3A0ZA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0zA00
2BTZA 4CWNA 2IOQA 2JKIA 1TH8A 4XIPA 1UY8A 3CGYA 4U7NA 3G7BA 3TZ0A 4LWIA 4GFNA 2YI5A 4JQLA 3OWBA 3LNUA 4R1FA 4AS9A 3SL2A 5FNFA 4E00A 5GGZA 4URMA 3A0WA 1QZRA 2FYPA 1H7SA 2BSMA 3NMQA 4CE3A 3RKZA 3K60A 3OWDA 3TUHA 4V26A 3KE6A 1I5CA 4W7TA 5M4EA 3OPDA 2CG9A 2XX4A 2C2AA 3HZ5A 3OW6A 2ZKJA 4YKYA 4XKAA 4WUCA 1YC4A 1UYKA 2HG1A 4EM7A 4KFGA 2Q8GA 5J6AA 2WI6A 1S16A 3WQ9A 1UY7A 2Q8IA 2YEGA 3WHAA 2YEJA 3B25A 4NH9A 2XDKA 5CTYA 2QG2A 1UYIA 1L0OA 1A4HA 1GKXA 2YEIA 3B28A 4O07A 4XCLA 3HYZA 4XIQA 3ZXOA 1KIJA 4XC0A 4AWPA 1B3QA 5F5RA 2QFOA 1BYQA 5IDMA 1KZNA 1YC3A 1ZXMA 3BMYA 1Z5CA 3B27A 4H85A 2XJGA 4BIUA 1Y8PA 4DZYA 3LPSA 3R4MA 2YK9A 4FMTA 3TZ5A 1YERA 3GIGA 1QY8A 1S14A 1UYFA 4DUHA 2E0AA 2YE4A 1Y8NA 4YKRA 3Q5LA 2BT0A 4HY1A 4CWOA 2H8MA 4LP0A 2AKPA 3O2FA 3CRLA 4YKWA 4GQTA 2YE6A 1UYLA 4O05A 4Q20A 1B62A 3U2KA 4HXWA 4BQJA 2PNRA 3RLPA 1R62A 4U7OA 2K5BA 3GIGB 1Y8OA 3K99A 5CTXA 3INWA 4YKZA 5C93A 3CGZA 1EA6A 3Q5JA 3OMUA 4URLA 3TTZA 2IORA 4PRVA 2YKBA 4CWFA 1ZW9A 1ID0A 3ZKDA 4JAVA 4EFUA 1I5AA 4XCJA 1YT1A 4YKTA 4AWQA 4E01A 4L94A 1AH6A 4I5SA 2YE5A 4EGHA 3JZ3A 2XDLA 4E02A 1UY9A 2YEHA 4LWGA 2BYHA 2YEEA 3T2SA 3GIEA 2BREA 3K98A 4U93A 1BXDA 4O09A 3R92A 3O6OA 2XCMA 5BODA 4XIRA 5FNCA 4CE1A 2O1UA 1TC0A 3FT5A 4EMVA 2YKJA 4GT8A 4PU9A 1QYEA 2YGEA 4YKQA 4WUBA 1UYGA 1I5BA 2HKJA 5D7DA 4LWFA 5D7RA 3Q5KA 2O1VA 1NHJA 1U2OA 2ESAA 4XE2A 4FCRA 3QTFA 4HY6A 2FWYA 4XKOA 3FT8A 1I59A 1YS3A 2Q8HA 1I58A 3VHCA 4BIZA 1TILA 3A0XA 4FCPA 5FNDA 4QPKA 5D6PA 4O0BA 4KSGA 3C0EA 3HZ1A 4LPBA 1U0ZA 1THNA 4GCZA 2BU2A 4KP4A 3T10A 3HHUA 4LWHA 3K97A 3R4NA 2YKIA 3DGEA 2VCIA 3A0RA 4R3AA 4XITA 2YJWA 4CE2A 1BGQA 3BM9A 2BZ5A 1AMWA 4XD8A 4H81A 3R91A 2XABA 2GFDA 3QDDA 4NH7A 3EKRA 4B6CA 2YE9A 1Z5BA 3C11A 3ZKBA 4CWRA 1AH8A 3U67A 4H7QA 3RLRA 3EHFA 5D7CA 1ZXNA 4HZ5A 2YGFA 3RLQA 1EI1A 4BAEA 1US7A 3T0HA 4X9LA 3ZM7A 4L93A 1ZWHA 1UYHA 3R4PA 2VCJA 2IOPA 2UWDA 4JAUA 1MX0A 1Y4SA 3EHHA 4HXZA 4ZKIA 2ZDXA 4XKKA 4PRXA 1GJVA 2FXSA 2VWCA 3R4OA 5CTWA 4EGKA 5M4MA 3T0ZA 4HYPA 4PL9A 2XHRA 3EHJA 1NHHA 4K4OA 4HZ0A 4ASBA 4URNA 4KQVA 3EKOA 2CCUA 2XHXA 5BOCA 4LWEA 1NHIA 2XD6A 1YT2A 2YE7A 5CTUA 4P8OA 2YI7A 3HYYA 2IWXA 4XTJA 3ZXQA 4P7AA 5M4NA 1AJ6A 1UYEA 2YKEA 3D0BA 1Z5AA 3A0TA 2ZBKB 1OSFA 1YC1A 4XDMA 3TZ4A 2XX2A 2WI5A 2YKCA 3HEKA 1I5DA 3T1KA 2WEQA 4YKUA 2WI3A 5L3JA 3IEDA 2YE3A 