3A0YA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
147
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0yA00
3VHDA 2YE7A 2CCSA 4GQTA 4CWOA 1U0ZA 4ASAA 3A0WA 1GKZA 1KIJA 5GGZA 5M4PA 4YKXA 5BOCA 4E00A 4HZ0A 4XKKA 3A0ZA 1B3QA 1Y8OA 4UROA 4WUCA 4CE3A 3WQ9A 4GFNA 4AWOA 3OPDA 2Q8FA 1Z59A 2BSMA 4HY1A 4WUDA 2BU7A 3TZ2A 4BXIA 4JAVA 4CWRA 1OSFA 2YEDA 2PNRA 4JAUA 4KSGA 4LWHA 1UYEA 4CWQA 4KFGA 2VCIA 3OWDA 2QFOA 3R4PA 4AS9A 1Y8NA 5D6QA 1QYEA 3CGYA 3CGZA 4ASGA 1AM1A 1UYIA 2UWDA 4X9LA 1YESA 3B28A 2Q8IA 1I5CA 1UY8A 2YEJA 1ZXNA 2XJXA 1EI1A 2YKIA 3KE6A 1Y4SA 4L93A 1Z5CA 3C0EA 5M4NA 4ZVIA 1KZNA 4MPEA 1EA6A 3GIEA 1ZXMA 2ZDXA 1I5BA 1GKXA 1ID0A 4LWEA 2YEIA 2O1VA 4DUHA 3B25A 5J6AA 1U2OA 3R4MA 3A0XA 2XHTA 2BTZA 1B63A 2YI0A 3R92A 3SL2A 3U67A 2YEGA 3CRKA 1BGQA 2YEEA 4YKWA 2Q8HA 2YEFA 5FWKA 4MBCA 4O05A 2IOPA 1ZW9A 4AWQA 2YGAA 5M4MA 2XDKA 1YT2A 1TC0A 3OW6A 1Z5BA 5BODA 5D7CA 4YKQA 3FT8A 3WHAA 2CGFA 1Z5AA 4KP4A 2VCJA 3D2RA 1UYGA 3INXA 4PRVA 3PEJA 3OWBA 2BU6A 2YKCA 3INWA 3PEHA 4XTJA 1MX0A 1YT0A 3Q5JA 4YKUA 3D0BA 4BIUA 4H81A 4H7QA 1AJ6A 2WI3A 3HYYA 2YE2A 4KSHA 2WERA 2YI6A 1Y4UA 2Q2EB 3R91A 5F5RA 1AH6A 4URNA 3LNUA 4P8OA 5CF0A 1S16A 1YT1A 3EHGA 4XIPA 2XDSA 2YGEA 4R1FA 4I3HA 2IORA 2XX4A 4XC0A 4O04A 2YK9A 3D36A 3LPSA 3RLRA 2AKPA 2IWSA 4H85A 1S14A 1NHHA 1US7A 2BRCA 1YC3A 1UYCA 2HKJA 3RLQA 5D7DA 4URLA 2QG0A 4L90A 2WI4A 2YE8A 2WI2A 2YEAA 1QZRA 5FNCA 2ESAA 1I58A 4EGIA 4XKAA 2XCMA 2XDXA 3GIGA 3G7BA 1NHJA 2YKJA 4GT8A 3O6OA 4LPBA 4BAEA 1R62A 1UY7A 1NHIA 2YE5A 4NH9A 2JKIA 4EMVA 1UYFA 2QG2A 3CWVA 3FV5A 4Q20A 4L91A 4LWGA 2XDUA 3K99A 2ZDYA 2WI7A 3O0IA 5CTYA 4V26A 3CRLA 5CPHA 1Y8PA 2JJCA 3K60A 1UYLA 4BQJA 1JM6A 4MOTA 3VHAA 4L8ZA 3ZXOA 4CWFA 3EKRA 3T0HA 1TC6A 2BREA 2BYHA 3TTZA 1H7UA 1PVGA 4YKTA 5D6PA 5F3KA 4P7AA 4JASA 1TBWA 5J71A 3T0ZA 3HZ5A 4NH7A 2VWCA 4U7NA 1I5DA 2QF6A 4U7OA 2BT0A 2CCTA 1TIDA 3RKZA 4HXWA 1AMWA 2BZ5A 4E01A 4B7PA 2BU5A 3TZ4A 2YKBA 1TILA 5FNFA 2WI5A 4HXZA 4YKYA 2H55A 3IEDA 4CE2A 4FCQA 3Q5KA 2XABA 4XDMA 1UYKA 3ZXQA 2WI1A 5D7RA 3EHJA 4KQVA 3T2SA 4B6CA 4FCPA 4XIRA 3HHUA 4ZKIA 2C2AA 3TUHA 4BIZA 2XHXA 5IDJA 4LWFA 3QTFA 2WEPA 2BYIA 3K98A 4LP0A 2IOQA 3R4NA 2XJGA 1L0OA 2YGFA 4EM7A 4YKZA 2Q8GA 1BYQA 2ZKJA 2CCUA 2YE6A 3H80A 4MPNA 2YE9A 2K5BA 4CWNA 4NH8A 4EGKA 1YETA 5CTUA 3T10A 4EGHA 4HYMA 1A4HA 2IWXA 4LWIA 4EFTA 3BMYA 2CH4A 3O2FA 4QPKA 2H8MA 4L94A 3ZKBA 4XCLA 1I59A 4HY6A 2CG9A 3A0RA 4I5SA 3QDDA 5IN9A 4YKRA 4GCZA 4KTNA 3EHFA 4FMTA 4E02A 1YSRA 1THNA 2BU8A 4BQGA 3C11A 1UY9A 4R3MA 4R3AA 4WUBA 4CE1A 2XX2A 4AWPA 4PL9A 4XD8A 2XK2A 2FWYA 1BKNA 3ZM7A 1YS3A 3GIFA 4EFUA 3HYZA 3RLPA 4URMA 3EHHA 1YSZA 1UYMA 2GQPA 1BXDA 5L3JA 2E0AA 1YERA 3R4OA 1QY8A 4HZ5A 1H7SA 3TZ5A 4GGLA 3ZKDA 1B62A 3TZ0A 1TH8A 2XJJA 5FNDA 4JQLA 4K4OA 2YJWA 1YC4A 5IDMA 4FPPA 4XITA 2FXSA 2XDLA 4XIQA 1I5AA 2EXLA 5M4EA 1UY6A 4XCJA 4CWSA 2XX5A 1YC1A 2XD6A 2ZBKB 5M4KA 1MU5A 3FT5A 3Q5LA 2YECA 4CWPA 3HZ1A 4PRXA 2HG1A 3GIGB 2FYPA 4O09A 4O07A 1GJVA 2VW5A 1AH8A 3VHCA 3G75A 4PU9A 3VADA 4XKOA 1UYHA 2YEBA 2XHRA 2YI7A 4EEHA 3B26A 3JZ3A 2FWZA 3NMQA 4QPJA 3MNRP 4HYPA 3BM9A 3H4LA 2YE3A 2YKEA 4MB9A 4DZYA 3B24A 4CWTA 4U93A 4ASFA 2WI6A 5CTXA 4FCRA 4W7TA 3K97A 4MP7A 2YK2A 3OMUA 2YI5A 3A0TA 3DGEA 1UYDA 3T1KA 4ASBA 2YEHA 2YJXA 3HEKA 2BU2A 3U2DA 2IWUA 2GFDA 2YE4A 5CTWA 5C93A 1ZWHA 2O1WA 3EKOA 3B27A 3U2KA 4V25A 4O0BA 4XE2A 5M4HA 3G7EA 4GEEA 2O1UA 2WEQA 4MPCA 2HCHA 3A0YA 4MP2A
