3A0WA

Catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
152
structure length
152
Chain Sequence
b'MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0wA00
3OWDA 3PEHA 3RLPA 3R4OA 4FCPA 5IDMA 3G7BA 4XCLA 2XDKA 2XD6A 1B63A 2WI4A 4LWHA 4EEHA 3HYZA 3VHDA 4MP7A 4R1FA 3D36A 3O6OA 2YEGA 1Z5BA 4AWOA 2YEJA 1BGQA 2WI7A 4CE2A 4GEEA 4ASBA 3A0RA 2JKIA 4L94A 1Z5CA 4YKTA 5L3JA 5BODA 2YEHA 3D0BA 1UY6A 3K98A 4WUDA 2FWYA 4ZVIA 4KP4A 4LWEA 5M4HA 1Z59A 1UY9A 4LWGA 4MPNA 1OSFA 2YI0A 2HKJA 3B24A 1AH6A 4EFUA 2CCTA 4B6CA 2YJWA 1UY7A 3ZKDA 3H4LA 1I5DA 4XE2A 4L93A 1TH8A 4YKXA 3CWVA 1YT0A 5CF0A 1Y4SA 2CH4A 4YKZA 5GGZA 4EMVA 3HEKA 4URMA 1ZXNA 2Q8IA 2XJXA 2YI7A 2YE8A 5CTXA 4YKYA 2QG0A 1BKNA 1JM6A 1MU5A 2XX5A 3R4MA 2FXSA 4CWOA 3R4PA 4H81A 4BAEA 2YEDA 4XIRA 2EXLA 3H80A 4KTNA 1US7A 4YKUA 3T10A 2YE5A 4QPJA 2WI3A 1YC4A 4HZ5A 4K4OA 2YJXA 4LWIA 4KSGA 4GQTA 1B3QA 3Q5JA 3EHGA 3R92A 2YGEA 4FPPA 2O1VA 3CRLA 3ZXOA 1GKXA 2FYPA 1UYLA 2BYHA 4Q20A 4V25A 1UY8A 1MX0A 3K97A 4B7PA 1R62A 3A0WA 2BU5A 3R91A 4EGIA 2XDUA 3GIGA 4KFGA 5F5RA 4AS9A 3TZ0A 5M4MA 4MBCA 2XX2A 2GFDA 3C0EA 3U67A 2YEBA 3KE6A 3LPSA 3O2FA 4W7TA 5F3KA 3BMYA 4GFNA 1UYGA 3NMQA 2YE4A 3EHHA 3CRKA 1YC1A 4P8OA 1H7UA 2CCSA 1B62A 1BYQA 5CTUA 4MB9A 3VHAA 4LWFA 2XDLA 1TBWA 1TILA 4I5SA 4BQJA 2ZKJA 2XJGA 3U2DA 1EA6A 4L8ZA 3RKZA 3ZXQA 2WI6A 4XIPA 1AMWA 3OMUA 1NHHA 3B26A 1YETA 3B28A 4GGLA 5CPHA 3U2KA 5D7RA 2YKJA 2ZBKB 1S16A 2WEPA 3A0XA 2GQPA 2JJCA 2YE9A 2YECA 4HXZA 2C2AA 1YT1A 2XHRA 3VADA 2YKEA 4U7OA 1I59A 3Q5LA 4HY1A 5D7CA 3G75A 2AKPA 2VCIA 2YE6A 2VCJA 2WI1A 3BM9A 3EHFA 4GCZA 1UYDA 4O04A 3G7EA 2IOQA 2YK2A 4JAVA 2YI5A 3A0ZA 2ESAA 4E01A 4WUCA 2K5BA 2XDXA 3IEDA 4GT8A 3GIGB 1H7SA 3RLRA 1NHJA 1YS3A 5CTYA 2QG2A 4JAUA 4CE1A 2Q8HA 5D6QA 4CWRA 5FNDA 2XCMA 1I58A 4CWQA 5FWKA 3WQ9A 1PVGA 2YE7A 4XKAA 5BOCA 2YGFA 1I5AA 4ASGA 2H8MA 1GJVA 4L91A 2BU6A 3TTZA 1ZWHA 2WI5A 4L90A 1KZNA 2HCHA 3FT8A 4FCQA 1ID0A 3HZ1A 2XJJA 2BRCA 2QFOA 4V26A 4O0BA 2IWSA 3EKRA 3VHCA 3TUHA 1AM1A 4O07A 2YKBA 1YSRA 2CGFA 4BXIA 3QDDA 4HXWA 2WI2A 2YE2A 4BIUA 4XKOA 4PU9A 4HY6A 5IN9A 2BTZA 3HYYA 2WERA 1TIDA 2VWCA 2YK9A 1TC6A 2E0AA 4YKQA 2YKCA 4HYPA 4O05A 3JZ3A 3T2SA 4EM7A 2Q2EB 3HHUA 4XD8A 1BXDA 1I5BA 3INXA 3K60A 3RLQA 4WUBA 4DUHA 2BZ5A 2O1UA 4XKKA 3T0HA 1Y8PA 4DZYA 4MP2A 4P7AA 3T1KA 1KIJA 4KSHA 3ZKBA 1UYIA 1AH8A 3D2RA 5CTWA 3TZ2A 4AWPA 4MPEA 3O0IA 5M4EA 4XCJA 4MPCA 1U0ZA 3TZ5A 3OW6A 2YKIA 4PRXA 1QY8A 1UYMA 4X9LA 4EGKA 3HZ5A 4HYMA 1ZXMA 2XDSA 1Z5AA 2YI6A 3FV5A 2Q8FA 3B25A 3GIFA 2BU7A 3ZM7A 2YE3A 5FNCA 1THNA 4CWSA 1YSZA 4URLA 2BU2A 1S14A 2XHTA 1AJ6A 1ZW9A 3OPDA 5M4KA 4CWPA 3Q5KA 2BSMA 2IORA 1UYKA 1UYHA 5FNFA 3PEJA 4UROA 3MNRP 3OWBA 2XK2A 3B27A 4H7QA 1QYEA 3R4NA 2ZDXA 1UYEA 2BYIA 2H55A 4E02A 4ASAA 2IOPA 3QTFA 4NH8A 2VW5A 4QPKA 1UYFA 1YC3A 2YEFA 4PRVA 2XX4A 2PNRA 2FWZA 1QZRA 1A4HA 3INWA 3CGZA 3EKOA 4U93A 4MOTA 4XTJA 4FMTA 4CWNA 4BQGA 2IWXA 4URNA 4O09A 1GKZA 4FCRA 4NH7A 1UYCA 4XDMA 3WHAA 5D7DA 4R3AA 4YKRA 4HZ0A 5J6AA 4I3HA 2O1WA 4ZKIA 2BT0A 3A0YA 2BREA 1NHIA 3T0ZA 2CG9A 2QF6A 3EHJA 3A0TA 4XC0A 4LP0A 2XABA 3FT5A 4ASFA 4CWTA 1U2OA 3CGYA 4LPBA 4BIZA 2IWUA 4KQVA 4XIQA 2YEIA 2YEAA 4R3MA 2BU8A 2YEEA 5D6PA 1YESA 5M4PA 5J71A 4E00A 4PL9A 1I5CA 1Y8OA 4EFTA 3GIEA 4U7NA 3TZ4A 1TC0A 2WEQA 4EGHA 1Y8NA 2ZDYA 4CE3A 4JQLA 1Y4UA 4H85A 5IDJA 2UWDA 3SL2A 4XITA 3DGEA 5M4NA 1EI1A 4YKWA 2HG1A 4CWFA 5C93A 2CCUA 4AWQA 3LNUA 1L0OA 3K99A 2XHXA 3C11A 2Q8GA 2YGAA 1YERA 1YT2A 4NH9A 4JASA