2XX5A 3MNRP 5IDJA 5M4KA 1Y4UA 2YEDA 4ZVIA 3A0ZA 4CWTA 4HYMA 4GEEA 3A0YA 4MB9A 4EEHA 4CWPA 3H4LA 2YEFA 4BXIA 4ASFA 1TBWA 1UYDA 3VHDA 2GQPA 2CCSA 4R3MA 1YESA 2YI0A 2YE2A 2H55A 1TC6A 5F3KA 2YEBA 3EHGA 3GIFA 4GGLA 4UROA 3H80A 5M4HA 2BYIA 4I3HA 1YSRA 4CWQA 1B63A 3G7EA 2FWZA 1YETA 2ZDYA 3B24A 2YK2A 4AWOA 5IN9A 4NH8A 4ASAA 2BU5A 2O1WA 2IWSA 2CGFA 1UYCA 3B26A 3CRKA 2WI4A 3D36A 4MOTA 2JJCA 2BU7A 4BQGA 3CWVA 2WERA 4QPJA 3TZ2A 1UYMA 2XJXA 2YI6A 2WI2A 2BU8A 4KSHA 4O04A 2BU6A 1UY6A 5CF0A 4MP2A 3FV5A 1YSZA 2YE8A 2YGAA 3VHAA 2XK2A 4MPEA 4EFTA 1TIDA 2XDSA 2YECA 2CCTA 2WEPA 4L8ZA 5FWKA 3U2DA 2XDUA 3O0IA 3PEJA 1PVGA 4FPPA 4YKXA 4CWSA 4FCQA 3D2RA 1AM1A 2XJJA 4ASGA 4B7PA 4JASA 5D6QA 4WUDA 4L90A 1GKZA 4MPNA 4MBCA 2CH4A 3PEHA 4KTNA 2Q2EB 2EXLA 3G75A 2YEAA 2XHTA 4V25A 2WI7A 3VADA 2Q8FA 5J71A 2YJXA 1BKNA 2QG0A 4EGIA 2HCHA 2QF6A 1JM6A 3INXA 1YT0A 1Z59A 5M4PA 2WI1A 1H7UA 4MP7A 2BRCA 2VW5A 5CPHA 2XDXA 4MPCA 1MU5A 4L91A 2IWUA
chains in the Genus database with same CATH superfamily
2BTZA 4CWNA 2IOQA 2JKIA 1TH8A 4XIPA 1UY8A 3CGYA 4U7NA 3G7BA 3TZ0A 4LWIA 4GFNA 2YI5A 4JQLA 3OWBA 3LNUA 4R1FA 4AS9A 3SL2A 5FNFA 4E00A 5GGZA 4URMA 3A0WA 1QZRA 2FYPA 1H7SA 2BSMA 3NMQA 4CE3A 3RKZA 3K60A 3OWDA 3TUHA 4V26A 3KE6A 1I5CA 4W7TA 5M4EA 3OPDA 2CG9A 2XX4A 2C2AA 3HZ5A 3OW6A 2ZKJA 4YKYA 4XKAA 4WUCA 1YC4A 1UYKA 2HG1A 4EM7A 4KFGA 2Q8GA 5J6AA 2WI6A 1S16A 3WQ9A 1UY7A 2Q8IA 2YEGA 3WHAA 2YEJA 2C1IA 3B25A 4NH9A 2XDKA 5CTYA 2QG2A 1UYIA 1L0OA 1A4HA 1GKXA 2YEIA 3B28A 4O07A 4XCLA 3HYZA 4XIQA 3ZXOA 1KIJA 4XC0A 4AWPA 1B3QA 5F5RA 2QFOA 1BYQA 5IDMA 1KZNA 1YC3A 1ZXMA 3BMYA 1Z5CA 3B27A 4H85A 2XJGA 4BIUA 1Y8PA 4DZYA 3LPSA 3R4MA 2YK9A 4FMTA 3TZ5A 1YERA 3GIGA 1QY8A 1S14A 1UYFA 4DUHA 2E0AA 2YE4A 1Y8NA 4YKRA 3Q5LA 2BT0A 4HY1A 4CWOA 2H8MA 4LP0A 2AKPA 3O2FA 3CRLA 4YKWA 4GQTA 2YE6A 1UYLA 4O05A 4Q20A 1B62A 3U2KA 4HXWA 4BQJA 2PNRA 3RLPA 1R62A 4U7OA 2K5BA 3GIGB 1Y8OA 3K99A 5CTXA 3INWA 4YKZA 5C93A 3CGZA 1EA6A 3Q5JA 3OMUA 4URLA 3TTZA 2IORA 4PRVA 2YKBA 4CWFA 1ZW9A 1ID0A 3ZKDA 4JAVA 4EFUA 1I5AA 1IXMA 4XCJA 1YT1A 4YKTA 4AWQA 4E01A 4L94A 1AH6A 4I5SA 2YE5A 4EGHA 1F51A 3JZ3A 2XDLA 4E02A 1UY9A 2YEHA 4LWGA 2BYHA 2YEEA 3T2SA 3GIEA 2BREA 3K98A 4U93A 1BXDA 4O09A 3R92A 3O6OA 2XCMA 5BODA 4XIRA 5FNCA 4CE1A 2O1UA 1TC0A 3FT5A 4EMVA 2YKJA 4GT8A 4PU9A 1QYEA 2YGEA 4YKQA 4WUBA 1UYGA 1I5BA 2HKJA 5D7DA 4LWFA 5D7RA 3Q5KA 2O1VA 