chains in the Genus database with same CATH superfamily
3VHDA 2YE7A 2CCSA 4GQTA 4CWOA 1U0ZA 4ASAA 3A0WA 1GKZA 1KIJA 2HHIA 5GGZA 5M4PA 4YKXA 5BOCA 4E00A 4HZ0A 4XKKA 3A0ZA 1B3QA 1Y8OA 4UROA 4WUCA 4CE3A 2C1IA 3WQ9A 4GFNA 4AWOA 3OPDA 2Q8FA 1Z59A 2BSMA 4HY1A 4WUDA 2BU7A 3TZ2A 4BXIA 4JAVA 4CWRA 1OSFA 2YEDA 2PNRA 4JAUA 4KSGA 4LWHA 1UYEA 4CWQA 4KFGA 2VCIA 3OWDA 2QFOA 3R4PA 4AS9A 1Y8NA 5D6QA 1QYEA 3CGYA 3CGZA 4ASGA 1AM1A 1UYIA 2UWDA 4X9LA 1YESA 3B28A 2Q8IA 1I5CA 1UY8A 2YEJA 1ZXNA 2XJXA 1EI1A 2YKIA 3KE6A 1Y4SA 4L93A 1Z5CA 3C0EA 3LMMA 5M4NA 4ZVIA 1KZNA 4MPEA 1EA6A 3GIEA 1ZXMA 2ZDXA 1I5BA 1GKXA 1ID0A 4LWEA 2YEIA 2O1VA 4DUHA 3B25A 5J6AA 1U2OA 3R4MA 3A0XA 2XHTA 2BTZA 1B63A 2YI0A 3R92A 3SL2A 3U67A 2YEGA 3CRKA 1BGQA 2YEEA 4YKWA 2Q8HA 2YEFA 5FWKA 4MBCA 4O05A 2IOPA 1ZW9A 4AWQA 2YGAA 5M4MA 2XDKA 1YT2A 1TC0A 3OW6A 1Z5BA 5BODA 5D7CA 4YKQA 3FT8A 3WHAA 2CGFA 1Z5AA 4KP4A 2VCJA 3D2RA 1UYGA 3INXA 4PRVA 3PEJA 3OWBA 2BU6A 2YKCA 3INWA 3PEHA 4XTJA 1MX0A 1YT0A 3Q5JA 4YKUA 3D0BA 4BIUA 4H81A 4H7QA 1AJ6A 2WI3A 3HYYA 2YE2A 4KSHA 2WERA 2YI6A 1Y4UA 2Q2EB 3R91A 5F5RA 1AH6A 4URNA 3LNUA 4P8OA 5CF0A 1S16A 1YT1A 4E72A 3EHGA 4XIPA 2XDSA 2YGEA 4R1FA 4I3HA 2IORA 2XX4A 4XC0A 4O04A 2YK9A 3D36A 3LPSA 3RLRA 2AKPA 2IWSA 4H85A 1S14A 1NHHA 1US7A 2BRCA 1YC3A 1UYCA 2HKJA 3RLQA 5D7DA 4URLA 2QG0A 4L90A 2WI4A 2YE8A 2WI2A 2YEAA 1QZRA 5FNCA 2ESAA 1I58A 4EGIA 4XKAA 2XCMA 2XDXA 3GIGA 3G7BA 1NHJA 2YKJA 4GT8A 3O6OA 4LPBA 4BAEA 1R62A 1UY7A 1NHIA 2YE5A 4NH9A 2JKIA 4EMVA 1UYFA 3CYGA 2QG2A 3CWVA 3FV5A 4Q20A 4L91A 4LWGA 2XDUA 3K99A 2ZDYA 2WI7A 3O0IA 5CTYA 5JENA 4V26A 3CRLA 5CPHA 1Y8PA 2JJCA 3K60A 1UYLA 4BQJA 1JM6A 4MOTA 3VHAA 4L8ZA 3ZXOA 4CWFA 3EKRA 3T0HA 1TC6A 2BREA 2BYHA 1F51A 3TTZA 1H7UA 1PVGA 4YKTA 5D6PA 5F3KA 4P7AA 4JASA 1TBWA 5J71A 3T0ZA 3HZ5A 4NH7A 2VWCA 4U7NA 1I5DA 2QF6A 4U7OA 2BT0A 2CCTA 1TIDA 3RKZA 4HXWA 1AMWA 2BZ5A 4E01A 4B7PA 2BU5A 3TZ4A 2YKBA 1TILA 5FNFA 2WI5A 4HXZA 4YKYA 2H55A 3IEDA 4CE2A 4FCQA 3Q5KA 2XABA 4XDMA 1UYKA 3ZXQA 2WI1A 5D7RA 3EHJA 4KQVA 3T2SA 4B6CA 4FCPA 4XIRA 3HHUA 4ZKIA 2C2AA 3TUHA 4BIZA 2XHXA 5IDJA 4LWFA 3QTFA 2WEPA 2BYIA 3K98A 4LP0A 2IOQA 3R4NA 2XJGA 1L0OA 2YGFA 4EM7A 4YKZA 2Q8GA 1BYQA 2ZKJA 2CCUA 2YE6A 3H80A 4MPNA 2YE9A 2K5BA 4CWNA 4NH8A 4EGKA 1YETA 5CTUA 3T10A 4EGHA 4HYMA 2FTKA 1A4HA 2IWXA 4LWIA 4EFTA 3BMYA 2CH4A 3O2FA 4QPKA 2H8MA 4L94A 3ZKBA 4XCLA 1I59A 4HY6A 2CG9A 3A0RA 4I5SA 3QDDA 5IN9A 4YKRA 4GCZA 4KTNA 3EHFA 4FMTA 4E02A 1YSRA 1THNA 2BU8A 4BQGA 3C11A 1UY9A 4R3MA 4R3AA 4WUBA 4CE1A 2XX2A 4AWPA 4PL9A 4XD8A 2XK2A 2FWYA 1BKNA 3ZM7A 1YS3A 3GIFA 4EFUA 3HYZA 3RLPA 4URMA 3EHHA 1YSZA 1UYMA 2GQPA 1BXDA 5L3JA 2E0AA 1YERA 3R4OA 1QY8A 4HZ5A 1H7SA 3TZ5A 4GGLA 3ZKDA 1B62A 3TZ0A 1TH8A 2XJJA 5FNDA 4JQLA 4K4OA 2YJWA 1YC4A 5IDMA 4FPPA 4XITA 2FXSA 2XDLA 4XIQA 1I5AA 2EXLA 5M4EA 1UY6A 4XCJA 4CWSA 2XX5A 1YC1A 2XD6A 2ZBKB 5M4KA 1MU5A 3FT5A 3S5TA 3Q5LA 2YECA 4CWPA 