chains in the Genus database with same CATH superfamily
3OWDA 3PEHA 3RLPA 3R4OA 4FCPA 5IDMA 3G7BA 4XCLA 2XDKA 2XD6A 1B63A 2WI4A 4LWHA 4EEHA 3HYZA 3VHDA 4MP7A 4R1FA 3D36A 3O6OA 2YEGA 1Z5BA 4AWOA 2YEJA 1BGQA 2WI7A 4CE2A 4GEEA 4ASBA 3A0RA 2HHIA 2JKIA 4L94A 1Z5CA 4YKTA 5L3JA 5BODA 2YEHA 3D0BA 1UY6A 3K98A 4WUDA 2FWYA 4ZVIA 4KP4A 4LWEA 1F51A 1Z59A 5M4HA 1UY9A 4LWGA 4MPNA 1OSFA 2YI0A 2HKJA 3B24A 1AH6A 4EFUA 2CCTA 4B6CA 2YJWA 3LMMA 2FTKA 1UY7A 3ZKDA 3H4LA 1I5DA 4XE2A 4L93A 1TH8A 4YKXA 3CWVA 1YT0A 5CF0A 1Y4SA 2CH4A 4YKZA 5GGZA 4EMVA 3HEKA 4URMA 1ZXNA 2Q8IA 2XJXA 2YI7A 2YE8A 5CTXA 4YKYA 2QG0A 1BKNA 1JM6A 1MU5A 2XX5A 3R4MA 2FXSA 4CWOA 3R4PA 4H81A 4BAEA 2YEDA 4XIRA 2EXLA 3H80A 4KTNA 1US7A 4YKUA 3T10A 2YE5A 4QPJA 2WI3A 1YC4A 4HZ5A 4K4OA 2YJXA 4LWIA 4KSGA 4GQTA 1B3QA 3Q5JA 3EHGA 3R92A 2YGEA 4FPPA 2O1VA 3CRLA 3ZXOA 1GKXA 2FYPA 1UYLA 2BYHA 4Q20A 4V25A 1UY8A 1MX0A 3K97A 4B7PA 1R62A 3A0WA 2BU5A 3R91A 4EGIA 2XDUA 3GIGA 4KFGA 1IXMA 5F5RA 4AS9A 3TZ0A 5M4MA 4MBCA 2XX2A 2GFDA 3C0EA 3U67A 2YEBA 3KE6A 3LPSA 3O2FA 4W7TA 5F3KA 3BMYA 4GFNA 1UYGA 3NMQA 2YE4A 3EHHA 3CRKA 1YC1A 4P8OA 1H7UA 2CCSA 1B62A 1BYQA 5CTUA 4MB9A 3VHAA 4LWFA 2XDLA 1TBWA 1TILA 4I5SA 4BQJA 2ZKJA 2XJGA 3U2DA 1EA6A 4L8ZA 3RKZA 3ZXQA 2WI6A 3CYGA 4XIPA 1AMWA 3OMUA 1NHHA 3B26A 1YETA 3B28A 4GGLA 5CPHA 3U2KA 5D7RA 2YKJA 2ZBKB 1S16A 2WEPA 3A0XA 2GQPA 2JJCA 2YE9A 2YECA 4HXZA 2C2AA 1YT1A 2XHRA 3VADA 2YKEA 4U7OA 1I59A 3Q5LA 4HY1A 5D7CA 3G75A 2AKPA 2VCIA 2YE6A 2VCJA 2WI1A 3BM9A 3EHFA 4GCZA 1UYDA 4O04A 3G7EA 2IOQA 2YK2A 4JAVA 2YI5A 3A0ZA 2ESAA 4E01A 4WUCA 2K5BA 2XDXA 3IEDA 4GT8A 3GIGB 1H7SA 3RLRA 2C1IA 1NHJA 1YS3A 5CTYA 2QG2A 4JAUA 4CE1A 2Q8HA 5D6QA 4CWRA 5FNDA 2XCMA 1I58A 4CWQA 5FWKA 3WQ9A 3S5TA 1PVGA 2YE7A 4XKAA 5BOCA 2YGFA 1I5AA 4ASGA 2H8MA 1GJVA 4L91A 2BU6A 3TTZA 1ZWHA 2WI5A 4L90A 1KZNA 2HCHA 3FT8A 4FCQA 1ID0A 3HZ1A 2XJJA 2BRCA 2QFOA 4V26A 4O0BA 2IWSA 2C1GA 3EKRA 3VHCA 3TUHA 1AM1A 4O07A 2YKBA 1YSRA 2CGFA 4BXIA 3QDDA 4HXWA 2WI2A 2YE2A 4BIUA 4XKOA 4PU9A 4HY6A 5IN9A 2BTZA 3HYYA 2WERA 1TIDA 2VWCA 2YK9A 1TC6A 2E0AA 4YKQA 2YKCA 4HYPA 4O05A 3JZ3A 3T2SA 4EM7A 2Q2EB 3HHUA 4XD8A 1BXDA 1I5BA 3INXA 3K60A 3RLQA 4WUBA 4DUHA 2BZ5A 2O1UA 4XKKA 3T0HA 1Y8PA 4DZYA 4MP2A 4P7AA 3T1KA 1KIJA 4KSHA 3ZKBA 1UYIA 1AH8A 3D2RA 5CTWA 3TZ2A 4AWPA 4MPEA 3O0IA 5M4EA 4XCJA 4MPCA 1U0ZA 3TZ5A 3OW6A 2YKIA 4PRXA 5JENA 1QY8A 1UYMA 4X9LA 4EGKA 3HZ5A 4HYMA 1ZXMA 2XDSA 1Z5AA 2YI6A 3FV5A 2Q8FA 3B25A 3GIFA 2BU7A 3ZM7A 4E72A 2YE3A 5FNCA 1THNA 4CWSA 1YSZA 4URLA 2BU2A 1S14A 2XHTA 1AJ6A 1ZW9A 3OPDA 5M4KA 4CWPA 3Q5KA 2BSMA 2IORA 1UYKA 1UYHA 5FNFA 3PEJA 4UROA 3MNRP 3OWBA 2XK2A 3B27A 4H7QA 1QYEA 3R4NA 2ZDXA 1UYEA 2BYIA 2H55A 4E02A 4ASAA 2IOPA 3QTFA 4NH8A 2VW5A 4QPKA 1UYFA 1YC3A 2YEFA 4PRVA 2XX4A 2PNRA 2FWZA 1QZRA 1A4HA 3INWA 3CGZA 3EKOA 4U93A 4MOTA 4XTJA 4FMTA 4CWNA 4BQGA 2IWXA 4URNA 4O09A 