3A0YA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
147
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 55
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0yA00
1TILA 2BT0A 2XJXA 4LP0A 4YKTA 5J6AA 3H80A 1QYEA 2YK9A 3T0ZA 4CWPA 4XE2A 2XCMA 3CGYA 4ZVIA 1BKNA 3EHHA 4H85A 4LWGA 2Q8GA 1GKZA 4B6CA 2YE5A 4HY1A 1R62A 2XHTA 5F3KA 1I59A 1AM1A 2VWCA 2Q2EB 2XHXA 3IEDA 2YE8A 4E00A 4LWEA 1TC0A 1U2OA 4BIUA 4L8ZA 2YEGA 1Z5AA 4GGLA 4CWFA 1NHJA 3DGEA 2Q8HA 4MBCA 1MX0A 2C2AA 3JZ3A 3D36A 3D0BA 4H81A 4HY6A 4MP7A 2ZDXA 1BYQA 4NH7A 1B63A 1I5BA 3CGZA 2O1UA 3RLRA 2YK2A 3VHCA 2BU6A 2E0AA 4YKZA 2IORA 2HCHA 4FCRA 5GGZA 2YJXA 2WI7A 1Y8NA 5CTYA 4B7PA 3A0RA 3Q5JA 4ZKIA 4O0BA 4AWQA 1ZW9A 1JM6A 2HKJA 4BQJA 1YC4A 1I5CA 4DUHA 3A0ZA 1U0ZA 2YE9A 4GCZA 5BODA 1YSZA 4K4OA 3B26A 1AH8A 4U93A 4YKQA 5CTUA 2YEAA 2YECA 4XCJA 1YESA 2Q8FA 3R4OA 2YI0A 3TZ5A 4P7AA 3T1KA 3ZXOA 1QZRA 5D7CA 5IDMA 2YE3A 2YKEA 3B24A 2WI3A 2FWZA 3A0YA 4PL9A 2YI7A 2YKBA 4MPCA 1TC6A 1Z5CA 2XK2A 3ZM7A 5CPHA 2YEBA 4MOTA 4ASGA 2QG2A 4CWQA 4PU9A 3GIGA 2H55A 3EHJA 3LNUA 3MNRP 1AH6A 3TTZA 3HYYA 4L94A 4CWOA 5FNCA 1BGQA 1UYCA 2XDSA 4QPJA 1TIDA 2WEPA 3H4LA 5FNFA 4HYMA 4URLA 2FWYA 3EHFA 5IN9A 3TZ2A 3R4NA 4BQGA 2O1VA 3GIGB 4DZYA 1NHHA 1UYKA 3OWBA 3OW6A 3HZ1A 2YEIA 4O05A 3O2FA 1UYEA 1AJ6A 2WI2A 1I5DA 2GFDA 3Q5KA 3ZXQA 1S14A 2PNRA 2YGEA 4YKYA 2XD6A 2BTZA 2XDUA 2XX5A 3CRKA 1UYDA 5CTXA 2BYIA 4CWTA 3T2SA 3R4PA 4XKAA 4URMA 1H7SA 4L90A 3T10A 4XITA 2ESAA 2YE2A 3GIFA 4P8OA 3VHDA 2YGAA 4CE1A 2XX4A 2YEJA 5FNDA 3QDDA 4O04A 3BM9A 4PRVA 4XC0A 4YKXA 1Y4UA 5M4KA 3U2KA 1B62A 3K98A 2BZ5A 2YEFA 4XIRA 4FMTA 4BIZA 5M4MA 1BXDA 4HXWA 4CWNA 2XJGA 4EFTA 5M4NA 4X9LA 5M4PA 2YI5A 1UYGA 2AKPA 5FWKA 3Q5LA 2IWSA 4NH8A 4R1FA 4KSGA 3TZ4A 2WI5A 2H8MA 3B28A 3G7EA 4GEEA 1GKXA 3O6OA 4EM7A 1UY7A 3R92A 3EKOA 4CE3A 3OWDA 2XHRA 3RLQA 1I5AA 3G75A 2BU5A 4JQLA 4ASBA 3U67A 1UYMA 2YI6A 3EHGA 4E02A 4XIPA 2ZDYA 1US7A 2VW5A 5J71A 2YE7A 2BU7A 1YETA 4AWOA 5M4HA 2K5BA 4XDMA 4JASA 1ZXMA 4ASFA 1AMWA 1YS3A 5D6QA 5CF0A 3NMQA 2YKCA 2YE6A 1EA6A 2IOQA 4XD8A 4XIQA 2WI4A 1TH8A 2FXSA 2XABA 5BOCA 4HYPA 3VADA 1PVGA 1UYLA 4GFNA 2EXLA 2JJCA 4KP4A 2CG9A 4YKRA 3QTFA 1KIJA 2BYHA 4O07A 1ID0A 1YC1A 4WUBA 4FPPA 2O1WA 4XKOA 4BXIA 4YKUA 4XTJA 2VCIA 4LPBA 4MP2A 4MPEA 4R3MA 3OPDA 4XCLA 2GQPA 1Y4SA 4V25A 2YJWA 4KFGA 3LPSA 4KQVA 4ASAA 1Z5BA 2BREA 3OMUA 4MB9A 4YKWA 1UYIA 4KSHA 2UWDA 1ZXNA 3PEJA 2WI1A 1YT0A 5L3JA 1TBWA 1ZWHA 5D6PA 4LWFA 2ZBKB 3A0TA 2YE4A 4JAVA 4EMVA 1YT2A 4URNA 3G7BA 4CWRA 3T0HA 1L0OA 4FCPA 4WUDA 1EI1A 2QFOA 3HEKA 1UY8A 3HHUA 2HG1A 3O0IA 4AWPA 3KE6A 5M4EA 1UYHA 2CCTA 3CRLA 1I58A 1NHIA 2ZKJA 2FYPA 4W7TA 4FCQA 4EGIA 4GT8A 3INXA 4WUCA 4PRXA 1Y8PA 4LWHA 2XJJA 4AS9A 4H7QA 2Q8IA 4Q20A 3PEHA 2WI6A 4I3HA 2IWXA 4BAEA 1OSFA 3SL2A 2BU8A 3TZ0A 4U7NA 3R91A 2CCSA 1Z59A 4GQTA 3WQ9A 1YSRA 3U2DA 3WHAA 4EGHA 2YKIA 2IOPA 3B27A 3FT8A 2XDKA 4EFUA 1YT1A 4QPKA 4XKKA 3B25A 4U7OA 1KZNA 1UY6A 1B3QA 2QG0A 3R4MA 4L91A 4EGKA 3ZKDA 4LWIA 1GJVA 2CGFA 4MPNA 2CCUA 3A0XA 1UYFA 3GIEA 2BRCA 5IDJA 5C93A 4UROA 4NH9A 2JKIA 3FT5A 4JAUA 3BMYA 4R3AA 5D7RA 3TUHA 4V26A 1H7UA 3D2RA 3INWA 4L93A 1A4HA 2CH4A 1YERA 3HZ5A 4HZ5A 2BU2A 4EEHA 4HZ0A 3ZKBA 3A0WA 1YC3A 3K60A 5CTWA 2IWUA 1THNA 4KTNA 4E01A 2VCJA 1Y8OA 3CWVA 3K99A 4O09A 2YEEA 5D7DA 2QF6A 2WEQA 2YGFA 2YKJA 1QY8A 4CE2A 4I5SA 3RKZA 5F5RA 2WERA 4CWSA 2YEHA 1MU5A 2XDLA 2YEDA 3HYZA 2BSMA 4HXZA 3RLPA 1UY9A 3EKRA 2XX2A 3VHAA 3C11A 1S16A 3FV5A 3K97A 2XDXA 3C0EA