3HZ1A 4PRXA 2HG1A 3GIGB 2FYPA 4O09A 4O07A 1GJVA 2VW5A 1AH8A 3VHCA 3G75A 4PU9A 3VADA 4XKOA 1UYHA 2YEBA 2XHRA 2YI7A 4EEHA 3B26A 3JZ3A 2FWZA 3NMQA 4QPJA 3MNRP 1IXMA 4HYPA 3BM9A 3H4LA 2YE3A 2YKEA 4MB9A 4DZYA 3B24A 4CWTA 4U93A 4ASFA 2WI6A 5CTXA 4FCRA 4W7TA 3K97A 4MP7A 2C1GA 2YK2A 3OMUA 2YI5A 3A0TA 3DGEA 1UYDA 3T1KA 4ASBA 2YEHA 2YJXA 3HEKA 2BU2A 3U2DA 2IWUA 2GFDA 2YE4A 5CTWA 5C93A 1ZWHA 2O1WA 3EKOA 3B27A 3U2KA 4V25A 4O0BA 4XE2A 5M4HA 3G7EA 4GEEA 2O1UA 2WEQA 4MPCA 2HCHA 3A0YA 4MP2A
chains in the Genus database with same CATH topology
3VHDA 2YE7A 2CCSA 4GQTA 4CWOA 1U0ZA 4ASAA 3A0WA 1GKZA 1KIJA 5GGZA 5M4PA 4YKXA 5BOCA 4E00A 4HZ0A 4XKKA 3A0ZA 1B3QA 1Y8OA 4UROA 4WUCA 4CE3A 3WQ9A 4GFNA 4AWOA 3OPDA 2Q8FA 1Z59A 2BSMA 4HY1A 4WUDA 2BU7A 3TZ2A 4BXIA 4JAVA 4CWRA 1OSFA 2YEDA 2PNRA 4JAUA 4KSGA 4LWHA 1UYEA 4CWQA 4KFGA 2VCIA 3OWDA 2QFOA 3R4PA 4AS9A 1Y8NA 5D6QA 1QYEA 3CGYA 3CGZA 4ASGA 1AM1A 1UYIA 2UWDA 4X9LA 1YESA 3B28A 2Q8IA 1I5CA 1UY8A 2YEJA 1ZXNA 2XJXA 1EI1A 2YKIA 3KE6A 1Y4SA 4L93A 1Z5CA 3C0EA 5M4NA 4ZVIA 1KZNA 4MPEA 1EA6A 3GIEA 1ZXMA 2ZDXA 1I5BA 1GKXA 1ID0A 4LWEA 2YEIA 2O1VA 4DUHA 3B25A 5J6AA 1U2OA 3R4MA 3A0XA 2XHTA 2BTZA 1B63A 2YI0A 3R92A 3SL2A 3U67A 2YEGA 3CRKA 1BGQA 2YEEA 4YKWA 2Q8HA 2YEFA 5FWKA 4MBCA 4O05A 2IOPA 1ZW9A 4AWQA 2YGAA 5M4MA 2XDKA 1YT2A 1TC0A 3OW6A 1Z5BA 5BODA 5D7CA 4YKQA 3FT8A 3WHAA 2CGFA 1Z5AA 4KP4A 2VCJA 3D2RA 1UYGA 3INXA 4PRVA 3PEJA 3OWBA 2BU6A 2YKCA 3INWA 3PEHA 4XTJA 1MX0A 1YT0A 3Q5JA 4YKUA 3D0BA 4BIUA 4H81A 4H7QA 1AJ6A 2WI3A 3HYYA 2YE2A 4KSHA 2WERA 2YI6A 1Y4UA 2Q2EB 3R91A 5F5RA 1AH6A 4URNA 3LNUA 4P8OA 5CF0A 1S16A 1YT1A 3EHGA 4XIPA 2XDSA 2YGEA 4R1FA 4I3HA 2IORA 2XX4A 4XC0A 4O04A 2YK9A 3D36A 3LPSA 3RLRA 2AKPA 2IWSA 4H85A 1S14A 1NHHA 1US7A 2BRCA 1YC3A 1UYCA 2HKJA 3RLQA 5D7DA 4URLA 2QG0A 4L90A 2WI4A 2YE8A 2WI2A 2YEAA 1QZRA 5FNCA 2ESAA 1I58A 4EGIA 4XKAA 2XCMA 2XDXA 3GIGA 3G7BA 1NHJA 2YKJA 4GT8A 3O6OA 4LPBA 4BAEA 1R62A 1UY7A 1NHIA 2YE5A 4NH9A 2JKIA 4EMVA 1UYFA 2QG2A 3CWVA 3FV5A 4Q20A 4L91A 4LWGA 2XDUA 3K99A 2ZDYA 2WI7A 3O0IA 5CTYA 4V26A 3CRLA 5CPHA 1Y8PA 2JJCA 3K60A 1UYLA 4BQJA 1JM6A 4MOTA 3VHAA 4L8ZA 3ZXOA 4CWFA 3EKRA 3T0HA 1TC6A 2BREA 2BYHA 3TTZA 1H7UA 1PVGA 4YKTA 5D6PA 5F3KA 4P7AA 4JASA 1TBWA 5J71A 3T0ZA 3HZ5A 4NH7A 2VWCA 4U7NA 1I5DA 2QF6A 4U7OA 2BT0A 2CCTA 1TIDA 3RKZA 4HXWA 1AMWA 2BZ5A 4E01A 4B7PA 2BU5A 3TZ4A 2YKBA 1TILA 5FNFA 2WI5A 4HXZA 4YKYA 2H55A 3IEDA 4CE2A 4FCQA 3Q5KA 2XABA 4XDMA 1UYKA 3ZXQA 2WI1A 5D7RA 3EHJA 4KQVA 3T2SA 4B6CA 4FCPA 4XIRA 3HHUA 4ZKIA 2C2AA 3TUHA 4BIZA 2XHXA 5IDJA 4LWFA 3QTFA 2WEPA 2BYIA 3K98A 4LP0A 2IOQA 3R4NA 2XJGA 1L0OA 2YGFA 4EM7A 4YKZA 2Q8GA 1BYQA 2ZKJA 2CCUA 2YE6A 3H80A 4MPNA 2YE9A 2K5BA 4CWNA 4NH8A 4EGKA 1YETA 5CTUA 3T10A 4EGHA 4HYMA 1A4HA 2IWXA 4LWIA 4EFTA 3BMYA 2CH4A 3O2FA 4QPKA 2H8MA 4L94A 3ZKBA 4XCLA 1I59A 4HY6A 2CG9A 3A0RA 4I5SA 3QDDA 5IN9A 4YKRA 4GCZA 4KTNA 3EHFA 4FMTA 4E02A 1YSRA 1THNA 2BU8A 4BQGA 3C11A 1UY9A 4R3MA 4R3AA 4WUBA 4CE1A 2XX2A 4AWPA 4PL9A 4XD8A 2XK2A 2FWYA 1BKNA 3ZM7A 1YS3A 3GIFA 4EFUA 3HYZA 3RLPA 4URMA 3EHHA 1YSZA 1UYMA 2GQPA 1BXDA 5L3JA 2E0AA 1YERA 3R4OA 1QY8A 4HZ5A 1H7SA 3TZ5A 4GGLA 3ZKDA 