1GKZA 4FCRA 4NH7A 1UYCA 4XDMA 3WHAA 5D7DA 4R3AA 4YKRA 4HZ0A 5J6AA 4I3HA 2O1WA 4ZKIA 2BT0A 3A0YA 2BREA 1NHIA 3T0ZA 2CG9A 2QF6A 3EHJA 3A0TA 4XC0A 4LP0A 2XABA 3FT5A 4ASFA 4CWTA 1U2OA 3CGYA 4LPBA 4BIZA 2IWUA 4KQVA 4XIQA 2YEIA 2YEAA 4R3MA 2BU8A 2YEEA 5D6PA 1YESA 5M4PA 5J71A 4E00A 4PL9A 1I5CA 1Y8OA 4EFTA 3GIEA 4U7NA 3TZ4A 1TC0A 2WEQA 4EGHA 1Y8NA 2ZDYA 4CE3A 4JQLA 1Y4UA 4H85A 5IDJA 2UWDA 3SL2A 4XITA 3DGEA 5M4NA 1EI1A 4YKWA 2HG1A 4CWFA 5C93A 2CCUA 4AWQA 3LNUA 1L0OA 3K99A 2XHXA 3C11A 2Q8GA 2YGAA 1YERA 1YT2A 4NH9A 4JASA
chains in the Genus database with same CATH topology
3OWDA 3PEHA 3RLPA 3R4OA 4FCPA 5IDMA 3G7BA 4XCLA 2XDKA 2XD6A 1B63A 2WI4A 4LWHA 4EEHA 3HYZA 3VHDA 4MP7A 4R1FA 3D36A 3O6OA 2YEGA 1Z5BA 4AWOA 2YEJA 1BGQA 2WI7A 4CE2A 4GEEA 4ASBA 3A0RA 2JKIA 4L94A 1Z5CA 4YKTA 5L3JA 5BODA 2YEHA 3D0BA 1UY6A 3K98A 4WUDA 2FWYA 4ZVIA 4KP4A 4LWEA 5M4HA 1Z59A 1UY9A 4LWGA 4MPNA 1OSFA 2YI0A 2HKJA 3B24A 1AH6A 4EFUA 2CCTA 4B6CA 2YJWA 1UY7A 3ZKDA 3H4LA 1I5DA 4XE2A 4L93A 1TH8A 4YKXA 3CWVA 1YT0A 5CF0A 1Y4SA 2CH4A 4YKZA 5GGZA 4EMVA 3HEKA 4URMA 1ZXNA 2Q8IA 2XJXA 2YI7A 2YE8A 5CTXA 4YKYA 2QG0A 1BKNA 1JM6A 1MU5A 2XX5A 3R4MA 2FXSA 4CWOA 3R4PA 4H81A 4BAEA 2YEDA 4XIRA 2EXLA 3H80A 4KTNA 1US7A 4YKUA 3T10A 2YE5A 4QPJA 2WI3A 1YC4A 4HZ5A 4K4OA 2YJXA 4LWIA 4KSGA 4GQTA 1B3QA 3Q5JA 3EHGA 3R92A 2YGEA 4FPPA 2O1VA 3CRLA 3ZXOA 1GKXA 2FYPA 1UYLA 2BYHA 4Q20A 4V25A 1UY8A 1MX0A 3K97A 4B7PA 1R62A 3A0WA 2BU5A 3R91A 4EGIA 2XDUA 3GIGA 4KFGA 5F5RA 4AS9A 3TZ0A 5M4MA 4MBCA 2XX2A 2GFDA 3C0EA 3U67A 2YEBA 3KE6A 3LPSA 3O2FA 4W7TA 5F3KA 3BMYA 4GFNA 1UYGA 3NMQA 2YE4A 3EHHA 3CRKA 1YC1A 4P8OA 1H7UA 2CCSA 1B62A 1BYQA 5CTUA 4MB9A 3VHAA 4LWFA 2XDLA 1TBWA 1TILA 4I5SA 4BQJA 2ZKJA 2XJGA 3U2DA 1EA6A 4L8ZA 3RKZA 3ZXQA 2WI6A 4XIPA 1AMWA 3OMUA 1NHHA 3B26A 1YETA 3B28A 4GGLA 5CPHA 3U2KA 5D7RA 2YKJA 2ZBKB 1S16A 2WEPA 3A0XA 2GQPA 2JJCA 2YE9A 2YECA 4HXZA 2C2AA 1YT1A 2XHRA 3VADA 2YKEA 4U7OA 1I59A 3Q5LA 4HY1A 5D7CA 3G75A 2AKPA 2VCIA 2YE6A 2VCJA 2WI1A 3BM9A 3EHFA 4GCZA 1UYDA 4O04A 3G7EA 2IOQA 2YK2A 4JAVA 2YI5A 3A0ZA 2ESAA 4E01A 4WUCA 2K5BA 2XDXA 3IEDA 4GT8A 3GIGB 1H7SA 3RLRA 1NHJA 1YS3A 5CTYA 2QG2A 4JAUA 4CE1A 2Q8HA 5D6QA 4CWRA 5FNDA 2XCMA 1I58A 4CWQA 5FWKA 3WQ9A 1PVGA 2YE7A 4XKAA 5BOCA 2YGFA 1I5AA 4ASGA 2H8MA 1GJVA 4L91A 2BU6A 3TTZA 1ZWHA 2WI5A 4L90A 1KZNA 2HCHA 3FT8A 4FCQA 1ID0A 3HZ1A 2XJJA 2BRCA 2QFOA 4V26A 4O0BA 2IWSA 3EKRA 3VHCA 3TUHA 1AM1A 4O07A 2YKBA 1YSRA 2CGFA 4BXIA 3QDDA 4HXWA 2WI2A 2YE2A 4BIUA 4XKOA 4PU9A 4HY6A 5IN9A 2BTZA 3HYYA 2WERA 1TIDA 2VWCA 2YK9A 1TC6A 2E0AA 4YKQA 2YKCA 4HYPA 4O05A 3JZ3A 3T2SA 4EM7A 2Q2EB 3HHUA 4XD8A 1BXDA 1I5BA 3INXA 3K60A 3RLQA 4WUBA 4DUHA 2BZ5A 2O1UA 4XKKA 3T0HA 1Y8PA 4DZYA 4MP2A 4P7AA 3T1KA 1KIJA 4KSHA 3ZKBA 1UYIA 1AH8A 3D2RA 5CTWA 3TZ2A 4AWPA 4MPEA 3O0IA 5M4EA 4XCJA 4MPCA 1U0ZA 3TZ5A 3OW6A 2YKIA 4PRXA 1QY8A 1UYMA 4X9LA 4EGKA 3HZ5A 4HYMA 1ZXMA 2XDSA 1Z5AA 2YI6A 3FV5A 2Q8FA 3B25A 3GIFA 2BU7A 3ZM7A 2YE3A 5FNCA 1THNA 4CWSA 1YSZA 4URLA 2BU2A 1S14A 2XHTA 1AJ6A 1ZW9A 3OPDA 5M4KA 4CWPA 3Q5KA 2BSMA 2IORA 1UYKA 1UYHA 5FNFA 3PEJA 4UROA 3MNRP 3OWBA 2XK2A 3B27A 4H7QA 1QYEA 3R4NA 2ZDXA 1UYEA 2BYIA 2H55A 