3A0XA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 1: ammomium phosphate, monoclinic)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
b'MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 50
structure length 149
sequence length 149
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0xA00
2QG0A 1NHIA 1QYEA 4HY1A 4ASAA 4MPNA 3A0ZA 3A0TA 1YETA 4AWQA 1UY6A 3B26A 1AM1A 3D2RA 2VW5A 1TC0A 4URLA 4PU9A 4XKKA 4HXWA 4PL9A 2YKBA 2XD6A 4DUHA 2BYIA 2XX2A 1JM6A 3Q5KA 3H80A 4L91A 2YK2A 2YI6A 1KZNA 4XD8A 4CWNA 4XIQA 5D7RA 4XIPA 3ZKBA 2BU6A 4PRVA 2FYPA 3HZ1A 5FWKA 1US7A 4V25A 2BSMA 5FNFA 5CTXA 3HHUA 4L94A 1THNA 2WI6A 2QFOA 4BIUA 1AH8A 3BM9A 2CG9A 3B25A 3R4NA 3TZ5A 2JKIA 1Z5AA 1TILA 4HYMA 2UWDA 4EGKA 3CRLA 2WI3A 3T1KA 2IWSA 4JAVA 3Q5LA 1KIJA 2YI0A 1U0ZA 4LWEA 2XDLA 2YE2A 3WQ9A 5FNDA 3TTZA 1GJVA 2XK2A 2BU8A 1ID0A 2YE5A 4HXZA 1ZXNA 1UY7A 4JQLA 3RLQA 4EEHA 1S14A 4NH8A 4GT8A 1ZW9A 2YEJA 4NH9A 5D7CA 2WI4A 2YE3A 4XCLA 1Z59A 4L8ZA 1MX0A 3ZXOA 1BXDA 5BOCA 4BQGA 4XCJA 4I5SA 2PNRA 1PVGA 5J6AA 3SL2A 1L0OA 4YKQA 3OMUA 2ZDXA 4HZ5A 5CPHA 5M4NA 4AS9A 2E0AA 2YGEA 4GQTA 2Q8GA 4MP7A 5M4HA 2IWXA 3A0XA 2YEFA 4U7OA 3GIFA 2O1WA 4KSGA 4MPEA 1GKZA 5GGZA 3U2DA 1YT2A 4GFNA 3T10A 3TZ0A 4B7PA 3KE6A 5M4MA 4CE1A 1EA6A 3JZ3A 3C0EA 2K5BA 4ZVIA 4MBCA 1Y4UA 1MU5A 4PRXA 3R4MA 4KQVA 3EKOA 2QG2A 1NHHA 2YEIA 1TIDA 4BAEA 5M4PA 4GGLA 4EGIA 1UYIA 2BREA 3INWA 2O1VA 2Q8HA 4NH7A 3DGEA 4E01A 4CWOA 2XCMA 3LNUA 2WERA 4H7QA 2YKIA 2XJJA 4XTJA 1YC3A 2XDUA 4KFGA 2GFDA 2BRCA 4H85A 1TH8A 3IEDA 3B24A 3EHFA 2Q8FA 5CF0A 4JAUA 4EMVA 3G7EA 4R3MA 2YEDA 3RLRA 2CGFA 3TZ4A 2YJXA 3T0HA 3H4LA 4X9LA 4XKOA 3EKRA 4CWRA 3Q5JA 2EXLA 3R4OA 3O6OA 3G75A 3ZM7A 4EFUA 1I58A 4LWHA 1Y4SA 1I5AA 5F5RA 1UY9A 2JJCA 3EHJA 2YEHA 3A0WA 3K98A 3T2SA 1QY8A 4EGHA 4LWGA 4W7TA 4CWFA 3U2KA 3VHCA 4LWIA 2VCJA 4V26A 1R62A 3HYYA 1UYDA 4MB9A 2HCHA 1YSRA 4R1FA 2YEEA 2YI5A 5FNCA 1B62A 3G7BA 1I59A 2QF6A 5M4EA 1U2OA 4CWQA 3O2FA 4L93A 1TBWA 2CCUA 4KSHA 4LPBA 1YS3A 3R92A 3INXA 3TUHA 4CWPA 1H7UA 1AJ6A 4YKUA 4ASFA 3NMQA 3FT5A 4E02A 4EM7A 2IWUA 4B6CA 5M4KA 4O05A 3A0YA 2H8MA 3GIEA 2YI7A 5CTYA 3VHDA 1ZWHA 2WEQA 2FXSA 1UYCA 5BODA 4WUCA 4BIZA 4AWOA 4YKRA 4XITA 2XDSA 4HY6A 1YESA 2BU5A 2YEGA 3GIGA 4FCRA 4BQJA 4MOTA 2YKEA 4DZYA 5D7DA 5D6PA 1BGQA 3ZXQA 3PEJA 3QDDA 3FT8A 2YE6A 5IDMA 3R4PA 1YERA 3K97A 3EHHA 1UYGA 2XHRA 3BMYA 3D36A 3RKZA 4O07A 4E00A 2ZKJA 1BYQA 2BT0A 3K60A 3FV5A 2ZDYA 4YKXA 3EHGA 3ZKDA 4ZKIA 3GIGB 2IOQA 1AH6A 1UYMA 3VHAA 3OW6A 3D0BA 4XIRA 1UY8A 4P8OA 2XJGA 4YKZA 2YKJA 2WI2A 5L3JA 2XJXA 1I5BA 4MPCA 2YEAA 4KTNA 1GKXA 4HYPA 4CE2A 3C11A 1B3QA 4GCZA 4XDMA 1Y8PA 3CRKA 2WEPA 4XC0A 2VWCA 2FWYA 2CCTA 4CWTA 4QPKA 4L90A 1H7SA 2ZBKB 3MNRP 3WHAA 3K99A 2WI7A 1YT1A 5CTUA 1Y8OA 1UYKA 1UYHA 4LWFA 2ESAA 4CWSA 1A4HA 2BZ5A 4ASBA 1ZXMA 2YK9A 2WI1A 2YE9A 4ASGA 1UYFA 4O04A 2BU2A 4WUDA 1OSFA 4FMTA 1NHJA 2Q8IA 2O1UA 2HG1A 1I5CA 4AWPA 4H81A 1B63A 2WI5A 4WUBA 1BKNA 1UYLA 1S16A 3VADA 3OWBA 2XABA 2YE4A 1Z5CA 1YT0A 2C2AA 2XDKA 4UROA 4U7NA 3QTFA 4K4OA 3R91A 4URNA 2IOPA 2YEBA 2YJWA 4GEEA 3U67A 1Z5BA 2YKCA 2VCIA 4I3HA 4KP4A 3PEHA 2XX4A 4LP0A 2XDXA 2Q2EB 2YGAA 1TC6A 2YECA 5J71A 4P7AA 1QZRA 5F3KA 4FPPA 3CGYA 4QPJA 1EI1A 2FWZA 2H55A 4BXIA 3A0RA 1YSZA 4YKYA 3OPDA 5CTWA 3RLPA 2CCSA 2CH4A 3HYZA 2IORA 1UYEA 2XX5A 3HEKA 3CWVA 3O0IA 4FCQA 4HZ0A 4XKAA 5D6QA 4FCPA 4O0BA 4O09A 5IDJA 5C93A 4CE3A 1YC4A 1YC1A 3LPSA 2BU7A 1I5DA 4XE2A 2BTZA 4EFTA 2HKJA 2YE7A 4YKWA 4URMA 3B27A 2XHXA 2AKPA 4Q20A 5IN9A 2GQPA 3TZ2A 4U93A 3HZ5A 3B28A 4YKTA 2XHTA 1AMWA 4R3AA 2BYHA 2YE8A 4MP2A 2YGFA 3OWDA 1Y8NA 3T0ZA 3CGZA 4JASA
