3A0WA

Catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
152
structure length
152
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 55
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0wA00
2VCIA 2XDKA 2XDXA 3QTFA 3VADA 5L3JA 4L8ZA 4NH8A 2CGFA 5J71A 1UYHA 2YGFA 2XJGA 5CPHA 2JJCA 2VW5A 2QG0A 3IEDA 2WI3A 4JQLA 1QY8A 1TC0A 3KE6A 1UY9A 2QF6A 2IWXA 3B26A 2BSMA 4CWFA 3GIEA 2YKBA 2YECA 4WUBA 4XKAA 3H4LA 4HYMA 3K98A 4XTJA 4YKQA 4XIPA 5D6PA 4EGKA 4HZ5A 3A0RA 5M4KA 3MNRP 1I5AA 4JAVA 3SL2A 2WEPA 1QYEA 4U93A 4V26A 4MPNA 1BYQA 1YS3A 1Y8PA 4AWQA 3BMYA 2IORA 1NHHA 4MBCA 2IWSA 4X9LA 1Z5CA 3A0ZA 5BODA 4HY1A 3U2DA 5D7DA 4H81A 2YE9A 2GFDA 1TILA 2YEDA 4QPKA 2YEEA 2O1VA 4YKTA 3RLPA 4K4OA 1YC3A 3EHFA 2YKCA 3VHDA 2FXSA 2CCSA 5CTXA 4R1FA 5C93A 1I5CA 2UWDA 2YKIA 1ZWHA 1NHJA 1OSFA 4MPCA 1UYCA 4QPJA 2BU6A 4XKKA 3TZ2A 1I59A 4R3AA 1A4HA 2PNRA 4XC0A 2H8MA 5FNCA 3R91A 2YKEA 4O09A 3K60A 4HZ0A 4URMA 4E00A 4XCJA 5IDJA 4YKRA 2XDLA 2O1UA 4E02A 2BU5A 3A0WA 1BGQA 4NH7A 2YE4A 4HYPA 3TZ5A 3T0ZA 3OW6A 4LWIA 1YC1A 4R3MA 3HZ5A 4XITA 2HCHA 2YKJA 3RLRA 4JAUA 4BIZA 3CGYA 2WI5A 4E01A 1MX0A 3GIGB 1H7SA 5FWKA 1Y8NA 3A0YA 5M4NA 2IOQA 4WUDA 4ASBA 1JM6A 1AH8A 4CE3A 1Z5BA 2YEJA 1Z59A 3K97A 2YE3A 3GIFA 3RKZA 1UYIA 1Y4SA 4YKUA 3O2FA 4LP0A 3ZKDA 4O04A 1UYKA 2Q2EB 1I5DA 1AH6A 1U2OA 3NMQA 2BZ5A 4FCQA 4MB9A 4ASFA 4FPPA 3HZ1A 2Q8GA 2XHRA 3FV5A 1R62A 4AWOA 4BQJA 4ASAA 4U7NA 2YI5A 3T0HA 1BKNA 4KFGA 4AS9A 3WQ9A 2WERA 3TZ4A 2VWCA 1YT0A 1UYEA 3PEJA 3ZM7A 1EA6A 3A0XA 4XCLA 2CCTA 4HXWA 2WI7A 4MP2A 4B6CA 1TC6A 3T10A 3B25A 3JZ3A 2XX5A 1ZXNA 4KP4A 2WI4A 5CTUA 3EKOA 5F3KA 2QG2A 3INXA 1YSRA 4CWTA 4FCPA 2YJXA 4W7TA 4I5SA 5IDMA 3EHGA 4XDMA 2YI6A 1ZW9A 3TZ0A 2CH4A 3TTZA 3D36A 4PRVA 1YERA 2C2AA 3CRKA 1UYDA 3FT8A 2XK2A 1TBWA 4H85A 1ZXMA 1GKXA 5M4EA 3B27A 1S16A 1Y8OA 1THNA 2QFOA 2BYIA 1QZRA 4XE2A 4GQTA 2Q8IA 3R4PA 2IOPA 4EMVA 5M4HA 2CCUA 5M4MA 4EGIA 2CG9A 1Y4UA 4KSGA 4MOTA 2YE5A 4ZVIA 2XJXA 3Q5KA 1YC4A 3R92A 4LPBA 4CWQA 4FCRA 2ZKJA 3HEKA 4L93A 2XDUA 3HYZA 4O05A 3CWVA 4UROA 5CF0A 3FT5A 2XJJA 4YKYA 4LWHA 3ZXOA 1Z5AA 4H7QA 3T2SA 1US7A 3VHAA 1AM1A 1UYGA 3DGEA 4P7AA 4YKZA 4EEHA 2XCMA 1B3QA 1UYLA 1UY8A 4GEEA 4YKWA 4CE2A 2ESAA 4CE1A 5IN9A 5CTYA 3R4NA 3CRLA 3CGZA 4LWGA 4KQVA 3K99A 3PEHA 2YGAA 2YE6A 4PL9A 4GFNA 2YE2A 5GGZA 2BU2A 4XKOA 1H7UA 5FNDA 4XIQA 1AMWA 3EHJA 1UY7A 3G75A 4GGLA 3WHAA 4U7OA 2YE8A 3OPDA 3C11A 3INWA 2XX4A 3EKRA 1YT2A 4XIRA 4Q20A 4PU9A 4BIUA 2BU7A 4MP7A 4JASA 1UYMA 4CWSA 2O1WA 2YI0A 1L0OA 2WI1A 2BYHA 1YSZA 4I3HA 3R4OA 2YGEA 3B28A 4WUCA 1KIJA 3VHCA 1TIDA 4CWNA 5J6AA 2YE7A 2K5BA 3B24A 2BRCA 3D0BA 4YKXA 1B62A 2ZBKB 3O6OA 4P8OA 2BU8A 2XHXA 3D2RA 4GT8A 2XX2A 3U67A 3T1KA 1YETA 3LPSA 4B7PA 4DZYA 4LWFA 4EGHA 3RLQA 4DUHA 3H80A 4ZKIA 3G7EA 2YK9A 1ID0A 4L90A 3ZXQA 1YESA 5D7RA 5D7CA 4FMTA 3TUHA 5BOCA 4BQGA 2JKIA 2YEBA 4BXIA 1GJVA 2WEQA 2YEAA 1MU5A 2ZDXA 5FNFA 2YK2A 2ZDYA 2AKPA 2YJWA 1BXDA 4PRXA 2XD6A 1UYFA 3OWBA 1UY6A 3O0IA 1NHIA 4KTNA 4CWPA 2XABA 1GKZA 2EXLA 3A0TA 3BM9A 2YI7A 3U2KA 2BREA 4CWOA 2IWUA 4O07A 1EI1A 4NH9A 2YEIA 4V25A 1S14A 4CWRA 4BAEA 2XDSA 4O0BA 2FWZA 2BT0A 3HHUA 4L91A 4XD8A 4URNA 4EFTA 2VCJA 4KSHA 4EM7A 5CTWA 4L94A 2Q8HA 1KZNA 2Q8FA 1U0ZA 3GIGA 3EHHA 3OMUA 4EFUA 4GCZA 2YEFA 1AJ6A 2YEGA 2H55A 2HG1A 3R4MA 2WI2A 2WI6A 5D6QA 3C0EA 4HXZA 2GQPA 2BTZA 3LNUA 3Q5LA 2FYPA 1I58A 2E0AA 1PVGA 3Q5JA 4HY6A 4ASGA 3QDDA 2XHTA 2YEHA 3G7BA 1B63A 2HKJA 1I5BA 1YT1A 3HYYA 3ZKBA 5M4PA 5F5RA 1TH8A 4MPEA 4AWPA 3OWDA 2FWYA 4LWEA 4URLA