chains in the Genus database with same CATH superfamily
1TILA 2BT0A 2XJXA 4LP0A 4YKTA 5J6AA 3H80A 1QYEA 2YK9A 3T0ZA 4CWPA 4XE2A 2XCMA 3CGYA 4ZVIA 1BKNA 3EHHA 4H85A 4LWGA 2Q8GA 1GKZA 4B6CA 2YE5A 4HY1A 1R62A 2XHTA 5F3KA 1I59A 1AM1A 2VWCA 2Q2EB 2XHXA 3IEDA 2YE8A 4E00A 4LWEA 1TC0A 1U2OA 4BIUA 4L8ZA 2YEGA 1Z5AA 4GGLA 4CWFA 1NHJA 3DGEA 2Q8HA 4MBCA 1MX0A 2C2AA 3JZ3A 3D36A 3D0BA 4H81A 4HY6A 4MP7A 2ZDXA 1BYQA 4NH7A 1B63A 1I5BA 3CGZA 2O1UA 3RLRA 2YK2A 3VHCA 2BU6A 2E0AA 4YKZA 2IORA 2HCHA 4FCRA 5GGZA 2YJXA 2WI7A 1Y8NA 5CTYA 4B7PA 3A0RA 3Q5JA 4ZKIA 4O0BA 4AWQA 1ZW9A 1JM6A 2HKJA 4BQJA 1YC4A 1I5CA 4DUHA 3A0ZA 1U0ZA 2YE9A 4GCZA 5BODA 1YSZA 4K4OA 3B26A 1AH8A 4E72A 4U93A 4YKQA 5CTUA 2YEAA 2YECA 4XCJA 1YESA 2Q8FA 3R4OA 2YI0A 3TZ5A 4P7AA 3T1KA 3ZXOA 1QZRA 5D7CA 5IDMA 2YE3A 2YKEA 3B24A 2WI3A 2FWZA 3A0YA 4PL9A 2YI7A 2YKBA 4MPCA 1TC6A 1Z5CA 2XK2A 3ZM7A 5CPHA 2YEBA 4MOTA 4ASGA 2HHIA 2QG2A 4CWQA 4PU9A 3GIGA 2H55A 3EHJA 3LNUA 3MNRP 1AH6A 3TTZA 3HYYA 4L94A 4CWOA 5FNCA 1BGQA 1UYCA 2XDSA 4QPJA 1TIDA 2WEPA 3H4LA 5FNFA 4HYMA 4URLA 2FWYA 3EHFA 5IN9A 3TZ2A 3R4NA 4BQGA 2O1VA 3GIGB 4DZYA 1NHHA 1UYKA 3OWBA 5JENA 3OW6A 3HZ1A 2YEIA 4O05A 3O2FA 1UYEA 1AJ6A 2WI2A 1I5DA 2GFDA 3Q5KA 3ZXQA 1S14A 2PNRA 2YGEA 4YKYA 2XD6A 2BTZA 2XDUA 2XX5A 3CRKA 1UYDA 5CTXA 2BYIA 4CWTA 3T2SA 3R4PA 4XKAA 4URMA 1H7SA 4L90A 3T10A 4XITA 2ESAA 2YE2A 3GIFA 4P8OA 3VHDA 2YGAA 4CE1A 2XX4A 2YEJA 5FNDA 3QDDA 4O04A 3BM9A 4PRVA 4XC0A 4YKXA 1Y4UA 5M4KA 3U2KA 1B62A 3K98A 2BZ5A 2YEFA 4XIRA 4FMTA 4BIZA 5M4MA 1BXDA 4HXWA 4CWNA 2XJGA 4EFTA 5M4NA 4X9LA 5M4PA 2YI5A 1UYGA 2AKPA 5FWKA 3Q5LA 2IWSA 4NH8A 4R1FA 4KSGA 3TZ4A 2WI5A 2H8MA 3B28A 3G7EA 4GEEA 1GKXA 3O6OA 4EM7A 1UY7A 3R92A 3EKOA 4CE3A 3OWDA 2XHRA 3RLQA 1I5AA 3G75A 2BU5A 4JQLA 4ASBA 3U67A 1UYMA 2YI6A 3EHGA 4E02A 4XIPA 2ZDYA 1US7A 2VW5A 5J71A 2YE7A 2BU7A 1YETA 4AWOA 5M4HA 2K5BA 4XDMA 4JASA 1ZXMA 4ASFA 1AMWA 1YS3A 5D6QA 5CF0A 3NMQA 2YKCA 2YE6A 1EA6A 2IOQA 4XD8A 4XIQA 2WI4A 1TH8A 2FXSA 2XABA 5BOCA 2FTKA 4HYPA 3VADA 1PVGA 1UYLA 4GFNA 2EXLA 2JJCA 4KP4A 3S5TA 2CG9A 4YKRA 3QTFA 1F51A 1KIJA 2BYHA 4O07A 2C1GA 1ID0A 1YC1A 4WUBA 4FPPA 2O1WA 3LMMA 4XKOA 4BXIA 4YKUA 4XTJA 2VCIA 4LPBA 4MP2A 4MPEA 4R3MA 3OPDA 4XCLA 2GQPA 1Y4SA 4V25A 2YJWA 4KFGA 3LPSA 4KQVA 4ASAA 1Z5BA 2BREA 3OMUA 4MB9A 4YKWA 1UYIA 4KSHA 2UWDA 1ZXNA 3PEJA 2WI1A 1YT0A 5L3JA 1TBWA 1ZWHA 5D6PA 4LWFA 2ZBKB 3A0TA 2YE4A 4JAVA 4EMVA 1YT2A 4URNA 3G7BA 4CWRA 3T0HA 1L0OA 4FCPA 4WUDA 1EI1A 2QFOA 3HEKA 1UY8A 3HHUA 2HG1A 3O0IA 4AWPA 3KE6A 5M4EA 1UYHA 2CCTA 3CRLA 1I58A 1NHIA 2ZKJA 2FYPA 4W7TA 4FCQA 4EGIA 4GT8A 3INXA 4WUCA 4PRXA 1Y8PA 4LWHA 2XJJA 4AS9A 4H7QA 1IXMA 2Q8IA 4Q20A 3PEHA 2WI6A 4I3HA 2IWXA 4BAEA 1OSFA 3SL2A 2BU8A 3TZ0A 4U7NA 3R91A 2CCSA 1Z59A 4GQTA 3WQ9A 1YSRA 3U2DA 3WHAA 4EGHA 2YKIA 2IOPA 3B27A 3FT8A 2XDKA 4EFUA 1YT1A 4QPKA 4XKKA 3B25A 4U7OA 