5A 3IDSA 1NVUQ 2BFBA 1YBFA 4Q4CA 1R5NA 3OCZA 1EFVA 4JP5A 3ESQA 5JCJA 2KB0A 3E9QA 4KODA 4DNPA 3OZDA 4UULA 1K86A 3ZS8A 4OYLA 3RYTC 2O8BA 3CX3A 5FBQB 3LE8A 4B6PA 1DJOA 1X86B 1J8DA 5MFPA 3VJLA 1UMDB 3CNQS 2XUJA 4US2R 2BKVA 2EV9A 3GJRA 4KH1A 1WEKA 2IHBA 2GBLC 3HBJA 4HDKA 3VI3B 1AKNA 2R6ZA 4IXNA 3ENQA 1ZK1A 1Z88A 4CFSA 1XLTA 2O3RA 1II8A 3ISTA 4NE2A 4QUIA 1FSPA 1YVUA 4KPGA 3BH0A 4M0FA 2WQ7A 5DHUA 3BMQB 2Q2QA 4MW1A 3E8XA 3HUUA 3A6JA 5ENZA 3S68A 1P4GA 4PGMA 1IBCA 3Q4GA 3GPLA 1YE8A 2VHUA 4INJA 1E4YA 4BNDB 1U9IA 3FNHA 3SS9X 4RKQA 3F71A 3JQFC 3D0OA 4G2NA 4LSZA 4REQA 4ZPXA 3ROKA 4A10A 4EFNA 1IBKB 1U1GA 3WSWA 2I1QA 2XOKA 3DUFB 1K06A 3G0DA 3EOAI 3LUAA 3PGMA 4R2HA 4RVOA 5BYJA 2X0EA 3HY6A 4H1UA 4IDFA 4GW3A 3E15A 5NULA 1TAHA 4UMDA 3ZHCA 4ZTZB 1KFJB 3FFWA 3IIIA 2X7XA 2OYRA 1NE2A 4QT4A 4YX9A 1KDYA 2FW1A 2UZ0A 2Y67A 4R1PA 3UWKA 3L1UA 5HKBA 3ODGA 4EYQA 2BBSA 4NV1A 4LAFA 2E4ZA 2ON6A 2HW8A 3MYRA 1YA4A 4LQCA 2X4DA 3TG8A 3QYAA 2MJLA 3TQTA 2N75A 3AFIA 5ADUS 1PTKA 3A9SA 4JSTA 2ZANA 4J0CA 3EMVA 2YQZA 4JVOA 4ESEA 4JXZA 5AVOA 2ZRHA 2UXBB 2JBWA 2P78A 1NW4A 1F2UA 3FGOA 3HKEB 1HDZA 1QHEA 3FKJA 4LHZA 3L4JA 3WO1A 1JIVA 1ADFA 1T8PA 2OYCA 1OBFO 1II0A 1ZIYA 3LBAA 4UUPA 1JFVA 3WGGA 1R0XA 3EARA 2XBUA 1AQIA 2YY7A 4TTSA 2FOIA 2B92A 2OZEA 2O20A 4Q4HB 1P8AA 3SEZA 3VR5D 5GOTA 2YOHA 1YTUA 1H6DA 4V03A 1PK9A 4OYHA 5FBHA 2YZKA 4W9NC 4PBTA 4R9RA 2QD1A 2C0QA 3SZGA 2P62A 3ISJA 3ZCXA 2PFKA 2PKWA 3ZQ4A 5EHQA 3HR8A 3NEAA 3PYMA 2ACVA 4G0UA 521PA 4ZV9A 3K2BA 4P83A 4RORA 3CW2A 3D59A 2W58A 3JX9A 4H4CA 5KKNB 2XMCA 3NHMA 4QNMA 5G3ZA 1W5EA 2BFMA 1CQJA 4L78A 5BW5A 1A82A 3GJXC 2H52A 4RVCA 1I51A 4DILA 2CL0X 3TB4A 3KUDA 1VCOA 4GZ3A 4HNQA 1ECBA 2I55A 4TT8A 3NC0C 2O0HA 1JPNA 4G9BA 5BR7A 2RAFA 4OXIA 1NUUA 4MVJM 5L8VA 2C7RA 2FHSA 1GTSA 2P90A 1RKVA 4CF7A 1K89A 4L22A 4MKGA 1N4AA 1KBZA 4Y1FA 4C0KA 2ILVA 3M1AA 2FR1A 2ECKA 1LFDB 3PUWA 2ZSDA 4FDAA 5B3LA 5KC9A 5LKAA 1GVNB 1QV6A 5IVIA 4OY3A 3E7FA 4NENA 2QNRA 3EVNA 5EP2A 1M1ZA 2A5GA 