chains in the Genus database with same CATH superfamily
2QG0A 1NHIA 1QYEA 4HY1A 4ASAA 4MPNA 3A0ZA 3A0TA 1YETA 4AWQA 1UY6A 3B26A 1AM1A 3D2RA 2VW5A 1TC0A 4URLA 4PU9A 4XKKA 4HXWA 4PL9A 2YKBA 2XD6A 4DUHA 2BYIA 2XX2A 1JM6A 3Q5KA 3H80A 4L91A 2YK2A 2YI6A 1KZNA 4XD8A 4CWNA 4XIQA 5D7RA 4XIPA 3ZKBA 2BU6A 4PRVA 2FYPA 3HZ1A 5FWKA 1US7A 4V25A 2BSMA 5FNFA 5CTXA 3HHUA 4L94A 1THNA 2WI6A 2QFOA 4BIUA 1AH8A 3BM9A 2CG9A 3B25A 3R4NA 3TZ5A 2JKIA 1Z5AA 1TILA 4HYMA 2UWDA 4EGKA 3CRLA 2WI3A 3T1KA 2IWSA 4JAVA 3Q5LA 1KIJA 2YI0A 1U0ZA 4LWEA 2XDLA 2YE2A 3WQ9A 5FNDA 3TTZA 1GJVA 2XK2A 2BU8A 1ID0A 2YE5A 4HXZA 1ZXNA 1UY7A 4JQLA 3RLQA 4EEHA 1S14A 4NH8A 4GT8A 1ZW9A 2YEJA 4NH9A 5D7CA 2WI4A 2YE3A 4XCLA 1Z59A 4L8ZA 1MX0A 3ZXOA 1BXDA 5BOCA 4BQGA 4XCJA 4I5SA 2PNRA 1PVGA 5J6AA 3SL2A 1L0OA 4YKQA 3OMUA 2ZDXA 4HZ5A 5CPHA 4E72A 5M4NA 4AS9A 2E0AA 2YGEA 4GQTA 2Q8GA 4MP7A 5M4HA 2IWXA 3A0XA 2YEFA 1F51A 4U7OA 3GIFA 2O1WA 4KSGA 4MPEA 1GKZA 5GGZA 3U2DA 1YT2A 4GFNA 3T10A 3TZ0A 4B7PA 3KE6A 5M4MA 4CE1A 1EA6A 3JZ3A 3C0EA 2K5BA 4ZVIA 4MBCA 1Y4UA 1MU5A 4PRXA 3R4MA 4KQVA 3EKOA 2QG2A 1NHHA 2YEIA 1TIDA 4BAEA 5M4PA 4GGLA 4EGIA 1UYIA 2BREA 3INWA 2O1VA 2Q8HA 4NH7A 3DGEA 4E01A 4CWOA 2C1IA 2XCMA 3LNUA 2WERA 4H7QA 2YKIA 2XJJA 4XTJA 1YC3A 2XDUA 4KFGA 2GFDA 3CYGA 2BRCA 4H85A 1TH8A 3IEDA 3B24A 3EHFA 2Q8FA 5CF0A 4JAUA 4EMVA 3G7EA 4R3MA 2YEDA 3RLRA 2CGFA 3TZ4A 2YJXA 3T0HA 3H4LA 4X9LA 4XKOA 3EKRA 4CWRA 3Q5JA 2EXLA 3R4OA 3O6OA 3G75A 3ZM7A 4EFUA 1I58A 4LWHA 1Y4SA 1I5AA 5F5RA 1UY9A 2JJCA 3EHJA 2YEHA 3LMMA 3A0WA 3K98A 3T2SA 1QY8A 4EGHA 4LWGA 4W7TA 4CWFA 3U2KA 3VHCA 4LWIA 2VCJA 4V26A 1R62A 3HYYA 1UYDA 4MB9A 2HCHA 1YSRA 4R1FA 2YEEA 2YI5A 5FNCA 1B62A 3G7BA 1I59A 2QF6A 5M4EA 1U2OA 4CWQA 3O2FA 4L93A 1TBWA 2CCUA 4KSHA 4LPBA 1YS3A 3R92A 3INXA 3TUHA 4CWPA 1H7UA 1AJ6A 4YKUA 4ASFA 3NMQA 3FT5A 4E02A 4EM7A 2IWUA 4B6CA 5M4KA 4O05A 3A0YA 2H8MA 3GIEA 2YI7A 5CTYA 3VHDA 1ZWHA 2WEQA 2FXSA 1UYCA 5BODA 4WUCA 4BIZA 4AWOA 4YKRA 4XITA 2XDSA 4HY6A 1YESA 2HHIA 2BU5A 2YEGA 3GIGA 4FCRA 4BQJA 4MOTA 2YKEA 4DZYA 5D7DA 5D6PA 1BGQA 3ZXQA 3PEJA 3QDDA 3FT8A 2YE6A 5IDMA 3R4PA 1YERA 3K97A 3EHHA 1UYGA 2XHRA 3BMYA 3D36A 3RKZA 4O07A 4E00A 2ZKJA 1BYQA 2BT0A 3K60A 3FV5A 2ZDYA 4YKXA 3EHGA 3ZKDA 4ZKIA 3GIGB 2IOQA 1AH6A 1UYMA 3VHAA 3OW6A 3D0BA 4XIRA 1UY8A 4P8OA 2XJGA 4YKZA 2YKJA 2WI2A 5L3JA 2XJXA 1I5BA 4MPCA 2YEAA 4KTNA 1GKXA 4HYPA 4CE2A 3C11A 1B3QA 4GCZA 4XDMA 1Y8PA 1IXMA 3CRKA 2WEPA 4XC0A 2VWCA 2FWYA 2CCTA 4CWTA 4QPKA 4L90A 1H7SA 2FTKA 2ZBKB 3MNRP 3WHAA 3K99A 2WI7A 1YT1A 5CTUA 1Y8OA 1UYKA 1UYHA 4LWFA 2ESAA 4CWSA 1A4HA 5JENA 2BZ5A 4ASBA 1ZXMA 2YK9A 2WI1A 2YE9A 4ASGA 1UYFA 4O04A 2BU2A 4WUDA 1OSFA 4FMTA 3S5TA 1NHJA 2Q8IA 2O1UA 2HG1A 1I5CA 4AWPA 4H81A 1B63A 2WI5A 4WUBA 1BKNA 1UYLA 1S16A 3VADA 