chains in the Genus database with same CATH superfamily
2VCIA 2XDKA 2XDXA 3QTFA 3VADA 5L3JA 4L8ZA 4NH8A 2CGFA 5J71A 1UYHA 2YGFA 2XJGA 5CPHA 2JJCA 2VW5A 2C1GA 2QG0A 3IEDA 2WI3A 4JQLA 1QY8A 3S5TA 1TC0A 3KE6A 1UY9A 2QF6A 2IWXA 3B26A 2BSMA 4CWFA 3GIEA 2YKBA 2YECA 4WUBA 4XKAA 3H4LA 4HYMA 3K98A 4XTJA 4YKQA 4XIPA 5D6PA 4EGKA 4HZ5A 3A0RA 5M4KA 3MNRP 1I5AA 4JAVA 3SL2A 2WEPA 1QYEA 4U93A 4V26A 4MPNA 1BYQA 1YS3A 1Y8PA 4AWQA 3BMYA 2IORA 1NHHA 4MBCA 2IWSA 4X9LA 1Z5CA 3A0ZA 5BODA 4HY1A 3U2DA 5D7DA 4H81A 2YE9A 2GFDA 1TILA 2YEDA 4QPKA 2YEEA 2C1IA 2O1VA 4YKTA 3RLPA 4K4OA 1YC3A 3EHFA 2YKCA 3VHDA 2FXSA 2CCSA 5CTXA 4R1FA 5C93A 1I5CA 2UWDA 2YKIA 1ZWHA 1NHJA 1OSFA 4MPCA 1UYCA 4QPJA 2BU6A 4XKKA 3TZ2A 1I59A 4R3AA 1F51A 1A4HA 2PNRA 4XC0A 2H8MA 5FNCA 3R91A 2YKEA 4O09A 3K60A 4HZ0A 4URMA 4E00A 4XCJA 5IDJA 4YKRA 2XDLA 2O1UA 4E02A 2BU5A 3A0WA 1BGQA 4NH7A 2YE4A 4HYPA 3TZ5A 3T0ZA 3OW6A 4LWIA 1YC1A 4R3MA 3HZ5A 4XITA 2HCHA 2YKJA 3RLRA 4JAUA 4BIZA 3CGYA 2WI5A 4E01A 1MX0A 3GIGB 1H7SA 5FWKA 1Y8NA 5JENA 3A0YA 5M4NA 2IOQA 4WUDA 4ASBA 1JM6A 1AH8A 4CE3A 1Z5BA 3CYGA 2YEJA 1Z59A 3K97A 2YE3A 3GIFA 3RKZA 2FTKA 1UYIA 1Y4SA 4YKUA 3O2FA 4LP0A 3ZKDA 4O04A 1UYKA 2Q2EB 1I5DA 1AH6A 1U2OA 3NMQA 2BZ5A 4FCQA 4MB9A 4ASFA 4FPPA 3HZ1A 2Q8GA 2XHRA 3FV5A 1R62A 4AWOA 4BQJA 4ASAA 4U7NA 2YI5A 3LMMA 3T0HA 1BKNA 4KFGA 4AS9A 3WQ9A 2WERA 3TZ4A 2VWCA 1YT0A 1UYEA 3PEJA 3ZM7A 1EA6A 3A0XA 4XCLA 2CCTA 4HXWA 2WI7A 4MP2A 4B6CA 1TC6A 3T10A 3B25A 3JZ3A 2XX5A 1ZXNA 4KP4A 2WI4A 5CTUA 3EKOA 5F3KA 2QG2A 3INXA 1YSRA 4CWTA 4FCPA 2YJXA 4W7TA 4I5SA 5IDMA 3EHGA 1IXMA 4XDMA 2YI6A 1ZW9A 3TZ0A 2CH4A 3TTZA 3D36A 4PRVA 1YERA 2C2AA 3CRKA 1UYDA 3FT8A 2XK2A 1TBWA 4H85A 1ZXMA 1GKXA 5M4EA 3B27A 1S16A 1Y8OA 1THNA 2QFOA 2BYIA 1QZRA 4XE2A 4GQTA 2Q8IA 3R4PA 2IOPA 4EMVA 5M4HA 2CCUA 5M4MA 4EGIA 4E72A 2CG9A 1Y4UA 4KSGA 4MOTA 2YE5A 4ZVIA 2XJXA 3Q5KA 1YC4A 3R92A 4LPBA 4CWQA 4FCRA 2ZKJA 3HEKA 4L93A 2XDUA 3HYZA 4O05A 3CWVA 4UROA 5CF0A 3FT5A 2XJJA 4YKYA 4LWHA 3ZXOA 1Z5AA 4H7QA 3T2SA 1US7A 3VHAA 1AM1A 1UYGA 3DGEA 4P7AA 4YKZA 4EEHA 2XCMA 1B3QA 1UYLA 1UY8A 4GEEA 4YKWA 4CE2A 2ESAA 4CE1A 5IN9A 5CTYA 3R4NA 3CRLA 3CGZA 4LWGA 4KQVA 3K99A 3PEHA 2YGAA 2YE6A 4PL9A 4GFNA 2YE2A 5GGZA 2BU2A 4XKOA 1H7UA 5FNDA 4XIQA 1AMWA 3EHJA 1UY7A 3G75A 4GGLA 3WHAA 4U7OA 2YE8A 3OPDA 3C11A 3INWA 2XX4A 3EKRA 1YT2A 4XIRA 4Q20A 4PU9A 4BIUA 2BU7A 4MP7A 4JASA 1UYMA 4CWSA 2O1WA 2YI0A 1L0OA 2WI1A 2HHIA 2BYHA 1YSZA 4I3HA 3R4OA 2YGEA 3B28A 4WUCA 1KIJA 3VHCA 1TIDA 4CWNA 5J6AA 2YE7A 2K5BA 3B24A 2BRCA 3D0BA 4YKXA 1B62A 2ZBKB 3O6OA 4P8OA 2BU8A 2XHXA 3D2RA 4GT8A 2XX2A 3U67A 3T1KA 1YETA 3LPSA 4B7PA 4DZYA 4LWFA 4EGHA 3RLQA 4DUHA 3H80A 4ZKIA 3G7EA 2YK9A 1ID0A 4L90A 3ZXQA 1YESA 5D7RA 5D7CA 4FMTA 3TUHA 5BOCA 4BQGA 2JKIA 2YEBA 4BXIA 1GJVA 2WEQA 2YEAA 1MU5A 2ZDXA 5FNFA 2YK2A 2ZDYA 2AKPA 2YJWA 1BXDA 