3A0WA

Catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
152
structure length
152
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0wA00
4AS9A 5D7DA 1EA6A 4L90A 4HZ0A 3RKZA 5M4MA 1ZWHA 2YJXA 3O6OA 3A0YA 4B6CA 2CCUA 2ZDYA 2XDKA 2VW5A 4CWOA 2XD6A 2AKPA 4URLA 4EGHA 3VHCA 1YERA 3DGEA 3EHFA 4LWHA 4QPKA 2UWDA 2YE5A 1B62A 3ZM7A 2BU7A 4KFGA 5GGZA 4XIQA 1Z5CA 2YE4A 4LWEA 2HG1A 5CTWA 1ZXMA 2QG2A 4CE2A 2YEAA 2HKJA 4BXIA 4EGIA 1YT0A 4YKUA 2IORA 5CF0A 3CGZA 1UY7A 4GT8A 1B3QA 3VADA 4ASFA 5D7CA 3EKRA 2FWZA 2BSMA 2HCHA 4URNA 2CH4A 2O1WA 4XTJA 3TZ5A 4WUDA 4H85A 3ZKBA 4MBCA 2XABA 2YKBA 4LPBA 3D36A 3LPSA 1THNA 2BU8A 4KP4A 1KZNA 1MX0A 2YJWA 3A0ZA 4URMA 4CWTA 4ASBA 3TZ2A 3LNUA 4GQTA 3D0BA 3HEKA 4ZKIA 1YSRA 4YKTA 3ZXOA 2BRCA 4I3HA 2WERA 2Q8GA 3B24A 2FWYA 1R62A 3T0HA 4EEHA 3U2KA 2XJGA 2YEJA 5D7RA 3TZ0A 3HZ5A 4H81A 4AWQA 4JQLA 5M4NA 4X9LA 3OW6A 4U7OA 3U67A 4XD8A 1TILA 5CTXA 3K98A 3HYYA 4XCJA 1AMWA 4L91A 1GKZA 3FT5A 1A4HA 3B25A 4W7TA 2YKIA 2YKCA 2CG9A 2VCJA 3PEJA 4XIRA 4XDMA 5D6PA 4WUBA 3VHAA 4FCRA 4L94A 4YKYA 2YGAA 2XDXA 2XHXA 5L3JA 4NH7A 4EFUA 3TUHA 1UY9A 4O04A 4DUHA 3H80A 1H7UA 2VCIA 1NHIA 3K97A 2XDLA 3QDDA 4E00A 1UY8A 2YE2A 2YGFA 2IOPA 2YEGA 2GQPA 2IOQA 3R4OA 4XKKA 2XDUA 3Q5LA 4U7NA 4GEEA 3EKOA 4ASGA 3C0EA 5BODA 4HXZA 3WHAA 2BU5A 2O1VA 4YKRA 1YS3A 4O07A 1BKNA 1UYGA 4V26A 4BQGA 1L0OA 2YI0A 2ZKJA 4HYMA 3IEDA 2BU6A 3HHUA 2FXSA 3HYZA 1ZXNA 2XJXA 3O0IA 2PNRA 4JAUA 4MP7A 4ZVIA 4KSHA 3H4LA 1AM1A 5M4PA 4MPNA 4LWGA 3CWVA 3TTZA 2YE9A 3G75A 5FNFA 2WI6A 2WI3A 4LWIA 1Y8PA 2IWXA 1BGQA 2YEIA 1U0ZA 4EM7A 2VWCA 5J6AA 1OSFA 1UYHA 2E0AA 4P7AA 2XHTA 2YEDA 1YESA 3GIGA 2WI4A 3T1KA 3ZXQA 3BM9A 2YEBA 1NHJA 2WI2A 3GIEA 3R91A 1TC0A 1B63A 3NMQA 5M4EA 4BAEA 4JASA 1I5DA 1Z5AA 3Q5KA 5IDJA 4CWRA 3R4PA 2IWUA 4R3AA 3RLRA 3G7EA 4XIPA 3T0ZA 3C11A 2BREA 1QYEA 3RLQA 4AWPA 1TH8A 1ID0A 3FT8A 2XCMA 2CGFA 2FYPA 4YKWA 2YK2A 3HZ1A 2WEPA 1S14A 4XKOA 2EXLA 2BYHA 4XC0A 4PU9A 2O1UA 2GFDA 4CWNA 1I58A 2YI6A 4L93A 3GIGB 4YKZA 1GJVA 2XHRA 1Y4SA 2Q2EB 3CRLA 3JZ3A 1TC6A 2CCSA 3INWA 1U2OA 3A0RA 3EHGA 3A0XA 2YEEA 3WQ9A 1I5BA 4FMTA 1BYQA 1S16A 1YT2A 3EHHA 4MB9A 3R4MA 4EFTA 2BYIA 2QG0A 1UYIA 3CGYA 1YETA 1BXDA 1Y4UA 4HY1A 3QTFA 2H55A 1ZW9A 4ASAA 4NH9A 5FWKA 4XKAA 1UYLA 5M4KA 1YT1A 3BMYA 4XCLA 2C2AA 2WI5A 4P8OA 1I59A 1AH8A 4CWSA 4O0BA 1YSZA 3RLPA 3OWDA 2WEQA 3A0TA 3U2DA 2K5BA 4HXWA 4R1FA 5CPHA 3KE6A 3OMUA 1US7A 1UYEA 3CRKA 3B26A 1UYKA 2YEHA 4MP2A 2YK9A 2ESAA 4AWOA 5M4HA 2YKJA 4XE2A 5F5RA 4KSGA 1I5AA 5IDMA 4LWFA 2XDSA 2XK2A 4H7QA 4MPEA 4EMVA 2XX5A 4PRXA 3G7BA 1AJ6A 4JAVA 1QZRA 4DZYA 4E02A 4CWQA 4R3MA 4BIZA 2QF6A 1UYDA 1UYCA 2JKIA 4GGLA 3K99A 4FPPA 1Z59A 1QY8A 2ZDXA 4L8ZA 4U93A 1GKXA 2ZBKB 1Y8NA 4FCQA 2YE6A 4PL9A 1NHHA 4E01A 3SL2A 1I5CA 3K60A 4MOTA 2YI7A 4O09A 2Q8HA 3T10A 3TZ4A 4I5SA 4LP0A 3ZKDA 4BIUA 1UY6A 2BT0A 3R92A 4K4OA 1H7SA 3D2RA 2YE7A 1AH6A 2YE8A 3MNRP 4O05A 2CCTA 1KIJA 4MPCA 3B28A 4QPJA 2XX2A 3OWBA 4GFNA 4YKXA 3O2FA 3R4NA 4B7PA 3INXA 3FV5A 4GCZA 4XITA 1YC3A 2H8MA 2YGEA 1UYFA 4FCPA 4WUCA 2Q8FA 4KTNA 4BQJA 4HYPA 1TIDA 2QFOA 2XX4A 3PEHA 3OPDA 5D6QA 4CWFA 3B27A 2YECA 2YKEA 1MU5A 4CWPA 2IWSA 5FNDA 2BTZA 1UYMA 4EGKA 1JM6A 3VHDA 5J71A 2JJCA 4V25A 5CTUA 1YC4A 5F3KA 2YEFA 4CE3A 2XJJA 1PVGA 5IN9A 3Q5JA 1TBWA 5BOCA 2BU2A 2YE3A 2WI7A 1Z5BA 4Q20A 4PRVA 4HZ5A 2Q8IA 3GIFA 2BZ5A 2YI5A 1EI1A 3A0WA 4NH8A 4UROA 4CE1A 2WI1A 1Y8OA 4YKQA 5CTYA 1YC1A 3T2SA 5C93A 3EHJA 4KQVA 4HY6A 5FNCA