3OWBA 2XABA 2YE4A 1Z5CA 1YT0A 2C2AA 2XDKA 4UROA 4U7NA 3QTFA 4K4OA 3R91A 4URNA 2IOPA 2YEBA 2YJWA 4GEEA 3U67A 1Z5BA 2YKCA 2VCIA 4I3HA 4KP4A 3PEHA 2XX4A 4LP0A 2XDXA 2Q2EB 2YGAA 1TC6A 2YECA 5J71A 2C1GA 4P7AA 1QZRA 5F3KA 4FPPA 3CGYA 4QPJA 1EI1A 2FWZA 2H55A 4BXIA 3A0RA 1YSZA 4YKYA 3OPDA 5CTWA 3RLPA 2CCSA 2CH4A 3HYZA 2IORA 1UYEA 2XX5A 3HEKA 3CWVA 4FCQA 3O0IA 4HZ0A 4XKAA 5D6QA 4FCPA 4O0BA 4O09A 5IDJA 5C93A 4CE3A 1YC4A 1YC1A 3LPSA 2BU7A 1I5DA 4XE2A 2BTZA 4EFTA 2HKJA 2YE7A 4YKWA 4URMA 3B27A 2XHXA 2AKPA 4Q20A 5IN9A 2GQPA 3TZ2A 4U93A 3HZ5A 3B28A 4YKTA 2XHTA 1AMWA 4R3AA 2BYHA 2YE8A 4MP2A 2YGFA 3OWDA 1Y8NA 3T0ZA 3CGZA 4JASA
chains in the Genus database with same CATH topology
2QG0A 1NHIA 1QYEA 4HY1A 4ASAA 4MPNA 3A0ZA 3A0TA 1YETA 4AWQA 1UY6A 3B26A 1AM1A 3D2RA 2VW5A 1TC0A 4URLA 4PU9A 4XKKA 4HXWA 4PL9A 2YKBA 2XD6A 4DUHA 2BYIA 2XX2A 1JM6A 3Q5KA 3H80A 4L91A 2YK2A 2YI6A 1KZNA 4XD8A 4CWNA 4XIQA 5D7RA 4XIPA 3ZKBA 2BU6A 4PRVA 2FYPA 3HZ1A 5FWKA 1US7A 4V25A 2BSMA 5FNFA 5CTXA 3HHUA 4L94A 1THNA 2WI6A 2QFOA 4BIUA 1AH8A 3BM9A 2CG9A 3B25A 3R4NA 3TZ5A 2JKIA 1Z5AA 1TILA 4HYMA 2UWDA 4EGKA 3CRLA 2WI3A 3T1KA 2IWSA 4JAVA 3Q5LA 1KIJA 2YI0A 1U0ZA 4LWEA 2XDLA 2YE2A 3WQ9A 5FNDA 3TTZA 1GJVA 2XK2A 2BU8A 1ID0A 2YE5A 4HXZA 1ZXNA 1UY7A 4JQLA 3RLQA 4EEHA 1S14A 4NH8A 4GT8A 1ZW9A 2YEJA 4NH9A 5D7CA 2WI4A 2YE3A 4XCLA 1Z59A 4L8ZA 1MX0A 3ZXOA 1BXDA 5BOCA 4BQGA 4XCJA 4I5SA 2PNRA 1PVGA 5J6AA 3SL2A 1L0OA 4YKQA 3OMUA 2ZDXA 4HZ5A 5CPHA 5M4NA 4AS9A 2E0AA 2YGEA 4GQTA 2Q8GA 4MP7A 5M4HA 2IWXA 3A0XA 2YEFA 4U7OA 3GIFA 2O1WA 4KSGA 4MPEA 1GKZA 5GGZA 3U2DA 1YT2A 4GFNA 3T10A 3TZ0A 4B7PA 3KE6A 5M4MA 4CE1A 1EA6A 3JZ3A 3C0EA 2K5BA 4ZVIA 4MBCA 1Y4UA 1MU5A 4PRXA 3R4MA 4KQVA 3EKOA 2QG2A 1NHHA 2YEIA 1TIDA 4BAEA 5M4PA 4GGLA 4EGIA 1UYIA 2BREA 3INWA 2O1VA 2Q8HA 4NH7A 3DGEA 4E01A 4CWOA 2XCMA 3LNUA 2WERA 4H7QA 2YKIA 2XJJA 4XTJA 1YC3A 2XDUA 4KFGA 2GFDA 2BRCA 4H85A 1TH8A 3IEDA 3B24A 3EHFA 2Q8FA 5CF0A 4JAUA 4EMVA 3G7EA 4R3MA 2YEDA 3RLRA 2CGFA 3TZ4A 2YJXA 3T0HA 3H4LA 4X9LA 4XKOA 3EKRA 4CWRA 3Q5JA 2EXLA 3R4OA 3O6OA 3G75A 3ZM7A 4EFUA 1I58A 4LWHA 1Y4SA 1I5AA 5F5RA 1UY9A 2JJCA 3EHJA 2YEHA 3A0WA 3K98A 3T2SA 1QY8A 4EGHA 4LWGA 4W7TA 4CWFA 3U2KA 3VHCA 4LWIA 2VCJA 4V26A 1R62A 3HYYA 1UYDA 4MB9A 2HCHA 1YSRA 4R1FA 2YEEA 2YI5A 5FNCA 1B62A 3G7BA 1I59A 2QF6A 5M4EA 1U2OA 4CWQA 3O2FA 4L93A 1TBWA 2CCUA 4KSHA 4LPBA 1YS3A 3R92A 3INXA 3TUHA 4CWPA 1H7UA 1AJ6A 4YKUA 4ASFA 3NMQA 3FT5A 4E02A 4EM7A 2IWUA 4B6CA 5M4KA 4O05A 3A0YA 2H8MA 3GIEA 2YI7A 5CTYA 3VHDA 1ZWHA 2WEQA 2FXSA 1UYCA 5BODA 4WUCA 4BIZA 4AWOA 4YKRA 4XITA 2XDSA 4HY6A 1YESA 2BU5A 2YEGA 3GIGA 4FCRA 4BQJA 4MOTA 2YKEA 4DZYA 5D7DA 5D6PA 1BGQA 3ZXQA 3PEJA 3QDDA 3FT8A 2YE6A 5IDMA 3R4PA 1YERA 3K97A 3EHHA 1UYGA 2XHRA 3BMYA 3D36A 3RKZA 4O07A 4E00A 2ZKJA 1BYQA 2BT0A 3K60A 3FV5A 2ZDYA 4YKXA 3EHGA 3ZKDA 4ZKIA 3GIGB 2IOQA 1AH6A 1UYMA 3VHAA 3OW6A 3D0BA 4XIRA 1UY8A 4P8OA 2XJGA 4YKZA 2YKJA 2WI2A 5L3JA 2XJXA 1I5BA 4MPCA 2YEAA 4KTNA 1GKXA 4HYPA 4CE2A 3C11A 1B3QA 4GCZA 4XDMA 1Y8PA 3CRKA 2WEPA 4XC0A 2VWCA 2FWYA 2CCTA 4CWTA 4QPKA 4L90A 1H7SA 2ZBKB 3MNRP 3WHAA 3K99A 2WI7A 1YT1A 5CTUA 1Y8OA 1UYKA 1UYHA 4LWFA 2ESAA 4CWSA 1A4HA 2BZ5A 