1KZNA 1UY6A 1B3QA 2QG0A 3R4MA 4L91A 4EGKA 3ZKDA 4LWIA 1GJVA 2CGFA 4MPNA 2CCUA 3A0XA 1UYFA 3GIEA 2BRCA 5IDJA 5C93A 3CYGA 4UROA 4NH9A 2JKIA 3FT5A 4JAUA 3BMYA 4R3AA 5D7RA 3TUHA 4V26A 1H7UA 3D2RA 3INWA 4L93A 1A4HA 2CH4A 1YERA 3HZ5A 4HZ5A 2BU2A 4EEHA 4HZ0A 3ZKBA 3A0WA 1YC3A 3K60A 5CTWA 2IWUA 1THNA 4KTNA 4E01A 2VCJA 1Y8OA 3CWVA 3K99A 4O09A 2YEEA 5D7DA 2QF6A 2WEQA 2YGFA 2YKJA 1QY8A 4CE2A 4I5SA 2C1IA 3RKZA 5F5RA 2WERA 4CWSA 2YEHA 1MU5A 2XDLA 2YEDA 3HYZA 2BSMA 4HXZA 3RLPA 1UY9A 3EKRA 2XX2A 3VHAA 3C11A 1S16A 3FV5A 3K97A 2XDXA 3C0EA
chains in the Genus database with same CATH topology
1TILA 2BT0A 2XJXA 4LP0A 4YKTA 5J6AA 3H80A 1QYEA 2YK9A 3T0ZA 4CWPA 4XE2A 2XCMA 3CGYA 4ZVIA 1BKNA 3EHHA 4H85A 4LWGA 2Q8GA 1GKZA 4B6CA 2YE5A 4HY1A 1R62A 2XHTA 5F3KA 1I59A 1AM1A 2VWCA 2Q2EB 2XHXA 3IEDA 2YE8A 4E00A 4LWEA 1TC0A 1U2OA 4BIUA 4L8ZA 2YEGA 1Z5AA 4GGLA 4CWFA 1NHJA 3DGEA 2Q8HA 4MBCA 1MX0A 2C2AA 3JZ3A 3D36A 3D0BA 4H81A 4HY6A 4MP7A 2ZDXA 1BYQA 4NH7A 1B63A 1I5BA 3CGZA 2O1UA 3RLRA 2YK2A 3VHCA 2BU6A 2E0AA 4YKZA 2IORA 2HCHA 4FCRA 5GGZA 2YJXA 2WI7A 1Y8NA 5CTYA 4B7PA 3A0RA 3Q5JA 4ZKIA 4O0BA 4AWQA 1ZW9A 1JM6A 2HKJA 4BQJA 1YC4A 1I5CA 4DUHA 3A0ZA 1U0ZA 2YE9A 4GCZA 5BODA 1YSZA 4K4OA 3B26A 1AH8A 4U93A 4YKQA 5CTUA 2YEAA 2YECA 4XCJA 1YESA 2Q8FA 3R4OA 2YI0A 3TZ5A 4P7AA 3T1KA 3ZXOA 1QZRA 5D7CA 5IDMA 2YE3A 2YKEA 3B24A 2WI3A 2FWZA 3A0YA 4PL9A 2YI7A 2YKBA 4MPCA 1TC6A 1Z5CA 2XK2A 3ZM7A 5CPHA 2YEBA 4MOTA 4ASGA 2QG2A 4CWQA 4PU9A 3GIGA 2H55A 3EHJA 3LNUA 3MNRP 1AH6A 3TTZA 3HYYA 4L94A 4CWOA 5FNCA 1BGQA 1UYCA 2XDSA 4QPJA 1TIDA 2WEPA 3H4LA 5FNFA 4HYMA 4URLA 2FWYA 3EHFA 5IN9A 3TZ2A 3R4NA 4BQGA 2O1VA 3GIGB 4DZYA 1NHHA 1UYKA 3OWBA 3OW6A 3HZ1A 2YEIA 4O05A 3O2FA 1UYEA 1AJ6A 2WI2A 1I5DA 2GFDA 3Q5KA 3ZXQA 1S14A 2PNRA 2YGEA 4YKYA 2XD6A 2BTZA 2XDUA 2XX5A 3CRKA 1UYDA 5CTXA 2BYIA 4CWTA 3T2SA 3R4PA 4XKAA 4URMA 1H7SA 4L90A 3T10A 4XITA 2ESAA 2YE2A 3GIFA 4P8OA 3VHDA 2YGAA 4CE1A 2XX4A 2YEJA 5FNDA 3QDDA 4O04A 3BM9A 4PRVA 4XC0A 4YKXA 1Y4UA 5M4KA 3U2KA 1B62A 3K98A 2BZ5A 2YEFA 4XIRA 4FMTA 4BIZA 5M4MA 1BXDA 4HXWA 4CWNA 2XJGA 4EFTA 5M4NA 4X9LA 5M4PA 2YI5A 1UYGA 2AKPA 5FWKA 3Q5LA 2IWSA 4NH8A 4R1FA 4KSGA 3TZ4A 2WI5A 2H8MA 3B28A 3G7EA 4GEEA 1GKXA 3O6OA 4EM7A 1UY7A 3R92A 3EKOA 4CE3A 3OWDA 2XHRA 3RLQA 1I5AA 3G75A 2BU5A 4JQLA 4ASBA 3U67A 1UYMA 2YI6A 3EHGA 4E02A 4XIPA 2ZDYA 1US7A 2VW5A 5J71A 2YE7A 2BU7A 1YETA 4AWOA 5M4HA 2K5BA 4XDMA 4JASA 1ZXMA 4ASFA 1AMWA 1YS3A 5D6QA 5CF0A 3NMQA 2YKCA 2YE6A 1EA6A 2IOQA 4XD8A 4XIQA 2WI4A 1TH8A 2FXSA 2XABA 5BOCA 4HYPA 3VADA 1PVGA 1UYLA 4GFNA 2EXLA 2JJCA 4KP4A 2CG9A 4YKRA 3QTFA 1KIJA 2BYHA 4O07A 1ID0A 1YC1A 4WUBA 4FPPA 2O1WA 4XKOA 4BXIA 4YKUA 4XTJA 2VCIA 4LPBA 4MP2A 4MPEA 4R3MA 3OPDA 4XCLA 2GQPA 1Y4SA 4V25A 2YJWA 4KFGA 3LPSA 4KQVA 4ASAA 1Z5BA 2BREA 3OMUA 4MB9A 4YKWA 1UYIA 4KSHA 2UWDA 1ZXNA 3PEJA 2WI1A 1YT0A 5L3JA 1TBWA 1ZWHA 5D6PA 4LWFA 2ZBKB 3A0TA 2YE4A 4JAVA 4EMVA 1YT2A 4URNA 3G7BA 4CWRA 3T0HA 1L0OA 4FCPA 4WUDA 1EI1A 2QFOA 3HEKA 1UY8A 3HHUA 2HG1A 3O0IA 4AWPA 3KE6A 5M4EA 1UYHA 2CCTA 3CRLA 1I58A 1NHIA 2ZKJA 2FYPA 4W7TA 4FCQA 4EGIA 4GT8A 3INXA 4WUCA 4PRXA 1Y8PA 4LWHA 2XJJA 4AS9A 4H7QA 2Q8IA 4Q20A 3PEHA 