1B62A 3TZ0A 1TH8A 2XJJA 5FNDA 4JQLA 4K4OA 2YJWA 1YC4A 5IDMA 4FPPA 4XITA 2FXSA 2XDLA 4XIQA 1I5AA 2EXLA 5M4EA 1UY6A 4XCJA 4CWSA 2XX5A 1YC1A 2XD6A 2ZBKB 5M4KA 1MU5A 3FT5A 3Q5LA 2YECA 4CWPA 3HZ1A 4PRXA 2HG1A 3GIGB 2FYPA 4O09A 4O07A 1GJVA 2VW5A 1AH8A 3VHCA 3G75A 4PU9A 3VADA 4XKOA 1UYHA 2YEBA 2XHRA 2YI7A 4EEHA 3B26A 3JZ3A 2FWZA 3NMQA 4QPJA 3MNRP 4HYPA 3BM9A 3H4LA 2YE3A 2YKEA 4MB9A 4DZYA 3B24A 4CWTA 4U93A 4ASFA 2WI6A 5CTXA 4FCRA 4W7TA 3K97A 4MP7A 2YK2A 3OMUA 2YI5A 3A0TA 3DGEA 1UYDA 3T1KA 4ASBA 2YEHA 2YJXA 3HEKA 2BU2A 3U2DA 2IWUA 2GFDA 2YE4A 5CTWA 5C93A 1ZWHA 2O1WA 3EKOA 3B27A 3U2KA 4V25A 4O0BA 4XE2A 5M4HA 3G7EA 4GEEA 2O1UA 2WEQA 4MPCA 2HCHA 3A0YA 4MP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHD A;  2YE7 A;  2CCS A;  4GQT A;  4CWO A;  1U0Z A;  4ASA A;  3A0W A;  1GKZ A;  1KIJ A;  5GGZ A;  5M4P A;  4YKX A;  5BOC A;  4E00 A;  4HZ0 A;  4XKK A;  3A0Z A;  1B3Q A;  1Y8O A;  4URO A;  4WUC A;  4CE3 A;  3WQ9 A;  4GFN A;  4AWO A;  3OPD A;  2Q8F A;  1Z59 A;  2BSM A;  4HY1 A;  4WUD A;  2BU7 A;  3TZ2 A;  4BXI A;  4JAV A;  4CWR A;  1OSF A;  2YED A;  2PNR A;  4JAU A;  4KSG A;  4LWH A;  1UYE A;  4CWQ A;  4KFG A;  2VCI A;  3OWD A;  2QFO A;  3R4P A;  4AS9 A;  1Y8N A;  5D6Q A;  1QYE A;  3CGY A;  3CGZ A;  4ASG A;  1AM1 A;  1UYI A;  2UWD A;  4X9L A;  1YES A;  3B28 A;  2Q8I A;  1I5C A;  1UY8 A;  2YEJ A;  1ZXN A;  2XJX A;  1EI1 A;  2YKI A;  3KE6 A;  1Y4S A;  4L93 A;  1Z5C A;  3C0E A;  5M4N A;  4ZVI A;  1KZN A;  4MPE A;  1EA6 A;  3GIE A;  1ZXM A;  2ZDX A;  1I5B A;  1GKX A;  1ID0 A;  4LWE A;  2YEI A;  2O1V A;  4DUH A;  3B25 A;  5J6A A;  1U2O A;  3R4M A;  3A0X A;  2XHT A;  2BTZ A;  1B63 A;  2YI0 A;  3R92 A;  3SL2 A;  3U67 A;  2YEG A;  3CRK A;  1BGQ A;  2YEE A;  4YKW A;  2Q8H A;  2YEF A;  5FWK A;  4MBC A;  4O05 A;  2IOP A;  1ZW9 A;  4AWQ A;  2YGA A;  5M4M A;  2XDK A;  1YT2 A;  1TC0 A;  3OW6 A;  1Z5B A;  5BOD A;  5D7C A;  4YKQ A;  3FT8 A;  3WHA A;  2CGF A;  1Z5A A;  4KP4 A;  2VCJ A;  3D2R A;  1UYG A;  3INX A;  4PRV A;  3PEJ A;  3OWB A;  2BU6 A;  2YKC A;  3INW A;  3PEH A;  4XTJ A;  1MX0 A;  1YT0 A;  3Q5J A;  4YKU A;  3D0B A;  4BIU A;  4H81 A;  4H7Q A;  1AJ6 A;  2WI3 A;  3HYY A;  2YE2 A;  4KSH A;  2WER A;  2YI6 A;  1Y4U A;  2Q2E B;  3R91 A;  5F5R A;  1AH6 A;  4URN A;  3LNU A;  4P8O A;  5CF0 A;  1S16 A;  1YT1 A;  3EHG A;  4XIP A;  2XDS A;  2YGE A;  4R1F A;  4I3H A;  2IOR A;  2XX4 A;  4XC0 A;  4O04 A;  2YK9 A;  3D36 A;  3LPS A;  3RLR A;  2AKP A;  2IWS A;  4H85 A;  1S14 A;  1NHH A;  1US7 A;  2BRC A;  1YC3 A;  1UYC A;  2HKJ A;  3RLQ A;  5D7D A;  4URL A;  2QG0 A;  4L90 A;  2WI4 A;  2YE8 A;  2WI2 A;  2YEA A;  1QZR A;  5FNC A;  2ESA A;  1I58 A;  4EGI A;  4XKA A;  2XCM A;  2XDX A;  3GIG A;  3G7B A;  1NHJ A;  2YKJ A;  4GT8 A;  3O6O A;  4LPB A;  4BAE A;  1R62 A;  1UY7 A;  1NHI A;  2YE5 A;  4NH9 A;  2JKI A;  4EMV A;  1UYF A;  2QG2 A;  3CWV A;  3FV5 A;  4Q20 A;  4L91 A;  4LWG A;  2XDU A;  3K99 A;  2ZDY A;  2WI7 A;  3O0I A;  5CTY A;  4V26 A;  3CRL A;  5CPH A;  1Y8P A;  2JJC A;  3K60 A;  1UYL A;  4BQJ A;  1JM6 A;  4MOT A;  3VHA A;  4L8Z A;  3ZXO A;  4CWF A;  3EKR A;  3T0H A;  1TC6 