4ASBA 1ZXMA 2YK9A 2WI1A 2YE9A 4ASGA 1UYFA 4O04A 2BU2A 4WUDA 1OSFA 4FMTA 1NHJA 2Q8IA 2O1UA 2HG1A 1I5CA 4AWPA 4H81A 1B63A 2WI5A 4WUBA 1BKNA 1UYLA 1S16A 3VADA 3OWBA 2XABA 2YE4A 1Z5CA 1YT0A 2C2AA 2XDKA 4UROA 4U7NA 3QTFA 4K4OA 3R91A 4URNA 2IOPA 2YEBA 2YJWA 4GEEA 3U67A 1Z5BA 2YKCA 2VCIA 4I3HA 4KP4A 3PEHA 2XX4A 4LP0A 2XDXA 2Q2EB 2YGAA 1TC6A 2YECA 5J71A 4P7AA 1QZRA 5F3KA 4FPPA 3CGYA 4QPJA 1EI1A 2FWZA 2H55A 4BXIA 3A0RA 1YSZA 4YKYA 3OPDA 5CTWA 3RLPA 2CCSA 2CH4A 3HYZA 2IORA 1UYEA 2XX5A 3HEKA 3CWVA 3O0IA 4FCQA 4HZ0A 4XKAA 5D6QA 4FCPA 4O0BA 4O09A 5IDJA 5C93A 4CE3A 1YC4A 1YC1A 3LPSA 2BU7A 1I5DA 4XE2A 2BTZA 4EFTA 2HKJA 2YE7A 4YKWA 4URMA 3B27A 2XHXA 2AKPA 4Q20A 5IN9A 2GQPA 3TZ2A 4U93A 3HZ5A 3B28A 4YKTA 2XHTA 1AMWA 4R3AA 2BYHA 2YE8A 4MP2A 2YGFA 3OWDA 1Y8NA 3T0ZA 3CGZA 4JASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QG0 A;  1NHI A;  1QYE A;  4HY1 A;  4ASA A;  4MPN A;  3A0Z A;  3A0T A;  1YET A;  4AWQ A;  1UY6 A;  3B26 A;  1AM1 A;  3D2R A;  2VW5 A;  1TC0 A;  4URL A;  4PU9 A;  4XKK A;  4HXW A;  4PL9 A;  2YKB A;  2XD6 A;  4DUH A;  2BYI A;  2XX2 A;  1JM6 A;  3Q5K A;  3H80 A;  4L91 A;  2YK2 A;  2YI6 A;  1KZN A;  4XD8 A;  4CWN A;  4XIQ A;  5D7R A;  4XIP A;  3ZKB A;  2BU6 A;  4PRV A;  2FYP A;  3HZ1 A;  5FWK A;  1US7 A;  4V25 A;  2BSM A;  5FNF A;  5CTX A;  3HHU A;  4L94 A;  1THN A;  2WI6 A;  2QFO A;  4BIU A;  1AH8 A;  3BM9 A;  2CG9 A;  3B25 A;  3R4N A;  3TZ5 A;  2JKI A;  1Z5A A;  1TIL A;  4HYM A;  2UWD A;  4EGK A;  3CRL A;  2WI3 A;  3T1K A;  2IWS A;  4JAV A;  3Q5L A;  1KIJ A;  2YI0 A;  1U0Z A;  4LWE A;  2XDL A;  2YE2 A;  3WQ9 A;  5FND A;  3TTZ A;  1GJV A;  2XK2 A;  2BU8 A;  1ID0 A;  2YE5 A;  4HXZ A;  1ZXN A;  1UY7 A;  4JQL A;  3RLQ A;  4EEH A;  1S14 A;  4NH8 A;  4GT8 A;  1ZW9 A;  2YEJ A;  4NH9 A;  5D7C A;  2WI4 A;  2YE3 A;  4XCL A;  1Z59 A;  4L8Z A;  1MX0 A;  3ZXO A;  1BXD A;  5BOC A;  4BQG A;  4XCJ A;  4I5S A;  2PNR A;  1PVG A;  5J6A A;  3SL2 A;  1L0O A;  4YKQ A;  3OMU A;  2ZDX A;  4HZ5 A;  5CPH A;  5M4N A;  4AS9 A;  2E0A A;  2YGE A;  4GQT A;  2Q8G A;  4MP7 A;  5M4H A;  2IWX A;  3A0X A;  2YEF A;  4U7O A;  3GIF A;  2O1W A;  4KSG A;  4MPE A;  1GKZ A;  5GGZ A;  3U2D A;  1YT2 A;  4GFN A;  3T10 A;  3TZ0 A;  4B7P A;  3KE6 A;  5M4M A;  4CE1 A;  1EA6 A;  3JZ3 A;  3C0E A;  2K5B A;  4ZVI A;  4MBC A;  1Y4U A;  1MU5 A;  4PRX A;  3R4M A;  4KQV A;  3EKO A;  2QG2 A;  1NHH A;  2YEI A;  1TID A;  4BAE A;  5M4P A;  4GGL A;  4EGI A;  1UYI A;  2BRE A;  3INW A;  2O1V A;  2Q8H A;  4NH7 A;  3DGE A;  4E01 A;  4CWO A;  2XCM A;  3LNU A;  2WER A;  4H7Q A;  2YKI A;  2XJJ A;  4XTJ A;  1YC3 A;  2XDU A;  4KFG A;  2GFD A;  2BRC A;  4H85 A;  1TH8 A;  3IED A;  3B24 A;  3EHF A;  2Q8F A;  5CF0 A;  4JAU A;  4EMV A;  3G7E A;  4R3M A;  2YED A;  3RLR A;  2CGF A;  3TZ4 A;  2YJX A;  3T0H A;  3H4L A;  4X9L A;  4XKO A;  3EKR A;  4CWR A;  3Q5J A;  2EXL A;  3R4O A;  3O6O A;  3G75 A;  3ZM7 A;  4EFU A;  1I58 A;  4LWH A;  1Y4S A;  1I5A A;  5F5R A;  1UY9 A;  2JJC A;  3EHJ A;  2YEH A;  3A0W A;  3K98 A;  3T2S A;  1QY8 A;  4EGH A;  4LWG A;  4W7T A;  4CWF A;  3U2K A;  3VHC A;  4LWI A;  2VCJ A;  4V26 A;  1R62 A;  3HYY A;  1UYD A;  4MB9 