2WI6A 4I3HA 2IWXA 4BAEA 1OSFA 3SL2A 2BU8A 3TZ0A 4U7NA 3R91A 2CCSA 1Z59A 4GQTA 3WQ9A 1YSRA 3U2DA 3WHAA 4EGHA 2YKIA 2IOPA 3B27A 3FT8A 2XDKA 4EFUA 1YT1A 4QPKA 4XKKA 3B25A 4U7OA 1KZNA 1UY6A 1B3QA 2QG0A 3R4MA 4L91A 4EGKA 3ZKDA 4LWIA 1GJVA 2CGFA 4MPNA 2CCUA 3A0XA 1UYFA 3GIEA 2BRCA 5IDJA 5C93A 4UROA 4NH9A 2JKIA 3FT5A 4JAUA 3BMYA 4R3AA 5D7RA 3TUHA 4V26A 1H7UA 3D2RA 3INWA 4L93A 1A4HA 2CH4A 1YERA 3HZ5A 4HZ5A 2BU2A 4EEHA 4HZ0A 3ZKBA 3A0WA 1YC3A 3K60A 5CTWA 2IWUA 1THNA 4KTNA 4E01A 2VCJA 1Y8OA 3CWVA 3K99A 4O09A 2YEEA 5D7DA 2QF6A 2WEQA 2YGFA 2YKJA 1QY8A 4CE2A 4I5SA 3RKZA 5F5RA 2WERA 4CWSA 2YEHA 1MU5A 2XDLA 2YEDA 3HYZA 2BSMA 4HXZA 3RLPA 1UY9A 3EKRA 2XX2A 3VHAA 3C11A 1S16A 3FV5A 3K97A 2XDXA 3C0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIL A;  2BT0 A;  2XJX A;  4LP0 A;  4YKT A;  5J6A A;  3H80 A;  1QYE A;  2YK9 A;  3T0Z A;  4CWP A;  4XE2 A;  2XCM A;  3CGY A;  4ZVI A;  1BKN A;  3EHH A;  4H85 A;  4LWG A;  2Q8G A;  1GKZ A;  4B6C A;  2YE5 A;  4HY1 A;  1R62 A;  2XHT A;  5F3K A;  1I59 A;  1AM1 A;  2VWC A;  2Q2E B;  2XHX A;  3IED A;  2YE8 A;  4E00 A;  4LWE A;  1TC0 A;  1U2O A;  4BIU A;  4L8Z A;  2YEG A;  1Z5A A;  4GGL A;  4CWF A;  1NHJ A;  3DGE A;  2Q8H A;  4MBC A;  1MX0 A;  2C2A A;  3JZ3 A;  3D36 A;  3D0B A;  4H81 A;  4HY6 A;  4MP7 A;  2ZDX A;  1BYQ A;  4NH7 A;  1B63 A;  1I5B A;  3CGZ A;  2O1U A;  3RLR A;  2YK2 A;  3VHC A;  2BU6 A;  2E0A A;  4YKZ A;  2IOR A;  2HCH A;  4FCR A;  5GGZ A;  2YJX A;  2WI7 A;  1Y8N A;  5CTY A;  4B7P A;  3A0R A;  3Q5J A;  4ZKI A;  4O0B A;  4AWQ A;  1ZW9 A;  1JM6 A;  2HKJ A;  4BQJ A;  1YC4 A;  1I5C A;  4DUH A;  3A0Z A;  1U0Z A;  2YE9 A;  4GCZ A;  5BOD A;  1YSZ A;  4K4O A;  3B26 A;  1AH8 A;  4U93 A;  4YKQ A;  5CTU A;  2YEA A;  2YEC A;  4XCJ A;  1YES A;  2Q8F A;  3R4O A;  2YI0 A;  3TZ5 A;  4P7A A;  3T1K A;  3ZXO A;  1QZR A;  5D7C A;  5IDM A;  2YE3 A;  2YKE A;  3B24 A;  2WI3 A;  2FWZ A;  3A0Y A;  4PL9 A;  2YI7 A;  2YKB A;  4MPC A;  1TC6 A;  1Z5C A;  2XK2 A;  3ZM7 A;  5CPH A;  2YEB A;  4MOT A;  4ASG A;  2QG2 A;  4CWQ A;  4PU9 A;  3GIG A;  2H55 A;  3EHJ A;  3LNU A;  3MNR P;  1AH6 A;  3TTZ A;  3HYY A;  4L94 A;  4CWO A;  5FNC A;  1BGQ A;  1UYC A;  2XDS A;  4QPJ A;  1TID A;  2WEP A;  3H4L A;  5FNF A;  4HYM A;  4URL A;  2FWY A;  3EHF A;  5IN9 A;  3TZ2 A;  3R4N A;  4BQG A;  2O1V A;  3GIG B;  4DZY A;  1NHH A;  1UYK A;  3OWB A;  3OW6 A;  3HZ1 A;  2YEI A;  4O05 A;  3O2F A;  1UYE A;  1AJ6 A;  2WI2 A;  1I5D A;  2GFD A;  3Q5K A;  3ZXQ A;  1S14 A;  2PNR A;  2YGE A;  4YKY A;  2XD6 A;  2BTZ A;  2XDU A;  2XX5 A;  3CRK A;  1UYD A;  5CTX A;  2BYI A;  4CWT A;  3T2S A;  3R4P A;  4XKA A;  4URM A;  1H7S A;  4L90 A;  3T10 A;  4XIT A;  2ESA A;  2YE2 A;  3GIF A;  4P8O A;  3VHD A;  2YGA A;  4CE1 A;  2XX4 A;  2YEJ A;  5FND A;  3QDD A;  4O04 A;  3BM9 A;  4PRV A;  4XC0 A;  4YKX A;  1Y4U A;  5M4K A;  3U2K A;  1B62 A;  3K98 A;  2BZ5 A;  2YEF A;  4XIR A;  4FMT A;  4BIZ A;  5M4M A;  1BXD A;  4HXW A;  4CWN A;  2XJG A;  4EFT A;  5M4N A;  4X9L A;  5M4P A;  2YI5 A;  1UYG A;  2AKP A;  5FWK A;  3Q5L A;  2IWS A;  4NH8 A;  4R1F A;  4KSG A;  3TZ4 A;  2WI5 A;  2H8M A;  3B28 A;  3G7E