1NHJA 1U2OA 2ESAA 4XE2A 4FCRA 3QTFA 4HY6A 2FWYA 4XKOA 3FT8A 1I59A 1YS3A 2Q8HA 1I58A 3VHCA 4BIZA 1TILA 3A0XA 4FCPA 5FNDA 4QPKA 5D6PA 4O0BA 4KSGA 3C0EA 3HZ1A 1U0ZA 1THNA 4GCZA 4LPBA 2BU2A 3S5TA 4KP4A 3T10A 3HHUA 4LWHA 3K97A 3R4NA 2YKIA 3DGEA 2VCIA 3A0RA 4R3AA 4XITA 2YJWA 4CE2A 1BGQA 3BM9A 2BZ5A 1AMWA 4XD8A 4H81A 3R91A 2XABA 2GFDA 2C1GA 3QDDA 4NH7A 3EKRA 4B6CA 2YE9A 1Z5BA 3C11A 3ZKBA 4CWRA 1AH8A 3U67A 4H7QA 3RLRA 3EHFA 5D7CA 1ZXNA 4HZ5A 2YGFA 3RLQA 1EI1A 4BAEA 1US7A 3T0HA 4X9LA 5JENA 3ZM7A 4L93A 1ZWHA 1UYHA 3R4PA 2VCJA 3LMMA 2IOPA 2UWDA 4JAUA 1MX0A 1Y4SA 3EHHA 4HXZA 4ZKIA 2ZDXA 4XKKA 4PRXA 1GJVA 2FXSA 2VWCA 3R4OA 5CTWA 4EGKA 5M4MA 3T0ZA 4HYPA 4E72A 4PL9A 2XHRA 3EHJA 1NHHA 4K4OA 4HZ0A 4ASBA 4URNA 4KQVA 3EKOA 2CCUA 2XHXA 5BOCA 4LWEA 1NHIA 2XD6A 1YT2A 2YE7A 5CTUA 4P8OA 2YI7A 3HYYA 2IWXA 4XTJA 3ZXQA 4P7AA 2FTKA 5M4NA 1AJ6A 1UYEA 2YKEA 3D0BA 1Z5AA 3A0TA 2ZBKB 1OSFA 1YC1A 4XDMA 3TZ4A 2XX2A 2WI5A 2YKCA 3HEKA 1I5DA 3T1KA 2WEQA 4YKUA 2WI3A 5L3JA 3IEDA 2YE3A 2XX5A 3MNRP 5IDJA 5M4KA 1Y4UA 2YEDA 4ZVIA 3A0ZA 4CWTA 4HYMA 4GEEA 3A0YA 4MB9A 4EEHA 4CWPA 3H4LA 2YEFA 4BXIA 4ASFA 1TBWA 1UYDA 3VHDA 2GQPA 2CCSA 4R3MA 1YESA 2YI0A 2YE2A 2H55A 1TC6A 5F3KA 2YEBA 3EHGA 3GIFA 4GGLA 4UROA 3H80A 5M4HA 2BYIA 4I3HA 1YSRA 4CWQA 1B63A 3G7EA 2FWZA 1YETA 2ZDYA 3B24A 2YK2A 4AWOA 5IN9A 2HHIA 3CYGA 4NH8A 4ASAA 2BU5A 2O1WA 2IWSA 2CGFA 1UYCA 3B26A 3CRKA 2WI4A 3D36A 4MOTA 2JJCA 2BU7A 4BQGA 3CWVA 2WERA 4QPJA 3TZ2A 1UYMA 2XJXA 2YI6A 2WI2A 2BU8A 4KSHA 4O04A 2BU6A 1UY6A 5CF0A 4MP2A 3FV5A 1YSZA 2YE8A 2YGAA 3VHAA 2XK2A 4MPEA 4EFTA 1TIDA 2XDSA 2YECA 2CCTA 2WEPA 4L8ZA 5FWKA 3U2DA 2XDUA 3O0IA 3PEJA 1PVGA 4FPPA 4YKXA 4CWSA 4FCQA 3D2RA 1AM1A 2XJJA 4ASGA 4B7PA 4JASA 5D6QA 4WUDA 4L90A 1GKZA 4MPNA 4MBCA 2CH4A 3PEHA 4KTNA 2Q2EB 2EXLA 3G75A 2YEAA 2XHTA 4V25A 2WI7A 3VADA 2Q8FA 5J71A 2YJXA 1BKNA 2QG0A 4EGIA 2HCHA 2QF6A 1JM6A 3INXA 1YT0A 1Z59A 5M4PA 2WI1A 1H7UA 4MP7A 2BRCA 2VW5A 5CPHA 2XDXA 4MPCA 1MU5A 4L91A 2IWUA
chains in the Genus database with same CATH topology