4E02A 4ASAA 2IOPA 3QTFA 4NH8A 2VW5A 4QPKA 1UYFA 1YC3A 2YEFA 4PRVA 2XX4A 2PNRA 2FWZA 1QZRA 1A4HA 3INWA 3CGZA 3EKOA 4U93A 4MOTA 4XTJA 4FMTA 4CWNA 4BQGA 2IWXA 4URNA 4O09A 1GKZA 4FCRA 4NH7A 1UYCA 4XDMA 3WHAA 5D7DA 4R3AA 4YKRA 4HZ0A 5J6AA 4I3HA 2O1WA 4ZKIA 2BT0A 3A0YA 2BREA 1NHIA 3T0ZA 2CG9A 2QF6A 3EHJA 3A0TA 4XC0A 4LP0A 2XABA 3FT5A 4ASFA 4CWTA 1U2OA 3CGYA 4LPBA 4BIZA 2IWUA 4KQVA 4XIQA 2YEIA 2YEAA 4R3MA 2BU8A 2YEEA 5D6PA 1YESA 5M4PA 5J71A 4E00A 4PL9A 1I5CA 1Y8OA 4EFTA 3GIEA 4U7NA 3TZ4A 1TC0A 2WEQA 4EGHA 1Y8NA 2ZDYA 4CE3A 4JQLA 1Y4UA 4H85A 5IDJA 2UWDA 3SL2A 4XITA 3DGEA 5M4NA 1EI1A 4YKWA 2HG1A 4CWFA 5C93A 2CCUA 4AWQA 3LNUA 1L0OA 3K99A 2XHXA 3C11A 2Q8GA 2YGAA 1YERA 1YT2A 4NH9A 4JASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWD A;  3PEH A;  3RLP A;  3R4O A;  4FCP A;  5IDM A;  3G7B A;  4XCL A;  2XDK A;  2XD6 A;  1B63 A;  2WI4 A;  4LWH A;  4EEH A;  3HYZ A;  3VHD A;  4MP7 A;  4R1F A;  3D36 A;  3O6O A;  2YEG A;  1Z5B A;  4AWO A;  2YEJ A;  1BGQ A;  2WI7 A;  4CE2 A;  4GEE A;  4ASB A;  3A0R A;  2JKI A;  4L94 A;  1Z5C A;  4YKT A;  5L3J A;  5BOD A;  2YEH A;  3D0B A;  1UY6 A;  3K98 A;  4WUD A;  2FWY A;  4ZVI A;  4KP4 A;  4LWE A;  5M4H A;  1Z59 A;  1UY9 A;  4LWG A;  4MPN A;  1OSF A;  2YI0 A;  2HKJ A;  3B24 A;  1AH6 A;  4EFU A;  2CCT A;  4B6C A;  2YJW A;  1UY7 A;  3ZKD A;  3H4L A;  1I5D A;  4XE2 A;  4L93 A;  1TH8 A;  4YKX A;  3CWV A;  1YT0 A;  5CF0 A;  1Y4S A;  2CH4 A;  4YKZ A;  5GGZ A;  4EMV A;  3HEK A;  4URM A;  1ZXN A;  2Q8I A;  2XJX A;  2YI7 A;  2YE8 A;  5CTX A;  4YKY A;  2QG0 A;  1BKN A;  1JM6 A;  1MU5 A;  2XX5 A;  3R4M A;  2FXS A;  4CWO A;  3R4P A;  4H81 A;  4BAE A;  2YED A;  4XIR A;  2EXL A;  3H80 A;  4KTN A;  1US7 A;  4YKU A;  3T10 A;  2YE5 A;  4QPJ A;  2WI3 A;  1YC4 A;  4HZ5 A;  4K4O A;  2YJX A;  4LWI A;  4KSG A;  4GQT A;  1B3Q A;  3Q5J A;  3EHG A;  3R92 A;  2YGE A;  4FPP A;  2O1V A;  3CRL A;  3ZXO A;  1GKX A;  2FYP A;  1UYL A;  2BYH A;  4Q20 A;  4V25 A;  1UY8 A;  1MX0 A;  3K97 A;  4B7P A;  1R62 A;  3A0W A;  2BU5 A;  3R91 A;  4EGI A;  2XDU A;  3GIG A;  4KFG A;  5F5R A;  4AS9 A;  3TZ0 A;  5M4M A;  4MBC A;  2XX2 A;  2GFD A;  3C0E A;  3U67 A;  2YEB A;  3KE6 A;  3LPS A;  3O2F A;  4W7T A;  5F3K A;  3BMY A;  4GFN A;  1UYG A;  3NMQ A;  2YE4 A;  3EHH A;  3CRK A;  1YC1 A;  4P8O A;  1H7U A;  2CCS A;  1B62 A;  1BYQ A;  5CTU A;  4MB9 A;  3VHA A;  4LWF A;  2XDL A;  1TBW A;  1TIL A;  4I5S A;  4BQJ A;  2ZKJ A;  2XJG A;  3U2D A;  1EA6 A;  4L8Z A;  3RKZ A;  3ZXQ A;  2WI6 A;  4XIP A;  1AMW A;  3OMU A;  1NHH A;  3B26 A;  1YET A;  3B28 A;  4GGL A;  5CPH A;  3U2K A;  5D7R A;  2YKJ A;  2ZBK B;  1S16 A;  2WEP A;  3A0X A;  2GQP A;  2JJC A;  2YE9 A;  2YEC A;  4HXZ A;  2C2A A;  1YT1 A;  2XHR A;  3VAD A;  2YKE A;  4U7O A;  1I59 A;  3Q5L A;  4HY1 A;  5D7C A;  3G75 A;  2AKP A;  2VCI A;  2YE6 A;  2VCJ A;  2WI1 A;  3BM9 A;  3EHF A;  4GCZ A;  1UYD A;  4O04 A;  3G7E A;  2IOQ A;  2YK2 A;  4JAV A;  2YI5 A;  3A0Z A;  2ESA A;  4E01 A;  4WUC A;  2K5B A;  2XDX A;  3IED A;  4GT8 A;  3GIG B;  1H7S A;  3RLR A;  1NHJ A;  1YS3 A;  5CTY A;  2QG2 A;  4JAU A;  4CE1 A;  2Q8H A;  5D6Q A;  4CWR A;  