A;  4GEE A;  1GKX A;  3O6O A;  4EM7 A;  1UY7 A;  3R92 A;  3EKO A;  4CE3 A;  3OWD A;  2XHR A;  3RLQ A;  1I5A A;  3G75 A;  2BU5 A;  4JQL A;  4ASB A;  3U67 A;  1UYM A;  2YI6 A;  3EHG A;  4E02 A;  4XIP A;  2ZDY A;  1US7 A;  2VW5 A;  5J71 A;  2YE7 A;  2BU7 A;  1YET A;  4AWO A;  5M4H A;  2K5B A;  4XDM A;  4JAS A;  1ZXM A;  4ASF A;  1AMW A;  1YS3 A;  5D6Q A;  5CF0 A;  3NMQ A;  2YKC A;  2YE6 A;  1EA6 A;  2IOQ A;  4XD8 A;  4XIQ A;  2WI4 A;  1TH8 A;  2FXS A;  2XAB A;  5BOC A;  4HYP A;  3VAD A;  1PVG A;  1UYL A;  4GFN A;  2EXL A;  2JJC A;  4KP4 A;  2CG9 A;  4YKR A;  3QTF A;  1KIJ A;  2BYH A;  4O07 A;  1ID0 A;  1YC1 A;  4WUB A;  4FPP A;  2O1W A;  4XKO A;  4BXI A;  4YKU A;  4XTJ A;  2VCI A;  4LPB A;  4MP2 A;  4MPE A;  4R3M A;  3OPD A;  4XCL A;  2GQP A;  1Y4S A;  4V25 A;  2YJW A;  4KFG A;  3LPS A;  4KQV A;  4ASA A;  1Z5B A;  2BRE A;  3OMU A;  4MB9 A;  4YKW A;  1UYI A;  4KSH A;  2UWD A;  1ZXN A;  3PEJ A;  2WI1 A;  1YT0 A;  5L3J A;  1TBW A;  1ZWH A;  5D6P A;  4LWF A;  2ZBK B;  3A0T A;  2YE4 A;  4JAV A;  4EMV A;  1YT2 A;  4URN A;  3G7B A;  4CWR A;  3T0H A;  1L0O A;  4FCP A;  4WUD A;  1EI1 A;  2QFO A;  3HEK A;  1UY8 A;  3HHU A;  2HG1 A;  3O0I A;  4AWP A;  3KE6 A;  5M4E A;  1UYH A;  2CCT A;  3CRL A;  1I58 A;  1NHI A;  2ZKJ A;  2FYP A;  4W7T A;  4FCQ A;  4EGI A;  4GT8 A;  3INX A;  4WUC A;  4PRX A;  1Y8P A;  4LWH A;  2XJJ A;  4AS9 A;  4H7Q A;  2Q8I A;  4Q20 A;  3PEH A;  2WI6 A;  4I3H A;  2IWX A;  4BAE A;  1OSF A;  3SL2 A;  2BU8 A;  3TZ0 A;  4U7N A;  3R91 A;  2CCS A;  1Z59 A;  4GQT A;  3WQ9 A;  1YSR A;  3U2D A;  3WHA A;  4EGH A;  2YKI A;  2IOP A;  3B27 A;  3FT8 A;  2XDK A;  4EFU A;  1YT1 A;  4QPK A;  4XKK A;  3B25 A;  4U7O A;  1KZN A;  1UY6 A;  1B3Q A;  2QG0 A;  3R4M A;  4L91 A;  4EGK A;  3ZKD A;  4LWI A;  1GJV A;  2CGF A;  4MPN A;  2CCU A;  3A0X A;  1UYF A;  3GIE A;  2BRC A;  5IDJ A;  5C93 A;  4URO A;  4NH9 A;  2JKI A;  3FT5 A;  4JAU A;  3BMY A;  4R3A A;  5D7R A;  3TUH A;  4V26 A;  1H7U A;  3D2R A;  3INW A;  4L93 A;  1A4H A;  2CH4 A;  1YER A;  3HZ5 A;  4HZ5 A;  2BU2 A;  4EEH A;  4HZ0 A;  3ZKB A;  3A0W A;  1YC3 A;  3K60 A;  5CTW A;  2IWU A;  1THN A;  4KTN A;  4E01 A;  2VCJ A;  1Y8O A;  3CWV A;  3K99 A;  4O09 A;  2YEE A;  5D7D A;  2QF6 A;  2WEQ A;  2YGF A;  2YKJ A;  1QY8 A;  4CE2 A;  4I5S A;  3RKZ A;  5F5R A;  2WER A;  4CWS A;  2YEH A;  1MU5 A;  2XDL A;  2YED A;  3HYZ A;  2BSM A;  4HXZ A;  3RLP A;  1UY9 A;  3EKR A;  2XX2 A;  3VHA A;  3C11 A;  1S16 A;  3FV5 A;  3K97 A;  2XDX A;  3C0E A; 
#chains in the Genus database with same CATH topology
 1TIL A;  2BT0 A;  2XJX A;  4LP0 A;  4YKT A;  5J6A A;  3H80 A;  1QYE A;  2YK9 A;  3T0Z A;  4CWP A;  4XE2 A;  2XCM A;  3CGY A;  4ZVI A;  1BKN A;  3EHH A;  4H85 A;  4LWG A;  2Q8G A;  1GKZ A;  4B6C A;  2YE5 A;  4HY1 A;  1R62 A;  2XHT A;  5F3K A;  1I59 A;  1AM1 A;  2VWC A;  2Q2E B;  2XHX A;  3IED A;  2YE8 A;  4E00 A;  4LWE A;  1TC0 A;  1U2O A;  4BIU A;  4L8Z A;  2YEG A;  1Z5A A;  4GGL A;  4CWF A;  1NHJ A;  3DGE A;  2Q8H A;  4MBC A;  1MX0 A;  2C2A A;  3JZ3 A;  3D36 A;  3D0B A;  4H81 A;  4HY6 A;  4MP7 A;  2ZDX A;  1BYQ A;  4NH7 A;  1B63 A;  