2BTZA 4CWNA 2IOQA 2JKIA 1TH8A 4XIPA 1UY8A 3CGYA 4U7NA 3G7BA 3TZ0A 4LWIA 4GFNA 2YI5A 4JQLA 3OWBA 3LNUA 4R1FA 4AS9A 3SL2A 5FNFA 4E00A 5GGZA 4URMA 3A0WA 1QZRA 2FYPA 1H7SA 2BSMA 3NMQA 4CE3A 3RKZA 3K60A 3OWDA 3TUHA 4V26A 3KE6A 1I5CA 4W7TA 5M4EA 3OPDA 2CG9A 2XX4A 2C2AA 3HZ5A 3OW6A 2ZKJA 4YKYA 4XKAA 4WUCA 1YC4A 1UYKA 2HG1A 4EM7A 4KFGA 2Q8GA 5J6AA 2WI6A 1S16A 3WQ9A 1UY7A 2Q8IA 2YEGA 3WHAA 2YEJA 3B25A 4NH9A 2XDKA 5CTYA 2QG2A 1UYIA 1L0OA 1A4HA 1GKXA 2YEIA 3B28A 4O07A 4XCLA 3HYZA 4XIQA 3ZXOA 1KIJA 4XC0A 4AWPA 1B3QA 5F5RA 2QFOA 1BYQA 5IDMA 1KZNA 1YC3A 1ZXMA 3BMYA 1Z5CA 3B27A 4H85A 2XJGA 4BIUA 1Y8PA 4DZYA 3LPSA 3R4MA 2YK9A 4FMTA 3TZ5A 1YERA 3GIGA 1QY8A 1S14A 1UYFA 4DUHA 2E0AA 2YE4A 1Y8NA 4YKRA 3Q5LA 2BT0A 4HY1A 4CWOA 2H8MA 4LP0A 2AKPA 3O2FA 3CRLA 4YKWA 4GQTA 2YE6A 1UYLA 4O05A 4Q20A 1B62A 3U2KA 4HXWA 4BQJA 2PNRA 3RLPA 1R62A 4U7OA 2K5BA 3GIGB 1Y8OA 3K99A 5CTXA 3INWA 4YKZA 5C93A 3CGZA 1EA6A 3Q5JA 3OMUA 4URLA 3TTZA 2IORA 4PRVA 2YKBA 4CWFA 1ZW9A 1ID0A 3ZKDA 4JAVA 4EFUA 1I5AA 4XCJA 1YT1A 4YKTA 4AWQA 4E01A 4L94A 1AH6A 4I5SA 2YE5A 4EGHA 3JZ3A 2XDLA 4E02A 1UY9A 2YEHA 4LWGA 2BYHA 2YEEA 3T2SA 3GIEA 2BREA 3K98A 4U93A 1BXDA 4O09A 3R92A 3O6OA 2XCMA 5BODA 4XIRA 5FNCA 4CE1A 2O1UA 1TC0A 3FT5A 4EMVA 2YKJA 4GT8A 4PU9A 1QYEA 2YGEA 4YKQA 4WUBA 1UYGA 1I5BA 2HKJA 5D7DA 4LWFA 5D7RA 3Q5KA 2O1VA 1NHJA 1U2OA 2ESAA 4XE2A 4FCRA 3QTFA 4HY6A 2FWYA 4XKOA 3FT8A 1I59A 1YS3A 2Q8HA 1I58A 3VHCA 4BIZA 1TILA 3A0XA 4FCPA 5FNDA 4QPKA 5D6PA 4O0BA 4KSGA 3C0EA 3HZ1A 4LPBA 1U0ZA 1THNA 4GCZA 2BU2A 4KP4A 3T10A 3HHUA 4LWHA 3K97A 3R4NA 2YKIA 3DGEA 2VCIA 3A0RA 4R3AA 4XITA 2YJWA 4CE2A 1BGQA 3BM9A 2BZ5A 1AMWA 4XD8A 4H81A 3R91A 2XABA 2GFDA 3QDDA 4NH7A 3EKRA 4B6CA 2YE9A 1Z5BA 3C11A 3ZKBA 4CWRA 1AH8A 3U67A 4H7QA 3RLRA 3EHFA 5D7CA 1ZXNA 4HZ5A 2YGFA 3RLQA 1EI1A 4BAEA 1US7A 3T0HA 4X9LA 3ZM7A 4L93A 1ZWHA 1UYHA 3R4PA 2VCJA 2IOPA 2UWDA 4JAUA 1MX0A 1Y4SA 3EHHA 4HXZA 4ZKIA 2ZDXA 4XKKA 4PRXA 1GJVA 2FXSA 2VWCA 3R4OA 5CTWA 4EGKA 5M4MA 3T0ZA 4HYPA 4PL9A 2XHRA 3EHJA 1NHHA 4K4OA 4HZ0A 4ASBA 4URNA 4KQVA 3EKOA 2CCUA 2XHXA 5BOCA 4LWEA 1NHIA 2XD6A 1YT2A 2YE7A 5CTUA 4P8OA 2YI7A 3HYYA 2IWXA 4XTJA 3ZXQA 4P7AA 5M4NA 1AJ6A 1UYEA 2YKEA 3D0BA 1Z5AA 3A0TA 2ZBKB 1OSFA 1YC1A 4XDMA 3TZ4A 2XX2A 2WI5A 2YKCA 3HEKA 1I5DA 3T1KA 2WEQA 4YKUA 2WI3A 5L3JA 3IEDA 2YE3A 2XX5A 3MNRP 5IDJA 5M4KA 1Y4UA 2YEDA 4ZVIA 3A0ZA 4CWTA 4HYMA 4GEEA 3A0YA 4MB9A 4EEHA 4CWPA 3H4LA 2YEFA 4BXIA 4ASFA 1TBWA 1UYDA 3VHDA 2GQPA 2CCSA 4R3MA 1YESA 2YI0A 2YE2A 2H55A 1TC6A 5F3KA 2YEBA 3EHGA 3GIFA 4GGLA 4UROA 3H80A 5M4HA 2BYIA 4I3HA 1YSRA 4CWQA 1B63A 3G7EA 2FWZA 1YETA 2ZDYA 3B24A 2YK2A 4AWOA 5IN9A 4NH8A 4ASAA 2BU5A 2O1WA 2IWSA 2CGFA 1UYCA 3B26A 3CRKA 2WI4A 3D36A 4MOTA 2JJCA 