A;  2BRE A;  2BYH A;  3TTZ A;  1H7U A;  1PVG A;  4YKT A;  5D6P A;  5F3K A;  4P7A A;  4JAS A;  1TBW A;  5J71 A;  3T0Z A;  3HZ5 A;  4NH7 A;  2VWC A;  4U7N A;  1I5D A;  2QF6 A;  4U7O A;  2BT0 A;  2CCT A;  1TID A;  3RKZ A;  4HXW A;  1AMW A;  2BZ5 A;  4E01 A;  4B7P A;  2BU5 A;  3TZ4 A;  2YKB A;  1TIL A;  5FNF A;  2WI5 A;  4HXZ A;  4YKY A;  2H55 A;  3IED A;  4CE2 A;  4FCQ A;  3Q5K A;  2XAB A;  4XDM A;  1UYK A;  3ZXQ A;  2WI1 A;  5D7R A;  3EHJ A;  4KQV A;  3T2S A;  4B6C A;  4FCP A;  4XIR A;  3HHU A;  4ZKI A;  2C2A A;  3TUH A;  4BIZ A;  2XHX A;  5IDJ A;  4LWF A;  3QTF A;  2WEP A;  2BYI A;  3K98 A;  4LP0 A;  2IOQ A;  3R4N A;  2XJG A;  1L0O A;  2YGF A;  4EM7 A;  4YKZ A;  2Q8G A;  1BYQ A;  2ZKJ A;  2CCU A;  2YE6 A;  3H80 A;  4MPN A;  2YE9 A;  2K5B A;  4CWN A;  4NH8 A;  4EGK A;  1YET A;  5CTU A;  3T10 A;  4EGH A;  4HYM A;  1A4H A;  2IWX A;  4LWI A;  4EFT A;  3BMY A;  2CH4 A;  3O2F A;  4QPK A;  2H8M A;  4L94 A;  3ZKB A;  4XCL A;  1I59 A;  4HY6 A;  2CG9 A;  3A0R A;  4I5S A;  3QDD A;  5IN9 A;  4YKR A;  4GCZ A;  4KTN A;  3EHF A;  4FMT A;  4E02 A;  1YSR A;  1THN A;  2BU8 A;  4BQG A;  3C11 A;  1UY9 A;  4R3M A;  4R3A A;  4WUB A;  4CE1 A;  2XX2 A;  4AWP A;  4PL9 A;  4XD8 A;  2XK2 A;  2FWY A;  1BKN A;  3ZM7 A;  1YS3 A;  3GIF A;  4EFU A;  3HYZ A;  3RLP A;  4URM A;  3EHH A;  1YSZ A;  1UYM A;  2GQP A;  1BXD A;  5L3J A;  2E0A A;  1YER A;  3R4O A;  1QY8 A;  4HZ5 A;  1H7S A;  3TZ5 A;  4GGL A;  3ZKD A;  1B62 A;  3TZ0 A;  1TH8 A;  2XJJ A;  5FND A;  4JQL A;  4K4O A;  2YJW A;  1YC4 A;  5IDM A;  4FPP A;  4XIT A;  2FXS A;  2XDL A;  4XIQ A;  1I5A A;  2EXL A;  5M4E A;  1UY6 A;  4XCJ A;  4CWS A;  2XX5 A;  1YC1 A;  2XD6 A;  2ZBK B;  5M4K A;  1MU5 A;  3FT5 A;  3Q5L A;  2YEC A;  4CWP A;  3HZ1 A;  4PRX A;  2HG1 A;  3GIG B;  2FYP A;  4O09 A;  4O07 A;  1GJV A;  2VW5 A;  1AH8 A;  3VHC A;  3G75 A;  4PU9 A;  3VAD A;  4XKO A;  1UYH A;  2YEB A;  2XHR A;  2YI7 A;  4EEH A;  3B26 A;  3JZ3 A;  2FWZ A;  3NMQ A;  4QPJ A;  3MNR P;  4HYP A;  3BM9 A;  3H4L A;  2YE3 A;  2YKE A;  4MB9 A;  4DZY A;  3B24 A;  4CWT A;  4U93 A;  4ASF A;  2WI6 A;  5CTX A;  4FCR A;  4W7T A;  3K97 A;  4MP7 A;  2YK2 A;  3OMU A;  2YI5 A;  3A0T A;  3DGE A;  1UYD A;  3T1K A;  4ASB A;  2YEH A;  2YJX A;  3HEK A;  2BU2 A;  3U2D A;  2IWU A;  2GFD A;  2YE4 A;  5CTW A;  5C93 A;  1ZWH A;  2O1W A;  3EKO A;  3B27 A;  3U2K A;  4V25 A;  4O0B A;  4XE2 A;  5M4H A;  3G7E A;  4GEE A;  2O1U A;  2WEQ A;  4MPC A;  2HCH A;  3A0Y A;  4MP2 A; 
#chains in the Genus database with same CATH topology
 3VHD A;  2YE7 A;  2CCS A;  4GQT A;  4CWO A;  1U0Z A;  4ASA A;  3A0W A;  1GKZ A;  1KIJ A;  2HHI A;  5GGZ A;  5M4P A;  4YKX A;  5BOC A;  4E00 A;  4HZ0 A;  4XKK A;  3A0Z A;  1B3Q A;  1Y8O A;  4URO A;  4WUC A;  4CE3 A;  2C1I A;  3WQ9 A;  4GFN A;  4AWO A;  3OPD A;  2Q8F A;  1Z59 A;  2BSM A;  4HY1 A;  4WUD A;  2BU7 A;  3TZ2 A;  4BXI A;  4JAV A;  4CWR A;  1OSF A;  2YED A;  2PNR A;  4JAU A;  4KSG A;  4LWH A;  1UYE A;  4CWQ A;  4KFG A;  2VCI A;  3OWD A;  2QFO A;  3R4P A;  4AS9 A;  1Y8N A;  5D6Q A;  1QYE A;  3CGY A;  3CGZ A;  4ASG A;  1AM1 A;  1UYI A;  2UWD A;  4X9L