1I5B A;  3CGZ A;  2O1U A;  3RLR A;  2YK2 A;  3VHC A;  2BU6 A;  2E0A A;  4YKZ A;  2IOR A;  2HCH A;  4FCR A;  5GGZ A;  2YJX A;  2WI7 A;  1Y8N A;  5CTY A;  4B7P A;  3A0R A;  3Q5J A;  4ZKI A;  4O0B A;  4AWQ A;  1ZW9 A;  1JM6 A;  2HKJ A;  4BQJ A;  1YC4 A;  1I5C A;  4DUH A;  3A0Z A;  1U0Z A;  2YE9 A;  4GCZ A;  5BOD A;  1YSZ A;  4K4O A;  3B26 A;  1AH8 A;  4E72 A;  4U93 A;  4YKQ A;  5CTU A;  2YEA A;  2YEC A;  4XCJ A;  1YES A;  2Q8F A;  3R4O A;  2YI0 A;  3TZ5 A;  4P7A A;  3T1K A;  3ZXO A;  1QZR A;  5D7C A;  5IDM A;  2YE3 A;  2YKE A;  3B24 A;  2WI3 A;  2FWZ A;  3A0Y A;  4PL9 A;  2YI7 A;  2YKB A;  4MPC A;  1TC6 A;  1Z5C A;  2XK2 A;  3ZM7 A;  5CPH A;  2YEB A;  4MOT A;  4ASG A;  2HHI A;  2QG2 A;  4CWQ A;  4PU9 A;  3GIG A;  2H55 A;  3EHJ A;  3LNU A;  3MNR P;  1AH6 A;  3TTZ A;  3HYY A;  4L94 A;  4CWO A;  5FNC A;  1BGQ A;  1UYC A;  2XDS A;  4QPJ A;  1TID A;  2WEP A;  3H4L A;  5FNF A;  4HYM A;  4URL A;  2FWY A;  3EHF A;  5IN9 A;  3TZ2 A;  3R4N A;  4BQG A;  2O1V A;  3GIG B;  4DZY A;  1NHH A;  1UYK A;  3OWB A;  5JEN A;  3OW6 A;  3HZ1 A;  2YEI A;  4O05 A;  3O2F A;  1UYE A;  1AJ6 A;  2WI2 A;  1I5D A;  2GFD A;  3Q5K A;  3ZXQ A;  1S14 A;  2PNR A;  2YGE A;  4YKY A;  2XD6 A;  2BTZ A;  2XDU A;  2XX5 A;  3CRK A;  1UYD A;  5CTX A;  2BYI A;  4CWT A;  3T2S A;  3R4P A;  4XKA A;  4URM A;  1H7S A;  4L90 A;  3T10 A;  4XIT A;  2ESA A;  2YE2 A;  3GIF A;  4P8O A;  3VHD A;  2YGA A;  4CE1 A;  2XX4 A;  2YEJ A;  5FND A;  3QDD A;  4O04 A;  3BM9 A;  4PRV A;  4XC0 A;  4YKX A;  1Y4U A;  5M4K A;  3U2K A;  1B62 A;  3K98 A;  2BZ5 A;  2YEF A;  4XIR A;  4FMT A;  4BIZ A;  5M4M A;  1BXD A;  4HXW A;  4CWN A;  2XJG A;  4EFT A;  5M4N A;  4X9L A;  5M4P A;  2YI5 A;  1UYG A;  2AKP A;  5FWK A;  3Q5L A;  2IWS A;  4NH8 A;  4R1F A;  4KSG A;  3TZ4 A;  2WI5 A;  2H8M A;  3B28 A;  3G7E A;  4GEE A;  1GKX A;  3O6O A;  4EM7 A;  1UY7 A;  3R92 A;  3EKO A;  4CE3 A;  3OWD A;  2XHR A;  3RLQ A;  1I5A A;  3G75 A;  2BU5 A;  4JQL A;  4ASB A;  3U67 A;  1UYM A;  2YI6 A;  3EHG A;  4E02 A;  4XIP A;  2ZDY A;  1US7 A;  2VW5 A;  5J71 A;  2YE7 A;  2BU7 A;  1YET A;  4AWO A;  5M4H A;  2K5B A;  4XDM A;  4JAS A;  1ZXM A;  4ASF A;  1AMW A;  1YS3 A;  5D6Q A;  5CF0 A;  3NMQ A;  2YKC A;  2YE6 A;  1EA6 A;  2IOQ A;  4XD8 A;  4XIQ A;  2WI4 A;  1TH8 A;  2FXS A;  2XAB A;  5BOC A;  2FTK A;  4HYP A;  3VAD A;  1PVG A;  1UYL A;  4GFN A;  2EXL A;  2JJC A;  4KP4 A;  3S5T A;  2CG9 A;  4YKR A;  3QTF A;  1F51 A;  1KIJ A;  2BYH A;  4O07 A;  2C1G A;  1ID0 A;  1YC1 A;  4WUB A;  4FPP A;  2O1W A;  3LMM A;  4XKO A;  4BXI A;  4YKU A;  4XTJ A;  2VCI A;  4LPB A;  4MP2 A;  4MPE A;  4R3M A;  3OPD A;  4XCL A;  2GQP A;  1Y4S A;  4V25 A;  2YJW A;  4KFG A;  3LPS A;  4KQV A;  4ASA A;  1Z5B A;  2BRE A;  3OMU A;  4MB9 A;  4YKW A;  1UYI A;  4KSH A;  2UWD A;  1ZXN A;  3PEJ A;  2WI1 A;  1YT0 A;  5L3J A;  1TBW A;  1ZWH A;  5D6P A;  4LWF A;  2ZBK B;  3A0T A;  2YE4 A;  4JAV A;  4EMV A;  1YT2 A;  4URN A;  3G7B A;  4CWR A;  3T0H A;  1L0O A;  4FCP A;  4WUD A;  1EI1 A;  2QFO A;  3HEK A;  1UY8 A;  3HHU A;  2HG1 A;  3O0I A;  4AWP A;  3KE6 A;  5M4E A;  1UYH A;  2CCT A;  3CRL A;  1I58 