4PRXA 2XD6A 1UYFA 3OWBA 1UY6A 3O0IA 1NHIA 4KTNA 4CWPA 2XABA 1GKZA 2EXLA 3A0TA 3BM9A 2YI7A 3U2KA 2BREA 4CWOA 2IWUA 4O07A 1EI1A 4NH9A 2YEIA 4V25A 1S14A 4CWRA 4BAEA 2XDSA 4O0BA 2FWZA 2BT0A 3HHUA 4L91A 4XD8A 4URNA 4EFTA 2VCJA 4KSHA 4EM7A 5CTWA 4L94A 2Q8HA 1KZNA 2Q8FA 1U0ZA 3GIGA 3EHHA 3OMUA 4EFUA 4GCZA 2YEFA 1AJ6A 2YEGA 2H55A 2HG1A 3R4MA 2WI2A 2WI6A 5D6QA 3C0EA 4HXZA 2GQPA 2BTZA 3LNUA 3Q5LA 2FYPA 1I58A 2E0AA 1PVGA 3Q5JA 4HY6A 4ASGA 3QDDA 2XHTA 2YEHA 3G7BA 1B63A 2HKJA 1I5BA 1YT1A 3HYYA 3ZKBA 5M4PA 5F5RA 1TH8A 4MPEA 4AWPA 3OWDA 2FWYA 4LWEA 4URLA
chains in the Genus database with same CATH topology
2VCIA 2XDKA 2XDXA 3QTFA 3VADA 5L3JA 4L8ZA 4NH8A 2CGFA 5J71A 1UYHA 2YGFA 2XJGA 5CPHA 2JJCA 2VW5A 2QG0A 3IEDA 2WI3A 4JQLA 1QY8A 1TC0A 3KE6A 1UY9A 2QF6A 2IWXA 3B26A 2BSMA 4CWFA 3GIEA 2YKBA 2YECA 4WUBA 4XKAA 3H4LA 4HYMA 3K98A 4XTJA 4YKQA 4XIPA 5D6PA 4EGKA 4HZ5A 3A0RA 5M4KA 3MNRP 1I5AA 4JAVA 3SL2A 2WEPA 1QYEA 4U93A 4V26A 4MPNA 1BYQA 1YS3A 1Y8PA 4AWQA 3BMYA 2IORA 1NHHA 4MBCA 2IWSA 4X9LA 1Z5CA 3A0ZA 5BODA 4HY1A 3U2DA 5D7DA 4H81A 2YE9A 2GFDA 1TILA 2YEDA 4QPKA 2YEEA 2O1VA 4YKTA 3RLPA 4K4OA 1YC3A 3EHFA 2YKCA 3VHDA 2FXSA 2CCSA 5CTXA 4R1FA 5C93A 1I5CA 2UWDA 2YKIA 1ZWHA 1NHJA 1OSFA 4MPCA 1UYCA 4QPJA 2BU6A 4XKKA 3TZ2A 1I59A 4R3AA 1A4HA 2PNRA 4XC0A 2H8MA 5FNCA 3R91A 2YKEA 4O09A 3K60A 4HZ0A 4URMA 4E00A 4XCJA 5IDJA 4YKRA 2XDLA 2O1UA 4E02A 2BU5A 3A0WA 1BGQA 4NH7A 2YE4A 4HYPA 3TZ5A 3T0ZA 3OW6A 4LWIA 1YC1A 4R3MA 3HZ5A 4XITA 2HCHA 2YKJA 3RLRA 4JAUA 4BIZA 3CGYA 2WI5A 4E01A 1MX0A 3GIGB 1H7SA 5FWKA 1Y8NA 3A0YA 5M4NA 2IOQA 4WUDA 4ASBA 1JM6A 1AH8A 4CE3A 1Z5BA 2YEJA 1Z59A 3K97A 2YE3A 3GIFA 3RKZA 1UYIA 1Y4SA 4YKUA 3O2FA 4LP0A 3ZKDA 4O04A 1UYKA 2Q2EB 1I5DA 1AH6A 1U2OA 3NMQA 2BZ5A 4FCQA 4MB9A 4ASFA 4FPPA 3HZ1A 2Q8GA 2XHRA 3FV5A 1R62A 4AWOA 4BQJA 4ASAA 4U7NA 2YI5A 3T0HA 1BKNA 4KFGA 4AS9A 3WQ9A 2WERA 3TZ4A 2VWCA 1YT0A 1UYEA 3PEJA 3ZM7A 1EA6A 3A0XA 4XCLA 2CCTA 4HXWA 2WI7A 4MP2A 4B6CA 1TC6A 3T10A 3B25A 3JZ3A 2XX5A 1ZXNA 4KP4A 2WI4A 5CTUA 3EKOA 5F3KA 2QG2A 3INXA 1YSRA 4CWTA 4FCPA 2YJXA 4W7TA 4I5SA 5IDMA 3EHGA 4XDMA 2YI6A 1ZW9A 3TZ0A 2CH4A 3TTZA 3D36A 4PRVA 1YERA 2C2AA 3CRKA 1UYDA 3FT8A 2XK2A 1TBWA 4H85A 1ZXMA 1GKXA 5M4EA 3B27A 1S16A 1Y8OA 1THNA 2QFOA 2BYIA 1QZRA 4XE2A 4GQTA 2Q8IA 3R4PA 2IOPA 4EMVA 5M4HA 2CCUA 5M4MA 4EGIA 2CG9A 1Y4UA 4KSGA 4MOTA 2YE5A 4ZVIA 2XJXA 3Q5KA 1YC4A 3R92A 4LPBA 4CWQA 4FCRA 2ZKJA 3HEKA 4L93A 2XDUA 3HYZA 4O05A 3CWVA 4UROA 5CF0A 3FT5A 2XJJA 4YKYA 4LWHA 3ZXOA 1Z5AA 4H7QA 3T2SA 1US7A 3VHAA 1AM1A 1UYGA 3DGEA 4P7AA 4YKZA 4EEHA 2XCMA 1B3QA 1UYLA 1UY8A 4GEEA 4YKWA 4CE2A 2ESAA 4CE1A 5IN9A 5CTYA 3R4NA 3CRLA 3CGZA 4LWGA 4KQVA 3K99A 3PEHA 2YGAA 2YE6A 4PL9A 4GFNA 2YE2A 5GGZA 2BU2A 4XKOA 1H7UA 5FNDA 4XIQA 1AMWA 3EHJA 1UY7A 3G75A 4GGLA 3WHAA 4U7OA 2YE8A 3OPDA 3C11A 3INWA 2XX4A 3EKRA 1YT2A 4XIRA 4Q20A 4PU9A 4BIUA 2BU7A 4MP7A 4JASA 1UYMA 4CWSA 2O1WA 2YI0A 1L0OA 2WI1A 2BYHA 1YSZA 4I3HA 3R4OA 2YGEA 3B28A 4WUCA 1KIJA 3VHCA 1TIDA 4CWNA 5J6AA 2YE7A 2K5BA 3B24A 2BRCA 3D0BA 4YKXA 1B62A 2ZBKB 3O6OA 4P8OA 2BU8A 2XHXA 3D2RA 4GT8A 2XX2A 3U67A 3T1KA 1YETA 3LPSA 4B7PA 4DZYA 4LWFA 4EGHA 3RLQA 4DUHA 3H80A 