A;  2HCH A;  1YSR A;  4R1F A;  2YEE A;  2YI5 A;  5FNC A;  1B62 A;  3G7B A;  1I59 A;  2QF6 A;  5M4E A;  1U2O A;  4CWQ A;  3O2F A;  4L93 A;  1TBW A;  2CCU A;  4KSH A;  4LPB A;  1YS3 A;  3R92 A;  3INX A;  3TUH A;  4CWP A;  1H7U A;  1AJ6 A;  4YKU A;  4ASF A;  3NMQ A;  3FT5 A;  4E02 A;  4EM7 A;  2IWU A;  4B6C A;  5M4K A;  4O05 A;  3A0Y A;  2H8M A;  3GIE A;  2YI7 A;  5CTY A;  3VHD A;  1ZWH A;  2WEQ A;  2FXS A;  1UYC A;  5BOD A;  4WUC A;  4BIZ A;  4AWO A;  4YKR A;  4XIT A;  2XDS A;  4HY6 A;  1YES A;  2BU5 A;  2YEG A;  3GIG A;  4FCR A;  4BQJ A;  4MOT A;  2YKE A;  4DZY A;  5D7D A;  5D6P A;  1BGQ A;  3ZXQ A;  3PEJ A;  3QDD A;  3FT8 A;  2YE6 A;  5IDM A;  3R4P A;  1YER A;  3K97 A;  3EHH A;  1UYG A;  2XHR A;  3BMY A;  3D36 A;  3RKZ A;  4O07 A;  4E00 A;  2ZKJ A;  1BYQ A;  2BT0 A;  3K60 A;  3FV5 A;  2ZDY A;  4YKX A;  3EHG A;  3ZKD A;  4ZKI A;  3GIG B;  2IOQ A;  1AH6 A;  1UYM A;  3VHA A;  3OW6 A;  3D0B A;  4XIR A;  1UY8 A;  4P8O A;  2XJG A;  4YKZ A;  2YKJ A;  2WI2 A;  5L3J A;  2XJX A;  1I5B A;  4MPC A;  2YEA A;  4KTN A;  1GKX A;  4HYP A;  4CE2 A;  3C11 A;  1B3Q A;  4GCZ A;  4XDM A;  1Y8P A;  3CRK A;  2WEP A;  4XC0 A;  2VWC A;  2FWY A;  2CCT A;  4CWT A;  4QPK A;  4L90 A;  1H7S A;  2ZBK B;  3MNR P;  3WHA A;  3K99 A;  2WI7 A;  1YT1 A;  5CTU A;  1Y8O A;  1UYK A;  1UYH A;  4LWF A;  2ESA A;  4CWS A;  1A4H A;  2BZ5 A;  4ASB A;  1ZXM A;  2YK9 A;  2WI1 A;  2YE9 A;  4ASG A;  1UYF A;  4O04 A;  2BU2 A;  4WUD A;  1OSF A;  4FMT A;  1NHJ A;  2Q8I A;  2O1U A;  2HG1 A;  1I5C A;  4AWP A;  4H81 A;  1B63 A;  2WI5 A;  4WUB A;  1BKN A;  1UYL A;  1S16 A;  3VAD A;  3OWB A;  2XAB A;  2YE4 A;  1Z5C A;  1YT0 A;  2C2A A;  2XDK A;  4URO A;  4U7N A;  3QTF A;  4K4O A;  3R91 A;  4URN A;  2IOP A;  2YEB A;  2YJW A;  4GEE A;  3U67 A;  1Z5B A;  2YKC A;  2VCI A;  4I3H A;  4KP4 A;  3PEH A;  2XX4 A;  4LP0 A;  2XDX A;  2Q2E B;  2YGA A;  1TC6 A;  2YEC A;  5J71 A;  4P7A A;  1QZR A;  5F3K A;  4FPP A;  3CGY A;  4QPJ A;  1EI1 A;  2FWZ A;  2H55 A;  4BXI A;  3A0R A;  1YSZ A;  4YKY A;  3OPD A;  5CTW A;  3RLP A;  2CCS A;  2CH4 A;  3HYZ A;  2IOR A;  1UYE A;  2XX5 A;  3HEK A;  3CWV A;  3O0I A;  4FCQ A;  4HZ0 A;  4XKA A;  5D6Q A;  4FCP A;  4O0B A;  4O09 A;  5IDJ A;  5C93 A;  4CE3 A;  1YC4 A;  1YC1 A;  3LPS A;  2BU7 A;  1I5D A;  4XE2 A;  2BTZ A;  4EFT A;  2HKJ A;  2YE7 A;  4YKW A;  4URM A;  3B27 A;  2XHX A;  2AKP A;  4Q20 A;  5IN9 A;  2GQP A;  3TZ2 A;  4U93 A;  3HZ5 A;  3B28 A;  4YKT A;  2XHT A;  1AMW A;  4R3A A;  2BYH A;  2YE8 A;  4MP2 A;  2YGF A;  3OWD A;  1Y8N A;  3T0Z A;  3CGZ A;  4JAS A; 
#chains in the Genus database with same CATH topology
 2QG0 A;  1NHI A;  1QYE A;  4HY1 A;  4ASA A;  4MPN A;  3A0Z A;  3A0T A;  1YET A;  4AWQ A;  1UY6 A;  3B26 A;  1AM1 A;  3D2R A;  2VW5 A;  1TC0 A;  4URL A;  4PU9 A;  4XKK A;  4HXW A;  4PL9 A;  2YKB A;  2XD6 A;  4DUH A;  2BYI A;  2XX2 A;  1JM6 A;  3Q5K A;  3H80 A;  4L91 A;  2YK2 A;  2YI6 A;  1KZN A;  4XD8 A;  4CWN A;  4XIQ A;  5D7R A;  4XIP A;  3ZKB A;  2BU6 A;  4PRV A;  2FYP A;  3HZ1 A;  5FWK A;  1US7 A;  4V25 A;  2BSM A;  5FNF A;  5CTX A;  3HHU A;  4L94 A;  1THN A;  2WI6 A;  2QFO A;  4BIU