5FND A;  2XCM A;  1I58 A;  4CWQ A;  5FWK A;  3WQ9 A;  1PVG A;  2YE7 A;  4XKA A;  5BOC A;  2YGF A;  1I5A A;  4ASG A;  2H8M A;  1GJV A;  4L91 A;  2BU6 A;  3TTZ A;  1ZWH A;  2WI5 A;  4L90 A;  1KZN A;  2HCH A;  3FT8 A;  4FCQ A;  1ID0 A;  3HZ1 A;  2XJJ A;  2BRC A;  2QFO A;  4V26 A;  4O0B A;  2IWS A;  3EKR A;  3VHC A;  3TUH A;  1AM1 A;  4O07 A;  2YKB A;  1YSR A;  2CGF A;  4BXI A;  3QDD A;  4HXW A;  2WI2 A;  2YE2 A;  4BIU A;  4XKO A;  4PU9 A;  4HY6 A;  5IN9 A;  2BTZ A;  3HYY A;  2WER A;  1TID A;  2VWC A;  2YK9 A;  1TC6 A;  2E0A A;  4YKQ A;  2YKC A;  4HYP A;  4O05 A;  3JZ3 A;  3T2S A;  4EM7 A;  2Q2E B;  3HHU A;  4XD8 A;  1BXD A;  1I5B A;  3INX A;  3K60 A;  3RLQ A;  4WUB A;  4DUH A;  2BZ5 A;  2O1U A;  4XKK A;  3T0H A;  1Y8P A;  4DZY A;  4MP2 A;  4P7A A;  3T1K A;  1KIJ A;  4KSH A;  3ZKB A;  1UYI A;  1AH8 A;  3D2R A;  5CTW A;  3TZ2 A;  4AWP A;  4MPE A;  3O0I A;  5M4E A;  4XCJ A;  4MPC A;  1U0Z A;  3TZ5 A;  3OW6 A;  2YKI A;  4PRX A;  1QY8 A;  1UYM A;  4X9L A;  4EGK A;  3HZ5 A;  4HYM A;  1ZXM A;  2XDS A;  1Z5A A;  2YI6 A;  3FV5 A;  2Q8F A;  3B25 A;  3GIF A;  2BU7 A;  3ZM7 A;  2YE3 A;  5FNC A;  1THN A;  4CWS A;  1YSZ A;  4URL A;  2BU2 A;  1S14 A;  2XHT A;  1AJ6 A;  1ZW9 A;  3OPD A;  5M4K A;  4CWP A;  3Q5K A;  2BSM A;  2IOR A;  1UYK A;  1UYH A;  5FNF A;  3PEJ A;  4URO A;  3MNR P;  3OWB A;  2XK2 A;  3B27 A;  4H7Q A;  1QYE A;  3R4N A;  2ZDX A;  1UYE A;  2BYI A;  2H55 A;  4E02 A;  4ASA A;  2IOP A;  3QTF A;  4NH8 A;  2VW5 A;  4QPK A;  1UYF A;  1YC3 A;  2YEF A;  4PRV A;  2XX4 A;  2PNR A;  2FWZ A;  1QZR A;  1A4H A;  3INW A;  3CGZ A;  3EKO A;  4U93 A;  4MOT A;  4XTJ A;  4FMT A;  4CWN A;  4BQG A;  2IWX A;  4URN A;  4O09 A;  1GKZ A;  4FCR A;  4NH7 A;  1UYC A;  4XDM A;  3WHA A;  5D7D A;  4R3A A;  4YKR A;  4HZ0 A;  5J6A A;  4I3H A;  2O1W A;  4ZKI A;  2BT0 A;  3A0Y A;  2BRE A;  1NHI A;  3T0Z A;  2CG9 A;  2QF6 A;  3EHJ A;  3A0T A;  4XC0 A;  4LP0 A;  2XAB A;  3FT5 A;  4ASF A;  4CWT A;  1U2O A;  3CGY A;  4LPB A;  4BIZ A;  2IWU A;  4KQV A;  4XIQ A;  2YEI A;  2YEA A;  4R3M A;  2BU8 A;  2YEE A;  5D6P A;  1YES A;  5M4P A;  5J71 A;  4E00 A;  4PL9 A;  1I5C A;  1Y8O A;  4EFT A;  3GIE A;  4U7N A;  3TZ4 A;  1TC0 A;  2WEQ A;  4EGH A;  1Y8N A;  2ZDY A;  4CE3 A;  4JQL A;  1Y4U A;  4H85 A;  5IDJ A;  2UWD A;  3SL2 A;  4XIT A;  3DGE A;  5M4N A;  1EI1 A;  4YKW A;  2HG1 A;  4CWF A;  5C93 A;  2CCU A;  4AWQ A;  3LNU A;  1L0O A;  3K99 A;  2XHX A;  3C11 A;  2Q8G A;  2YGA A;  1YER A;  1YT2 A;  4NH9 A;  4JAS A; 
#chains in the Genus database with same CATH topology
 3OWD A;  3PEH A;  3RLP A;  3R4O A;  4FCP A;  5IDM A;  3G7B A;  4XCL A;  2XDK A;  2XD6 A;  1B63 A;  2WI4 A;  4LWH A;  4EEH A;  3HYZ A;  3VHD A;  4MP7 A;  4R1F A;  3D36 A;  3O6O A;  2YEG A;  1Z5B A;  4AWO A;  2YEJ A;  1BGQ A;  2WI7 A;  4CE2 A;  4GEE A;  4ASB A;  3A0R A;  2HHI A;  2JKI A;  4L94 A;  1Z5C A;  4YKT A;  5L3J A;  5BOD A;  2YEH A;  3D0B A;  1UY6 A;  3K98 A;  4WUD A;  2FWY A;  4ZVI A;  4KP4 A;  4LWE A;  1F51 A;  1Z59 A;  5M4H A;  1UY9 A;  4LWG A;  4MPN A;  1OSF A;  2YI0 A;  2HKJ A;  3B24 A;  1AH6 A;  4EFU A;  2CCT A;  4B6C A;  2YJW