4ZKIA 3G7EA 2YK9A 1ID0A 4L90A 3ZXQA 1YESA 5D7RA 5D7CA 4FMTA 3TUHA 5BOCA 4BQGA 2JKIA 2YEBA 4BXIA 1GJVA 2WEQA 2YEAA 1MU5A 2ZDXA 5FNFA 2YK2A 2ZDYA 2AKPA 2YJWA 1BXDA 4PRXA 2XD6A 1UYFA 3OWBA 1UY6A 3O0IA 1NHIA 4KTNA 4CWPA 2XABA 1GKZA 2EXLA 3A0TA 3BM9A 2YI7A 3U2KA 2BREA 4CWOA 2IWUA 4O07A 1EI1A 4NH9A 2YEIA 4V25A 1S14A 4CWRA 4BAEA 2XDSA 4O0BA 2FWZA 2BT0A 3HHUA 4L91A 4XD8A 4URNA 4EFTA 2VCJA 4KSHA 4EM7A 5CTWA 4L94A 2Q8HA 1KZNA 2Q8FA 1U0ZA 3GIGA 3EHHA 3OMUA 4EFUA 4GCZA 2YEFA 1AJ6A 2YEGA 2H55A 2HG1A 3R4MA 2WI2A 2WI6A 5D6QA 3C0EA 4HXZA 2GQPA 2BTZA 3LNUA 3Q5LA 2FYPA 1I58A 2E0AA 1PVGA 3Q5JA 4HY6A 4ASGA 3QDDA 2XHTA 2YEHA 3G7BA 1B63A 2HKJA 1I5BA 1YT1A 3HYYA 3ZKBA 5M4PA 5F5RA 1TH8A 4MPEA 4AWPA 3OWDA 2FWYA 4LWEA 4URLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCI A;  2XDK A;  2XDX A;  3QTF A;  3VAD A;  5L3J A;  4L8Z A;  4NH8 A;  2CGF A;  5J71 A;  1UYH A;  2YGF A;  2XJG A;  5CPH A;  2JJC A;  2VW5 A;  2QG0 A;  3IED A;  2WI3 A;  4JQL A;  1QY8 A;  1TC0 A;  3KE6 A;  1UY9 A;  2QF6 A;  2IWX A;  3B26 A;  2BSM A;  4CWF A;  3GIE A;  2YKB A;  2YEC A;  4WUB A;  4XKA A;  3H4L A;  4HYM A;  3K98 A;  4XTJ A;  4YKQ A;  4XIP A;  5D6P A;  4EGK A;  4HZ5 A;  3A0R A;  5M4K A;  3MNR P;  1I5A A;  4JAV A;  3SL2 A;  2WEP A;  1QYE A;  4U93 A;  4V26 A;  4MPN A;  1BYQ A;  1YS3 A;  1Y8P A;  4AWQ A;  3BMY A;  2IOR A;  1NHH A;  4MBC A;  2IWS A;  4X9L A;  1Z5C A;  3A0Z A;  5BOD A;  4HY1 A;  3U2D A;  5D7D A;  4H81 A;  2YE9 A;  2GFD A;  1TIL A;  2YED A;  4QPK A;  2YEE A;  2O1V A;  4YKT A;  3RLP A;  4K4O A;  1YC3 A;  3EHF A;  2YKC A;  3VHD A;  2FXS A;  2CCS A;  5CTX A;  4R1F A;  5C93 A;  1I5C A;  2UWD A;  2YKI A;  1ZWH A;  1NHJ A;  1OSF A;  4MPC A;  1UYC A;  4QPJ A;  2BU6 A;  4XKK A;  3TZ2 A;  1I59 A;  4R3A A;  1A4H A;  2PNR A;  4XC0 A;  2H8M A;  5FNC A;  3R91 A;  2YKE A;  4O09 A;  3K60 A;  4HZ0 A;  4URM A;  4E00 A;  4XCJ A;  5IDJ A;  4YKR A;  2XDL A;  2O1U A;  4E02 A;  2BU5 A;  3A0W A;  1BGQ A;  4NH7 A;  2YE4 A;  4HYP A;  3TZ5 A;  3T0Z A;  3OW6 A;  4LWI A;  1YC1 A;  4R3M A;  3HZ5 A;  4XIT A;  2HCH A;  2YKJ A;  3RLR A;  4JAU A;  4BIZ A;  3CGY A;  2WI5 A;  4E01 A;  1MX0 A;  3GIG B;  1H7S A;  5FWK A;  1Y8N A;  3A0Y A;  5M4N A;  2IOQ A;  4WUD A;  4ASB A;  1JM6 A;  1AH8 A;  4CE3 A;  1Z5B A;  2YEJ A;  1Z59 A;  3K97 A;  2YE3 A;  3GIF A;  3RKZ A;  1UYI A;  1Y4S A;  4YKU A;  3O2F A;  4LP0 A;  3ZKD A;  4O04 A;  1UYK A;  2Q2E B;  1I5D A;  1AH6 A;  1U2O A;  3NMQ A;  2BZ5 A;  4FCQ A;  4MB9 A;  4ASF A;  4FPP A;  3HZ1 A;  2Q8G A;  2XHR A;  3FV5 A;  1R62 A;  4AWO A;  4BQJ A;  4ASA A;  4U7N A;  2YI5 A;  3T0H A;  1BKN A;  4KFG A;  4AS9 A;  3WQ9 A;  2WER A;  3TZ4 A;  2VWC A;  1YT0 A;  1UYE A;  3PEJ A;  3ZM7 A;  1EA6 A;  3A0X A;  4XCL A;  2CCT A;  4HXW A;  2WI7 A;  4MP2 A;  4B6C A;  1TC6 A;  3T10 A;  3B25 A;  3JZ3 A;  2XX5 A;  1ZXN A;  4KP4 A;  2WI4 A;  5CTU A;  3EKO A;  5F3K A;  2QG2 A;  3INX A;  1YSR A;  4CWT A;  4FCP A;  2YJX A;  4W7T A;  4I5S A;  5IDM A;  3EHG A;  4XDM A;  2YI6 A;  1ZW9 A;  3TZ0 A;  2CH4 A;  3TTZ A;  3D36 A;  4PRV A;  1YER A;  2C2A A;  3CRK A;  1UYD A;  3FT8 A;  2XK2 A;  1TBW A;  4H85 A;  1ZXM A;  