2CLCX 3R7AA 5A9RA 1I7DA 1VXOA 2ES4A 1BA2A 1ZH6A 4HAYA 5KINB 2QRVB 1IWBB 3T5MA 4WFIA 2C2BA 2EGHA 2ZYUX 5MHTA 1H0SA 2JFNA 4Y0AA 3X43A 2VP5A 1PF7E 5BW6B 2CJXA 4RKEA 1XP5A 4DRXB 4KPEC 1CZLA 4WIAA 2FQXA 3B13B 1SQ5A 1UPFA 3UMFA 2QOEA 1Q1QA 4KQWA 4EYSA 5CA1F 1KI1A 1V2HE 3P32A 3DEZA 2QDXA 3C5CA 2RK4A 3WB0A 3GNSA 4NE7A 5ICMA 5B6PA 1X77A 1CR4A 1IBRA 1MFPA 1SY7A 4JR2A 2I33A 1SK9A 1V4NA 2HRRA 4KSCA 5CLFA 3MCVA 2Z08A 3QU2A 4IUCS 5DIFA 4ERNA 4PG8A 2Q5JA 4J3JA 2RJ3A 3JQ6A 4JP3A 4ND1A 4AKHA 2VDMB 1IG3A 1DKOA 5KTPA 2CD7A 5DOZA 3TN7A 1PK7A 5DN6D 2QROA 2H9AA 2CHGA 2WTEA 3CRRA 4LI3X 1RC8A 4Y1RB 1K7SN 2QVZX 2OCLA 1T8UA 1U0TA 2VK2A 3TIVA 3DULA 3IBCA 3WKAA 1V1RA 5T3UA 1RS0A 2AIRA 3WI7A 3AOEC 3JPYA 2JFYA 3ICCA 2WKRA 5GVRA 5JPDA 1Z0ZA 3K15A 2H8KA 2G09A 1EB8A 2DULA 3GZJA 5ECYA 2V45A 1RAEA 2WAYA 3I2FA 3KDPA 5JE8A 2YWXA 3CEAA 4GXRA 3GJYA 1E92A 3QVXA 2WVJA 3MLAA 4G1FA 4RVUA 5AK6A 4R41A 4AJHA 5K3EA 1H9CA 2ZJYA 5AM5A 5C1PA 1NKSA 2NW6A 3O84A 1RCUA 3U3ZA 4RPIA 4ZV4A 1IDN1 2D0DA 3M1LA 1GDTA 2CL5A 2ZIWB 2AN5A 2CXHA 2ZUBA 421PA 4NMLA 2W2PA 2WDPA 1U7WA 1K5HA 3K4QA 4YO8A 4FNAA 1WVIA 2X5XA 3TTUA 1M6EX 1IUKA 4Z8YA 3V8VA 1HMYA 3IP1A 2QDKA 3RUCA 3WWPA 4BVKA 3P26A 1W85A 1ZQ9A 4HL6A 1BDJA 1S8AA 1NULA 4JDUA 2CXPA 3GVPA 4RDHA 1QTIA 3I6IA 3LOUA 2JHAA 3MJTA 5LUBA 3QBEA 2YVUA 2IXEA 1QQ7A 1DO2A 2B4AA 4LY3A 1K92A 1W0KA 3ICEA 2M1ZA 1GAXA 4BP3A 5DMHA 2BCEA 1QWOA 2HMAA 1SU8A 3IPRA 1IHYA 2FSUA 4ZEXA 1PWHA 3T4XA 4R81A 4ASUA 1A95A 4NULA 2IU3A 3M81A 4LYHA 3MJFA 4WN3A 4GI5A 5JSHA 4JEIA 5ED0A 1N4DA 2C07A 2VRBA 2Y77A 3D4NA 5C8VA 3U7GA 4U7JA 3T9EA 1VSBA 4CMGA 1H69A 3K8YA 2DFTA 1BE6A 2Z5VA 4MICA 3GI1A 5DBIA 1KZ1A 4MI1A 4N5MA 3DFZA 1CUUA 2BFEB 2PD3A 3OOEA 3WDKA 2ERCA 2X0RA 4V1CA 3LQRA 3PA6A 5GGYA 4J91A 4WNIA 5EKUA 3L04A 2BJHA 4AULA 2JFWA 3K70D 4GPBA 2ZYTX 3KSMA 1RKBA 1Y82A 2H4WA 2X0JA 4QREA 3EMBA 3RW9A 3LNTA 4LNUB 3KPJA 4OHCA 2FR8A 4MVJE 2OO5C 4PZUA 1AOXA 2IP1A 4GG1A 3JR3A 4EGCB 4U7HA 4UMFA 1HUQA 2B69A 5LQMA 1ETUA 4GZ6A 