3A0WA

Catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
152
structure length
152
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 55
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0wA00
4URLA 4BXIA 2IWSA 2IWXA 3A0TA 3A0XA 1ZWHA 3NMQA 2WI6A 4JQLA 4O05A 4O09A 4PU9A 2C2AA 4XCJA 4XIPA 2YKEA 3C0EA 4BIZA 3ZXOA 5CF0A 3CGZA 5C93A 2YJXA 4FCRA 3ZXQA 2XHTA 1NHHA 2XABA 2BYHA 5FWKA 1Z59A 2YEGA 3INWA 3RKZA 2XJGA 4YKZA 2WI4A 4DZYA 2XX2A 3INXA 4KSGA 2YI6A 3O2FA 3A0ZA 4CWNA 4WUBA 4HY1A 3H80A 3BM9A 3BMYA 4I5SA 4MPEA 4R3MA 2BREA 5M4KA 1UY7A 2YEHA 4E01A 1I5AA 2WEQA 2FWZA 2FYPA 1YT1A 2WEPA 3ZKDA 4EGKA 3U2DA 4YKUA 1B63A 2CH4A 3B26A 4URNA 1BXDA 2VCIA 3TTZA 4BQJA 1YS3A 5M4MA 2YE2A 1MU5A 4EGIA 2YE4A 4Q20A 2YE6A 1UYEA 4ZVIA 1B62A 3R91A 3B28A 5M4HA 3MNRP 4NH7A 3RLPA 4EFTA 3EKOA 4LWFA 2BU6A 4EM7A 5L3JA 1TH8A 3FT5A 3Q5LA 1YC1A 1Y8OA 3RLQA 1TIDA 2YEAA 4V25A 2YI5A 5F3KA 3T0HA 2ZDYA 1YSZA 1QY8A 2H55A 4EMVA 4E02A 4XE2A 2CCUA 2K5BA 3KE6A 2ZBKB 1I5CA 4MPCA 1OSFA 3D2RA 2YGFA 2IWUA 4KSHA 2BYIA 4L94A 4CWQA 4MP7A 4H85A 2YEIA 1MX0A 3HZ1A 3R4OA 1YC4A 4KQVA 4JAVA 4FCQA 4AWPA 4LWGA 1KIJA 3ZKBA 4B6CA 1R62A 2IOQA 5D7DA 2XCMA 3Q5JA 4XKOA 2YKCA 3HYYA 3PEJA 2GQPA 4XKAA 4EFUA 3VHAA 2EXLA 5J6AA 4CWSA 4X9LA 3R92A 3G7BA 3CRLA 4MPNA 4CWOA 3OMUA 3WQ9A 1I5BA 2Q8FA 1AH8A 4KTNA 4HY6A 4BQGA 4XDMA 4ASGA 1AH6A 4AWQA 1EI1A 2E0AA 4CWFA 3CRKA 4CE2A 2WI7A 5D7CA 4V26A 4MP2A 3EHFA 3TZ5A 4CE1A 1NHJA 1S14A 4YKRA 3FT8A 3U2KA 4GGLA 2Q8IA 3HEKA 5F5RA 4XKKA 2ESAA 3VADA 3OW6A 2HG1A 4B7PA 2XD6A 1BYQA 4GCZA 3CGYA 2WI1A 2O1UA 4FCPA 4LPBA 1AJ6A 1Y4UA 3LPSA 2YGEA 4YKYA 2YE7A 3QDDA 3GIEA 5D6QA 2XDSA 4L91A 4P7AA 4ASAA 4O07A 3R4PA 4XIQA 5BOCA 2XDUA 2XDKA 4W7TA 4L8ZA 2AKPA 4P8OA 3OWBA 4HXZA 1UYCA 2XDLA 4ZKIA 2XHRA 3B27A 4PRVA 3WHAA 1PVGA 2CG9A 3R4MA 5FNFA 3T0ZA 4KFGA 4AWOA 3T1KA 4WUCA 5BODA 2YE8A 1U0ZA 5D6PA 4BAEA 4LWEA 1U2OA 4H81A 2WI2A 2YI0A 1QZRA 3D0BA 3CWVA 2JKIA 1YETA 1UY9A 2GFDA 2QG2A 2YKBA 3PEHA 4MOTA 1B3QA 1ZXMA 4O0BA 4LP0A 3GIGA 4HXWA 2VCJA 1Y8NA 1UY8A 5IDMA 1UYHA 1YSRA 4R1FA 2QG0A 4YKTA 3JZ3A 5CTXA 3K97A 3TZ0A 5IDJA 4XIRA 2O1WA 2VWCA 4K4OA 4KP4A 1YC3A 2YKIA 4UROA 1JM6A 1GKZA 3VHCA 2BTZA 4PL9A 5GGZA 5M4NA 4XTJA 4YKXA 3TZ2A 1UYDA 1EA6A 3LNUA 5FNDA 4HZ5A 1ID0A 2HCHA 2YK2A 2YEEA 1I59A 1UYLA 2WERA 4E00A 4U7NA 2JJCA 3A0YA 4L93A 1AMWA 1I58A 2YE3A 1YT0A 2XX4A 3O6OA 4MB9A 4FMTA 1YESA 3G75A 4AS9A 4QPKA 2XJJA 2YE9A 1UYGA 4WUDA 4CE3A 2BRCA 1GJVA 4GEEA 2QF6A 4YKQA 2YKJA 5M4EA 4LWIA 4CWPA 1UY6A 2CCSA 4BIUA 5J71A 3TUHA 3T2SA 2Q2EB 4EEHA 2YEJA 2QFOA 3GIFA 2FWYA 1YERA 1Y8PA 3B24A 2BZ5A 2XX5A 2FXSA 2YEDA 2O1VA 2Q8GA 4QPJA 2H8MA 4ASFA 4PRXA 1TILA 3B25A 4GQTA 1Z5CA 1Z5AA 3EHJA 3U67A 4EGHA 1QYEA 3OWDA 3HHUA 2CCTA 4LWHA 4NH9A 4ASBA 1H7UA 3G7EA 3QTFA 3Q5KA 3A0WA 3C11A 3FV5A 4XITA 1S16A 3D36A 2WI5A 1UYMA 4I3HA 4HYPA 2IORA 4MBCA 4JASA 3DGEA 4R3AA 2YECA 2ZDXA 5CPHA 4HYMA 4HZ0A 2YK9A 2XJXA 4U93A 2XHXA 3VHDA 2YE5A 2UWDA 1AM1A 4XCLA 4NH8A 1US7A 4CWTA 4CWRA 2BU8A 5M4PA 3A0RA 2ZKJA 2XK2A 3K99A 1A4HA 5CTUA 5FNCA 1BKNA 2YEFA 1KZNA 4DUHA 3O0IA 2BSMA 3EKRA 2BT0A 5CTYA 1BGQA 2YEBA 4GT8A 2HKJA 1TC6A 2BU2A 2BU7A 2BU5A 1ZW9A 1GKXA 3GIGB 4XD8A 2PNRA 1TBWA 1TC0A 2IOPA 2XDXA 3R4NA 4JAUA 3ZM7A 1THNA 5CTWA 1Z5BA 3RLRA 1I5DA 2WI3A 2YI7A 1UYIA 2CGFA 3EHHA 1YT2A 3OPDA 4XC0A 1UYFA 4YKWA 4U7OA 2YGAA 3IEDA 2Q8HA 4GFNA 3SL2A 1H7SA 5IN9A 3TZ4A 1UYKA 3T10A 4H7QA 5D7RA 4L90A 3K98A 3HYZA 3EHGA 1L0OA 2VW5A 3HZ5A 3K60A 2YJWA 3H4LA 4URMA 1ZXNA 1Y4SA 1NHIA 4O04A 4FPPA