chains in the Genus database with same CATH superfamily
4AS9A 5D7DA 1EA6A 4L90A 4HZ0A 2C1GA 3RKZA 5M4MA 1ZWHA 2YJXA 3O6OA 3A0YA 4B6CA 2CCUA 2ZDYA 2XDKA 2VW5A 4CWOA 2XD6A 2AKPA 4URLA 4EGHA 3VHCA 1YERA 3DGEA 3EHFA 4LWHA 4QPKA 2UWDA 2YE5A 1B62A 3ZM7A 2BU7A 4KFGA 5GGZA 4XIQA 1Z5CA 2YE4A 4LWEA 2HG1A 5CTWA 1ZXMA 2QG2A 4CE2A 2YEAA 2HKJA 4BXIA 4EGIA 1YT0A 4YKUA 2IORA 5CF0A 3CGZA 1UY7A 4GT8A 1B3QA 3VADA 4ASFA 1F51A 5D7CA 3EKRA 2FWZA 2BSMA 2HCHA 4URNA 2CH4A 2O1WA 4XTJA 3TZ5A 4WUDA 4H85A 3ZKBA 4MBCA 2XABA 2YKBA 4LPBA 3D36A 3LPSA 1THNA 2BU8A 4KP4A 1KZNA 1MX0A 2YJWA 3A0ZA 4URMA 4CWTA 4ASBA 3TZ2A 3CYGA 3LNUA 4GQTA 3D0BA 3HEKA 4ZKIA 1YSRA 4YKTA 3ZXOA 2BRCA 4I3HA 5JENA 2WERA 2Q8GA 3B24A 2FWYA 1R62A 3T0HA 4EEHA 3U2KA 2XJGA 2YEJA 5D7RA 3TZ0A 3HZ5A 4H81A 4AWQA 4JQLA 5M4NA 4X9LA 3OW6A 4U7OA 3U67A 4XD8A 1TILA 5CTXA 3K98A 3HYYA 4XCJA 1AMWA 4L91A 1GKZA 3FT5A 1A4HA 3B25A 4W7TA 2YKIA 2YKCA 2CG9A 2VCJA 3PEJA 4XIRA 4XDMA 5D6PA 4WUBA 3VHAA 4FCRA 4L94A 4YKYA 2YGAA 2XDXA 2XHXA 5L3JA 4NH7A 4EFUA 3TUHA 1UY9A 4O04A 4DUHA 3H80A 1H7UA 2VCIA 1NHIA 3K97A 3LMMA 2XDLA 3QDDA 4E00A 1UY8A 2YE2A 2YGFA 2IOPA 2YEGA 2GQPA 2IOQA 3R4OA 4XKKA 2XDUA 3Q5LA 4U7NA 4GEEA 3EKOA 4ASGA 3C0EA 5BODA 4HXZA 3WHAA 2BU5A 2O1VA 4YKRA 1YS3A 4O07A 1BKNA 1UYGA 4V26A 4BQGA 1L0OA 2YI0A 2ZKJA 4HYMA 3IEDA 2BU6A 3HHUA 2FXSA 3HYZA 1ZXNA 2XJXA 3O0IA 2PNRA 4JAUA 4MP7A 4ZVIA 4KSHA 3H4LA 1AM1A 2C1IA 3S5TA 5M4PA 4MPNA 4LWGA 3CWVA 3TTZA 2YE9A 3G75A 5FNFA 2WI6A 2WI3A 4LWIA 1Y8PA 2IWXA 1BGQA 2YEIA 1U0ZA 4EM7A 2VWCA 5J6AA 1OSFA 1UYHA 2E0AA 4P7AA 2XHTA 2YEDA 1YESA 3GIGA 2WI4A 3T1KA 3ZXQA 3BM9A 2YEBA 1NHJA 2WI2A 3GIEA 3R91A 1TC0A 1B63A 3NMQA 5M4EA 4BAEA 4JASA 1I5DA 1Z5AA 3Q5KA 5IDJA 4CWRA 3R4PA 2IWUA 4R3AA 3RLRA 3G7EA 4XIPA 3T0ZA 3C11A 2BREA 1QYEA 3RLQA 4AWPA 1TH8A 1ID0A 3FT8A 2XCMA 2CGFA 2FYPA 4YKWA 2YK2A 3HZ1A 2WEPA 1S14A 4XKOA 2EXLA 2BYHA 4XC0A 4PU9A 2O1UA 2GFDA 4CWNA 1I58A 2YI6A 4L93A 3GIGB 4YKZA 1GJVA 2XHRA 1Y4SA 2HHIA 2Q2EB 3JZ3A 1TC6A 2CCSA 3CRLA 3INWA 1U2OA 3A0RA 2FTKA 3EHGA 3A0XA 2YEEA 3WQ9A 1I5BA 4FMTA 1BYQA 1S16A 1YT2A 3EHHA 4MB9A 3R4MA 4EFTA 2BYIA 2QG0A 1UYIA 3CGYA 1YETA 1BXDA 1Y4UA 4HY1A 3QTFA 2H55A 1ZW9A 4ASAA 4NH9A 5FWKA 4XKAA 1UYLA 5M4KA 1YT1A 3BMYA 4XCLA 2C2AA 2WI5A 4P8OA 1I59A 1AH8A 4CWSA 4O0BA 1YSZA 3RLPA 3OWDA 2WEQA 3A0TA 3U2DA 2K5BA 4HXWA 4R1FA 5CPHA 3KE6A 3OMUA 1US7A 1UYEA 3CRKA 3B26A 1UYKA 2YEHA 4MP2A 2YK9A 2ESAA 4AWOA 5M4HA 2YKJA 4XE2A 5F5RA 4KSGA 1I5AA 5IDMA 4LWFA 2XDSA 2XK2A 4H7QA 4MPEA 4EMVA 2XX5A 4PRXA 3G7BA 1AJ6A 4JAVA 1QZRA 4DZYA 4E02A 4CWQA 4R3MA 4BIZA 2QF6A 1UYDA 1UYCA 2JKIA 4GGLA 3K99A 4FPPA 1Z59A 1QY8A 2ZDXA 4L8ZA 4U93A 1GKXA 2ZBKB 1Y8NA 4FCQA 2YE6A 4PL9A 1NHHA 4E01A 3SL2A 1I5CA 3K60A 4MOTA 2YI7A 4O09A 2Q8HA 3T10A 3TZ4A 4I5SA 4LP0A 3ZKDA 4BIUA 1UY6A 2BT0A 3R92A 4K4OA 1H7SA 3D2RA 2YE7A 1AH6A 2YE8A 3MNRP 4O05A 4E72A 2CCTA 1KIJA 4MPCA 