1GKX A;  5M4E A;  3B27 A;  1S16 A;  1Y8O A;  1THN A;  2QFO A;  2BYI A;  1QZR A;  4XE2 A;  4GQT A;  2Q8I A;  3R4P A;  2IOP A;  4EMV A;  5M4H A;  2CCU A;  5M4M A;  4EGI A;  2CG9 A;  1Y4U A;  4KSG A;  4MOT A;  2YE5 A;  4ZVI A;  2XJX A;  3Q5K A;  1YC4 A;  3R92 A;  4LPB A;  4CWQ A;  4FCR A;  2ZKJ A;  3HEK A;  4L93 A;  2XDU A;  3HYZ A;  4O05 A;  3CWV A;  4URO A;  5CF0 A;  3FT5 A;  2XJJ A;  4YKY A;  4LWH A;  3ZXO A;  1Z5A A;  4H7Q A;  3T2S A;  1US7 A;  3VHA A;  1AM1 A;  1UYG A;  3DGE A;  4P7A A;  4YKZ A;  4EEH A;  2XCM A;  1B3Q A;  1UYL A;  1UY8 A;  4GEE A;  4YKW A;  4CE2 A;  2ESA A;  4CE1 A;  5IN9 A;  5CTY A;  3R4N A;  3CRL A;  3CGZ A;  4LWG A;  4KQV A;  3K99 A;  3PEH A;  2YGA A;  2YE6 A;  4PL9 A;  4GFN A;  2YE2 A;  5GGZ A;  2BU2 A;  4XKO A;  1H7U A;  5FND A;  4XIQ A;  1AMW A;  3EHJ A;  1UY7 A;  3G75 A;  4GGL A;  3WHA A;  4U7O A;  2YE8 A;  3OPD A;  3C11 A;  3INW A;  2XX4 A;  3EKR A;  1YT2 A;  4XIR A;  4Q20 A;  4PU9 A;  4BIU A;  2BU7 A;  4MP7 A;  4JAS A;  1UYM A;  4CWS A;  2O1W A;  2YI0 A;  1L0O A;  2WI1 A;  2BYH A;  1YSZ A;  4I3H A;  3R4O A;  2YGE A;  3B28 A;  4WUC A;  1KIJ A;  3VHC A;  1TID A;  4CWN A;  5J6A A;  2YE7 A;  2K5B A;  3B24 A;  2BRC A;  3D0B A;  4YKX A;  1B62 A;  2ZBK B;  3O6O A;  4P8O A;  2BU8 A;  2XHX A;  3D2R A;  4GT8 A;  2XX2 A;  3U67 A;  3T1K A;  1YET A;  3LPS A;  4B7P A;  4DZY A;  4LWF A;  4EGH A;  3RLQ A;  4DUH A;  3H80 A;  4ZKI A;  3G7E A;  2YK9 A;  1ID0 A;  4L90 A;  3ZXQ A;  1YES A;  5D7R A;  5D7C A;  4FMT A;  3TUH A;  5BOC A;  4BQG A;  2JKI A;  2YEB A;  4BXI A;  1GJV A;  2WEQ A;  2YEA A;  1MU5 A;  2ZDX A;  5FNF A;  2YK2 A;  2ZDY A;  2AKP A;  2YJW A;  1BXD A;  4PRX A;  2XD6 A;  1UYF A;  3OWB A;  1UY6 A;  3O0I A;  1NHI A;  4KTN A;  4CWP A;  2XAB A;  1GKZ A;  2EXL A;  3A0T A;  3BM9 A;  2YI7 A;  3U2K A;  2BRE A;  4CWO A;  2IWU A;  4O07 A;  1EI1 A;  4NH9 A;  2YEI A;  4V25 A;  1S14 A;  4CWR A;  4BAE A;  2XDS A;  4O0B A;  2FWZ A;  2BT0 A;  3HHU A;  4L91 A;  4XD8 A;  4URN A;  4EFT A;  2VCJ A;  4KSH A;  4EM7 A;  5CTW A;  4L94 A;  2Q8H A;  1KZN A;  2Q8F A;  1U0Z A;  3GIG A;  3EHH A;  3OMU A;  4EFU A;  4GCZ A;  2YEF A;  1AJ6 A;  2YEG A;  2H55 A;  2HG1 A;  3R4M A;  2WI2 A;  2WI6 A;  5D6Q A;  3C0E A;  4HXZ A;  2GQP A;  2BTZ A;  3LNU A;  3Q5L A;  2FYP A;  1I58 A;  2E0A A;  1PVG A;  3Q5J A;  4HY6 A;  4ASG A;  3QDD A;  2XHT A;  2YEH A;  3G7B A;  1B63 A;  2HKJ A;  1I5B A;  1YT1 A;  3HYY A;  3ZKB A;  5M4P A;  5F5R A;  1TH8 A;  4MPE A;  4AWP A;  3OWD A;  2FWY A;  4LWE A;  4URL A; 
#chains in the Genus database with same CATH topology
 2VCI A;  2XDK A;  2XDX A;  3QTF A;  3VAD A;  5L3J A;  4L8Z A;  4NH8 A;  2CGF A;  5J71 A;  1UYH A;  2YGF A;  2XJG A;  5CPH A;  2JJC A;  2VW5 A;  2C1G A;  2QG0 A;  3IED A;  2WI3 A;  4JQL A;  1QY8 A;  3S5T A;  1TC0 A;  3KE6 A;  1UY9 A;  2QF6 A;  2IWX A;  3B26 A;  2BSM A;  4CWF A;  3GIE A;  2YKB A;  2YEC A;  4WUB A;  4XKA A;  3H4L A;  4HYM A;  3K98 A;  4XTJ A;  4YKQ A;  4XIP A;  5D6P A;  4EGK A;  4HZ5 A;  3A0R A;  5M4K A;  3MNR P;  1I5A A;  4JAV A;  3SL2 A;  2WEP A;  1QYE A;  4U93 A;  4V26 A;  4MPN A;  1BYQ A;  1YS3 A;  1Y8P A;  