chains in the Genus database with same CATH superfamily
4URLA 4BXIA 2IWSA 2IWXA 3A0TA 3A0XA 1ZWHA 3NMQA 2WI6A 4JQLA 4O05A 4O09A 4PU9A 2C2AA 4XCJA 4XIPA 3S5TA 2YKEA 3C0EA 4BIZA 3ZXOA 5CF0A 3CGZA 5C93A 2YJXA 3CYGA 4FCRA 3ZXQA 2XHTA 1NHHA 2XABA 2BYHA 5FWKA 1Z59A 2YEGA 3INWA 3RKZA 2XJGA 4YKZA 2WI4A 4DZYA 3LMMA 2XX2A 3INXA 4KSGA 2YI6A 3O2FA 1IXMA 3A0ZA 4CWNA 4WUBA 4HY1A 3H80A 3BM9A 3BMYA 4I5SA 4MPEA 4R3MA 2BREA 5M4KA 1UY7A 2YEHA 4E01A 1I5AA 2WEQA 2FWZA 2FYPA 1YT1A 2WEPA 3ZKDA 4EGKA 3U2DA 4YKUA 1B63A 2CH4A 3B26A 4URNA 5JENA 1BXDA 2VCIA 2C1GA 3TTZA 4BQJA 1YS3A 5M4MA 2YE2A 1MU5A 4EGIA 2YE4A 4Q20A 2YE6A 1UYEA 4ZVIA 1B62A 3R91A 3B28A 5M4HA 3MNRP 4NH7A 3RLPA 4EFTA 3EKOA 4LWFA 2BU6A 4EM7A 5L3JA 1TH8A 3FT5A 3Q5LA 1YC1A 1Y8OA 3RLQA 1TIDA 2YEAA 4V25A 2YI5A 5F3KA 3T0HA 2ZDYA 1YSZA 1QY8A 1F51A 2H55A 4EMVA 4E02A 4XE2A 2CCUA 2K5BA 3KE6A 2ZBKB 1I5CA 4MPCA 1OSFA 3D2RA 2YGFA 2IWUA 4KSHA 2BYIA 4L94A 4CWQA 4MP7A 4H85A 2YEIA 1MX0A 3HZ1A 3R4OA 1YC4A 4KQVA 4JAVA 4FCQA 4AWPA 4LWGA 1KIJA 3ZKBA 4B6CA 1R62A 2IOQA 5D7DA 2XCMA 3Q5JA 4XKOA 2YKCA 3HYYA 3PEJA 2GQPA 4XKAA 4EFUA 3VHAA 2EXLA 5J6AA 4CWSA 4X9LA 3R92A 3G7BA 3CRLA 4MPNA 4CWOA 3OMUA 3WQ9A 1I5BA 2Q8FA 1AH8A 4KTNA 4HY6A 4BQGA 4XDMA 4ASGA 1AH6A 4AWQA 2C1IA 1EI1A 2E0AA 4CWFA 3CRKA 4CE2A 2WI7A 5D7CA 4V26A 4MP2A 3EHFA 3TZ5A 4CE1A 1NHJA 1S14A 4YKRA 3FT8A 3U2KA 4GGLA 2Q8IA 3HEKA 5F5RA 4XKKA 2ESAA 3VADA 3OW6A 4E72A 2HG1A 4B7PA 2XD6A 1BYQA 4GCZA 3CGYA 2WI1A 2O1UA 4FCPA 4LPBA 1AJ6A 1Y4UA 3LPSA 2YGEA 4YKYA 2YE7A 3QDDA 3GIEA 5D6QA 2XDSA 4L91A 4P7AA 4ASAA 4O07A 3R4PA 4XIQA 5BOCA 2XDUA 2XDKA 4W7TA 4L8ZA 2AKPA 4P8OA 3OWBA 4HXZA 1UYCA 2XDLA 4ZKIA 2XHRA 3B27A 4PRVA 3WHAA 1PVGA 2CG9A 3R4MA 5FNFA 3T0ZA 4KFGA 4AWOA 3T1KA 4WUCA 5BODA 2YE8A 1U0ZA 5D6PA 4BAEA 4LWEA 1U2OA 2HHIA 4H81A 2WI2A 2YI0A 1QZRA 3D0BA 3CWVA 2JKIA 1YETA 1UY9A 2GFDA 2QG2A 2YKBA 3PEHA 4MOTA 1B3QA 1ZXMA 4O0BA 4LP0A 3GIGA 4HXWA 2VCJA 1Y8NA 1UY8A 5IDMA 1UYHA 1YSRA 4R1FA 2QG0A 4YKTA 3JZ3A 5CTXA 3K97A 3TZ0A 5IDJA 4XIRA 2O1WA 2VWCA 4K4OA 4KP4A 1YC3A 2YKIA 4UROA 1JM6A 1GKZA 3VHCA 2BTZA 4PL9A 5GGZA 5M4NA 4XTJA 4YKXA 3TZ2A 1UYDA 1EA6A 3LNUA 5FNDA 4HZ5A 1ID0A 2HCHA 2YK2A 2YEEA 1I59A 1UYLA 2WERA 4E00A 4U7NA 2JJCA 3A0YA 4L93A 1AMWA 1I58A 2YE3A 1YT0A 2XX4A 3O6OA 4MB9A 4FMTA 1YESA 3G75A 4AS9A 4QPKA 2XJJA 2YE9A 1UYGA 4WUDA 4CE3A 2BRCA 1GJVA 4GEEA 2QF6A 4YKQA 2YKJA 5M4EA 4LWIA 4CWPA 1UY6A 2CCSA 4BIUA 5J71A 3TUHA 3T2SA 2Q2EB 4EEHA 2YEJA 2QFOA 3GIFA 2FWYA 1YERA 1Y8PA 3B24A 2BZ5A 2XX5A 2FXSA 2YEDA 2O1VA 2Q8GA 4QPJA 2H8MA 4ASFA 4PRXA 1TILA 3B25A 4GQTA 1Z5CA 1Z5AA 3EHJA 3U67A 4EGHA 1QYEA 3OWDA 3HHUA 2CCTA 4LWHA 4NH9A 4ASBA 1H7UA 3G7EA 3QTFA 3Q5KA 3A0WA 3C11A 3FV5A 4XITA 1S16A 3D36A 2WI5A 1UYMA 4I3HA 4HYPA 2IORA 4MBCA 4JASA 3DGEA 4R3AA 2YECA 2ZDXA 5CPHA 4HYMA 4HZ0A 2YK9A 2XJXA 4U93A 2XHXA 3VHDA 