2GYYA 4G36A 1X7YA 4U02A 4WOPA 1CRZA 5JDIA 2ID9A 1GSHA 2QLBA 3ZE8A 4EG8A 1VLQA 4TL7A 3U7FB 3NYQA 4YI5A 1CZNA 4A03A 1SVSA 3WGJA 1N32B 16PKA 3FI9A 4O4JA 1I1NA 2IXGA 3CLUD 3EPLA 4IO0A 2AYYA 4E15A 1NMQA 4Q6WA 4C7VA 4YUXA 5HQTA 2WUFA 4MVJI 3B6EA 3UO8B 3GLGE 3RYFA 3V4VB 3WGZA 3COSA 1EWYA 1LTQA 1O6GA 1XROA 1YIDA 4ILKA 4JLAA 3ZGOA 4NYMR 2OGSA 3IPYA 3BXHA 2FF5A 2YMPA 2B94A 2ZWIA 3OZSA 1GWNA 2ZROA 3AEKA 5SYNA 4RZUA 2HQRA 1ACMA 3PD0A 1HMPA 1M2KA 4MVJG 1P3JA 5GINE 3ICVA 5FNZA 4OGLA 1R0SA 2BF7A 3GFOA 5AUPB 1Q0RA 3VR6A 2YV4A 1J2JA 2P4QA 4R1NA 4DT1B 5LJLA 4F72A 4E70A 2EFDB 3ED1A 3OQBA 4E1VA 4KMMA 1Q0UA 4GQBA 5BR1A 1LBQA 2J5RA 3D6FA 5GPBA 2IYSA 5CAEA 1TZBA 5CXXA 4FGSA 2BUBA 4DMUB 1Y9AA 5AHRA 1O1YA 3EMDA 5K3DA 4XQEA 1MRZA 1NRIA 1ZVMA 3V4PB 4OMUA 4RXMA 4DUZB 4M49A 2WQ6A 4URUR 3EW7A 3DZ8A 1Z5OA 1EDZA 2O1EA 2AJBA 2HK8A 3NXKA 4BFYA 4FS8A 4A8JB 3G0GA 1S01A 2CMKA 3GQBB 4MV6A 3ZBTA 1IXRC 2FP3A 3OPYA 4C14A 2GFIA 4EIWA 4Z9AA 4B3XA 2YMMA 4KLAA 1SVLA 4LZLA 3TWOA 5JRZA 2D0PB 4ZCRA 4YCNA 2FFJA 1QGDA 1GQOA 2AMVA 3JSXA 1BA3A 4EHBA 2H7XA 3LLSA 4A0FA 4H59A 2IU6A 3FTDA 2VSNA 4NZNA 1SXJA 2XYPA 1OWNA 3RAEC 1Q14A 3NB0A 3ETLA 3L8DA 5DTJA 3DE0X 1TRHA 4H77A 1J33A 2PS1A 2ZJ7A 3IUJA 2WTMA 4UU0A 4B79A 4PG4A 3WP1B 1WDTA 6PFKA 5IJZA 4QOSA 3JAWA 2G88A 4FJ2A 4HDNB 5M34A 4XB1A 3G1UA 3HDGA 3JTEA 1CLEA 3ZDDA 3CT4A 3UMCA 4UBIA 2G9QA 3HLYA 4FI3C 4F6RA 1F06A 3GFPA 1ZL2A 4KVGA 5BV1A 6ABPA 1XZEA 3B6MA 1F0KA 2ZWOA 3CVWA 2ZTHA 3AC0A 2IY8A 1LV7A 3IBFA 3RFXA 2QPLA 2IEGA 5ENDA 2FCRA 1JU9A 2YJ5A 1TZMA 4UUMA 2Q7OE 3RSCA 5MFZA 5ITWA 4D1YA 1CUWA 1TVKA 3DF9A 3IELA 2VP0A 2NAPA 5TNXA 5AVWA 2BD0A 5JYEA 3OH8A 1K7EB 4RZXA 3I2GA 4XYBA 1L5MA 1M8JA 8ABPA 3M1YA 1XCPA 3UMRA 1KYTA 4QHTA 1TK9A 3UUFA 1SCDA 2NU7B 4WX2B 1HZZA 1EXMA 1E9CA 2PWPA 3AKYA 3C1AA 4BWVA 1RQNA 4OG2A 1EVQA 1NW8A 1U2GC 2PQMA 2PWYA 3B36A 3HDQA 5G53C 3EB9A 3OLWA 1R3UA 1M5RA 3E7XA 1QQAA 2WHRA 1ZIOA 4MQFA 1WRBA 2W11A 1C4KA 3GRFA 5EA2A 4LXXA 3WTCA 1TGVA 3O4RA 1AKUA 