A;  1AH8 A;  3BM9 A;  2CG9 A;  3B25 A;  3R4N A;  3TZ5 A;  2JKI A;  1Z5A A;  1TIL A;  4HYM A;  2UWD A;  4EGK A;  3CRL A;  2WI3 A;  3T1K A;  2IWS A;  4JAV A;  3Q5L A;  1KIJ A;  2YI0 A;  1U0Z A;  4LWE A;  2XDL A;  2YE2 A;  3WQ9 A;  5FND A;  3TTZ A;  1GJV A;  2XK2 A;  2BU8 A;  1ID0 A;  2YE5 A;  4HXZ A;  1ZXN A;  1UY7 A;  4JQL A;  3RLQ A;  4EEH A;  1S14 A;  4NH8 A;  4GT8 A;  1ZW9 A;  2YEJ A;  4NH9 A;  5D7C A;  2WI4 A;  2YE3 A;  4XCL A;  1Z59 A;  4L8Z A;  1MX0 A;  3ZXO A;  1BXD A;  5BOC A;  4BQG A;  4XCJ A;  4I5S A;  2PNR A;  1PVG A;  5J6A A;  3SL2 A;  1L0O A;  4YKQ A;  3OMU A;  2ZDX A;  4HZ5 A;  5CPH A;  4E72 A;  5M4N A;  4AS9 A;  2E0A A;  2YGE A;  4GQT A;  2Q8G A;  4MP7 A;  5M4H A;  2IWX A;  3A0X A;  2YEF A;  1F51 A;  4U7O A;  3GIF A;  2O1W A;  4KSG A;  4MPE A;  1GKZ A;  5GGZ A;  3U2D A;  1YT2 A;  4GFN A;  3T10 A;  3TZ0 A;  4B7P A;  3KE6 A;  5M4M A;  4CE1 A;  1EA6 A;  3JZ3 A;  3C0E A;  2K5B A;  4ZVI A;  4MBC A;  1Y4U A;  1MU5 A;  4PRX A;  3R4M A;  4KQV A;  3EKO A;  2QG2 A;  1NHH A;  2YEI A;  1TID A;  4BAE A;  5M4P A;  4GGL A;  4EGI A;  1UYI A;  2BRE A;  3INW A;  2O1V A;  2Q8H A;  4NH7 A;  3DGE A;  4E01 A;  4CWO A;  2C1I A;  2XCM A;  3LNU A;  2WER A;  4H7Q A;  2YKI A;  2XJJ A;  4XTJ A;  1YC3 A;  2XDU A;  4KFG A;  2GFD A;  3CYG A;  2BRC A;  4H85 A;  1TH8 A;  3IED A;  3B24 A;  3EHF A;  2Q8F A;  5CF0 A;  4JAU A;  4EMV A;  3G7E A;  4R3M A;  2YED A;  3RLR A;  2CGF A;  3TZ4 A;  2YJX A;  3T0H A;  3H4L A;  4X9L A;  4XKO A;  3EKR A;  4CWR A;  3Q5J A;  2EXL A;  3R4O A;  3O6O A;  3G75 A;  3ZM7 A;  4EFU A;  1I58 A;  4LWH A;  1Y4S A;  1I5A A;  5F5R A;  1UY9 A;  2JJC A;  3EHJ A;  2YEH A;  3LMM A;  3A0W A;  3K98 A;  3T2S A;  1QY8 A;  4EGH A;  4LWG A;  4W7T A;  4CWF A;  3U2K A;  3VHC A;  4LWI A;  2VCJ A;  4V26 A;  1R62 A;  3HYY A;  1UYD A;  4MB9 A;  2HCH A;  1YSR A;  4R1F A;  2YEE A;  2YI5 A;  5FNC A;  1B62 A;  3G7B A;  1I59 A;  2QF6 A;  5M4E A;  1U2O A;  4CWQ A;  3O2F A;  4L93 A;  1TBW A;  2CCU A;  4KSH A;  4LPB A;  1YS3 A;  3R92 A;  3INX A;  3TUH A;  4CWP A;  1H7U A;  1AJ6 A;  4YKU A;  4ASF A;  3NMQ A;  3FT5 A;  4E02 A;  4EM7 A;  2IWU A;  4B6C A;  5M4K A;  4O05 A;  3A0Y A;  2H8M A;  3GIE A;  2YI7 A;  5CTY A;  3VHD A;  1ZWH A;  2WEQ A;  2FXS A;  1UYC A;  5BOD A;  4WUC A;  4BIZ A;  4AWO A;  4YKR A;  4XIT A;  2XDS A;  4HY6 A;  1YES A;  2HHI A;  2BU5 A;  2YEG A;  3GIG A;  4FCR A;  4BQJ A;  4MOT A;  2YKE A;  4DZY A;  5D7D A;  5D6P A;  1BGQ A;  3ZXQ A;  3PEJ A;  3QDD A;  3FT8 A;  2YE6 A;  5IDM A;  3R4P A;  1YER A;  3K97 A;  3EHH A;  1UYG A;  2XHR A;  3BMY A;  3D36 A;  3RKZ A;  4O07 A;  4E00 A;  2ZKJ A;  1BYQ A;  2BT0 A;  3K60 A;  3FV5 A;  2ZDY A;  4YKX A;  3EHG A;  3ZKD A;  4ZKI A;  3GIG B;  2IOQ A;  1AH6 A;  1UYM A;  3VHA A;  3OW6 A;  3D0B A;  4XIR A;  1UY8 A;  4P8O A;  2XJG A;  4YKZ A;  2YKJ A;  2WI2 A;  5L3J A;  2XJX A;  1I5B A;  4MPC A;  2YEA A;  4KTN A;  1GKX A;  4HYP A;  4CE2 A;  3C11 A;  1B3Q A;  4GCZ A;  4XDM A;  1Y8P A;  1IXM A;  3CRK A;  2WEP A;  4XC0 A;  2VWC A;  2FWY A;  2CCT A;  4CWT A;  4QPK A;  4L90 A;  1H7S A;  2FTK A;  2ZBK B;  3MNR P;  3WHA A;  3K99 A;  2WI7 A;  1YT1 A;  