2YE5A 2UWDA 1AM1A 4XCLA 4NH8A 1US7A 4CWTA 4CWRA 2BU8A 5M4PA 3A0RA 2ZKJA 2XK2A 3K99A 1A4HA 5CTUA 5FNCA 1BKNA 2YEFA 1KZNA 4DUHA 3O0IA 2BSMA 3EKRA 2BT0A 5CTYA 1BGQA 2YEBA 4GT8A 2HKJA 1TC6A 2BU2A 2BU7A 2BU5A 1ZW9A 1GKXA 3GIGB 4XD8A 2PNRA 1TBWA 1TC0A 2IOPA 2XDXA 3R4NA 4JAUA 3ZM7A 1THNA 5CTWA 1Z5BA 3RLRA 1I5DA 2WI3A 2YI7A 1UYIA 2CGFA 3EHHA 1YT2A 3OPDA 4XC0A 1UYFA 4YKWA 4U7OA 2YGAA 3IEDA 2Q8HA 4GFNA 3SL2A 1H7SA 5IN9A 3TZ4A 1UYKA 3T10A 4H7QA 5D7RA 4L90A 3K98A 3HYZA 3EHGA 1L0OA 2VW5A 3HZ5A 3K60A 2YJWA 2FTKA 3H4LA 4URMA 1ZXNA 1Y4SA 1NHIA 4O04A 4FPPA
chains in the Genus database with same CATH topology
4URLA 4BXIA 2IWSA 2IWXA 3A0TA 3A0XA 1ZWHA 3NMQA 2WI6A 4JQLA 4O05A 4O09A 4PU9A 2C2AA 4XCJA 4XIPA 2YKEA 3C0EA 4BIZA 3ZXOA 5CF0A 3CGZA 5C93A 2YJXA 4FCRA 3ZXQA 2XHTA 1NHHA 2XABA 2BYHA 5FWKA 1Z59A 2YEGA 3INWA 3RKZA 2XJGA 4YKZA 2WI4A 4DZYA 2XX2A 3INXA 4KSGA 2YI6A 3O2FA 3A0ZA 4CWNA 4WUBA 4HY1A 3H80A 3BM9A 3BMYA 4I5SA 4MPEA 4R3MA 2BREA 5M4KA 1UY7A 2YEHA 4E01A 1I5AA 2WEQA 2FWZA 2FYPA 1YT1A 2WEPA 3ZKDA 4EGKA 3U2DA 4YKUA 1B63A 2CH4A 3B26A 4URNA 1BXDA 2VCIA 3TTZA 4BQJA 1YS3A 5M4MA 2YE2A 1MU5A 4EGIA 2YE4A 4Q20A 2YE6A 1UYEA 4ZVIA 1B62A 3R91A 3B28A 5M4HA 3MNRP 4NH7A 3RLPA 4EFTA 3EKOA 4LWFA 2BU6A 4EM7A 5L3JA 1TH8A 3FT5A 3Q5LA 1YC1A 1Y8OA 3RLQA 1TIDA 2YEAA 4V25A 2YI5A 5F3KA 3T0HA 2ZDYA 1YSZA 1QY8A 2H55A 4EMVA 4E02A 4XE2A 2CCUA 2K5BA 3KE6A 2ZBKB 1I5CA 4MPCA 1OSFA 3D2RA 2YGFA 2IWUA 4KSHA 2BYIA 4L94A 4CWQA 4MP7A 4H85A 2YEIA 1MX0A 3HZ1A 3R4OA 1YC4A 4KQVA 4JAVA 4FCQA 4AWPA 4LWGA 1KIJA 3ZKBA 4B6CA 1R62A 2IOQA 5D7DA 2XCMA 3Q5JA 4XKOA 2YKCA 3HYYA 3PEJA 2GQPA 4XKAA 4EFUA 3VHAA 2EXLA 5J6AA 4CWSA 4X9LA 3R92A 3G7BA 3CRLA 4MPNA 4CWOA 3OMUA 3WQ9A 1I5BA 2Q8FA 1AH8A 4KTNA 4HY6A 4BQGA 4XDMA 4ASGA 1AH6A 4AWQA 1EI1A 2E0AA 4CWFA 3CRKA 4CE2A 2WI7A 5D7CA 4V26A 4MP2A 3EHFA 3TZ5A 4CE1A 1NHJA 1S14A 4YKRA 3FT8A 3U2KA 4GGLA 2Q8IA 3HEKA 5F5RA 4XKKA 2ESAA 3VADA 3OW6A 2HG1A 4B7PA 2XD6A 1BYQA 4GCZA 3CGYA 2WI1A 2O1UA 4FCPA 4LPBA 1AJ6A 1Y4UA 3LPSA 2YGEA 4YKYA 2YE7A 3QDDA 3GIEA 5D6QA 2XDSA 4L91A 4P7AA 4ASAA 4O07A 3R4PA 4XIQA 5BOCA 2XDUA 2XDKA 4W7TA 4L8ZA 2AKPA 4P8OA 3OWBA 4HXZA 1UYCA 2XDLA 4ZKIA 2XHRA 3B27A 4PRVA 3WHAA 1PVGA 2CG9A 3R4MA 5FNFA 3T0ZA 4KFGA 4AWOA 3T1KA 4WUCA 5BODA 2YE8A 1U0ZA 5D6PA 4BAEA 4LWEA 1U2OA 4H81A 2WI2A 2YI0A 1QZRA 3D0BA 3CWVA 2JKIA 1YETA 1UY9A 2GFDA 2QG2A 2YKBA 3PEHA 4MOTA 1B3QA 1ZXMA 4O0BA 4LP0A 3GIGA 4HXWA 2VCJA 1Y8NA 1UY8A 5IDMA 1UYHA 1YSRA 4R1FA 2QG0A 4YKTA 3JZ3A 5CTXA 3K97A 3TZ0A 5IDJA 4XIRA 2O1WA 2VWCA 4K4OA 4KP4A 1YC3A 2YKIA 4UROA 1JM6A 1GKZA 3VHCA 2BTZA 4PL9A 5GGZA 5M4NA 4XTJA 4YKXA 3TZ2A 1UYDA 1EA6A 3LNUA 5FNDA 4HZ5A 1ID0A 2HCHA 2YK2A 2YEEA 1I59A 1UYLA 2WERA 4E00A 4U7NA 2JJCA 3A0YA 4L93A 1AMWA 1I58A 2YE3A 1YT0A 2XX4A 3O6OA 4MB9A 4FMTA 1YESA 3G75A 4AS9A 4QPKA 2XJJA 2YE9A 1UYGA 4WUDA 4CE3A 2BRCA 1GJVA 4GEEA 2QF6A 4YKQA 2YKJA 5M4EA 4LWIA 4CWPA 1UY6A 2CCSA 4BIUA 5J71A 3TUHA 3T2SA 2Q2EB 4EEHA 2YEJA 2QFOA 3GIFA 2FWYA 1YERA 1Y8PA 3B24A 2BZ5A 2XX5A 2FXSA 2YEDA 2O1VA 2Q8GA 4QPJA 2H8MA 4ASFA 4PRXA 1TILA 3B25A 4GQTA 1Z5CA 1Z5AA 3EHJA 3U67A 4EGHA 1QYEA 3OWDA 3HHUA 2CCTA 4LWHA 4NH9A 4ASBA 1H7UA 