1ZIPA 3OKFA 3ZCTA 5IVHA 1EQ2A 4LMPA 1YFJA 4HDMB 3DTYA 1BNCA 3C3KA 3O2QB 5IFKA 2NX2A 4TRNA 5F7JA 2CSXA 1N1DA 1Z0FA 3U4CA 3O38A 2IGTA 4YLEA 5TT1A 5A5FA 5A6SA 3B9PA 1U5AA 4L76A 3M3HA 4O2AF 4WH0A 3DDHA 3RVBA 4BAGA 4Z4QA 1IK4A 1NI4A 4EA6A 3SX0A 1K68A 3VO1A 4EAQA 1FRFS 1OXKB 4OJYA 4GX0A 4D6PA 4TL9A 4R5HA 4ED9A 1PL0A 1MIOA 4J03A 4BPRA 5LPNA 4HMQA 3PGLA 1XU7A 1N6RA 3N0TA 3STXA 4QXAA 4COOA 3NW9A 3MINB 3D8TA 2C54A 4X45A 2HNKA 4S1WA 1NVAA 1ZM4A 1ECCA 2PU7A 2VH2A 4JFRA 1I36A 2ODAA 1L5LA 1GCGA 4ZGBA 5GIPE 4RESA 3ZXXA 4ZYVA 2YHBA 3ANXA 1IY1A 1RLTA 2O19A 4LTNA 4ADSG 3BWDD 3FAZA 4ALLA 5ECWA 3NU1A 1CNMA 3HJFA 2H9IA 1UQUA 4MRMB 3DBLA 4P4SB 2P4HX 3AERA 1OASA 4YJKA 1QIDA 1ZAYA 1TJ3A 1DAGA 2XZPA 3K32A 5FQOA 4RNDB 3V2UA 2IX3A 5TR9A 2IW1A 2I78A 4OVKA 5L95A 5TLSA 3SYLA 1JR4A 2HA6A 3FF1A 3HYCA 1MCZA 1ISPA 1T3LA 4DNXA 1KPIA 3C1UA 2WAOA 4HHEA 3KZMA 1YL5A 2EKDA 1NQ5A 3A6HA 1OPXA 3TSWA 4DNFA 1RXIA 2ZS8A 2HUNA 3I30X 4PLWA 3QBJA 1BGXT 2B37A 4RDXA 2GCIA 2P1DA 3HGQA 1SZDA 2I67A 1E6KA 4BE9A 2O2IA 2QUJA 3PPIA 4LOKA 3T6KA 3ZN2A 3FR8A 3RS0A 4CF5A 4GXNA 3CURA 5TRTA 3KPYA 4RGYA 2VK4A 3RT1A 2I7DA 1EQAA 2TSYB 3AFHA 5BSUA 4BFVA 2I4NA 1XD2B 3KPVA 3H7IA 3KEFA 4DG9A 1MZPA 1ND6A 1CR0A 3WDMA 4IHKA 1NP7A 2IEIA 1E9RA 4BFUA 3CV3A 5T57A 4W9RA 1N5RA 1FNSA 3DM5A 5BQXA 5C53B 1NN3A 2FDRA 4JJZA 3VZBA 1HURA 3UYLA 4DWJA 3E22A 3MRSA 4P3KA 3GLVA 3HYLA 4QZVA 4S2EA 3PC3A 3I53A 1W0JA 1ZNYA 2WM8A 4NBTA 5ALSA 1SVKA 4NK4A 4BLPA 3CH6A 3VHLB 1P62B 4XJVA 5IJ9A 3UJNA 3IR7A 1U04A 2AI1A 2XUIA 1DADA 1TC2A 1VYUA 4MV5A 3KBOA 2HV9A 4DJEC 3E1SA 3FHCB 2AUMA 2WA2A 4JCOA 2NUAB 5BWOA 2NNWB 3FYHA 4E5DA 1LFAA 4G9GA 5K0FA 1XTZA 2WPDD 5CH8A 5F4BA 3ZGZA 4JVNA 3CLKA 3K2EA 2OOSA 5CB8A 2FFAA 2PBLA 1GNTA 2GN4A 5KQSA 2R8PA 3EF3A 3B9RA 2ORED 1LY1A 3HYRA 3LI2A 1TKAA 4JLOA 3TZCA 4OKNA 1TYCA 4WJKB 1SBZA 5ERYA 4O63O 1JDTA 1JXOA 3SSMA 2XB2A 2PX0A 3DPUA 3INTA 3H2BA 5G0TA 5K99A 1JF8A 2E4WA 4LE1A 4CEHB 4F12A 2WKSA 1PK8A 3IAUA 2R4QA 3PD1A 1F7UA 3LDUA 3EWNA