3B28A 4QPJA 2XX2A 3OWBA 4GFNA 4YKXA 3O2FA 3R4NA 4B7PA 3INXA 3FV5A 4GCZA 4XITA 1YC3A 2H8MA 2YGEA 1UYFA 4FCPA 4WUCA 2Q8FA 4KTNA 4BQJA 4HYPA 1TIDA 2QFOA 2XX4A 3PEHA 3OPDA 5D6QA 4CWFA 3B27A 1IXMA 2YECA 2YKEA 1MU5A 4CWPA 2IWSA 5FNDA 2BTZA 1UYMA 4EGKA 1JM6A 3VHDA 5J71A 2JJCA 4V25A 5CTUA 1YC4A 5F3KA 2YEFA 4CE3A 2XJJA 1PVGA 5IN9A 3Q5JA 1TBWA 5BOCA 2BU2A 2YE3A 2WI7A 1Z5BA 4Q20A 4PRVA 4HZ5A 2Q8IA 3GIFA 2BZ5A 2YI5A 1EI1A 3A0WA 4NH8A 4UROA 4CE1A 2WI1A 1Y8OA 4YKQA 5CTYA 1YC1A 3T2SA 5C93A 3EHJA 4KQVA 4HY6A 5FNCA
chains in the Genus database with same CATH topology
4AS9A 5D7DA 1EA6A 4L90A 4HZ0A 3RKZA 5M4MA 1ZWHA 2YJXA 3O6OA 3A0YA 4B6CA 2CCUA 2ZDYA 2XDKA 2VW5A 4CWOA 2XD6A 2AKPA 4URLA 4EGHA 3VHCA 1YERA 3DGEA 3EHFA 4LWHA 4QPKA 2UWDA 2YE5A 1B62A 3ZM7A 2BU7A 4KFGA 5GGZA 4XIQA 1Z5CA 2YE4A 4LWEA 2HG1A 5CTWA 1ZXMA 2QG2A 4CE2A 2YEAA 2HKJA 4BXIA 4EGIA 1YT0A 4YKUA 2IORA 5CF0A 3CGZA 1UY7A 4GT8A 1B3QA 3VADA 4ASFA 5D7CA 3EKRA 2FWZA 2BSMA 2HCHA 4URNA 2CH4A 2O1WA 4XTJA 3TZ5A 4WUDA 4H85A 3ZKBA 4MBCA 2XABA 2YKBA 4LPBA 3D36A 3LPSA 1THNA 2BU8A 4KP4A 1KZNA 1MX0A 2YJWA 3A0ZA 4URMA 4CWTA 4ASBA 3TZ2A 3LNUA 4GQTA 3D0BA 3HEKA 4ZKIA 1YSRA 4YKTA 3ZXOA 2BRCA 4I3HA 2WERA 2Q8GA 3B24A 2FWYA 1R62A 3T0HA 4EEHA 3U2KA 2XJGA 2YEJA 5D7RA 3TZ0A 3HZ5A 4H81A 4AWQA 4JQLA 5M4NA 4X9LA 3OW6A 4U7OA 3U67A 4XD8A 1TILA 5CTXA 3K98A 3HYYA 4XCJA 1AMWA 4L91A 1GKZA 3FT5A 1A4HA 3B25A 4W7TA 2YKIA 2YKCA 2CG9A 2VCJA 3PEJA 4XIRA 4XDMA 5D6PA 4WUBA 3VHAA 4FCRA 4L94A 4YKYA 2YGAA 2XDXA 2XHXA 5L3JA 4NH7A 4EFUA 3TUHA 1UY9A 4O04A 4DUHA 3H80A 1H7UA 2VCIA 1NHIA 3K97A 2XDLA 3QDDA 4E00A 1UY8A 2YE2A 2YGFA 2IOPA 2YEGA 2GQPA 2IOQA 3R4OA 4XKKA 2XDUA 3Q5LA 4U7NA 4GEEA 3EKOA 4ASGA 3C0EA 5BODA 4HXZA 3WHAA 2BU5A 2O1VA 4YKRA 1YS3A 4O07A 1BKNA 1UYGA 4V26A 4BQGA 1L0OA 2YI0A 2ZKJA 4HYMA 3IEDA 2BU6A 3HHUA 2FXSA 3HYZA 1ZXNA 2XJXA 3O0IA 2PNRA 4JAUA 4MP7A 4ZVIA 4KSHA 3H4LA 1AM1A 5M4PA 4MPNA 4LWGA 3CWVA 3TTZA 2YE9A 3G75A 5FNFA 2WI6A 2WI3A 4LWIA 1Y8PA 2IWXA 1BGQA 2YEIA 1U0ZA 4EM7A 2VWCA 5J6AA 1OSFA 1UYHA 2E0AA 4P7AA 2XHTA 2YEDA 1YESA 3GIGA 2WI4A 3T1KA 3ZXQA 3BM9A 2YEBA 1NHJA 2WI2A 3GIEA 3R91A 1TC0A 1B63A 3NMQA 5M4EA 4BAEA 4JASA 1I5DA 1Z5AA 3Q5KA 5IDJA 4CWRA 3R4PA 2IWUA 4R3AA 3RLRA 3G7EA 4XIPA 3T0ZA 3C11A 2BREA 1QYEA 3RLQA 4AWPA 1TH8A 1ID0A 3FT8A 2XCMA 2CGFA 2FYPA 4YKWA 2YK2A 3HZ1A 2WEPA 1S14A 4XKOA 2EXLA 2BYHA 4XC0A 4PU9A 2O1UA 2GFDA 4CWNA 1I58A 2YI6A 4L93A 3GIGB 4YKZA 1GJVA 2XHRA 1Y4SA 2Q2EB 3CRLA 3JZ3A 1TC6A 2CCSA 3INWA 1U2OA 3A0RA 3EHGA 3A0XA 2YEEA 3WQ9A 1I5BA 4FMTA 1BYQA 1S16A 1YT2A 3EHHA 4MB9A 3R4MA 4EFTA 2BYIA 2QG0A 1UYIA 3CGYA 1YETA 1BXDA 1Y4UA 4HY1A 3QTFA 2H55A 1ZW9A 4ASAA 4NH9A 5FWKA 4XKAA 1UYLA 5M4KA 1YT1A 3BMYA 4XCLA 2C2AA 2WI5A 4P8OA 1I59A 1AH8A 4CWSA 4O0BA 1YSZA 3RLPA 3OWDA 2WEQA 3A0TA 3U2DA 2K5BA 4HXWA 4R1FA 5CPHA 3KE6A 3OMUA 1US7A 1UYEA 3CRKA 3B26A 1UYKA 2YEHA 4MP2A 2YK9A 2ESAA 4AWOA 5M4HA 2YKJA 4XE2A 5F5RA 4KSGA 1I5AA 5IDMA 4LWFA 2XDSA 2XK2A 4H7QA 4MPEA 4EMVA 2XX5A 4PRXA 3G7BA 1AJ6A 4JAVA 1QZRA 4DZYA 4E02A 4CWQA 4R3MA 4BIZA 2QF6A 1UYDA 1UYCA 2JKIA 4GGLA 3K99A 4FPPA 1Z59A 1QY8A 2ZDXA 4L8ZA 4U93A 1GKXA 2ZBKB 1Y8NA 4FCQA 2YE6A 4PL9A 