3G7EA 3QTFA 3Q5KA 3A0WA 3C11A 3FV5A 4XITA 1S16A 3D36A 2WI5A 1UYMA 4I3HA 4HYPA 2IORA 4MBCA 4JASA 3DGEA 4R3AA 2YECA 2ZDXA 5CPHA 4HYMA 4HZ0A 2YK9A 2XJXA 4U93A 2XHXA 3VHDA 2YE5A 2UWDA 1AM1A 4XCLA 4NH8A 1US7A 4CWTA 4CWRA 2BU8A 5M4PA 3A0RA 2ZKJA 2XK2A 3K99A 1A4HA 5CTUA 5FNCA 1BKNA 2YEFA 1KZNA 4DUHA 3O0IA 2BSMA 3EKRA 2BT0A 5CTYA 1BGQA 2YEBA 4GT8A 2HKJA 1TC6A 2BU2A 2BU7A 2BU5A 1ZW9A 1GKXA 3GIGB 4XD8A 2PNRA 1TBWA 1TC0A 2IOPA 2XDXA 3R4NA 4JAUA 3ZM7A 1THNA 5CTWA 1Z5BA 3RLRA 1I5DA 2WI3A 2YI7A 1UYIA 2CGFA 3EHHA 1YT2A 3OPDA 4XC0A 1UYFA 4YKWA 4U7OA 2YGAA 3IEDA 2Q8HA 4GFNA 3SL2A 1H7SA 5IN9A 3TZ4A 1UYKA 3T10A 4H7QA 5D7RA 4L90A 3K98A 3HYZA 3EHGA 1L0OA 2VW5A 3HZ5A 3K60A 2YJWA 3H4LA 4URMA 1ZXNA 1Y4SA 1NHIA 4O04A 4FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URL A;  4BXI A;  2IWS A;  2IWX A;  3A0T A;  3A0X A;  1ZWH A;  3NMQ A;  2WI6 A;  4JQL A;  4O05 A;  4O09 A;  4PU9 A;  2C2A A;  4XCJ A;  4XIP A;  2YKE A;  3C0E A;  4BIZ A;  3ZXO A;  5CF0 A;  3CGZ A;  5C93 A;  2YJX A;  4FCR A;  3ZXQ A;  2XHT A;  1NHH A;  2XAB A;  2BYH A;  5FWK A;  1Z59 A;  2YEG A;  3INW A;  3RKZ A;  2XJG A;  4YKZ A;  2WI4 A;  4DZY A;  2XX2 A;  3INX A;  4KSG A;  2YI6 A;  3O2F A;  3A0Z A;  4CWN A;  4WUB A;  4HY1 A;  3H80 A;  3BM9 A;  3BMY A;  4I5S A;  4MPE A;  4R3M A;  2BRE A;  5M4K A;  1UY7 A;  2YEH A;  4E01 A;  1I5A A;  2WEQ A;  2FWZ A;  2FYP A;  1YT1 A;  2WEP A;  3ZKD A;  4EGK A;  3U2D A;  4YKU A;  1B63 A;  2CH4 A;  3B26 A;  4URN A;  1BXD A;  2VCI A;  3TTZ A;  4BQJ A;  1YS3 A;  5M4M A;  2YE2 A;  1MU5 A;  4EGI A;  2YE4 A;  4Q20 A;  2YE6 A;  1UYE A;  4ZVI A;  1B62 A;  3R91 A;  3B28 A;  5M4H A;  3MNR P;  4NH7 A;  3RLP A;  4EFT A;  3EKO A;  4LWF A;  2BU6 A;  4EM7 A;  5L3J A;  1TH8 A;  3FT5 A;  3Q5L A;  1YC1 A;  1Y8O A;  3RLQ A;  1TID A;  2YEA A;  4V25 A;  2YI5 A;  5F3K A;  3T0H A;  2ZDY A;  1YSZ A;  1QY8 A;  2H55 A;  4EMV A;  4E02 A;  4XE2 A;  2CCU A;  2K5B A;  3KE6 A;  2ZBK B;  1I5C A;  4MPC A;  1OSF A;  3D2R A;  2YGF A;  2IWU A;  4KSH A;  2BYI A;  4L94 A;  4CWQ A;  4MP7 A;  4H85 A;  2YEI A;  1MX0 A;  3HZ1 A;  3R4O A;  1YC4 A;  4KQV A;  4JAV A;  4FCQ A;  4AWP A;  4LWG A;  1KIJ A;  3ZKB A;  4B6C A;  1R62 A;  2IOQ A;  5D7D A;  2XCM A;  3Q5J A;  4XKO A;  2YKC A;  3HYY A;  3PEJ A;  2GQP A;  4XKA A;  4EFU A;  3VHA A;  2EXL A;  5J6A A;  4CWS A;  4X9L A;  3R92 A;  3G7B A;  3CRL A;  4MPN A;  4CWO A;  3OMU A;  3WQ9 A;  1I5B A;  2Q8F A;  1AH8 A;  4KTN A;  4HY6 A;  4BQG A;  4XDM A;  4ASG A;  1AH6 A;  4AWQ A;  1EI1 A;  2E0A A;  4CWF A;  3CRK A;  4CE2 A;  2WI7 A;  5D7C A;  4V26 A;  4MP2 A;  3EHF A;  3TZ5 A;  4CE1 A;  1NHJ A;  1S14 A;  4YKR A;  3FT8 A;  3U2K A;  4GGL A;  2Q8I A;  3HEK A;  5F5R A;  4XKK A;  2ESA A;  3VAD A;  3OW6 A;  2HG1 A;  4B7P A;  2XD6 A;  1BYQ A;  4GCZ A;  3CGY A;  2WI1 A;  2O1U A;  4FCP A;  4LPB A;  1AJ6 A;  1Y4U A;  3LPS A;  2YGE A;  4YKY A;  2YE7 A;  3QDD A;  3GIE A;  5D6Q A;  2XDS A;  4L91 A;  4P7A A;  4ASA A;  4O07 A;  3R4P A;  4XIQ A;  5BOC A;  2XDU A;  2XDK A;  4W7T A;  4L8Z A;  2AKP A;  4P8O A;  3OWB A;  4HXZ A;  1UYC A;  2XDL A;  4ZKI A;  2XHR A;  3B27 A;  4PRV A;  3WHA A;  1PVG A;  