A;  3LMM A;  2FTK A;  1UY7 A;  3ZKD A;  3H4L A;  1I5D A;  4XE2 A;  4L93 A;  1TH8 A;  4YKX A;  3CWV A;  1YT0 A;  5CF0 A;  1Y4S A;  2CH4 A;  4YKZ A;  5GGZ A;  4EMV A;  3HEK A;  4URM A;  1ZXN A;  2Q8I A;  2XJX A;  2YI7 A;  2YE8 A;  5CTX A;  4YKY A;  2QG0 A;  1BKN A;  1JM6 A;  1MU5 A;  2XX5 A;  3R4M A;  2FXS A;  4CWO A;  3R4P A;  4H81 A;  4BAE A;  2YED A;  4XIR A;  2EXL A;  3H80 A;  4KTN A;  1US7 A;  4YKU A;  3T10 A;  2YE5 A;  4QPJ A;  2WI3 A;  1YC4 A;  4HZ5 A;  4K4O A;  2YJX A;  4LWI A;  4KSG A;  4GQT A;  1B3Q A;  3Q5J A;  3EHG A;  3R92 A;  2YGE A;  4FPP A;  2O1V A;  3CRL A;  3ZXO A;  1GKX A;  2FYP A;  1UYL A;  2BYH A;  4Q20 A;  4V25 A;  1UY8 A;  1MX0 A;  3K97 A;  4B7P A;  1R62 A;  3A0W A;  2BU5 A;  3R91 A;  4EGI A;  2XDU A;  3GIG A;  4KFG A;  1IXM A;  5F5R A;  4AS9 A;  3TZ0 A;  5M4M A;  4MBC A;  2XX2 A;  2GFD A;  3C0E A;  3U67 A;  2YEB A;  3KE6 A;  3LPS A;  3O2F A;  4W7T A;  5F3K A;  3BMY A;  4GFN A;  1UYG A;  3NMQ A;  2YE4 A;  3EHH A;  3CRK A;  1YC1 A;  4P8O A;  1H7U A;  2CCS A;  1B62 A;  1BYQ A;  5CTU A;  4MB9 A;  3VHA A;  4LWF A;  2XDL A;  1TBW A;  1TIL A;  4I5S A;  4BQJ A;  2ZKJ A;  2XJG A;  3U2D A;  1EA6 A;  4L8Z A;  3RKZ A;  3ZXQ A;  2WI6 A;  3CYG A;  4XIP A;  1AMW A;  3OMU A;  1NHH A;  3B26 A;  1YET A;  3B28 A;  4GGL A;  5CPH A;  3U2K A;  5D7R A;  2YKJ A;  2ZBK B;  1S16 A;  2WEP A;  3A0X A;  2GQP A;  2JJC A;  2YE9 A;  2YEC A;  4HXZ A;  2C2A A;  1YT1 A;  2XHR A;  3VAD A;  2YKE A;  4U7O A;  1I59 A;  3Q5L A;  4HY1 A;  5D7C A;  3G75 A;  2AKP A;  2VCI A;  2YE6 A;  2VCJ A;  2WI1 A;  3BM9 A;  3EHF A;  4GCZ A;  1UYD A;  4O04 A;  3G7E A;  2IOQ A;  2YK2 A;  4JAV A;  2YI5 A;  3A0Z A;  2ESA A;  4E01 A;  4WUC A;  2K5B A;  2XDX A;  3IED A;  4GT8 A;  3GIG B;  1H7S A;  3RLR A;  2C1I A;  1NHJ A;  1YS3 A;  5CTY A;  2QG2 A;  4JAU A;  4CE1 A;  2Q8H A;  5D6Q A;  4CWR A;  5FND A;  2XCM A;  1I58 A;  4CWQ A;  5FWK A;  3WQ9 A;  3S5T A;  1PVG A;  2YE7 A;  4XKA A;  5BOC A;  2YGF A;  1I5A A;  4ASG A;  2H8M A;  1GJV A;  4L91 A;  2BU6 A;  3TTZ A;  1ZWH A;  2WI5 A;  4L90 A;  1KZN A;  2HCH A;  3FT8 A;  4FCQ A;  1ID0 A;  3HZ1 A;  2XJJ A;  2BRC A;  2QFO A;  4V26 A;  4O0B A;  2IWS A;  2C1G A;  3EKR A;  3VHC A;  3TUH A;  1AM1 A;  4O07 A;  2YKB A;  1YSR A;  2CGF A;  4BXI A;  3QDD A;  4HXW A;  2WI2 A;  2YE2 A;  4BIU A;  4XKO A;  4PU9 A;  4HY6 A;  5IN9 A;  2BTZ A;  3HYY A;  2WER A;  1TID A;  2VWC A;  2YK9 A;  1TC6 A;  2E0A A;  4YKQ A;  2YKC A;  4HYP A;  4O05 A;  3JZ3 A;  3T2S A;  4EM7 A;  2Q2E B;  3HHU A;  4XD8 A;  1BXD A;  1I5B A;  3INX A;  3K60 A;  3RLQ A;  4WUB A;  4DUH A;  2BZ5 A;  2O1U A;  4XKK A;  3T0H A;  1Y8P A;  4DZY A;  4MP2 A;  4P7A A;  3T1K A;  1KIJ A;  4KSH A;  3ZKB A;  1UYI A;  1AH8 A;  3D2R A;  5CTW A;  3TZ2 A;  4AWP A;  4MPE A;  3O0I A;  5M4E A;  4XCJ A;  4MPC A;  1U0Z A;  3TZ5 A;  3OW6 A;  2YKI A;  4PRX A;  5JEN A;  1QY8 A;  1UYM A;  4X9L A;  4EGK A;  3HZ5 A;  4HYM A;  1ZXM A;  2XDS A;  1Z5A A;  2YI6 A;  3FV5 A;  2Q8F A;  3B25 A;  3GIF A;  2BU7 A;  3ZM7 A;  4E72 A;  2YE3 A;  5FNC A;  1THN A;  4CWS A;  1YSZ A;  4URL A;  2BU2 A;  1S14 A;  2XHT A;  1AJ6 A;  1ZW9 A;  