A;  1YES A;  3B28 A;  2Q8I A;  1I5C A;  1UY8 A;  2YEJ A;  1ZXN A;  2XJX A;  1EI1 A;  2YKI A;  3KE6 A;  1Y4S A;  4L93 A;  1Z5C A;  3C0E A;  3LMM A;  5M4N A;  4ZVI A;  1KZN A;  4MPE A;  1EA6 A;  3GIE A;  1ZXM A;  2ZDX A;  1I5B A;  1GKX A;  1ID0 A;  4LWE A;  2YEI A;  2O1V A;  4DUH A;  3B25 A;  5J6A A;  1U2O A;  3R4M A;  3A0X A;  2XHT A;  2BTZ A;  1B63 A;  2YI0 A;  3R92 A;  3SL2 A;  3U67 A;  2YEG A;  3CRK A;  1BGQ A;  2YEE A;  4YKW A;  2Q8H A;  2YEF A;  5FWK A;  4MBC A;  4O05 A;  2IOP A;  1ZW9 A;  4AWQ A;  2YGA A;  5M4M A;  2XDK A;  1YT2 A;  1TC0 A;  3OW6 A;  1Z5B A;  5BOD A;  5D7C A;  4YKQ A;  3FT8 A;  3WHA A;  2CGF A;  1Z5A A;  4KP4 A;  2VCJ A;  3D2R A;  1UYG A;  3INX A;  4PRV A;  3PEJ A;  3OWB A;  2BU6 A;  2YKC A;  3INW A;  3PEH A;  4XTJ A;  1MX0 A;  1YT0 A;  3Q5J A;  4YKU A;  3D0B A;  4BIU A;  4H81 A;  4H7Q A;  1AJ6 A;  2WI3 A;  3HYY A;  2YE2 A;  4KSH A;  2WER A;  2YI6 A;  1Y4U A;  2Q2E B;  3R91 A;  5F5R A;  1AH6 A;  4URN A;  3LNU A;  4P8O A;  5CF0 A;  1S16 A;  1YT1 A;  4E72 A;  3EHG A;  4XIP A;  2XDS A;  2YGE A;  4R1F A;  4I3H A;  2IOR A;  2XX4 A;  4XC0 A;  4O04 A;  2YK9 A;  3D36 A;  3LPS A;  3RLR A;  2AKP A;  2IWS A;  4H85 A;  1S14 A;  1NHH A;  1US7 A;  2BRC A;  1YC3 A;  1UYC A;  2HKJ A;  3RLQ A;  5D7D A;  4URL A;  2QG0 A;  4L90 A;  2WI4 A;  2YE8 A;  2WI2 A;  2YEA A;  1QZR A;  5FNC A;  2ESA A;  1I58 A;  4EGI A;  4XKA A;  2XCM A;  2XDX A;  3GIG A;  3G7B A;  1NHJ A;  2YKJ A;  4GT8 A;  3O6O A;  4LPB A;  4BAE A;  1R62 A;  1UY7 A;  1NHI A;  2YE5 A;  4NH9 A;  2JKI A;  4EMV A;  1UYF A;  3CYG A;  2QG2 A;  3CWV A;  3FV5 A;  4Q20 A;  4L91 A;  4LWG A;  2XDU A;  3K99 A;  2ZDY A;  2WI7 A;  3O0I A;  5CTY A;  5JEN A;  4V26 A;  3CRL A;  5CPH A;  1Y8P A;  2JJC A;  3K60 A;  1UYL A;  4BQJ A;  1JM6 A;  4MOT A;  3VHA A;  4L8Z A;  3ZXO A;  4CWF A;  3EKR A;  3T0H A;  1TC6 A;  2BRE A;  2BYH A;  1F51 A;  3TTZ A;  1H7U A;  1PVG A;  4YKT A;  5D6P A;  5F3K A;  4P7A A;  4JAS A;  1TBW A;  5J71 A;  3T0Z A;  3HZ5 A;  4NH7 A;  2VWC A;  4U7N A;  1I5D A;  2QF6 A;  4U7O A;  2BT0 A;  2CCT A;  1TID A;  3RKZ A;  4HXW A;  1AMW A;  2BZ5 A;  4E01 A;  4B7P A;  2BU5 A;  3TZ4 A;  2YKB A;  1TIL A;  5FNF A;  2WI5 A;  4HXZ A;  4YKY A;  2H55 A;  3IED A;  4CE2 A;  4FCQ A;  3Q5K A;  2XAB A;  4XDM A;  1UYK A;  3ZXQ A;  2WI1 A;  5D7R A;  3EHJ A;  4KQV A;  3T2S A;  4B6C A;  4FCP A;  4XIR A;  3HHU A;  4ZKI A;  2C2A A;  3TUH A;  4BIZ A;  2XHX A;  5IDJ A;  4LWF A;  3QTF A;  2WEP A;  2BYI A;  3K98 A;  4LP0 A;  2IOQ A;  3R4N A;  2XJG A;  1L0O A;  2YGF A;  4EM7 A;  4YKZ A;  2Q8G A;  1BYQ A;  2ZKJ A;  2CCU A;  2YE6 A;  3H80 A;  4MPN A;  2YE9 A;  2K5B A;  4CWN A;  4NH8 A;  4EGK A;  1YET A;  5CTU A;  3T10 A;  4EGH A;  4HYM A;  2FTK A;  1A4H A;  2IWX A;  4LWI A;  4EFT A;  3BMY A;  2CH4 A;  3O2F A;  4QPK A;  2H8M A;  4L94 A;  3ZKB A;  4XCL A;  1I59 A;  4HY6 A;  2CG9 A;  3A0R A;  4I5S A;  3QDD A;  5IN9 A;  4YKR A;  4GCZ A;  4KTN A;  3EHF A;  4FMT A;  4E02 A;  1YSR A;  1THN A;  2BU8 A;  4BQG A;  3C11 A;  1UY9 A;  4R3M A;  4R3A A;  4WUB A;  4CE1 A;  2XX2 A;  4AWP A;  4PL9 A;  4XD8 A;  2XK2 A;  2FWY A;  