2BU7A 4BQGA 3CWVA 2WERA 4QPJA 3TZ2A 1UYMA 2XJXA 2YI6A 2WI2A 2BU8A 4KSHA 4O04A 2BU6A 1UY6A 5CF0A 4MP2A 3FV5A 1YSZA 2YE8A 2YGAA 3VHAA 2XK2A 4MPEA 4EFTA 1TIDA 2XDSA 2YECA 2CCTA 2WEPA 4L8ZA 5FWKA 3U2DA 2XDUA 3O0IA 3PEJA 1PVGA 4FPPA 4YKXA 4CWSA 4FCQA 3D2RA 1AM1A 2XJJA 4ASGA 4B7PA 4JASA 5D6QA 4WUDA 4L90A 1GKZA 4MPNA 4MBCA 2CH4A 3PEHA 4KTNA 2Q2EB 2EXLA 3G75A 2YEAA 2XHTA 4V25A 2WI7A 3VADA 2Q8FA 5J71A 2YJXA 1BKNA 2QG0A 4EGIA 2HCHA 2QF6A 1JM6A 3INXA 1YT0A 1Z59A 5M4PA 2WI1A 1H7UA 4MP7A 2BRCA 2VW5A 5CPHA 2XDXA 4MPCA 1MU5A 4L91A 2IWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTZ A;  4CWN A;  2IOQ A;  2JKI A;  1TH8 A;  4XIP A;  1UY8 A;  3CGY A;  4U7N A;  3G7B A;  3TZ0 A;  4LWI A;  4GFN A;  2YI5 A;  4JQL A;  3OWB A;  3LNU A;  4R1F A;  4AS9 A;  3SL2 A;  5FNF A;  4E00 A;  5GGZ A;  4URM A;  3A0W A;  1QZR A;  2FYP A;  1H7S A;  2BSM A;  3NMQ A;  4CE3 A;  3RKZ A;  3K60 A;  3OWD A;  3TUH A;  4V26 A;  3KE6 A;  1I5C A;  4W7T A;  5M4E A;  3OPD A;  2CG9 A;  2XX4 A;  2C2A A;  3HZ5 A;  3OW6 A;  2ZKJ A;  4YKY A;  4XKA A;  4WUC A;  1YC4 A;  1UYK A;  2HG1 A;  4EM7 A;  4KFG A;  2Q8G A;  5J6A A;  2WI6 A;  1S16 A;  3WQ9 A;  1UY7 A;  2Q8I A;  2YEG A;  3WHA A;  2YEJ A;  3B25 A;  4NH9 A;  2XDK A;  5CTY A;  2QG2 A;  1UYI A;  1L0O A;  1A4H A;  1GKX A;  2YEI A;  3B28 A;  4O07 A;  4XCL A;  3HYZ A;  4XIQ A;  3ZXO A;  1KIJ A;  4XC0 A;  4AWP A;  1B3Q A;  5F5R A;  2QFO A;  1BYQ A;  5IDM A;  1KZN A;  1YC3 A;  1ZXM A;  3BMY A;  1Z5C A;  3B27 A;  4H85 A;  2XJG A;  4BIU A;  1Y8P A;  4DZY A;  3LPS A;  3R4M A;  2YK9 A;  4FMT A;  3TZ5 A;  1YER A;  3GIG A;  1QY8 A;  1S14 A;  1UYF A;  4DUH A;  2E0A A;  2YE4 A;  1Y8N A;  4YKR A;  3Q5L A;  2BT0 A;  4HY1 A;  4CWO A;  2H8M A;  4LP0 A;  2AKP A;  3O2F A;  3CRL A;  4YKW A;  4GQT A;  2YE6 A;  1UYL A;  4O05 A;  4Q20 A;  1B62 A;  3U2K A;  4HXW A;  4BQJ A;  2PNR A;  3RLP A;  1R62 A;  4U7O A;  2K5B A;  3GIG B;  1Y8O A;  3K99 A;  5CTX A;  3INW A;  4YKZ A;  5C93 A;  3CGZ A;  1EA6 A;  3Q5J A;  3OMU A;  4URL A;  3TTZ A;  2IOR A;  4PRV A;  2YKB A;  4CWF A;  1ZW9 A;  1ID0 A;  3ZKD A;  4JAV A;  4EFU A;  1I5A A;  4XCJ A;  1YT1 A;  4YKT A;  4AWQ A;  4E01 A;  4L94 A;  1AH6 A;  4I5S A;  2YE5 A;  4EGH A;  3JZ3 A;  2XDL A;  4E02 A;  1UY9 A;  2YEH A;  4LWG A;  2BYH A;  2YEE A;  3T2S A;  3GIE A;  2BRE A;  3K98 A;  4U93 A;  1BXD A;  4O09 A;  3R92 A;  