2CG9 A;  3R4M A;  5FNF A;  3T0Z A;  4KFG A;  4AWO A;  3T1K A;  4WUC A;  5BOD A;  2YE8 A;  1U0Z A;  5D6P A;  4BAE A;  4LWE A;  1U2O A;  4H81 A;  2WI2 A;  2YI0 A;  1QZR A;  3D0B A;  3CWV A;  2JKI A;  1YET A;  1UY9 A;  2GFD A;  2QG2 A;  2YKB A;  3PEH A;  4MOT A;  1B3Q A;  1ZXM A;  4O0B A;  4LP0 A;  3GIG A;  4HXW A;  2VCJ A;  1Y8N A;  1UY8 A;  5IDM A;  1UYH A;  1YSR A;  4R1F A;  2QG0 A;  4YKT A;  3JZ3 A;  5CTX A;  3K97 A;  3TZ0 A;  5IDJ A;  4XIR A;  2O1W A;  2VWC A;  4K4O A;  4KP4 A;  1YC3 A;  2YKI A;  4URO A;  1JM6 A;  1GKZ A;  3VHC A;  2BTZ A;  4PL9 A;  5GGZ A;  5M4N A;  4XTJ A;  4YKX A;  3TZ2 A;  1UYD A;  1EA6 A;  3LNU A;  5FND A;  4HZ5 A;  1ID0 A;  2HCH A;  2YK2 A;  2YEE A;  1I59 A;  1UYL A;  2WER A;  4E00 A;  4U7N A;  2JJC A;  3A0Y A;  4L93 A;  1AMW A;  1I58 A;  2YE3 A;  1YT0 A;  2XX4 A;  3O6O A;  4MB9 A;  4FMT A;  1YES A;  3G75 A;  4AS9 A;  4QPK A;  2XJJ A;  2YE9 A;  1UYG A;  4WUD A;  4CE3 A;  2BRC A;  1GJV A;  4GEE A;  2QF6 A;  4YKQ A;  2YKJ A;  5M4E A;  4LWI A;  4CWP A;  1UY6 A;  2CCS A;  4BIU A;  5J71 A;  3TUH A;  3T2S A;  2Q2E B;  4EEH A;  2YEJ A;  2QFO A;  3GIF A;  2FWY A;  1YER A;  1Y8P A;  3B24 A;  2BZ5 A;  2XX5 A;  2FXS A;  2YED A;  2O1V A;  2Q8G A;  4QPJ A;  2H8M A;  4ASF A;  4PRX A;  1TIL A;  3B25 A;  4GQT A;  1Z5C A;  1Z5A A;  3EHJ A;  3U67 A;  4EGH A;  1QYE A;  3OWD A;  3HHU A;  2CCT A;  4LWH A;  4NH9 A;  4ASB A;  1H7U A;  3G7E A;  3QTF A;  3Q5K A;  3A0W A;  3C11 A;  3FV5 A;  4XIT A;  1S16 A;  3D36 A;  2WI5 A;  1UYM A;  4I3H A;  4HYP A;  2IOR A;  4MBC A;  4JAS A;  3DGE A;  4R3A A;  2YEC A;  2ZDX A;  5CPH A;  4HYM A;  4HZ0 A;  2YK9 A;  2XJX A;  4U93 A;  2XHX A;  3VHD A;  2YE5 A;  2UWD A;  1AM1 A;  4XCL A;  4NH8 A;  1US7 A;  4CWT A;  4CWR A;  2BU8 A;  5M4P A;  3A0R A;  2ZKJ A;  2XK2 A;  3K99 A;  1A4H A;  5CTU A;  5FNC A;  1BKN A;  2YEF A;  1KZN A;  4DUH A;  3O0I A;  2BSM A;  3EKR A;  2BT0 A;  5CTY A;  1BGQ A;  2YEB A;  4GT8 A;  2HKJ A;  1TC6 A;  2BU2 A;  2BU7 A;  2BU5 A;  1ZW9 A;  1GKX A;  3GIG B;  4XD8 A;  2PNR A;  1TBW A;  1TC0 A;  2IOP A;  2XDX A;  3R4N A;  4JAU A;  3ZM7 A;  1THN A;  5CTW A;  1Z5B A;  3RLR A;  1I5D A;  2WI3 A;  2YI7 A;  1UYI A;  2CGF A;  3EHH A;  1YT2 A;  3OPD A;  4XC0 A;  1UYF A;  4YKW A;  4U7O A;  2YGA A;  3IED A;  2Q8H A;  4GFN A;  3SL2 A;  1H7S A;  5IN9 A;  3TZ4 A;  1UYK A;  3T10 A;  4H7Q A;  5D7R A;  4L90 A;  3K98 A;  3HYZ A;  3EHG A;  1L0O A;  2VW5 A;  3HZ5 A;  3K60 A;  2YJW A;  3H4L A;  4URM A;  1ZXN A;  1Y4S A;  1NHI A;  4O04 A;  4FPP A; 
#chains in the Genus database with same CATH topology
 4URL A;  4BXI A;  2IWS A;  2IWX A;  3A0T A;  3A0X A;  1ZWH A;  3NMQ A;  2WI6 A;  4JQL A;  4O05 A;  4O09 A;  4PU9 A;  2C2A A;  4XCJ A;  4XIP A;  3S5T A;  2YKE A;  3C0E A;  4BIZ A;  3ZXO A;  5CF0 A;  3CGZ A;  5C93 A;  2YJX A;  3CYG A;  4FCR A;  3ZXQ A;  2XHT A;  1NHH A;  2XAB A;  2BYH A;  5FWK A;  1Z59 A;  2YEG A;  3INW A;  3RKZ A;  2XJG A;  4YKZ A;  2WI4 A;  4DZY A;  3LMM A;  2XX2 A;  3INX A;  4KSG A;  2YI6 A;  3O2F A;  1IXM A;  3A0Z A;  4CWN A;  4WUB A;  4HY1 A;  3H80 A;  3BM9 A;  3BMY A;  4I5S A;  4MPE A;  4R3M A;  2BRE A;  