1NHHA 4E01A 3SL2A 1I5CA 3K60A 4MOTA 2YI7A 4O09A 2Q8HA 3T10A 3TZ4A 4I5SA 4LP0A 3ZKDA 4BIUA 1UY6A 2BT0A 3R92A 4K4OA 1H7SA 3D2RA 2YE7A 1AH6A 2YE8A 3MNRP 4O05A 2CCTA 1KIJA 4MPCA 3B28A 4QPJA 2XX2A 3OWBA 4GFNA 4YKXA 3O2FA 3R4NA 4B7PA 3INXA 3FV5A 4GCZA 4XITA 1YC3A 2H8MA 2YGEA 1UYFA 4FCPA 4WUCA 2Q8FA 4KTNA 4BQJA 4HYPA 1TIDA 2QFOA 2XX4A 3PEHA 3OPDA 5D6QA 4CWFA 3B27A 2YECA 2YKEA 1MU5A 4CWPA 2IWSA 5FNDA 2BTZA 1UYMA 4EGKA 1JM6A 3VHDA 5J71A 2JJCA 4V25A 5CTUA 1YC4A 5F3KA 2YEFA 4CE3A 2XJJA 1PVGA 5IN9A 3Q5JA 1TBWA 5BOCA 2BU2A 2YE3A 2WI7A 1Z5BA 4Q20A 4PRVA 4HZ5A 2Q8IA 3GIFA 2BZ5A 2YI5A 1EI1A 3A0WA 4NH8A 4UROA 4CE1A 2WI1A 1Y8OA 4YKQA 5CTYA 1YC1A 3T2SA 5C93A 3EHJA 4KQVA 4HY6A 5FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AS9 A;  5D7D A;  1EA6 A;  4L90 A;  4HZ0 A;  3RKZ A;  5M4M A;  1ZWH A;  2YJX A;  3O6O A;  3A0Y A;  4B6C A;  2CCU A;  2ZDY A;  2XDK A;  2VW5 A;  4CWO A;  2XD6 A;  2AKP A;  4URL A;  4EGH A;  3VHC A;  1YER A;  3DGE A;  3EHF A;  4LWH A;  4QPK A;  2UWD A;  2YE5 A;  1B62 A;  3ZM7 A;  2BU7 A;  4KFG A;  5GGZ A;  4XIQ A;  1Z5C A;  2YE4 A;  4LWE A;  2HG1 A;  5CTW A;  1ZXM A;  2QG2 A;  4CE2 A;  2YEA A;  2HKJ A;  4BXI A;  4EGI A;  1YT0 A;  4YKU A;  2IOR A;  5CF0 A;  3CGZ A;  1UY7 A;  4GT8 A;  1B3Q A;  3VAD A;  4ASF A;  5D7C A;  3EKR A;  2FWZ A;  2BSM A;  2HCH A;  4URN A;  2CH4 A;  2O1W A;  4XTJ A;  3TZ5 A;  4WUD A;  4H85 A;  3ZKB A;  4MBC A;  2XAB A;  2YKB A;  4LPB A;  3D36 A;  3LPS A;  1THN A;  2BU8 A;  4KP4 A;  1KZN A;  1MX0 A;  2YJW A;  3A0Z A;  4URM A;  4CWT A;  4ASB A;  3TZ2 A;  3LNU A;  4GQT A;  3D0B A;  3HEK A;  4ZKI A;  1YSR A;  4YKT A;  3ZXO A;  2BRC A;  4I3H A;  2WER A;  2Q8G A;  3B24 A;  2FWY A;  1R62 A;  3T0H A;  4EEH A;  3U2K A;  2XJG A;  2YEJ A;  5D7R A;  3TZ0 A;  3HZ5 A;  4H81 A;  4AWQ A;  4JQL A;  5M4N A;  4X9L A;  3OW6 A;  4U7O A;  3U67 A;  4XD8 A;  1TIL A;  5CTX A;  3K98 A;  3HYY A;  4XCJ A;  1AMW A;  4L91 A;  1GKZ A;  3FT5 A;  1A4H A;  3B25 A;  4W7T A;  2YKI A;  2YKC A;  2CG9 A;  2VCJ A;  3PEJ A;  4XIR A;  4XDM A;  5D6P A;  4WUB A;  3VHA A;  4FCR A;  4L94 A;  4YKY A;  2YGA A;  2XDX A;  2XHX A;  5L3J A;  4NH7 A;  4EFU A;  3TUH A;  1UY9 A;  4O04 A;  4DUH A;  3H80 A;  1H7U A;  2VCI A;  1NHI A;  3K97 A;  2XDL A;  3QDD A;  4E00 A;  1UY8 A;  2YE2 A;  2YGF A;  2IOP A;  2YEG A;  2GQP A;  2IOQ A;  3R4O A;  4XKK A;  2XDU A;  3Q5L A;  4U7N A;  4GEE A;  3EKO A;  4ASG A;  3C0E A;  5BOD A;  4HXZ A;  3WHA A;  2BU5 A;  2O1V A;  4YKR A;  1YS3 A;  4O07 A;  1BKN A;  1UYG A;  4V26 A;  4BQG A;  1L0O A;  2YI0 A;  2ZKJ A;  4HYM A;  3IED A;  2BU6 A;  3HHU A;  2FXS A;  3HYZ A;  1ZXN A;  2XJX A;  3O0I A;  2PNR A;  4JAU A;  4MP7 A;  4ZVI A;  4KSH A;  3H4L A;  1AM1 A;  5M4P A;  4MPN A;  4LWG A;  3CWV A;  3TTZ A;  2YE9 A;  3G75 A;  5FNF A;  2WI6 A;  2WI3 A;  4LWI A;  1Y8P A;  2IWX A;  1BGQ A;  2YEI A;  1U0Z A;  4EM7 A;  2VWC A;  5J6A A;  1OSF A;  1UYH A;  2E0A A;  4P7A A;  2XHT A;  2YED A;  1YES A;  3GIG A;  2WI4 A;  3T1K A;  3ZXQ A;  3BM9 A;  2YEB A;  1NHJ A;  2WI2 A;  3GIE A;  3R91 A;  1TC0 A;  1B63 A;  3NMQ A;  5M4E A;  4BAE A;  4JAS A;  1I5D A;  1Z5A A;  