5CTU A;  1Y8O A;  1UYK A;  1UYH A;  4LWF A;  2ESA A;  4CWS A;  1A4H A;  5JEN A;  2BZ5 A;  4ASB A;  1ZXM A;  2YK9 A;  2WI1 A;  2YE9 A;  4ASG A;  1UYF A;  4O04 A;  2BU2 A;  4WUD A;  1OSF A;  4FMT A;  3S5T A;  1NHJ A;  2Q8I A;  2O1U A;  2HG1 A;  1I5C A;  4AWP A;  4H81 A;  1B63 A;  2WI5 A;  4WUB A;  1BKN A;  1UYL A;  1S16 A;  3VAD A;  3OWB A;  2XAB A;  2YE4 A;  1Z5C A;  1YT0 A;  2C2A A;  2XDK A;  4URO A;  4U7N A;  3QTF A;  4K4O A;  3R91 A;  4URN A;  2IOP A;  2YEB A;  2YJW A;  4GEE A;  3U67 A;  1Z5B A;  2YKC A;  2VCI A;  4I3H A;  4KP4 A;  3PEH A;  2XX4 A;  4LP0 A;  2XDX A;  2Q2E B;  2YGA A;  1TC6 A;  2YEC A;  5J71 A;  2C1G A;  4P7A A;  1QZR A;  5F3K A;  4FPP A;  3CGY A;  4QPJ A;  1EI1 A;  2FWZ A;  2H55 A;  4BXI A;  3A0R A;  1YSZ A;  4YKY A;  3OPD A;  5CTW A;  3RLP A;  2CCS A;  2CH4 A;  3HYZ A;  2IOR A;  1UYE A;  2XX5 A;  3HEK A;  3CWV A;  4FCQ A;  3O0I A;  4HZ0 A;  4XKA A;  5D6Q A;  4FCP A;  4O0B A;  4O09 A;  5IDJ A;  5C93 A;  4CE3 A;  1YC4 A;  1YC1 A;  3LPS A;  2BU7 A;  1I5D A;  4XE2 A;  2BTZ A;  4EFT A;  2HKJ A;  2YE7 A;  4YKW A;  4URM A;  3B27 A;  2XHX A;  2AKP A;  4Q20 A;  5IN9 A;  2GQP A;  3TZ2 A;  4U93 A;  3HZ5 A;  3B28 A;  4YKT A;  2XHT A;  1AMW A;  4R3A A;  2BYH A;  2YE8 A;  4MP2 A;  2YGF A;  3OWD A;  1Y8N A;  3T0Z A;  3CGZ A;  4JAS A; 
#chains in the Genus database with same CATH homology
 2QG0 A;  1NHI A;  1QYE A;  4HY1 A;  4ASA A;  4MPN A;  3A0Z A;  3A0T A;  1YET A;  4AWQ A;  1UY6 A;  3B26 A;  1AM1 A;  3D2R A;  2VW5 A;  1TC0 A;  4URL A;  4PU9 A;  4XKK A;  4HXW A;  4PL9 A;  2YKB A;  2XD6 A;  4DUH A;  2BYI A;  2XX2 A;  1JM6 A;  3Q5K A;  3H80 A;  4L91 A;  2YK2 A;  2YI6 A;  1KZN A;  4XD8 A;  4CWN A;  4XIQ A;  5D7R A;  4XIP A;  3ZKB A;  2BU6 A;  4PRV A;  2FYP A;  3HZ1 A;  5FWK A;  1US7 A;  4V25 A;  2BSM A;  5FNF A;  5CTX A;  3HHU A;  4L94 A;  1THN A;  2WI6 A;  2QFO A;  4BIU A;  1AH8 A;  3BM9 A;  2CG9 A;  3B25 A;  3R4N A;  3TZ5 A;  2JKI A;  1Z5A A;  1TIL A;  4HYM A;  2UWD A;  4EGK A;  3CRL A;  2WI3 A;  3T1K A;  2IWS A;  4JAV A;  3Q5L A;  1KIJ A;  2YI0 A;  1U0Z A;  4LWE A;  2XDL A;  2YE2 A;  3WQ9 A;  5FND A;  3TTZ A;  1GJV A;  2XK2 A;  2BU8 A;  1ID0 A;  2YE5 A;  4HXZ A;  1ZXN A;  1UY7 A;  4JQL A;  3RLQ A;  4EEH A;  1S14 A;  4NH8 A;  4GT8 A;  1ZW9 A;  2YEJ A;  4NH9 A;  5D7C A;  2WI4 A;  2YE3 A;  4XCL A;  1Z59 A;  4L8Z A;  1MX0 A;  3ZXO A;  1BXD A;  5BOC A;  4BQG A;  4XCJ A;  4I5S A;  2PNR A;  1PVG A;  5J6A A;  3SL2 A;  1L0O A;  4YKQ A;  3OMU A;  2ZDX A;  4HZ5 A;  5CPH A;  5M4N A;  4AS9 A;  2E0A A;  2YGE A;  4GQT A;  2Q8G A;  4MP7 A;  5M4H A;  2IWX A;  3A0X A;  2YEF A;  4U7O A;  3GIF A;  2O1W A;  4KSG A;  4MPE A;  1GKZ A;  5GGZ A;  3U2D A;  1YT2 A;  4GFN A;  3T10 A;  3TZ0 A;  4B7P A;  3KE6 A;  5M4M A;  4CE1 A;  1EA6 A;  3JZ3 A;  3C0E A;  2K5B A;  4ZVI A;  4MBC A;  1Y4U A;  1MU5 A;  4PRX A;  3R4M A;  4KQV A;  3EKO A;  2QG2 A;  1NHH A;  2YEI A;  1TID A;  4BAE A;  5M4P A;  4GGL A;  4EGI A;  1UYI A;  2BRE A;  3INW A;  2O1V A;  2Q8H A;  4NH7 A;  3DGE A;  4E01 A;  4CWO A;  2XCM A;  3LNU A;  2WER A;  4H7Q A;  2YKI A;  2XJJ A;  4XTJ A;  1YC3 A;  2XDU A;  4KFG A;  2GFD A;  