1BKN A;  3ZM7 A;  1YS3 A;  3GIF A;  4EFU A;  3HYZ A;  3RLP A;  4URM A;  3EHH A;  1YSZ A;  1UYM A;  2GQP A;  1BXD A;  5L3J A;  2E0A A;  1YER A;  3R4O A;  1QY8 A;  4HZ5 A;  1H7S A;  3TZ5 A;  4GGL A;  3ZKD A;  1B62 A;  3TZ0 A;  1TH8 A;  2XJJ A;  5FND A;  4JQL A;  4K4O A;  2YJW A;  1YC4 A;  5IDM A;  4FPP A;  4XIT A;  2FXS A;  2XDL A;  4XIQ A;  1I5A A;  2EXL A;  5M4E A;  1UY6 A;  4XCJ A;  4CWS A;  2XX5 A;  1YC1 A;  2XD6 A;  2ZBK B;  5M4K A;  1MU5 A;  3FT5 A;  3S5T A;  3Q5L A;  2YEC A;  4CWP A;  3HZ1 A;  4PRX A;  2HG1 A;  3GIG B;  2FYP A;  4O09 A;  4O07 A;  1GJV A;  2VW5 A;  1AH8 A;  3VHC A;  3G75 A;  4PU9 A;  3VAD A;  4XKO A;  1UYH A;  2YEB A;  2XHR A;  2YI7 A;  4EEH A;  3B26 A;  3JZ3 A;  2FWZ A;  3NMQ A;  4QPJ A;  3MNR P;  1IXM A;  4HYP A;  3BM9 A;  3H4L A;  2YE3 A;  2YKE A;  4MB9 A;  4DZY A;  3B24 A;  4CWT A;  4U93 A;  4ASF A;  2WI6 A;  5CTX A;  4FCR A;  4W7T A;  3K97 A;  4MP7 A;  2C1G A;  2YK2 A;  3OMU A;  2YI5 A;  3A0T A;  3DGE A;  1UYD A;  3T1K A;  4ASB A;  2YEH A;  2YJX A;  3HEK A;  2BU2 A;  3U2D A;  2IWU A;  2GFD A;  2YE4 A;  5CTW A;  5C93 A;  1ZWH A;  2O1W A;  3EKO A;  3B27 A;  3U2K A;  4V25 A;  4O0B A;  4XE2 A;  5M4H A;  3G7E A;  4GEE A;  2O1U A;  2WEQ A;  4MPC A;  2HCH A;  3A0Y A;  4MP2 A; 
#chains in the Genus database with same CATH homology
 3VHD A;  2YE7 A;  2CCS A;  4GQT A;  4CWO A;  1U0Z A;  4ASA A;  3A0W A;  1GKZ A;  1KIJ A;  5GGZ A;  5M4P A;  4YKX A;  5BOC A;  4E00 A;  4HZ0 A;  4XKK A;  3A0Z A;  1B3Q A;  1Y8O A;  4URO A;  4WUC A;  4CE3 A;  3WQ9 A;  4GFN A;  4AWO A;  3OPD A;  2Q8F A;  1Z59 A;  2BSM A;  4HY1 A;  4WUD A;  2BU7 A;  3TZ2 A;  4BXI A;  4JAV A;  4CWR A;  1OSF A;  2YED A;  2PNR A;  4JAU A;  4KSG A;  4LWH A;  1UYE A;  4CWQ A;  4KFG A;  2VCI A;  3OWD A;  2QFO A;  3R4P A;  4AS9 A;  1Y8N A;  5D6Q A;  1QYE A;  3CGY A;  3CGZ A;  4ASG A;  1AM1 A;  1UYI A;  2UWD A;  4X9L A;  1YES A;  3B28 A;  2Q8I A;  1I5C A;  1UY8 A;  2YEJ A;  1ZXN A;  2XJX A;  1EI1 A;  2YKI A;  3KE6 A;  1Y4S A;  4L93 A;  1Z5C A;  3C0E A;  5M4N A;  4ZVI A;  1KZN A;  4MPE A;  1EA6 A;  3GIE A;  1ZXM A;  2ZDX A;  1I5B A;  1GKX A;  1ID0 A;  4LWE A;  2YEI A;  2O1V A;  4DUH A;  3B25 A;  5J6A A;  1U2O A;  3R4M A;  3A0X A;  2XHT A;  2BTZ A;  1B63 A;  2YI0 A;  3R92 A;  3SL2 A;  3U67 A;  2YEG A;  3CRK A;  1BGQ A;  2YEE A;  4YKW A;  2Q8H A;  2YEF A;  5FWK A;  4MBC A;  4O05 A;  2IOP A;  1ZW9 A;  4AWQ A;  2YGA A;  5M4M A;  2XDK A;  1YT2 A;  1TC0 A;  3OW6 A;  1Z5B A;  5BOD A;  5D7C A;  4YKQ A;  3FT8 A;  3WHA A;  2CGF A;  1Z5A A;  4KP4 A;  2VCJ A;  3D2R A;  1UYG A;  3INX A;  4PRV A;  3PEJ A;  3OWB A;  2BU6 A;  2YKC A;  3INW A;  3PEH A;  4XTJ A;  1MX0 A;  1YT0 A;  3Q5J A;  4YKU A;  3D0B A;  4BIU A;  4H81 A;  4H7Q A;  1AJ6 A;  2WI3 A;  3HYY A;  2YE2 A;  4KSH A;  2WER A;  2YI6 A;  1Y4U A;  2Q2E B;  3R91 A;  5F5R A;  1AH6 A;  4URN A;  3LNU A;  4P8O A;  5CF0 A;  1S16 A;  1YT1 A;  3EHG A;  4XIP A;  2XDS A;  2YGE A;  4R1F A;  4I3H A;  2IOR A;  2XX4 A;  4XC0 A;  4O04 A;  2YK9 A;  3D36 A;  3LPS A;  3RLR A;  2AKP A;  2IWS A;  4H85 A;  1S14 A;  1NHH A;  1US7 A;  2BRC A;  1YC3 A;  1UYC A;  