A;  1NHI A;  2ZKJ A;  2FYP A;  4W7T A;  4FCQ A;  4EGI A;  4GT8 A;  3INX A;  4WUC A;  4PRX A;  1Y8P A;  4LWH A;  2XJJ A;  4AS9 A;  4H7Q A;  1IXM A;  2Q8I A;  4Q20 A;  3PEH A;  2WI6 A;  4I3H A;  2IWX A;  4BAE A;  1OSF A;  3SL2 A;  2BU8 A;  3TZ0 A;  4U7N A;  3R91 A;  2CCS A;  1Z59 A;  4GQT A;  3WQ9 A;  1YSR A;  3U2D A;  3WHA A;  4EGH A;  2YKI A;  2IOP A;  3B27 A;  3FT8 A;  2XDK A;  4EFU A;  1YT1 A;  4QPK A;  4XKK A;  3B25 A;  4U7O A;  1KZN A;  1UY6 A;  1B3Q A;  2QG0 A;  3R4M A;  4L91 A;  4EGK A;  3ZKD A;  4LWI A;  1GJV A;  2CGF A;  4MPN A;  2CCU A;  3A0X A;  1UYF A;  3GIE A;  2BRC A;  5IDJ A;  5C93 A;  3CYG A;  4URO A;  4NH9 A;  2JKI A;  3FT5 A;  4JAU A;  3BMY A;  4R3A A;  5D7R A;  3TUH A;  4V26 A;  1H7U A;  3D2R A;  3INW A;  4L93 A;  1A4H A;  2CH4 A;  1YER A;  3HZ5 A;  4HZ5 A;  2BU2 A;  4EEH A;  4HZ0 A;  3ZKB A;  3A0W A;  1YC3 A;  3K60 A;  5CTW A;  2IWU A;  1THN A;  4KTN A;  4E01 A;  2VCJ A;  1Y8O A;  3CWV A;  3K99 A;  4O09 A;  2YEE A;  5D7D A;  2QF6 A;  2WEQ A;  2YGF A;  2YKJ A;  1QY8 A;  4CE2 A;  4I5S A;  2C1I A;  3RKZ A;  5F5R A;  2WER A;  4CWS A;  2YEH A;  1MU5 A;  2XDL A;  2YED A;  3HYZ A;  2BSM A;  4HXZ A;  3RLP A;  1UY9 A;  3EKR A;  2XX2 A;  3VHA A;  3C11 A;  1S16 A;  3FV5 A;  3K97 A;  2XDX A;  3C0E A; 
#chains in the Genus database with same CATH homology
 1TIL A;  2BT0 A;  2XJX A;  4LP0 A;  4YKT A;  5J6A A;  3H80 A;  1QYE A;  2YK9 A;  3T0Z A;  4CWP A;  4XE2 A;  2XCM A;  3CGY A;  4ZVI A;  1BKN A;  3EHH A;  4H85 A;  4LWG A;  2Q8G A;  1GKZ A;  4B6C A;  2YE5 A;  4HY1 A;  1R62 A;  2XHT A;  5F3K A;  1I59 A;  1AM1 A;  2VWC A;  2Q2E B;  2XHX A;  3IED A;  2YE8 A;  4E00 A;  4LWE A;  1TC0 A;  1U2O A;  4BIU A;  4L8Z A;  2YEG A;  1Z5A A;  4GGL A;  4CWF A;  1NHJ A;  3DGE A;  2Q8H A;  4MBC A;  1MX0 A;  2C2A A;  3JZ3 A;  3D36 A;  3D0B A;  4H81 A;  4HY6 A;  4MP7 A;  2ZDX A;  1BYQ A;  4NH7 A;  1B63 A;  1I5B A;  3CGZ A;  2O1U A;  3RLR A;  2YK2 A;  3VHC A;  2BU6 A;  2E0A A;  4YKZ A;  2IOR A;  2HCH A;  4FCR A;  5GGZ A;  2YJX A;  2WI7 A;  1Y8N A;  5CTY A;  4B7P A;  3A0R A;  3Q5J A;  4ZKI A;  4O0B A;  4AWQ A;  1ZW9 A;  1JM6 A;  2HKJ A;  4BQJ A;  1YC4 A;  1I5C A;  4DUH A;  3A0Z A;  1U0Z A;  2YE9 A;  4GCZ A;  5BOD A;  1YSZ A;  4K4O A;  3B26 A;  1AH8 A;  4U93 A;  4YKQ A;  5CTU A;  2YEA A;  2YEC A;  4XCJ A;  1YES A;  2Q8F A;  3R4O A;  2YI0 A;  3TZ5 A;  4P7A A;  3T1K A;  3ZXO A;  1QZR A;  5D7C A;  5IDM A;  2YE3 A;  2YKE A;  3B24 A;  2WI3 A;  2FWZ A;  3A0Y A;  4PL9 A;  2YI7 A;  2YKB A;  4MPC A;  1TC6 A;  1Z5C A;  2XK2 A;  3ZM7 A;  5CPH A;  2YEB A;  4MOT A;  4ASG A;  2QG2 A;  4CWQ A;  4PU9 A;  3GIG A;  2H55 A;  3EHJ A;  3LNU A;  3MNR P;  1AH6 A;  3TTZ A;  3HYY A;  4L94 A;  4CWO A;  5FNC A;  1BGQ A;  1UYC A;  2XDS A;  4QPJ A;  1TID A;  2WEP A;  3H4L A;  5FNF A;  4HYM A;  4URL A;  2FWY A;  3EHF A;  5IN9 A;  3TZ2 A;  3R4N A;  4BQG A;  2O1V A;  3GIG B;  4DZY A;  1NHH A;  1UYK A;  3OWB A;  3OW6 A;  3HZ1 A;  2YEI A;  4O05 A;  3O2F A;  1UYE A;  1AJ6 A;  2WI2 A;  1I5D A;  2GFD A;  3Q5K A;  3ZXQ A;  1S14 A;  2PNR A;  2YGE A;  4YKY A;  2XD6 A;  2BTZ A;  2XDU A;  2XX5 A;  3CRK A;  