3Q5K A;  5IDJ A;  4CWR A;  3R4P A;  2IWU A;  4R3A A;  3RLR A;  3G7E A;  4XIP A;  3T0Z A;  3C11 A;  2BRE A;  1QYE A;  3RLQ A;  4AWP A;  1TH8 A;  1ID0 A;  3FT8 A;  2XCM A;  2CGF A;  2FYP A;  4YKW A;  2YK2 A;  3HZ1 A;  2WEP A;  1S14 A;  4XKO A;  2EXL A;  2BYH A;  4XC0 A;  4PU9 A;  2O1U A;  2GFD A;  4CWN A;  1I58 A;  2YI6 A;  4L93 A;  3GIG B;  4YKZ A;  1GJV A;  2XHR A;  1Y4S A;  2Q2E B;  3CRL A;  3JZ3 A;  1TC6 A;  2CCS A;  3INW A;  1U2O A;  3A0R A;  3EHG A;  3A0X A;  2YEE A;  3WQ9 A;  1I5B A;  4FMT A;  1BYQ A;  1S16 A;  1YT2 A;  3EHH A;  4MB9 A;  3R4M A;  4EFT A;  2BYI A;  2QG0 A;  1UYI A;  3CGY A;  1YET A;  1BXD A;  1Y4U A;  4HY1 A;  3QTF A;  2H55 A;  1ZW9 A;  4ASA A;  4NH9 A;  5FWK A;  4XKA A;  1UYL A;  5M4K A;  1YT1 A;  3BMY A;  4XCL A;  2C2A A;  2WI5 A;  4P8O A;  1I59 A;  1AH8 A;  4CWS A;  4O0B A;  1YSZ A;  3RLP A;  3OWD A;  2WEQ A;  3A0T A;  3U2D A;  2K5B A;  4HXW A;  4R1F A;  5CPH A;  3KE6 A;  3OMU A;  1US7 A;  1UYE A;  3CRK A;  3B26 A;  1UYK A;  2YEH A;  4MP2 A;  2YK9 A;  2ESA A;  4AWO A;  5M4H A;  2YKJ A;  4XE2 A;  5F5R A;  4KSG A;  1I5A A;  5IDM A;  4LWF A;  2XDS A;  2XK2 A;  4H7Q A;  4MPE A;  4EMV A;  2XX5 A;  4PRX A;  3G7B A;  1AJ6 A;  4JAV A;  1QZR A;  4DZY A;  4E02 A;  4CWQ A;  4R3M A;  4BIZ A;  2QF6 A;  1UYD A;  1UYC A;  2JKI A;  4GGL A;  3K99 A;  4FPP A;  1Z59 A;  1QY8 A;  2ZDX A;  4L8Z A;  4U93 A;  1GKX A;  2ZBK B;  1Y8N A;  4FCQ A;  2YE6 A;  4PL9 A;  1NHH A;  4E01 A;  3SL2 A;  1I5C A;  3K60 A;  4MOT A;  2YI7 A;  4O09 A;  2Q8H A;  3T10 A;  3TZ4 A;  4I5S A;  4LP0 A;  3ZKD A;  4BIU A;  1UY6 A;  2BT0 A;  3R92 A;  4K4O A;  1H7S A;  3D2R A;  2YE7 A;  1AH6 A;  2YE8 A;  3MNR P;  4O05 A;  2CCT A;  1KIJ A;  4MPC A;  3B28 A;  4QPJ A;  2XX2 A;  3OWB A;  4GFN A;  4YKX A;  3O2F A;  3R4N A;  4B7P A;  3INX A;  3FV5 A;  4GCZ A;  4XIT A;  1YC3 A;  2H8M A;  2YGE A;  1UYF A;  4FCP A;  4WUC A;  2Q8F A;  4KTN A;  4BQJ A;  4HYP A;  1TID A;  2QFO A;  2XX4 A;  3PEH A;  3OPD A;  5D6Q A;  4CWF A;  3B27 A;  2YEC A;  2YKE A;  1MU5 A;  4CWP A;  2IWS A;  5FND A;  2BTZ A;  1UYM A;  4EGK A;  1JM6 A;  3VHD A;  5J71 A;  2JJC A;  4V25 A;  5CTU A;  1YC4 A;  5F3K A;  2YEF A;  4CE3 A;  2XJJ A;  1PVG A;  5IN9 A;  3Q5J A;  1TBW A;  5BOC A;  2BU2 A;  2YE3 A;  2WI7 A;  1Z5B A;  4Q20 A;  4PRV A;  4HZ5 A;  2Q8I A;  3GIF A;  2BZ5 A;  2YI5 A;  1EI1 A;  3A0W A;  4NH8 A;  4URO A;  4CE1 A;  2WI1 A;  1Y8O A;  4YKQ A;  5CTY A;  1YC1 A;  3T2S A;  5C93 A;  3EHJ A;  4KQV A;  4HY6 A;  5FNC A; 
#chains in the Genus database with same CATH topology
 4AS9 A;  5D7D A;  1EA6 A;  4L90 A;  4HZ0 A;  2C1G A;  3RKZ A;  5M4M A;  1ZWH A;  2YJX A;  3O6O A;  3A0Y A;  4B6C A;  2CCU A;  2ZDY A;  2XDK A;  2VW5 A;  4CWO A;  2XD6 A;  2AKP A;  4URL A;  4EGH A;  3VHC A;  1YER A;  3DGE A;  3EHF A;  4LWH A;  4QPK A;  2UWD A;  2YE5 A;  1B62 A;  3ZM7 A;  2BU7 A;  4KFG A;  5GGZ A;  4XIQ A;  1Z5C A;  2YE4 A;  4LWE A;  2HG1 A;  5CTW A;  1ZXM A;  2QG2 A;  4CE2 A;  2YEA A;  2HKJ A;  4BXI A;  4EGI A;  1YT0 A;  4YKU A;  2IOR A;  5CF0 A;  3CGZ A;  1UY7 A;  4GT8 A;  1B3Q A;  3VAD A;  4ASF A;  1F51 A;  5D7C A;  3EKR A;  