2HKJ A;  3RLQ A;  5D7D A;  4URL A;  2QG0 A;  4L90 A;  2WI4 A;  2YE8 A;  2WI2 A;  2YEA A;  1QZR A;  5FNC A;  2ESA A;  1I58 A;  4EGI A;  4XKA A;  2XCM A;  2XDX A;  3GIG A;  3G7B A;  1NHJ A;  2YKJ A;  4GT8 A;  3O6O A;  4LPB A;  4BAE A;  1R62 A;  1UY7 A;  1NHI A;  2YE5 A;  4NH9 A;  2JKI A;  4EMV A;  1UYF A;  2QG2 A;  3CWV A;  3FV5 A;  4Q20 A;  4L91 A;  4LWG A;  2XDU A;  3K99 A;  2ZDY A;  2WI7 A;  3O0I A;  5CTY A;  4V26 A;  3CRL A;  5CPH A;  1Y8P A;  2JJC A;  3K60 A;  1UYL A;  4BQJ A;  1JM6 A;  4MOT A;  3VHA A;  4L8Z A;  3ZXO A;  4CWF A;  3EKR A;  3T0H A;  1TC6 A;  2BRE A;  2BYH A;  3TTZ A;  1H7U A;  1PVG A;  4YKT A;  5D6P A;  5F3K A;  4P7A A;  4JAS A;  1TBW A;  5J71 A;  3T0Z A;  3HZ5 A;  4NH7 A;  2VWC A;  4U7N A;  1I5D A;  2QF6 A;  4U7O A;  2BT0 A;  2CCT A;  1TID A;  3RKZ A;  4HXW A;  1AMW A;  2BZ5 A;  4E01 A;  4B7P A;  2BU5 A;  3TZ4 A;  2YKB A;  1TIL A;  5FNF A;  2WI5 A;  4HXZ A;  4YKY A;  2H55 A;  3IED A;  4CE2 A;  4FCQ A;  3Q5K A;  2XAB A;  4XDM A;  1UYK A;  3ZXQ A;  2WI1 A;  5D7R A;  3EHJ A;  4KQV A;  3T2S A;  4B6C A;  4FCP A;  4XIR A;  3HHU A;  4ZKI A;  2C2A A;  3TUH A;  4BIZ A;  2XHX A;  5IDJ A;  4LWF A;  3QTF A;  2WEP A;  2BYI A;  3K98 A;  4LP0 A;  2IOQ A;  3R4N A;  2XJG A;  1L0O A;  2YGF A;  4EM7 A;  4YKZ A;  2Q8G A;  1BYQ A;  2ZKJ A;  2CCU A;  2YE6 A;  3H80 A;  4MPN A;  2YE9 A;  2K5B A;  4CWN A;  4NH8 A;  4EGK A;  1YET A;  5CTU A;  3T10 A;  4EGH A;  4HYM A;  1A4H A;  2IWX A;  4LWI A;  4EFT A;  3BMY A;  2CH4 A;  3O2F A;  4QPK A;  2H8M A;  4L94 A;  3ZKB A;  4XCL A;  1I59 A;  4HY6 A;  2CG9 A;  3A0R A;  4I5S A;  3QDD A;  5IN9 A;  4YKR A;  4GCZ A;  4KTN A;  3EHF A;  4FMT A;  4E02 A;  1YSR A;  1THN A;  2BU8 A;  4BQG A;  3C11 A;  1UY9 A;  4R3M A;  4R3A A;  4WUB A;  4CE1 A;  2XX2 A;  4AWP A;  4PL9 A;  4XD8 A;  2XK2 A;  2FWY A;  1BKN A;  3ZM7 A;  1YS3 A;  3GIF A;  4EFU A;  3HYZ A;  3RLP A;  4URM A;  3EHH A;  1YSZ A;  1UYM A;  2GQP A;  1BXD A;  5L3J A;  2E0A A;  1YER A;  3R4O A;  1QY8 A;  4HZ5 A;  1H7S A;  3TZ5 A;  4GGL A;  3ZKD A;  1B62 A;  3TZ0 A;  1TH8 A;  2XJJ A;  5FND A;  4JQL A;  4K4O A;  2YJW A;  1YC4 A;  5IDM A;  4FPP A;  4XIT A;  2FXS A;  2XDL A;  4XIQ A;  1I5A A;  2EXL A;  5M4E A;  1UY6 A;  4XCJ A;  4CWS A;  2XX5 A;  1YC1 A;  2XD6 A;  2ZBK B;  5M4K A;  1MU5 A;  3FT5 A;  3Q5L A;  2YEC A;  4CWP A;  3HZ1 A;  4PRX A;  2HG1 A;  3GIG B;  2FYP A;  4O09 A;  4O07 A;  1GJV A;  2VW5 A;  1AH8 A;  3VHC A;  3G75 A;  4PU9 A;  3VAD A;  4XKO A;  1UYH A;  2YEB A;  2XHR A;  2YI7 A;  4EEH A;  3B26 A;  3JZ3 A;  2FWZ A;  3NMQ A;  4QPJ A;  3MNR P;  4HYP A;  3BM9 A;  3H4L A;  2YE3 A;  2YKE A;  4MB9 A;  4DZY A;  3B24 A;  4CWT A;  4U93 A;  4ASF A;  2WI6 A;  5CTX A;  4FCR A;  4W7T A;  3K97 A;  4MP7 A;  2YK2 A;  3OMU A;  2YI5 A;  3A0T A;  3DGE A;  1UYD A;  3T1K A;  4ASB A;  2YEH A;  2YJX A;  3HEK A;  2BU2 A;  3U2D A;  2IWU A;  2GFD A;  2YE4 A;  5CTW A;  5C93 A;  1ZWH A;  2O1W A;  3EKO A;  3B27 A;  3U2K A;  4V25 A;  4O0B A;  4XE2 A;  5M4H A;  3G7E A;  4GEE A;  2O1U A;  2WEQ A;  4MPC A;  2HCH A;  3A0Y A;  4MP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...