5M4K A;  1UY7 A;  2YEH A;  4E01 A;  1I5A A;  2WEQ A;  2FWZ A;  2FYP A;  1YT1 A;  2WEP A;  3ZKD A;  4EGK A;  3U2D A;  4YKU A;  1B63 A;  2CH4 A;  3B26 A;  4URN A;  5JEN A;  1BXD A;  2VCI A;  2C1G A;  3TTZ A;  4BQJ A;  1YS3 A;  5M4M A;  2YE2 A;  1MU5 A;  4EGI A;  2YE4 A;  4Q20 A;  2YE6 A;  1UYE A;  4ZVI A;  1B62 A;  3R91 A;  3B28 A;  5M4H A;  3MNR P;  4NH7 A;  3RLP A;  4EFT A;  3EKO A;  4LWF A;  2BU6 A;  4EM7 A;  5L3J A;  1TH8 A;  3FT5 A;  3Q5L A;  1YC1 A;  1Y8O A;  3RLQ A;  1TID A;  2YEA A;  4V25 A;  2YI5 A;  5F3K A;  3T0H A;  2ZDY A;  1YSZ A;  1QY8 A;  1F51 A;  2H55 A;  4EMV A;  4E02 A;  4XE2 A;  2CCU A;  2K5B A;  3KE6 A;  2ZBK B;  1I5C A;  4MPC A;  1OSF A;  3D2R A;  2YGF A;  2IWU A;  4KSH A;  2BYI A;  4L94 A;  4CWQ A;  4MP7 A;  4H85 A;  2YEI A;  1MX0 A;  3HZ1 A;  3R4O A;  1YC4 A;  4KQV A;  4JAV A;  4FCQ A;  4AWP A;  4LWG A;  1KIJ A;  3ZKB A;  4B6C A;  1R62 A;  2IOQ A;  5D7D A;  2XCM A;  3Q5J A;  4XKO A;  2YKC A;  3HYY A;  3PEJ A;  2GQP A;  4XKA A;  4EFU A;  3VHA A;  2EXL A;  5J6A A;  4CWS A;  4X9L A;  3R92 A;  3G7B A;  3CRL A;  4MPN A;  4CWO A;  3OMU A;  3WQ9 A;  1I5B A;  2Q8F A;  1AH8 A;  4KTN A;  4HY6 A;  4BQG A;  4XDM A;  4ASG A;  1AH6 A;  4AWQ A;  2C1I A;  1EI1 A;  2E0A A;  4CWF A;  3CRK A;  4CE2 A;  2WI7 A;  5D7C A;  4V26 A;  4MP2 A;  3EHF A;  3TZ5 A;  4CE1 A;  1NHJ A;  1S14 A;  4YKR A;  3FT8 A;  3U2K A;  4GGL A;  2Q8I A;  3HEK A;  5F5R A;  4XKK A;  2ESA A;  3VAD A;  3OW6 A;  4E72 A;  2HG1 A;  4B7P A;  2XD6 A;  1BYQ A;  4GCZ A;  3CGY A;  2WI1 A;  2O1U A;  4FCP A;  4LPB A;  1AJ6 A;  1Y4U A;  3LPS A;  2YGE A;  4YKY A;  2YE7 A;  3QDD A;  3GIE A;  5D6Q A;  2XDS A;  4L91 A;  4P7A A;  4ASA A;  4O07 A;  3R4P A;  4XIQ A;  5BOC A;  2XDU A;  2XDK A;  4W7T A;  4L8Z A;  2AKP A;  4P8O A;  3OWB A;  4HXZ A;  1UYC A;  2XDL A;  4ZKI A;  2XHR A;  3B27 A;  4PRV A;  3WHA A;  1PVG A;  2CG9 A;  3R4M A;  5FNF A;  3T0Z A;  4KFG A;  4AWO A;  3T1K A;  4WUC A;  5BOD A;  2YE8 A;  1U0Z A;  5D6P A;  4BAE A;  4LWE A;  1U2O A;  2HHI A;  4H81 A;  2WI2 A;  2YI0 A;  1QZR A;  3D0B A;  3CWV A;  2JKI A;  1YET A;  1UY9 A;  2GFD A;  2QG2 A;  2YKB A;  3PEH A;  4MOT A;  1B3Q A;  1ZXM A;  4O0B A;  4LP0 A;  3GIG A;  4HXW A;  2VCJ A;  1Y8N A;  1UY8 A;  5IDM A;  1UYH A;  1YSR A;  4R1F A;  2QG0 A;  4YKT A;  3JZ3 A;  5CTX A;  3K97 A;  3TZ0 A;  5IDJ A;  4XIR A;  2O1W A;  2VWC A;  4K4O A;  4KP4 A;  1YC3 A;  2YKI A;  4URO A;  1JM6 A;  1GKZ A;  3VHC A;  2BTZ A;  4PL9 A;  5GGZ A;  5M4N A;  4XTJ A;  4YKX A;  3TZ2 A;  1UYD A;  1EA6 A;  3LNU A;  5FND A;  4HZ5 A;  1ID0 A;  2HCH A;  2YK2 A;  2YEE A;  1I59 A;  1UYL A;  2WER A;  4E00 A;  4U7N A;  2JJC A;  3A0Y A;  4L93 A;  1AMW A;  1I58 A;  2YE3 A;  1YT0 A;  2XX4 A;  3O6O A;  4MB9 A;  4FMT A;  1YES A;  3G75 A;  4AS9 A;  4QPK A;  2XJJ A;  2YE9 A;  1UYG A;  4WUD A;  4CE3 A;  2BRC A;  1GJV A;  4GEE A;  2QF6 A;  4YKQ A;  2YKJ A;  5M4E A;  4LWI A;  4CWP A;  1UY6 A;  2CCS A;  4BIU A;  5J71 A;  3TUH A;  3T2S A;  2Q2E B;  4EEH A;  2YEJ A;  2QFO A;  3GIF A;  2FWY A;  1YER A;  1Y8P A;  3B24 A;  2BZ5 A;  2XX5 A;  2FXS A;  2YED A;  2O1V A;  2Q8G A;  4QPJ A;  2H8M