1UYD A;  5CTX A;  2BYI A;  4CWT A;  3T2S A;  3R4P A;  4XKA A;  4URM A;  1H7S A;  4L90 A;  3T10 A;  4XIT A;  2ESA A;  2YE2 A;  3GIF A;  4P8O A;  3VHD A;  2YGA A;  4CE1 A;  2XX4 A;  2YEJ A;  5FND A;  3QDD A;  4O04 A;  3BM9 A;  4PRV A;  4XC0 A;  4YKX A;  1Y4U A;  5M4K A;  3U2K A;  1B62 A;  3K98 A;  2BZ5 A;  2YEF A;  4XIR A;  4FMT A;  4BIZ A;  5M4M A;  1BXD A;  4HXW A;  4CWN A;  2XJG A;  4EFT A;  5M4N A;  4X9L A;  5M4P A;  2YI5 A;  1UYG A;  2AKP A;  5FWK A;  3Q5L A;  2IWS A;  4NH8 A;  4R1F A;  4KSG A;  3TZ4 A;  2WI5 A;  2H8M A;  3B28 A;  3G7E A;  4GEE A;  1GKX A;  3O6O A;  4EM7 A;  1UY7 A;  3R92 A;  3EKO A;  4CE3 A;  3OWD A;  2XHR A;  3RLQ A;  1I5A A;  3G75 A;  2BU5 A;  4JQL A;  4ASB A;  3U67 A;  1UYM A;  2YI6 A;  3EHG A;  4E02 A;  4XIP A;  2ZDY A;  1US7 A;  2VW5 A;  5J71 A;  2YE7 A;  2BU7 A;  1YET A;  4AWO A;  5M4H A;  2K5B A;  4XDM A;  4JAS A;  1ZXM A;  4ASF A;  1AMW A;  1YS3 A;  5D6Q A;  5CF0 A;  3NMQ A;  2YKC A;  2YE6 A;  1EA6 A;  2IOQ A;  4XD8 A;  4XIQ A;  2WI4 A;  1TH8 A;  2FXS A;  2XAB A;  5BOC A;  4HYP A;  3VAD A;  1PVG A;  1UYL A;  4GFN A;  2EXL A;  2JJC A;  4KP4 A;  2CG9 A;  4YKR A;  3QTF A;  1KIJ A;  2BYH A;  4O07 A;  1ID0 A;  1YC1 A;  4WUB A;  4FPP A;  2O1W A;  4XKO A;  4BXI A;  4YKU A;  4XTJ A;  2VCI A;  4LPB A;  4MP2 A;  4MPE A;  4R3M A;  3OPD A;  4XCL A;  2GQP A;  1Y4S A;  4V25 A;  2YJW A;  4KFG A;  3LPS A;  4KQV A;  4ASA A;  1Z5B A;  2BRE A;  3OMU A;  4MB9 A;  4YKW A;  1UYI A;  4KSH A;  2UWD A;  1ZXN A;  3PEJ A;  2WI1 A;  1YT0 A;  5L3J A;  1TBW A;  1ZWH A;  5D6P A;  4LWF A;  2ZBK B;  3A0T A;  2YE4 A;  4JAV A;  4EMV A;  1YT2 A;  4URN A;  3G7B A;  4CWR A;  3T0H A;  1L0O A;  4FCP A;  4WUD A;  1EI1 A;  2QFO A;  3HEK A;  1UY8 A;  3HHU A;  2HG1 A;  3O0I A;  4AWP A;  3KE6 A;  5M4E A;  1UYH A;  2CCT A;  3CRL A;  1I58 A;  1NHI A;  2ZKJ A;  2FYP A;  4W7T A;  4FCQ A;  4EGI A;  4GT8 A;  3INX A;  4WUC A;  4PRX A;  1Y8P A;  4LWH A;  2XJJ A;  4AS9 A;  4H7Q A;  2Q8I A;  4Q20 A;  3PEH A;  2WI6 A;  4I3H A;  2IWX A;  4BAE A;  1OSF A;  3SL2 A;  2BU8 A;  3TZ0 A;  4U7N A;  3R91 A;  2CCS A;  1Z59 A;  4GQT A;  3WQ9 A;  1YSR A;  3U2D A;  3WHA A;  4EGH A;  2YKI A;  2IOP A;  3B27 A;  3FT8 A;  2XDK A;  4EFU A;  1YT1 A;  4QPK A;  4XKK A;  3B25 A;  4U7O A;  1KZN A;  1UY6 A;  1B3Q A;  2QG0 A;  3R4M A;  4L91 A;  4EGK A;  3ZKD A;  4LWI A;  1GJV A;  2CGF A;  4MPN A;  2CCU A;  3A0X A;  1UYF A;  3GIE A;  2BRC A;  5IDJ A;  5C93 A;  4URO A;  4NH9 A;  2JKI A;  3FT5 A;  4JAU A;  3BMY A;  4R3A A;  5D7R A;  3TUH A;  4V26 A;  1H7U A;  3D2R A;  3INW A;  4L93 A;  1A4H A;  2CH4 A;  1YER A;  3HZ5 A;  4HZ5 A;  2BU2 A;  4EEH A;  4HZ0 A;  3ZKB A;  3A0W A;  1YC3 A;  3K60 A;  5CTW A;  2IWU A;  1THN A;  4KTN A;  4E01 A;  2VCJ A;  1Y8O A;  3CWV A;  3K99 A;  4O09 A;  2YEE A;  5D7D A;  2QF6 A;  2WEQ A;  2YGF A;  2YKJ A;  1QY8 A;  4CE2 A;  4I5S A;  3RKZ A;  5F5R A;  2WER A;  4CWS A;  2YEH A;  1MU5 A;  2XDL A;  2YED A;  3HYZ A;  2BSM A;  4HXZ A;  3RLP A;  1UY9 A;  3EKR A;  2XX2 A;  3VHA A;  3C11 A;  1S16 A;  3FV5 A;  3K97 A;  2XDX A;  3C0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...