4AWQ A;  3BMY A;  2IOR A;  1NHH A;  4MBC A;  2IWS A;  4X9L A;  1Z5C A;  3A0Z A;  5BOD A;  4HY1 A;  3U2D A;  5D7D A;  4H81 A;  2YE9 A;  2GFD A;  1TIL A;  2YED A;  4QPK A;  2YEE A;  2C1I A;  2O1V A;  4YKT A;  3RLP A;  4K4O A;  1YC3 A;  3EHF A;  2YKC A;  3VHD A;  2FXS A;  2CCS A;  5CTX A;  4R1F A;  5C93 A;  1I5C A;  2UWD A;  2YKI A;  1ZWH A;  1NHJ A;  1OSF A;  4MPC A;  1UYC A;  4QPJ A;  2BU6 A;  4XKK A;  3TZ2 A;  1I59 A;  4R3A A;  1F51 A;  1A4H A;  2PNR A;  4XC0 A;  2H8M A;  5FNC A;  3R91 A;  2YKE A;  4O09 A;  3K60 A;  4HZ0 A;  4URM A;  4E00 A;  4XCJ A;  5IDJ A;  4YKR A;  2XDL A;  2O1U A;  4E02 A;  2BU5 A;  3A0W A;  1BGQ A;  4NH7 A;  2YE4 A;  4HYP A;  3TZ5 A;  3T0Z A;  3OW6 A;  4LWI A;  1YC1 A;  4R3M A;  3HZ5 A;  4XIT A;  2HCH A;  2YKJ A;  3RLR A;  4JAU A;  4BIZ A;  3CGY A;  2WI5 A;  4E01 A;  1MX0 A;  3GIG B;  1H7S A;  5FWK A;  1Y8N A;  5JEN A;  3A0Y A;  5M4N A;  2IOQ A;  4WUD A;  4ASB A;  1JM6 A;  1AH8 A;  4CE3 A;  1Z5B A;  3CYG A;  2YEJ A;  1Z59 A;  3K97 A;  2YE3 A;  3GIF A;  3RKZ A;  2FTK A;  1UYI A;  1Y4S A;  4YKU A;  3O2F A;  4LP0 A;  3ZKD A;  4O04 A;  1UYK A;  2Q2E B;  1I5D A;  1AH6 A;  1U2O A;  3NMQ A;  2BZ5 A;  4FCQ A;  4MB9 A;  4ASF A;  4FPP A;  3HZ1 A;  2Q8G A;  2XHR A;  3FV5 A;  1R62 A;  4AWO A;  4BQJ A;  4ASA A;  4U7N A;  2YI5 A;  3LMM A;  3T0H A;  1BKN A;  4KFG A;  4AS9 A;  3WQ9 A;  2WER A;  3TZ4 A;  2VWC A;  1YT0 A;  1UYE A;  3PEJ A;  3ZM7 A;  1EA6 A;  3A0X A;  4XCL A;  2CCT A;  4HXW A;  2WI7 A;  4MP2 A;  4B6C A;  1TC6 A;  3T10 A;  3B25 A;  3JZ3 A;  2XX5 A;  1ZXN A;  4KP4 A;  2WI4 A;  5CTU A;  3EKO A;  5F3K A;  2QG2 A;  3INX A;  1YSR A;  4CWT A;  4FCP A;  2YJX A;  4W7T A;  4I5S A;  5IDM A;  3EHG A;  1IXM A;  4XDM A;  2YI6 A;  1ZW9 A;  3TZ0 A;  2CH4 A;  3TTZ A;  3D36 A;  4PRV A;  1YER A;  2C2A A;  3CRK A;  1UYD A;  3FT8 A;  2XK2 A;  1TBW A;  4H85 A;  1ZXM A;  1GKX A;  5M4E A;  3B27 A;  1S16 A;  1Y8O A;  1THN A;  2QFO A;  2BYI A;  1QZR A;  4XE2 A;  4GQT A;  2Q8I A;  3R4P A;  2IOP A;  4EMV A;  5M4H A;  2CCU A;  5M4M A;  4EGI A;  4E72 A;  2CG9 A;  1Y4U A;  4KSG A;  4MOT A;  2YE5 A;  4ZVI A;  2XJX A;  3Q5K A;  1YC4 A;  3R92 A;  4LPB A;  4CWQ A;  4FCR A;  2ZKJ A;  3HEK A;  4L93 A;  2XDU A;  3HYZ A;  4O05 A;  3CWV A;  4URO A;  5CF0 A;  3FT5 A;  2XJJ A;  4YKY A;  4LWH A;  3ZXO A;  1Z5A A;  4H7Q A;  3T2S A;  1US7 A;  3VHA A;  1AM1 A;  1UYG A;  3DGE A;  4P7A A;  4YKZ A;  4EEH A;  2XCM A;  1B3Q A;  1UYL A;  1UY8 A;  4GEE A;  4YKW A;  4CE2 A;  2ESA A;  4CE1 A;  5IN9 A;  5CTY A;  3R4N A;  3CRL A;  3CGZ A;  4LWG A;  4KQV A;  3K99 A;  3PEH A;  2YGA A;  2YE6 A;  4PL9 A;  4GFN A;  2YE2 A;  5GGZ A;  2BU2 A;  4XKO A;  1H7U A;  5FND A;  4XIQ A;  1AMW A;  3EHJ A;  1UY7 A;  3G75 A;  4GGL A;  3WHA A;  4U7O A;  2YE8 A;  3OPD A;  3C11 A;  3INW A;  2XX4 A;  3EKR A;  1YT2 A;  4XIR A;  4Q20 A;  4PU9 A;  4BIU A;  2BU7 A;  4MP7 A;  4JAS A;  1UYM A;  4CWS A;  2O1W A;  2YI0 A;  1L0O A;  2WI1 A;  2HHI A;  2BYH A;  1YSZ A;  4I3H A;  3R4O A;  2YGE A;  3B28 A;  4WUC A;  1KIJ A;  3VHC A;  1TID A;  4CWN A;  5J6A A;  2YE7 A;  2K5B A;  3B24 A;  2BRC A;  3D0B A;  4YKX A;  1B62 A;  