3O6O A;  2XCM A;  5BOD A;  4XIR A;  5FNC A;  4CE1 A;  2O1U A;  1TC0 A;  3FT5 A;  4EMV A;  2YKJ A;  4GT8 A;  4PU9 A;  1QYE A;  2YGE A;  4YKQ A;  4WUB A;  1UYG A;  1I5B A;  2HKJ A;  5D7D A;  4LWF A;  5D7R A;  3Q5K A;  2O1V A;  1NHJ A;  1U2O A;  2ESA A;  4XE2 A;  4FCR A;  3QTF A;  4HY6 A;  2FWY A;  4XKO A;  3FT8 A;  1I59 A;  1YS3 A;  2Q8H A;  1I58 A;  3VHC A;  4BIZ A;  1TIL A;  3A0X A;  4FCP A;  5FND A;  4QPK A;  5D6P A;  4O0B A;  4KSG A;  3C0E A;  3HZ1 A;  4LPB A;  1U0Z A;  1THN A;  4GCZ A;  2BU2 A;  4KP4 A;  3T10 A;  3HHU A;  4LWH A;  3K97 A;  3R4N A;  2YKI A;  3DGE A;  2VCI A;  3A0R A;  4R3A A;  4XIT A;  2YJW A;  4CE2 A;  1BGQ A;  3BM9 A;  2BZ5 A;  1AMW A;  4XD8 A;  4H81 A;  3R91 A;  2XAB A;  2GFD A;  3QDD A;  4NH7 A;  3EKR A;  4B6C A;  2YE9 A;  1Z5B A;  3C11 A;  3ZKB A;  4CWR A;  1AH8 A;  3U67 A;  4H7Q A;  3RLR A;  3EHF A;  5D7C A;  1ZXN A;  4HZ5 A;  2YGF A;  3RLQ A;  1EI1 A;  4BAE A;  1US7 A;  3T0H A;  4X9L A;  3ZM7 A;  4L93 A;  1ZWH A;  1UYH A;  3R4P A;  2VCJ A;  2IOP A;  2UWD A;  4JAU A;  1MX0 A;  1Y4S A;  3EHH A;  4HXZ A;  4ZKI A;  2ZDX A;  4XKK A;  4PRX A;  1GJV A;  2FXS A;  2VWC A;  3R4O A;  5CTW A;  4EGK A;  5M4M A;  3T0Z A;  4HYP A;  4PL9 A;  2XHR A;  3EHJ A;  1NHH A;  4K4O A;  4HZ0 A;  4ASB A;  4URN A;  4KQV A;  3EKO A;  2CCU A;  2XHX A;  5BOC A;  4LWE A;  1NHI A;  2XD6 A;  1YT2 A;  2YE7 A;  5CTU A;  4P8O A;  2YI7 A;  3HYY A;  2IWX A;  4XTJ A;  3ZXQ A;  4P7A A;  5M4N A;  1AJ6 A;  1UYE A;  2YKE A;  3D0B A;  1Z5A A;  3A0T A;  2ZBK B;  1OSF A;  1YC1 A;  4XDM A;  3TZ4 A;  2XX2 A;  2WI5 A;  2YKC A;  3HEK A;  1I5D A;  3T1K A;  2WEQ A;  4YKU A;  2WI3 A;  5L3J A;  3IED A;  2YE3 A;  2XX5 A;  3MNR P;  5IDJ A;  5M4K A;  1Y4U A;  2YED A;  4ZVI A;  3A0Z A;  4CWT A;  4HYM A;  4GEE A;  3A0Y A;  4MB9 A;  4EEH A;  4CWP A;  3H4L A;  2YEF A;  4BXI A;  4ASF A;  1TBW A;  1UYD A;  3VHD A;  2GQP A;  2CCS A;  4R3M A;  1YES A;  2YI0 A;  2YE2 A;  2H55 A;  1TC6 A;  5F3K A;  2YEB A;  3EHG A;  3GIF A;  4GGL A;  4URO A;  3H80 A;  5M4H A;  2BYI A;  4I3H A;  1YSR A;  4CWQ A;  1B63 A;  3G7E A;  2FWZ A;  1YET A;  2ZDY A;  3B24 A;  2YK2 A;  4AWO A;  5IN9 A;  4NH8 A;  4ASA A;  2BU5 A;  2O1W A;  2IWS A;  2CGF A;  1UYC A;  3B26 A;  3CRK A;  2WI4 A;  3D36 A;  4MOT A;  2JJC A;  2BU7 A;  4BQG A;  3CWV A;  2WER A;  4QPJ A;  3TZ2 A;  1UYM A;  2XJX A;  2YI6 