2FWZ A;  2BSM A;  2HCH A;  4URN A;  2CH4 A;  2O1W A;  4XTJ A;  3TZ5 A;  4WUD A;  4H85 A;  3ZKB A;  4MBC A;  2XAB A;  2YKB A;  4LPB A;  3D36 A;  3LPS A;  1THN A;  2BU8 A;  4KP4 A;  1KZN A;  1MX0 A;  2YJW A;  3A0Z A;  4URM A;  4CWT A;  4ASB A;  3TZ2 A;  3CYG A;  3LNU A;  4GQT A;  3D0B A;  3HEK A;  4ZKI A;  1YSR A;  4YKT A;  3ZXO A;  2BRC A;  4I3H A;  5JEN A;  2WER A;  2Q8G A;  3B24 A;  2FWY A;  1R62 A;  3T0H A;  4EEH A;  3U2K A;  2XJG A;  2YEJ A;  5D7R A;  3TZ0 A;  3HZ5 A;  4H81 A;  4AWQ A;  4JQL A;  5M4N A;  4X9L A;  3OW6 A;  4U7O A;  3U67 A;  4XD8 A;  1TIL A;  5CTX A;  3K98 A;  3HYY A;  4XCJ A;  1AMW A;  4L91 A;  1GKZ A;  3FT5 A;  1A4H A;  3B25 A;  4W7T A;  2YKI A;  2YKC A;  2CG9 A;  2VCJ A;  3PEJ A;  4XIR A;  4XDM A;  5D6P A;  4WUB A;  3VHA A;  4FCR A;  4L94 A;  4YKY A;  2YGA A;  2XDX A;  2XHX A;  5L3J A;  4NH7 A;  4EFU A;  3TUH A;  1UY9 A;  4O04 A;  4DUH A;  3H80 A;  1H7U A;  2VCI A;  1NHI A;  3K97 A;  3LMM A;  2XDL A;  3QDD A;  4E00 A;  1UY8 A;  2YE2 A;  2YGF A;  2IOP A;  2YEG A;  2GQP A;  2IOQ A;  3R4O A;  4XKK A;  2XDU A;  3Q5L A;  4U7N A;  4GEE A;  3EKO A;  4ASG A;  3C0E A;  5BOD A;  4HXZ A;  3WHA A;  2BU5 A;  2O1V A;  4YKR A;  1YS3 A;  4O07 A;  1BKN A;  1UYG A;  4V26 A;  4BQG A;  1L0O A;  2YI0 A;  2ZKJ A;  4HYM A;  3IED A;  2BU6 A;  3HHU A;  2FXS A;  3HYZ A;  1ZXN A;  2XJX A;  3O0I A;  2PNR A;  4JAU A;  4MP7 A;  4ZVI A;  4KSH A;  3H4L A;  1AM1 A;  2C1I A;  3S5T A;  5M4P A;  4MPN A;  4LWG A;  3CWV A;  3TTZ A;  2YE9 A;  3G75 A;  5FNF A;  2WI6 A;  2WI3 A;  4LWI A;  1Y8P A;  2IWX A;  1BGQ A;  2YEI A;  1U0Z A;  4EM7 A;  2VWC A;  5J6A A;  1OSF A;  1UYH A;  2E0A A;  4P7A A;  2XHT A;  2YED A;  1YES A;  3GIG A;  2WI4 A;  3T1K A;  3ZXQ A;  3BM9 A;  2YEB A;  1NHJ A;  2WI2 A;  3GIE A;  3R91 A;  1TC0 A;  1B63 A;  3NMQ A;  5M4E A;  4BAE A;  4JAS A;  1I5D A;  1Z5A A;  3Q5K A;  5IDJ A;  4CWR A;  3R4P A;  2IWU A;  4R3A A;  3RLR A;  3G7E A;  4XIP A;  3T0Z A;  3C11 A;  2BRE A;  1QYE A;  3RLQ A;  4AWP A;  1TH8 A;  1ID0 A;  3FT8 A;  2XCM A;  2CGF A;  2FYP A;  4YKW A;  2YK2 A;  3HZ1 A;  2WEP A;  1S14 A;  4XKO A;  2EXL A;  2BYH A;  4XC0 A;  4PU9 A;  2O1U A;  2GFD A;  4CWN A;  1I58 A;  2YI6 A;  4L93 A;  3GIG B;  4YKZ A;  1GJV A;  2XHR A;  1Y4S A;  2HHI A;  2Q2E B;  3JZ3 A;  1TC6 A;  2CCS A;  3CRL A;  3INW A;  1U2O A;  3A0R A;  2FTK A;  3EHG A;  3A0X A;  2YEE A;  3WQ9 A;  1I5B A;  4FMT A;  1BYQ A;  1S16 A;  1YT2 A;  3EHH A;  4MB9 A;  3R4M A;  4EFT A;  2BYI A;  2QG0 A;  1UYI A;  3CGY A;  1YET A;  1BXD A;  1Y4U A;  4HY1 A;  3QTF A;  2H55 A;  1ZW9 A;  4ASA A;  4NH9 A;  5FWK A;  4XKA A;  1UYL A;  5M4K A;  1YT1 A;  3BMY A;  4XCL A;  2C2A A;  2WI5 A;  4P8O A;  1I59 A;  1AH8 A;  4CWS A;  4O0B A;  1YSZ A;  3RLP A;  3OWD A;  2WEQ A;  3A0T A;  3U2D A;  2K5B A;  4HXW A;  4R1F A;  5CPH A;  3KE6 A;  3OMU A;  1US7 A;  1UYE A;  3CRK A;  3B26 A;  1UYK A;  2YEH A;  4MP2 A;  2YK9 A;  2ESA A;  4AWO A;  5M4H A;  2YKJ A;  4XE2 A;  5F5R A;  4KSG A;  1I5A A;  5IDM A;  4LWF A;  2XDS A;  2XK2 A;  4H7Q A;  4MPE A;  4EMV A;  2XX5 A;  4PRX A;  3G7B A;  1AJ6 A;  4JAV A;  1QZR A;  4DZY A;  4E02 