2ZBK B;  3O6O A;  4P8O A;  2BU8 A;  2XHX A;  3D2R A;  4GT8 A;  2XX2 A;  3U67 A;  3T1K A;  1YET A;  3LPS A;  4B7P A;  4DZY A;  4LWF A;  4EGH A;  3RLQ A;  4DUH A;  3H80 A;  4ZKI A;  3G7E A;  2YK9 A;  1ID0 A;  4L90 A;  3ZXQ A;  1YES A;  5D7R A;  5D7C A;  4FMT A;  3TUH A;  5BOC A;  4BQG A;  2JKI A;  2YEB A;  4BXI A;  1GJV A;  2WEQ A;  2YEA A;  1MU5 A;  2ZDX A;  5FNF A;  2YK2 A;  2ZDY A;  2AKP A;  2YJW A;  1BXD A;  4PRX A;  2XD6 A;  1UYF A;  3OWB A;  1UY6 A;  3O0I A;  1NHI A;  4KTN A;  4CWP A;  2XAB A;  1GKZ A;  2EXL A;  3A0T A;  3BM9 A;  2YI7 A;  3U2K A;  2BRE A;  4CWO A;  2IWU A;  4O07 A;  1EI1 A;  4NH9 A;  2YEI A;  4V25 A;  1S14 A;  4CWR A;  4BAE A;  2XDS A;  4O0B A;  2FWZ A;  2BT0 A;  3HHU A;  4L91 A;  4XD8 A;  4URN A;  4EFT A;  2VCJ A;  4KSH A;  4EM7 A;  5CTW A;  4L94 A;  2Q8H A;  1KZN A;  2Q8F A;  1U0Z A;  3GIG A;  3EHH A;  3OMU A;  4EFU A;  4GCZ A;  2YEF A;  1AJ6 A;  2YEG A;  2H55 A;  2HG1 A;  3R4M A;  2WI2 A;  2WI6 A;  5D6Q A;  3C0E A;  4HXZ A;  2GQP A;  2BTZ A;  3LNU A;  3Q5L A;  2FYP A;  1I58 A;  2E0A A;  1PVG A;  3Q5J A;  4HY6 A;  4ASG A;  3QDD A;  2XHT A;  2YEH A;  3G7B A;  1B63 A;  2HKJ A;  1I5B A;  1YT1 A;  3HYY A;  3ZKB A;  5M4P A;  5F5R A;  1TH8 A;  4MPE A;  4AWP A;  3OWD A;  2FWY A;  4LWE A;  4URL A; 
#chains in the Genus database with same CATH homology
 2VCI A;  2XDK A;  2XDX A;  3QTF A;  3VAD A;  5L3J A;  4L8Z A;  4NH8 A;  2CGF A;  5J71 A;  1UYH A;  2YGF A;  2XJG A;  5CPH A;  2JJC A;  2VW5 A;  2QG0 A;  3IED A;  2WI3 A;  4JQL A;  1QY8 A;  1TC0 A;  3KE6 A;  1UY9 A;  2QF6 A;  2IWX A;  3B26 A;  2BSM A;  4CWF A;  3GIE A;  2YKB A;  2YEC A;  4WUB A;  4XKA A;  3H4L A;  4HYM A;  3K98 A;  4XTJ A;  4YKQ A;  4XIP A;  5D6P A;  4EGK A;  4HZ5 A;  3A0R A;  5M4K A;  3MNR P;  1I5A A;  4JAV A;  3SL2 A;  2WEP A;  1QYE A;  4U93 A;  4V26 A;  4MPN A;  1BYQ A;  1YS3 A;  1Y8P A;  4AWQ A;  3BMY A;  2IOR A;  1NHH A;  4MBC A;  2IWS A;  4X9L A;  1Z5C A;  3A0Z A;  5BOD A;  4HY1 A;  3U2D A;  5D7D A;  4H81 A;  2YE9 A;  2GFD A;  1TIL A;  2YED A;  4QPK A;  2YEE A;  2O1V A;  4YKT A;  3RLP A;  4K4O A;  1YC3 A;  3EHF A;  2YKC A;  3VHD A;  2FXS A;  2CCS A;  5CTX A;  4R1F A;  5C93 A;  1I5C A;  2UWD A;  2YKI A;  1ZWH A;  1NHJ A;  1OSF A;  4MPC A;  1UYC A;  4QPJ A;  2BU6 A;  4XKK A;  3TZ2 A;  1I59 A;  4R3A A;  1A4H A;  2PNR A;  4XC0 A;  2H8M A;  5FNC A;  3R91 A;  2YKE A;  4O09 A;  3K60 A;  4HZ0 A;  4URM A;  4E00 A;  4XCJ A;  5IDJ A;  4YKR A;  2XDL A;  2O1U A;  4E02 A;  2BU5 A;  3A0W A;  1BGQ A;  4NH7 A;  2YE4 A;  4HYP A;  3TZ5 A;  3T0Z A;  3OW6 A;  4LWI A;  1YC1 A;  4R3M A;  3HZ5 A;  4XIT A;  2HCH A;  2YKJ A;  3RLR A;  4JAU A;  4BIZ A;  3CGY A;  2WI5 A;  4E01 A;  1MX0 A;  3GIG B;  1H7S A;  5FWK A;  1Y8N A;  3A0Y A;  5M4N A;  2IOQ A;  4WUD A;  4ASB A;  1JM6 A;  1AH8 A;  4CE3 A;  1Z5B A;  2YEJ A;  1Z59 A;  3K97 A;  2YE3 A;  3GIF A;  3RKZ A;  1UYI A;  1Y4S A;  4YKU A;  3O2F A;  4LP0 A;  3ZKD A;  4O04 A;  1UYK A;  2Q2E B;  1I5D A;  1AH6 A;  1U2O A;  3NMQ A;  2BZ5 A;  4FCQ A;  4MB9 A;  4ASF A;  4FPP A;  3HZ1 A;  2Q8G A;  2XHR A;  3FV5 A;  1R62 A;  4AWO A;  4BQJ A;  4ASA A;  4U7N