A;  2WI2 A;  2BU8 A;  4KSH A;  4O04 A;  2BU6 A;  1UY6 A;  5CF0 A;  4MP2 A;  3FV5 A;  1YSZ A;  2YE8 A;  2YGA A;  3VHA A;  2XK2 A;  4MPE A;  4EFT A;  1TID A;  2XDS A;  2YEC A;  2CCT A;  2WEP A;  4L8Z A;  5FWK A;  3U2D A;  2XDU A;  3O0I A;  3PEJ A;  1PVG A;  4FPP A;  4YKX A;  4CWS A;  4FCQ A;  3D2R A;  1AM1 A;  2XJJ A;  4ASG A;  4B7P A;  4JAS A;  5D6Q A;  4WUD A;  4L90 A;  1GKZ A;  4MPN A;  4MBC A;  2CH4 A;  3PEH A;  4KTN A;  2Q2E B;  2EXL A;  3G75 A;  2YEA A;  2XHT A;  4V25 A;  2WI7 A;  3VAD A;  2Q8F A;  5J71 A;  2YJX A;  1BKN A;  2QG0 A;  4EGI A;  2HCH A;  2QF6 A;  1JM6 A;  3INX A;  1YT0 A;  1Z59 A;  5M4P A;  2WI1 A;  1H7U A;  4MP7 A;  2BRC A;  2VW5 A;  5CPH A;  2XDX A;  4MPC A;  1MU5 A;  4L91 A;  2IWU A; 
#chains in the Genus database with same CATH topology
 2BTZ A;  4CWN A;  2IOQ A;  2JKI A;  1TH8 A;  4XIP A;  1UY8 A;  3CGY A;  4U7N A;  3G7B A;  3TZ0 A;  4LWI A;  4GFN A;  2YI5 A;  4JQL A;  3OWB A;  3LNU A;  4R1F A;  4AS9 A;  3SL2 A;  5FNF A;  4E00 A;  5GGZ A;  4URM A;  3A0W A;  1QZR A;  2FYP A;  1H7S A;  2BSM A;  3NMQ A;  4CE3 A;  3RKZ A;  3K60 A;  3OWD A;  3TUH A;  4V26 A;  3KE6 A;  1I5C A;  4W7T A;  5M4E A;  3OPD A;  2CG9 A;  2XX4 A;  2C2A A;  3HZ5 A;  3OW6 A;  2ZKJ A;  4YKY A;  4XKA A;  4WUC A;  1YC4 A;  1UYK A;  2HG1 A;  4EM7 A;  4KFG A;  2Q8G A;  5J6A A;  2WI6 A;  1S16 A;  3WQ9 A;  1UY7 A;  2Q8I A;  2YEG A;  3WHA A;  2YEJ A;  2C1I A;  3B25 A;  4NH9 A;  2XDK A;  5CTY A;  2QG2 A;  1UYI A;  1L0O A;  1A4H A;  1GKX A;  2YEI A;  3B28 A;  4O07 A;  4XCL A;  3HYZ A;  4XIQ A;  3ZXO A;  1KIJ A;  4XC0 A;  4AWP A;  1B3Q A;  5F5R A;  2QFO A;  1BYQ A;  5IDM A;  1KZN A;  1YC3 A;  1ZXM A;  3BMY A;  1Z5C A;  3B27 A;  4H85 A;  2XJG A;  4BIU A;  1Y8P A;  4DZY A;  3LPS A;  3R4M A;  2YK9 A;  4FMT A;  3TZ5 A;  1YER A;  3GIG A;  1QY8 A;  1S14 A;  1UYF A;  4DUH A;  2E0A A;  2YE4 A;  1Y8N A;  4YKR A;  3Q5L A;  2BT0 A;  4HY1 A;  4CWO A;  2H8M A;  4LP0 A;  2AKP A;  3O2F A;  3CRL A;  4YKW A;  4GQT A;  2YE6 A;  1UYL A;  4O05 A;  4Q20 A;  1B62 A;  3U2K A;  4HXW A;  4BQJ A;  2PNR A;  3RLP A;  1R62 A;  4U7O A;  2K5B A;  3GIG B;  1Y8O A;  3K99 A;  5CTX A;  3INW A;  4YKZ A;  5C93 A;  3CGZ A;  1EA6 A;  3Q5J A;  3OMU A;  4URL A;  3TTZ A;  2IOR A;  4PRV A;  2YKB A;  4CWF A;  1ZW9 A;  1ID0 A;  3ZKD A;  4JAV A;  4EFU A;  1I5A A;  1IXM A;  4XCJ A;  1YT1 A;  