A;  4ASF A;  4PRX A;  1TIL A;  3B25 A;  4GQT A;  1Z5C A;  1Z5A A;  3EHJ A;  3U67 A;  4EGH A;  1QYE A;  3OWD A;  3HHU A;  2CCT A;  4LWH A;  4NH9 A;  4ASB A;  1H7U A;  3G7E A;  3QTF A;  3Q5K A;  3A0W A;  3C11 A;  3FV5 A;  4XIT A;  1S16 A;  3D36 A;  2WI5 A;  1UYM A;  4I3H A;  4HYP A;  2IOR A;  4MBC A;  4JAS A;  3DGE A;  4R3A A;  2YEC A;  2ZDX A;  5CPH A;  4HYM A;  4HZ0 A;  2YK9 A;  2XJX A;  4U93 A;  2XHX A;  3VHD A;  2YE5 A;  2UWD A;  1AM1 A;  4XCL A;  4NH8 A;  1US7 A;  4CWT A;  4CWR A;  2BU8 A;  5M4P A;  3A0R A;  2ZKJ A;  2XK2 A;  3K99 A;  1A4H A;  5CTU A;  5FNC A;  1BKN A;  2YEF A;  1KZN A;  4DUH A;  3O0I A;  2BSM A;  3EKR A;  2BT0 A;  5CTY A;  1BGQ A;  2YEB A;  4GT8 A;  2HKJ A;  1TC6 A;  2BU2 A;  2BU7 A;  2BU5 A;  1ZW9 A;  1GKX A;  3GIG B;  4XD8 A;  2PNR A;  1TBW A;  1TC0 A;  2IOP A;  2XDX A;  3R4N A;  4JAU A;  3ZM7 A;  1THN A;  5CTW A;  1Z5B A;  3RLR A;  1I5D A;  2WI3 A;  2YI7 A;  1UYI A;  2CGF A;  3EHH A;  1YT2 A;  3OPD A;  4XC0 A;  1UYF A;  4YKW A;  4U7O A;  2YGA A;  3IED A;  2Q8H A;  4GFN A;  3SL2 A;  1H7S A;  5IN9 A;  3TZ4 A;  1UYK A;  3T10 A;  4H7Q A;  5D7R A;  4L90 A;  3K98 A;  3HYZ A;  3EHG A;  1L0O A;  2VW5 A;  3HZ5 A;  3K60 A;  2YJW A;  2FTK A;  3H4L A;  4URM A;  1ZXN A;  1Y4S A;  1NHI A;  4O04 A;  4FPP A; 
#chains in the Genus database with same CATH homology
 4URL A;  4BXI A;  2IWS A;  2IWX A;  3A0T A;  3A0X A;  1ZWH A;  3NMQ A;  2WI6 A;  4JQL A;  4O05 A;  4O09 A;  4PU9 A;  2C2A A;  4XCJ A;  4XIP A;  2YKE A;  3C0E A;  4BIZ A;  3ZXO A;  5CF0 A;  3CGZ A;  5C93 A;  2YJX A;  4FCR A;  3ZXQ A;  2XHT A;  1NHH A;  2XAB A;  2BYH A;  5FWK A;  1Z59 A;  2YEG A;  3INW A;  3RKZ A;  2XJG A;  4YKZ A;  2WI4 A;  4DZY A;  2XX2 A;  3INX A;  4KSG A;  2YI6 A;  3O2F A;  3A0Z A;  4CWN A;  4WUB A;  4HY1 A;  3H80 A;  3BM9 A;  3BMY A;  4I5S A;  4MPE A;  4R3M A;  2BRE A;  5M4K A;  1UY7 A;  2YEH A;  4E01 A;  1I5A A;  2WEQ A;  2FWZ A;  2FYP A;  1YT1 A;  2WEP A;  3ZKD A;  4EGK A;  3U2D A;  4YKU A;  1B63 A;  2CH4 A;  3B26 A;  4URN A;  1BXD A;  2VCI A;  3TTZ A;  4BQJ A;  1YS3 A;  5M4M A;  2YE2 A;  1MU5 A;  4EGI A;  2YE4 A;  4Q20 A;  2YE6 A;  1UYE A;  4ZVI A;  1B62 A;  3R91 A;  3B28 A;  5M4H A;  3MNR P;  4NH7 A;  3RLP A;  4EFT A;  3EKO A;  4LWF A;  2BU6 A;  4EM7 A;  5L3J A;  1TH8 A;  3FT5 A;  3Q5L A;  1YC1 A;  1Y8O A;  3RLQ A;  1TID A;  2YEA A;  4V25 A;  2YI5 A;  5F3K A;  3T0H A;  2ZDY A;  1YSZ A;  1QY8 A;  2H55 A;  4EMV A;  4E02 A;  4XE2 A;  2CCU A;  2K5B A;  3KE6 A;  2ZBK B;  1I5C A;  4MPC A;  1OSF A;  3D2R A;  2YGF A;  2IWU A;  4KSH A;  2BYI A;  4L94 A;  4CWQ A;  4MP7 A;  4H85 A;  2YEI A;  1MX0 A;  3HZ1 A;  3R4O A;  1YC4 A;  4KQV A;  4JAV A;  4FCQ A;  4AWP A;  4LWG A;  1KIJ A;  3ZKB A;  4B6C A;  1R62 A;  2IOQ A;  5D7D A;  2XCM A;  3Q5J A;  4XKO A;  2YKC A;  3HYY A;  3PEJ A;  2GQP A;  4XKA A;  4EFU A;  3VHA A;  2EXL A;  5J6A A;  4CWS A;  4X9L A;  3R92 A;  3G7B A;  3CRL A;  4MPN A;  4CWO A;  3OMU A;  3WQ9 A;  1I5B A;  2Q8F A;  1AH8 A;  4KTN A;  4HY6 A;  4BQG A;  4XDM A;  4ASG A;  1AH6 A;  4AWQ A;  1EI1 A;  2E0A A;  4CWF A;  3CRK A;  4CE2 A;  2WI7 A;  5D7C A;  4V26 A;  4MP2 