A;  2YI5 A;  3T0H A;  1BKN A;  4KFG A;  4AS9 A;  3WQ9 A;  2WER A;  3TZ4 A;  2VWC A;  1YT0 A;  1UYE A;  3PEJ A;  3ZM7 A;  1EA6 A;  3A0X A;  4XCL A;  2CCT A;  4HXW A;  2WI7 A;  4MP2 A;  4B6C A;  1TC6 A;  3T10 A;  3B25 A;  3JZ3 A;  2XX5 A;  1ZXN A;  4KP4 A;  2WI4 A;  5CTU A;  3EKO A;  5F3K A;  2QG2 A;  3INX A;  1YSR A;  4CWT A;  4FCP A;  2YJX A;  4W7T A;  4I5S A;  5IDM A;  3EHG A;  4XDM A;  2YI6 A;  1ZW9 A;  3TZ0 A;  2CH4 A;  3TTZ A;  3D36 A;  4PRV A;  1YER A;  2C2A A;  3CRK A;  1UYD A;  3FT8 A;  2XK2 A;  1TBW A;  4H85 A;  1ZXM A;  1GKX A;  5M4E A;  3B27 A;  1S16 A;  1Y8O A;  1THN A;  2QFO A;  2BYI A;  1QZR A;  4XE2 A;  4GQT A;  2Q8I A;  3R4P A;  2IOP A;  4EMV A;  5M4H A;  2CCU A;  5M4M A;  4EGI A;  2CG9 A;  1Y4U A;  4KSG A;  4MOT A;  2YE5 A;  4ZVI A;  2XJX A;  3Q5K A;  1YC4 A;  3R92 A;  4LPB A;  4CWQ A;  4FCR A;  2ZKJ A;  3HEK A;  4L93 A;  2XDU A;  3HYZ A;  4O05 A;  3CWV A;  4URO A;  5CF0 A;  3FT5 A;  2XJJ A;  4YKY A;  4LWH A;  3ZXO A;  1Z5A A;  4H7Q A;  3T2S A;  1US7 A;  3VHA A;  1AM1 A;  1UYG A;  3DGE A;  4P7A A;  4YKZ A;  4EEH A;  2XCM A;  1B3Q A;  1UYL A;  1UY8 A;  4GEE A;  4YKW A;  4CE2 A;  2ESA A;  4CE1 A;  5IN9 A;  5CTY A;  3R4N A;  3CRL A;  3CGZ A;  4LWG A;  4KQV A;  3K99 A;  3PEH A;  2YGA A;  2YE6 A;  4PL9 A;  4GFN A;  2YE2 A;  5GGZ A;  2BU2 A;  4XKO A;  1H7U A;  5FND A;  4XIQ A;  1AMW A;  3EHJ A;  1UY7 A;  3G75 A;  4GGL A;  3WHA A;  4U7O A;  2YE8 A;  3OPD A;  3C11 A;  3INW A;  2XX4 A;  3EKR A;  1YT2 A;  4XIR A;  4Q20 A;  4PU9 A;  4BIU A;  2BU7 A;  4MP7 A;  4JAS A;  1UYM A;  4CWS A;  2O1W A;  2YI0 A;  1L0O A;  2WI1 A;  2BYH A;  1YSZ A;  4I3H A;  3R4O A;  2YGE A;  3B28 A;  4WUC A;  1KIJ A;  3VHC A;  1TID A;  4CWN A;  5J6A A;  2YE7 A;  2K5B A;  3B24 A;  2BRC A;  3D0B A;  4YKX A;  1B62 A;  2ZBK B;  3O6O A;  4P8O A;  2BU8 A;  2XHX A;  3D2R A;  4GT8 A;  2XX2 A;  3U67 A;  3T1K A;  1YET A;  3LPS A;  4B7P A;  4DZY A;  4LWF A;  4EGH A;  3RLQ A;  4DUH A;  3H80 A;  4ZKI A;  3G7E A;  2YK9 A;  1ID0 A;  4L90 A;  3ZXQ A;  1YES A;  5D7R A;  5D7C A;  4FMT A;  3TUH A;  5BOC A;  4BQG A;  2JKI A;  2YEB A;  4BXI A;  1GJV A;  2WEQ A;  2YEA A;  1MU5 A;  2ZDX A;  5FNF A;  2YK2 A;  2ZDY A;  2AKP A;  2YJW A;  1BXD A;  4PRX A;  2XD6 A;  1UYF A;  3OWB A;  1UY6 A;  3O0I A;  1NHI A;  4KTN A;  4CWP A;  2XAB A;  1GKZ A;  2EXL A;  3A0T A;  3BM9 A;  2YI7 A;  3U2K A;  2BRE A;  4CWO A;  2IWU A;  4O07 A;  1EI1 A;  4NH9 A;  2YEI A;  4V25 A;  1S14 A;  4CWR A;  4BAE A;  2XDS A;  4O0B A;  2FWZ A;  2BT0 A;  3HHU A;  4L91 A;  4XD8 A;  4URN A;  4EFT A;  2VCJ A;  4KSH A;  4EM7 A;  5CTW A;  4L94 A;  2Q8H A;  1KZN A;  2Q8F A;  1U0Z A;  3GIG A;  3EHH A;  3OMU A;  4EFU A;  4GCZ A;  2YEF A;  1AJ6 A;  2YEG A;  2H55 A;  2HG1 A;  3R4M A;  2WI2 A;  2WI6 A;  5D6Q A;  3C0E A;  4HXZ A;  2GQP A;  2BTZ A;  3LNU A;  3Q5L A;  2FYP A;  1I58 A;  2E0A A;  1PVG A;  3Q5J A;  4HY6 A;  4ASG A;  3QDD A;  2XHT A;  2YEH A;  3G7B A;  1B63 A;  2HKJ A;  1I5B A;  1YT1 A;  3HYY A;  3ZKB A;  5M4P A;  5F5R A;  1TH8 A;  4MPE A;  4AWP A;  3OWD A;  2FWY A;  4LWE A;  4URL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...