3OPD A;  5M4K A;  4CWP A;  3Q5K A;  2BSM A;  2IOR A;  1UYK A;  1UYH A;  5FNF A;  3PEJ A;  4URO A;  3MNR P;  3OWB A;  2XK2 A;  3B27 A;  4H7Q A;  1QYE A;  3R4N A;  2ZDX A;  1UYE A;  2BYI A;  2H55 A;  4E02 A;  4ASA A;  2IOP A;  3QTF A;  4NH8 A;  2VW5 A;  4QPK A;  1UYF A;  1YC3 A;  2YEF A;  4PRV A;  2XX4 A;  2PNR A;  2FWZ A;  1QZR A;  1A4H A;  3INW A;  3CGZ A;  3EKO A;  4U93 A;  4MOT A;  4XTJ A;  4FMT A;  4CWN A;  4BQG A;  2IWX A;  4URN A;  4O09 A;  1GKZ A;  4FCR A;  4NH7 A;  1UYC A;  4XDM A;  3WHA A;  5D7D A;  4R3A A;  4YKR A;  4HZ0 A;  5J6A A;  4I3H A;  2O1W A;  4ZKI A;  2BT0 A;  3A0Y A;  2BRE A;  1NHI A;  3T0Z A;  2CG9 A;  2QF6 A;  3EHJ A;  3A0T A;  4XC0 A;  4LP0 A;  2XAB A;  3FT5 A;  4ASF A;  4CWT A;  1U2O A;  3CGY A;  4LPB A;  4BIZ A;  2IWU A;  4KQV A;  4XIQ A;  2YEI A;  2YEA A;  4R3M A;  2BU8 A;  2YEE A;  5D6P A;  1YES A;  5M4P A;  5J71 A;  4E00 A;  4PL9 A;  1I5C A;  1Y8O A;  4EFT A;  3GIE A;  4U7N A;  3TZ4 A;  1TC0 A;  2WEQ A;  4EGH A;  1Y8N A;  2ZDY A;  4CE3 A;  4JQL A;  1Y4U A;  4H85 A;  5IDJ A;  2UWD A;  3SL2 A;  4XIT A;  3DGE A;  5M4N A;  1EI1 A;  4YKW A;  2HG1 A;  4CWF A;  5C93 A;  2CCU A;  4AWQ A;  3LNU A;  1L0O A;  3K99 A;  2XHX A;  3C11 A;  2Q8G A;  2YGA A;  1YER A;  1YT2 A;  4NH9 A;  4JAS A; 
#chains in the Genus database with same CATH homology
 3OWD A;  3PEH A;  3RLP A;  3R4O A;  4FCP A;  5IDM A;  3G7B A;  4XCL A;  2XDK A;  2XD6 A;  1B63 A;  2WI4 A;  4LWH A;  4EEH A;  3HYZ A;  3VHD A;  4MP7 A;  4R1F A;  3D36 A;  3O6O A;  2YEG A;  1Z5B A;  4AWO A;  2YEJ A;  1BGQ A;  2WI7 A;  4CE2 A;  4GEE A;  4ASB A;  3A0R A;  2JKI A;  4L94 A;  1Z5C A;  4YKT A;  5L3J A;  5BOD A;  2YEH A;  3D0B A;  1UY6 A;  3K98 A;  4WUD A;  2FWY A;  4ZVI A;  4KP4 A;  4LWE A;  5M4H A;  1Z59 A;  1UY9 A;  4LWG A;  4MPN A;  1OSF A;  2YI0 A;  2HKJ A;  3B24 A;  1AH6 A;  4EFU A;  2CCT A;  4B6C A;  2YJW A;  1UY7 A;  3ZKD A;  3H4L A;  1I5D A;  4XE2 A;  4L93 A;  1TH8 A;  4YKX A;  3CWV A;  1YT0 A;  5CF0 A;  1Y4S A;  2CH4 A;  4YKZ A;  5GGZ A;  4EMV A;  3HEK A;  4URM A;  1ZXN A;  2Q8I A;  2XJX A;  2YI7 A;  2YE8 A;  5CTX A;  4YKY A;  2QG0 A;  1BKN A;  1JM6 A;  1MU5 A;  2XX5 A;  3R4M A;  2FXS A;  4CWO A;  3R4P A;  4H81 A;  4BAE A;  2YED A;  4XIR A;  2EXL A;  3H80 A;  4KTN A;  1US7 A;  4YKU A;  3T10 A;  2YE5 A;  4QPJ A;  2WI3 A;  1YC4 A;  4HZ5 A;  4K4O A;  2YJX A;  4LWI A;  4KSG A;  4GQT A;  1B3Q A;  3Q5J A;  3EHG A;  3R92 A;  2YGE A;  4FPP A;  2O1V A;  3CRL A;  3ZXO A;  1GKX A;  2FYP A;  1UYL A;  2BYH A;  4Q20 A;  4V25 A;  1UY8 A;  1MX0 A;  3K97 A;  4B7P A;  1R62 A;  3A0W A;  2BU5 A;  3R91 A;  4EGI A;  2XDU A;  3GIG A;  4KFG A;  5F5R A;  4AS9 A;  3TZ0 A;  5M4M A;  4MBC A;  2XX2 A;  2GFD A;  3C0E A;  3U67 A;  2YEB A;  3KE6 A;  3LPS A;  3O2F A;  4W7T A;  5F3K A;  3BMY A;  4GFN A;  1UYG A;  3NMQ A;  2YE4 A;  3EHH A;  3CRK A;  1YC1 A;  4P8O A;  1H7U A;  2CCS A;  1B62 A;  1BYQ A;  5CTU A;  4MB9 A;  3VHA A;  4LWF A;  2XDL A;  1TBW A;  1TIL A;  4I5S A;  4BQJ A;  2ZKJ A;  2XJG A;  3U2D A;  1EA6 A;  4L8Z A;  3RKZ A;  3ZXQ A;  2WI6 A;  4XIP A;  1AMW A;  3OMU A;  1NHH A;  3B26 A;  1YET A;  