A;  3EHF A;  3TZ5 A;  4CE1 A;  1NHJ A;  1S14 A;  4YKR A;  3FT8 A;  3U2K A;  4GGL A;  2Q8I A;  3HEK A;  5F5R A;  4XKK A;  2ESA A;  3VAD A;  3OW6 A;  2HG1 A;  4B7P A;  2XD6 A;  1BYQ A;  4GCZ A;  3CGY A;  2WI1 A;  2O1U A;  4FCP A;  4LPB A;  1AJ6 A;  1Y4U A;  3LPS A;  2YGE A;  4YKY A;  2YE7 A;  3QDD A;  3GIE A;  5D6Q A;  2XDS A;  4L91 A;  4P7A A;  4ASA A;  4O07 A;  3R4P A;  4XIQ A;  5BOC A;  2XDU A;  2XDK A;  4W7T A;  4L8Z A;  2AKP A;  4P8O A;  3OWB A;  4HXZ A;  1UYC A;  2XDL A;  4ZKI A;  2XHR A;  3B27 A;  4PRV A;  3WHA A;  1PVG A;  2CG9 A;  3R4M A;  5FNF A;  3T0Z A;  4KFG A;  4AWO A;  3T1K A;  4WUC A;  5BOD A;  2YE8 A;  1U0Z A;  5D6P A;  4BAE A;  4LWE A;  1U2O A;  4H81 A;  2WI2 A;  2YI0 A;  1QZR A;  3D0B A;  3CWV A;  2JKI A;  1YET A;  1UY9 A;  2GFD A;  2QG2 A;  2YKB A;  3PEH A;  4MOT A;  1B3Q A;  1ZXM A;  4O0B A;  4LP0 A;  3GIG A;  4HXW A;  2VCJ A;  1Y8N A;  1UY8 A;  5IDM A;  1UYH A;  1YSR A;  4R1F A;  2QG0 A;  4YKT A;  3JZ3 A;  5CTX A;  3K97 A;  3TZ0 A;  5IDJ A;  4XIR A;  2O1W A;  2VWC A;  4K4O A;  4KP4 A;  1YC3 A;  2YKI A;  4URO A;  1JM6 A;  1GKZ A;  3VHC A;  2BTZ A;  4PL9 A;  5GGZ A;  5M4N A;  4XTJ A;  4YKX A;  3TZ2 A;  1UYD A;  1EA6 A;  3LNU A;  5FND A;  4HZ5 A;  1ID0 A;  2HCH A;  2YK2 A;  2YEE A;  1I59 A;  1UYL A;  2WER A;  4E00 A;  4U7N A;  2JJC A;  3A0Y A;  4L93 A;  1AMW A;  1I58 A;  2YE3 A;  1YT0 A;  2XX4 A;  3O6O A;  4MB9 A;  4FMT A;  1YES A;  3G75 A;  4AS9 A;  4QPK A;  2XJJ A;  2YE9 A;  1UYG A;  4WUD A;  4CE3 A;  2BRC A;  1GJV A;  4GEE A;  2QF6 A;  4YKQ A;  2YKJ A;  5M4E A;  4LWI A;  4CWP A;  1UY6 A;  2CCS A;  4BIU A;  5J71 A;  3TUH A;  3T2S A;  2Q2E B;  4EEH A;  2YEJ A;  2QFO A;  3GIF A;  2FWY A;  1YER A;  1Y8P A;  3B24 A;  2BZ5 A;  2XX5 A;  2FXS A;  2YED A;  2O1V A;  2Q8G A;  4QPJ A;  2H8M A;  4ASF A;  4PRX A;  1TIL A;  3B25 A;  4GQT A;  1Z5C A;  1Z5A A;  3EHJ A;  3U67 A;  4EGH A;  1QYE A;  3OWD A;  3HHU A;  2CCT A;  4LWH A;  4NH9 A;  4ASB A;  1H7U A;  3G7E A;  3QTF A;  3Q5K A;  3A0W A;  3C11 A;  3FV5 A;  4XIT A;  1S16 A;  3D36 A;  2WI5 A;  1UYM A;  4I3H A;  4HYP A;  2IOR A;  4MBC A;  4JAS A;  3DGE A;  4R3A A;  2YEC A;  2ZDX A;  5CPH A;  4HYM A;  4HZ0 A;  2YK9 A;  2XJX A;  4U93 A;  2XHX A;  3VHD A;  2YE5 A;  2UWD A;  1AM1 A;  4XCL A;  4NH8 A;  1US7 A;  4CWT A;  4CWR A;  2BU8 A;  5M4P A;  3A0R A;  2ZKJ A;  2XK2 A;  3K99 A;  1A4H A;  5CTU A;  5FNC A;  1BKN A;  2YEF A;  1KZN A;  4DUH A;  3O0I A;  2BSM A;  3EKR A;  2BT0 A;  5CTY A;  1BGQ A;  2YEB A;  4GT8 A;  2HKJ A;  1TC6 A;  2BU2 A;  2BU7 A;  2BU5 A;  1ZW9 A;  1GKX A;  3GIG B;  4XD8 A;  2PNR A;  1TBW A;  1TC0 A;  2IOP A;  2XDX A;  3R4N A;  4JAU A;  3ZM7 A;  1THN A;  5CTW A;  1Z5B A;  3RLR A;  1I5D A;  2WI3 A;  2YI7 A;  1UYI A;  2CGF A;  3EHH A;  1YT2 A;  3OPD A;  4XC0 A;  1UYF A;  4YKW A;  4U7O A;  2YGA A;  3IED A;  2Q8H A;  4GFN A;  3SL2 A;  1H7S A;  5IN9 A;  3TZ4 A;  1UYK A;  3T10 A;  4H7Q A;  5D7R A;  4L90 A;  3K98 A;  3HYZ A;  3EHG A;  1L0O A;  2VW5 A;  3HZ5 A;  3K60 A;  2YJW A;  3H4L A;  4URM A;  1ZXN A;  1Y4S A;  1NHI A;  4O04 A;  4FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...