A;  4CWQ A;  4R3M A;  4BIZ A;  2QF6 A;  1UYD A;  1UYC A;  2JKI A;  4GGL A;  3K99 A;  4FPP A;  1Z59 A;  1QY8 A;  2ZDX A;  4L8Z A;  4U93 A;  1GKX A;  2ZBK B;  1Y8N A;  4FCQ A;  2YE6 A;  4PL9 A;  1NHH A;  4E01 A;  3SL2 A;  1I5C A;  3K60 A;  4MOT A;  2YI7 A;  4O09 A;  2Q8H A;  3T10 A;  3TZ4 A;  4I5S A;  4LP0 A;  3ZKD A;  4BIU A;  1UY6 A;  2BT0 A;  3R92 A;  4K4O A;  1H7S A;  3D2R A;  2YE7 A;  1AH6 A;  2YE8 A;  3MNR P;  4O05 A;  4E72 A;  2CCT A;  1KIJ A;  4MPC A;  3B28 A;  4QPJ A;  2XX2 A;  3OWB A;  4GFN A;  4YKX A;  3O2F A;  3R4N A;  4B7P A;  3INX A;  3FV5 A;  4GCZ A;  4XIT A;  1YC3 A;  2H8M A;  2YGE A;  1UYF A;  4FCP A;  4WUC A;  2Q8F A;  4KTN A;  4BQJ A;  4HYP A;  1TID A;  2QFO A;  2XX4 A;  3PEH A;  3OPD A;  5D6Q A;  4CWF A;  3B27 A;  1IXM A;  2YEC A;  2YKE A;  1MU5 A;  4CWP A;  2IWS A;  5FND A;  2BTZ A;  1UYM A;  4EGK A;  1JM6 A;  3VHD A;  5J71 A;  2JJC A;  4V25 A;  5CTU A;  1YC4 A;  5F3K A;  2YEF A;  4CE3 A;  2XJJ A;  1PVG A;  5IN9 A;  3Q5J A;  1TBW A;  5BOC A;  2BU2 A;  2YE3 A;  2WI7 A;  1Z5B A;  4Q20 A;  4PRV A;  4HZ5 A;  2Q8I A;  3GIF A;  2BZ5 A;  2YI5 A;  1EI1 A;  3A0W A;  4NH8 A;  4URO A;  4CE1 A;  2WI1 A;  1Y8O A;  4YKQ A;  5CTY A;  1YC1 A;  3T2S A;  5C93 A;  3EHJ A;  4KQV A;  4HY6 A;  5FNC A; 
#chains in the Genus database with same CATH homology
 4AS9 A;  5D7D A;  1EA6 A;  4L90 A;  4HZ0 A;  3RKZ A;  5M4M A;  1ZWH A;  2YJX A;  3O6O A;  3A0Y A;  4B6C A;  2CCU A;  2ZDY A;  2XDK A;  2VW5 A;  4CWO A;  2XD6 A;  2AKP A;  4URL A;  4EGH A;  3VHC A;  1YER A;  3DGE A;  3EHF A;  4LWH A;  4QPK A;  2UWD A;  2YE5 A;  1B62 A;  3ZM7 A;  2BU7 A;  4KFG A;  5GGZ A;  4XIQ A;  1Z5C A;  2YE4 A;  4LWE A;  2HG1 A;  5CTW A;  1ZXM A;  2QG2 A;  4CE2 A;  2YEA A;  2HKJ A;  4BXI A;  4EGI A;  1YT0 A;  4YKU A;  2IOR A;  5CF0 A;  3CGZ A;  1UY7 A;  4GT8 A;  1B3Q A;  3VAD A;  4ASF A;  5D7C A;  3EKR A;  2FWZ A;  2BSM A;  2HCH A;  4URN A;  2CH4 A;  2O1W A;  4XTJ A;  3TZ5 A;  4WUD A;  4H85 A;  3ZKB A;  4MBC A;  2XAB A;  2YKB A;  4LPB A;  3D36 A;  3LPS A;  1THN A;  2BU8 A;  4KP4 A;  1KZN A;  1MX0 A;  2YJW A;  3A0Z A;  4URM A;  4CWT A;  4ASB A;  3TZ2 A;  3LNU A;  4GQT A;  3D0B A;  3HEK A;  4ZKI A;  1YSR A;  4YKT A;  3ZXO A;  2BRC A;  4I3H A;  2WER A;  2Q8G A;  3B24 A;  2FWY A;  1R62 A;  3T0H A;  4EEH A;  3U2K A;  2XJG A;  2YEJ A;  5D7R A;  3TZ0 A;  3HZ5 A;  4H81 A;  4AWQ A;  4JQL A;  5M4N A;  4X9L A;  3OW6 A;  4U7O A;  3U67 A;  4XD8 A;  1TIL A;  5CTX A;  3K98 A;  3HYY A;  4XCJ A;  1AMW A;  4L91 A;  1GKZ A;  3FT5 A;  1A4H A;  3B25 A;  4W7T A;  2YKI A;  2YKC A;  2CG9 A;  2VCJ A;  3PEJ A;  4XIR A;  4XDM A;  5D6P A;  4WUB A;  3VHA A;  4FCR A;  4L94 A;  4YKY A;  2YGA A;  2XDX A;  2XHX A;  5L3J A;  4NH7 A;  4EFU A;  3TUH A;  1UY9 A;  4O04 A;  4DUH A;  3H80 A;  1H7U A;  2VCI A;  1NHI A;  3K97 A;  2XDL A;  3QDD A;  4E00 A;  1UY8 A;  2YE2 A;  2YGF A;  2IOP A;  2YEG A;  2GQP A;  2IOQ A;  3R4O A;  4XKK A;  2XDU A;  3Q5L A;  4U7N A;  4GEE A;  3EKO A;  4ASG A;  3C0E A;  5BOD A;  4HXZ A;  3WHA A;  2BU5 A;  2O1V A;  4YKR A;  1YS3 A;  4O07 A;  1BKN A;  1UYG A;  4V26 A;  4BQG A;  1L0O A;  2YI0 