3B28 A;  4GGL A;  5CPH A;  3U2K A;  5D7R A;  2YKJ A;  2ZBK B;  1S16 A;  2WEP A;  3A0X A;  2GQP A;  2JJC A;  2YE9 A;  2YEC A;  4HXZ A;  2C2A A;  1YT1 A;  2XHR A;  3VAD A;  2YKE A;  4U7O A;  1I59 A;  3Q5L A;  4HY1 A;  5D7C A;  3G75 A;  2AKP A;  2VCI A;  2YE6 A;  2VCJ A;  2WI1 A;  3BM9 A;  3EHF A;  4GCZ A;  1UYD A;  4O04 A;  3G7E A;  2IOQ A;  2YK2 A;  4JAV A;  2YI5 A;  3A0Z A;  2ESA A;  4E01 A;  4WUC A;  2K5B A;  2XDX A;  3IED A;  4GT8 A;  3GIG B;  1H7S A;  3RLR A;  1NHJ A;  1YS3 A;  5CTY A;  2QG2 A;  4JAU A;  4CE1 A;  2Q8H A;  5D6Q A;  4CWR A;  5FND A;  2XCM A;  1I58 A;  4CWQ A;  5FWK A;  3WQ9 A;  1PVG A;  2YE7 A;  4XKA A;  5BOC A;  2YGF A;  1I5A A;  4ASG A;  2H8M A;  1GJV A;  4L91 A;  2BU6 A;  3TTZ A;  1ZWH A;  2WI5 A;  4L90 A;  1KZN A;  2HCH A;  3FT8 A;  4FCQ A;  1ID0 A;  3HZ1 A;  2XJJ A;  2BRC A;  2QFO A;  4V26 A;  4O0B A;  2IWS A;  3EKR A;  3VHC A;  3TUH A;  1AM1 A;  4O07 A;  2YKB A;  1YSR A;  2CGF A;  4BXI A;  3QDD A;  4HXW A;  2WI2 A;  2YE2 A;  4BIU A;  4XKO A;  4PU9 A;  4HY6 A;  5IN9 A;  2BTZ A;  3HYY A;  2WER A;  1TID A;  2VWC A;  2YK9 A;  1TC6 A;  2E0A A;  4YKQ A;  2YKC A;  4HYP A;  4O05 A;  3JZ3 A;  3T2S A;  4EM7 A;  2Q2E B;  3HHU A;  4XD8 A;  1BXD A;  1I5B A;  3INX A;  3K60 A;  3RLQ A;  4WUB A;  4DUH A;  2BZ5 A;  2O1U A;  4XKK A;  3T0H A;  1Y8P A;  4DZY A;  4MP2 A;  4P7A A;  3T1K A;  1KIJ A;  4KSH A;  3ZKB A;  1UYI A;  1AH8 A;  3D2R A;  5CTW A;  3TZ2 A;  4AWP A;  4MPE A;  3O0I A;  5M4E A;  4XCJ A;  4MPC A;  1U0Z A;  3TZ5 A;  3OW6 A;  2YKI A;  4PRX A;  1QY8 A;  1UYM A;  4X9L A;  4EGK A;  3HZ5 A;  4HYM A;  1ZXM A;  2XDS A;  1Z5A A;  2YI6 A;  3FV5 A;  2Q8F A;  3B25 A;  3GIF A;  2BU7 A;  3ZM7 A;  2YE3 A;  5FNC A;  1THN A;  4CWS A;  1YSZ A;  4URL A;  2BU2 A;  1S14 A;  2XHT A;  1AJ6 A;  1ZW9 A;  3OPD A;  5M4K A;  4CWP A;  3Q5K A;  2BSM A;  2IOR A;  1UYK A;  1UYH A;  5FNF A;  3PEJ A;  4URO A;  3MNR P;  3OWB A;  2XK2 A;  3B27 A;  4H7Q A;  1QYE A;  3R4N A;  2ZDX A;  1UYE A;  2BYI A;  2H55 A;  4E02 A;  4ASA A;  2IOP A;  3QTF A;  4NH8 A;  2VW5 A;  4QPK A;  1UYF A;  1YC3 A;  2YEF A;  4PRV A;  2XX4 A;  2PNR A;  2FWZ A;  1QZR A;  1A4H A;  3INW A;  3CGZ A;  3EKO A;  4U93 A;  4MOT A;  4XTJ A;  4FMT A;  4CWN A;  4BQG A;  2IWX A;  4URN A;  4O09 A;  1GKZ A;  4FCR A;  4NH7 A;  1UYC A;  4XDM A;  3WHA A;  5D7D A;  4R3A A;  4YKR A;  4HZ0 A;  5J6A A;  4I3H A;  2O1W A;  4ZKI A;  2BT0 A;  3A0Y A;  2BRE A;  1NHI A;  3T0Z A;  2CG9 A;  2QF6 A;  3EHJ A;  3A0T A;  4XC0 A;  4LP0 A;  2XAB A;  3FT5 A;  4ASF A;  4CWT A;  1U2O A;  3CGY A;  4LPB A;  4BIZ A;  2IWU A;  4KQV A;  4XIQ A;  2YEI A;  2YEA A;  4R3M A;  2BU8 A;  2YEE A;  5D6P A;  1YES A;  5M4P A;  5J71 A;  4E00 A;  4PL9 A;  1I5C A;  1Y8O A;  4EFT A;  3GIE A;  4U7N A;  3TZ4 A;  1TC0 A;  2WEQ A;  4EGH A;  1Y8N A;  2ZDY A;  4CE3 A;  4JQL A;  1Y4U A;  4H85 A;  5IDJ A;  2UWD A;  3SL2 A;  4XIT A;  3DGE A;  5M4N A;  1EI1 A;  4YKW A;  2HG1 A;  4CWF A;  5C93 A;  2CCU A;  4AWQ A;  3LNU A;  1L0O A;  3K99 A;  2XHX A;  3C11 A;  2Q8G A;  2YGA A;  1YER A;  1YT2 A;  4NH9 A;  4JAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...