2BRC A;  4H85 A;  1TH8 A;  3IED A;  3B24 A;  3EHF A;  2Q8F A;  5CF0 A;  4JAU A;  4EMV A;  3G7E A;  4R3M A;  2YED A;  3RLR A;  2CGF A;  3TZ4 A;  2YJX A;  3T0H A;  3H4L A;  4X9L A;  4XKO A;  3EKR A;  4CWR A;  3Q5J A;  2EXL A;  3R4O A;  3O6O A;  3G75 A;  3ZM7 A;  4EFU A;  1I58 A;  4LWH A;  1Y4S A;  1I5A A;  5F5R A;  1UY9 A;  2JJC A;  3EHJ A;  2YEH A;  3A0W A;  3K98 A;  3T2S A;  1QY8 A;  4EGH A;  4LWG A;  4W7T A;  4CWF A;  3U2K A;  3VHC A;  4LWI A;  2VCJ A;  4V26 A;  1R62 A;  3HYY A;  1UYD A;  4MB9 A;  2HCH A;  1YSR A;  4R1F A;  2YEE A;  2YI5 A;  5FNC A;  1B62 A;  3G7B A;  1I59 A;  2QF6 A;  5M4E A;  1U2O A;  4CWQ A;  3O2F A;  4L93 A;  1TBW A;  2CCU A;  4KSH A;  4LPB A;  1YS3 A;  3R92 A;  3INX A;  3TUH A;  4CWP A;  1H7U A;  1AJ6 A;  4YKU A;  4ASF A;  3NMQ A;  3FT5 A;  4E02 A;  4EM7 A;  2IWU A;  4B6C A;  5M4K A;  4O05 A;  3A0Y A;  2H8M A;  3GIE A;  2YI7 A;  5CTY A;  3VHD A;  1ZWH A;  2WEQ A;  2FXS A;  1UYC A;  5BOD A;  4WUC A;  4BIZ A;  4AWO A;  4YKR A;  4XIT A;  2XDS A;  4HY6 A;  1YES A;  2BU5 A;  2YEG A;  3GIG A;  4FCR A;  4BQJ A;  4MOT A;  2YKE A;  4DZY A;  5D7D A;  5D6P A;  1BGQ A;  3ZXQ A;  3PEJ A;  3QDD A;  3FT8 A;  2YE6 A;  5IDM A;  3R4P A;  1YER A;  3K97 A;  3EHH A;  1UYG A;  2XHR A;  3BMY A;  3D36 A;  3RKZ A;  4O07 A;  4E00 A;  2ZKJ A;  1BYQ A;  2BT0 A;  3K60 A;  3FV5 A;  2ZDY A;  4YKX A;  3EHG A;  3ZKD A;  4ZKI A;  3GIG B;  2IOQ A;  1AH6 A;  1UYM A;  3VHA A;  3OW6 A;  3D0B A;  4XIR A;  1UY8 A;  4P8O A;  2XJG A;  4YKZ A;  2YKJ A;  2WI2 A;  5L3J A;  2XJX A;  1I5B A;  4MPC A;  2YEA A;  4KTN A;  1GKX A;  4HYP A;  4CE2 A;  3C11 A;  1B3Q A;  4GCZ A;  4XDM A;  1Y8P A;  3CRK A;  2WEP A;  4XC0 A;  2VWC A;  2FWY A;  2CCT A;  4CWT A;  4QPK A;  4L90 A;  1H7S A;  2ZBK B;  3MNR P;  3WHA A;  3K99 A;  2WI7 A;  1YT1 A;  5CTU A;  1Y8O A;  1UYK A;  1UYH A;  4LWF A;  2ESA A;  4CWS A;  1A4H A;  2BZ5 A;  4ASB A;  1ZXM A;  2YK9 A;  2WI1 A;  2YE9 A;  4ASG A;  1UYF A;  4O04 A;  2BU2 A;  4WUD A;  1OSF A;  4FMT A;  1NHJ A;  2Q8I A;  2O1U A;  2HG1 A;  1I5C A;  4AWP A;  4H81 A;  1B63 A;  2WI5 A;  4WUB A;  1BKN A;  1UYL A;  1S16 A;  3VAD A;  3OWB A;  2XAB A;  2YE4 A;  1Z5C A;  1YT0 A;  2C2A A;  2XDK A;  4URO A;  4U7N A;  3QTF A;  4K4O A;  3R91 A;  4URN A;  2IOP A;  2YEB A;  2YJW A;  4GEE A;  3U67 A;  1Z5B A;  2YKC A;  2VCI A;  4I3H A;  4KP4 A;  3PEH A;  2XX4 A;  4LP0 A;  2XDX A;  2Q2E B;  2YGA A;  1TC6 A;  2YEC A;  5J71 A;  4P7A A;  1QZR A;  5F3K A;  4FPP A;  3CGY A;  4QPJ A;  1EI1 A;  2FWZ A;  2H55 A;  4BXI A;  3A0R A;  1YSZ A;  4YKY A;  3OPD A;  5CTW A;  3RLP A;  2CCS A;  2CH4 A;  3HYZ A;  2IOR A;  1UYE A;  2XX5 A;  3HEK A;  3CWV A;  3O0I A;  4FCQ A;  4HZ0 A;  4XKA A;  5D6Q A;  4FCP A;  4O0B A;  4O09 A;  5IDJ A;  5C93 A;  4CE3 A;  1YC4 A;  1YC1 A;  3LPS A;  2BU7 A;  1I5D A;  4XE2 A;  2BTZ A;  4EFT A;  2HKJ A;  2YE7 A;  4YKW A;  4URM A;  3B27 A;  2XHX A;  2AKP A;  4Q20 A;  5IN9 A;  2GQP A;  3TZ2 A;  4U93 A;  3HZ5 A;  3B28 A;  4YKT A;  2XHT A;  1AMW A;  4R3A A;  2BYH A;  2YE8 A;  4MP2 A;  2YGF A;  3OWD A;  1Y8N A;  3T0Z A;  3CGZ A;  4JAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...