A;  2ZKJ A;  4HYM A;  3IED A;  2BU6 A;  3HHU A;  2FXS A;  3HYZ A;  1ZXN A;  2XJX A;  3O0I A;  2PNR A;  4JAU A;  4MP7 A;  4ZVI A;  4KSH A;  3H4L A;  1AM1 A;  5M4P A;  4MPN A;  4LWG A;  3CWV A;  3TTZ A;  2YE9 A;  3G75 A;  5FNF A;  2WI6 A;  2WI3 A;  4LWI A;  1Y8P A;  2IWX A;  1BGQ A;  2YEI A;  1U0Z A;  4EM7 A;  2VWC A;  5J6A A;  1OSF A;  1UYH A;  2E0A A;  4P7A A;  2XHT A;  2YED A;  1YES A;  3GIG A;  2WI4 A;  3T1K A;  3ZXQ A;  3BM9 A;  2YEB A;  1NHJ A;  2WI2 A;  3GIE A;  3R91 A;  1TC0 A;  1B63 A;  3NMQ A;  5M4E A;  4BAE A;  4JAS A;  1I5D A;  1Z5A A;  3Q5K A;  5IDJ A;  4CWR A;  3R4P A;  2IWU A;  4R3A A;  3RLR A;  3G7E A;  4XIP A;  3T0Z A;  3C11 A;  2BRE A;  1QYE A;  3RLQ A;  4AWP A;  1TH8 A;  1ID0 A;  3FT8 A;  2XCM A;  2CGF A;  2FYP A;  4YKW A;  2YK2 A;  3HZ1 A;  2WEP A;  1S14 A;  4XKO A;  2EXL A;  2BYH A;  4XC0 A;  4PU9 A;  2O1U A;  2GFD A;  4CWN A;  1I58 A;  2YI6 A;  4L93 A;  3GIG B;  4YKZ A;  1GJV A;  2XHR A;  1Y4S A;  2Q2E B;  3CRL A;  3JZ3 A;  1TC6 A;  2CCS A;  3INW A;  1U2O A;  3A0R A;  3EHG A;  3A0X A;  2YEE A;  3WQ9 A;  1I5B A;  4FMT A;  1BYQ A;  1S16 A;  1YT2 A;  3EHH A;  4MB9 A;  3R4M A;  4EFT A;  2BYI A;  2QG0 A;  1UYI A;  3CGY A;  1YET A;  1BXD A;  1Y4U A;  4HY1 A;  3QTF A;  2H55 A;  1ZW9 A;  4ASA A;  4NH9 A;  5FWK A;  4XKA A;  1UYL A;  5M4K A;  1YT1 A;  3BMY A;  4XCL A;  2C2A A;  2WI5 A;  4P8O A;  1I59 A;  1AH8 A;  4CWS A;  4O0B A;  1YSZ A;  3RLP A;  3OWD A;  2WEQ A;  3A0T A;  3U2D A;  2K5B A;  4HXW A;  4R1F A;  5CPH A;  3KE6 A;  3OMU A;  1US7 A;  1UYE A;  3CRK A;  3B26 A;  1UYK A;  2YEH A;  4MP2 A;  2YK9 A;  2ESA A;  4AWO A;  5M4H A;  2YKJ A;  4XE2 A;  5F5R A;  4KSG A;  1I5A A;  5IDM A;  4LWF A;  2XDS A;  2XK2 A;  4H7Q A;  4MPE A;  4EMV A;  2XX5 A;  4PRX A;  3G7B A;  1AJ6 A;  4JAV A;  1QZR A;  4DZY A;  4E02 A;  4CWQ A;  4R3M A;  4BIZ A;  2QF6 A;  1UYD A;  1UYC A;  2JKI A;  4GGL A;  3K99 A;  4FPP A;  1Z59 A;  1QY8 A;  2ZDX A;  4L8Z A;  4U93 A;  1GKX A;  2ZBK B;  1Y8N A;  4FCQ A;  2YE6 A;  4PL9 A;  1NHH A;  4E01 A;  3SL2 A;  1I5C A;  3K60 A;  4MOT A;  2YI7 A;  4O09 A;  2Q8H A;  3T10 A;  3TZ4 A;  4I5S A;  4LP0 A;  3ZKD A;  4BIU A;  1UY6 A;  2BT0 A;  3R92 A;  4K4O A;  1H7S A;  3D2R A;  2YE7 A;  1AH6 A;  2YE8 A;  3MNR P;  4O05 A;  2CCT A;  1KIJ A;  4MPC A;  3B28 A;  4QPJ A;  2XX2 A;  3OWB A;  4GFN A;  4YKX A;  3O2F A;  3R4N A;  4B7P A;  3INX A;  3FV5 A;  4GCZ A;  4XIT A;  1YC3 A;  2H8M A;  2YGE A;  1UYF A;  4FCP A;  4WUC A;  2Q8F A;  4KTN A;  4BQJ A;  4HYP A;  1TID A;  2QFO A;  2XX4 A;  3PEH A;  3OPD A;  5D6Q A;  4CWF A;  3B27 A;  2YEC A;  2YKE A;  1MU5 A;  4CWP A;  2IWS A;  5FND A;  2BTZ A;  1UYM A;  4EGK A;  1JM6 A;  3VHD A;  5J71 A;  2JJC A;  4V25 A;  5CTU A;  1YC4 A;  5F3K A;  2YEF A;  4CE3 A;  2XJJ A;  1PVG A;  5IN9 A;  3Q5J A;  1TBW A;  5BOC A;  2BU2 A;  2YE3 A;  2WI7 A;  1Z5B A;  4Q20 A;  4PRV A;  4HZ5 A;  2Q8I A;  3GIF A;  2BZ5 A;  2YI5 A;  1EI1 A;  3A0W A;  4NH8 A;  4URO A;  4CE1 A;  2WI1 A;  1Y8O A;  4YKQ A;  5CTY A;  1YC1 A;  3T2S A;  5C93 A;  3EHJ A;  4KQV A;  4HY6 A;  5FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...