4YKT A;  4AWQ A;  4E01 A;  4L94 A;  1AH6 A;  4I5S A;  2YE5 A;  4EGH A;  1F51 A;  3JZ3 A;  2XDL A;  4E02 A;  1UY9 A;  2YEH A;  4LWG A;  2BYH A;  2YEE A;  3T2S A;  3GIE A;  2BRE A;  3K98 A;  4U93 A;  1BXD A;  4O09 A;  3R92 A;  3O6O A;  2XCM A;  5BOD A;  4XIR A;  5FNC A;  4CE1 A;  2O1U A;  1TC0 A;  3FT5 A;  4EMV A;  2YKJ A;  4GT8 A;  4PU9 A;  1QYE A;  2YGE A;  4YKQ A;  4WUB A;  1UYG A;  1I5B A;  2HKJ A;  5D7D A;  4LWF A;  5D7R A;  3Q5K A;  2O1V A;  1NHJ A;  1U2O A;  2ESA A;  4XE2 A;  4FCR A;  3QTF A;  4HY6 A;  2FWY A;  4XKO A;  3FT8 A;  1I59 A;  1YS3 A;  2Q8H A;  1I58 A;  3VHC A;  4BIZ A;  1TIL A;  3A0X A;  4FCP A;  5FND A;  4QPK A;  5D6P A;  4O0B A;  4KSG A;  3C0E A;  3HZ1 A;  1U0Z A;  1THN A;  4GCZ A;  4LPB A;  2BU2 A;  3S5T A;  4KP4 A;  3T10 A;  3HHU A;  4LWH A;  3K97 A;  3R4N A;  2YKI A;  3DGE A;  2VCI A;  3A0R A;  4R3A A;  4XIT A;  2YJW A;  4CE2 A;  1BGQ A;  3BM9 A;  2BZ5 A;  1AMW A;  4XD8 A;  4H81 A;  3R91 A;  2XAB A;  2GFD A;  2C1G A;  3QDD A;  4NH7 A;  3EKR A;  4B6C A;  2YE9 A;  1Z5B A;  3C11 A;  3ZKB A;  4CWR A;  1AH8 A;  3U67 A;  4H7Q A;  3RLR A;  3EHF A;  5D7C A;  1ZXN A;  4HZ5 A;  2YGF A;  3RLQ A;  1EI1 A;  4BAE A;  1US7 A;  3T0H A;  4X9L A;  5JEN A;  3ZM7 A;  4L93 A;  1ZWH A;  1UYH A;  3R4P A;  2VCJ A;  3LMM A;  2IOP A;  2UWD A;  4JAU A;  1MX0 A;  1Y4S A;  3EHH A;  4HXZ A;  4ZKI A;  2ZDX A;  4XKK A;  4PRX A;  1GJV A;  2FXS A;  2VWC A;  3R4O A;  5CTW A;  4EGK A;  5M4M A;  3T0Z A;  4HYP A;  4E72 A;  4PL9 A;  2XHR A;  3EHJ A;  1NHH A;  4K4O A;  4HZ0 A;  4ASB A;  4URN A;  4KQV A;  3EKO A;  2CCU A;  2XHX A;  5BOC A;  4LWE A;  1NHI A;  2XD6 A;  1YT2 A;  2YE7 A;  5CTU A;  4P8O A;  2YI7 A;  3HYY A;  2IWX A;  4XTJ A;  3ZXQ A;  4P7A A;  2FTK A;  5M4N A;  1AJ6 A;  1UYE A;  2YKE A;  3D0B A;  1Z5A A;  3A0T A;  2ZBK B;  1OSF A;  1YC1 A;  4XDM A;  3TZ4 A;  2XX2 A;  2WI5 A;  2YKC A;  3HEK A;  1I5D A;  3T1K A;  2WEQ A;  4YKU A;  2WI3 A;  5L3J A;  3IED A;  2YE3 A;  2XX5 A;  3MNR P;  5IDJ A;  5M4K A;  1Y4U A;  2YED A;  4ZVI A;  3A0Z A;  4CWT A;  4HYM A;  4GEE A;  3A0Y A;  4MB9 A;  4EEH A;  4CWP A;  3H4L A;  2YEF A;  4BXI A;  4ASF A;  1TBW A;  1UYD A;  3VHD A;  2GQP A;  2CCS A;  4R3M A;  1YES A;  2YI0 A;  2YE2 A;  2H55 A;  1TC6 A;  5F3K A;  2YEB A;  3EHG A;  3GIF A;  4GGL A;  4URO A;  3H80 A;  5M4H A;  2BYI A;  4I3H A;  1YSR A;  4CWQ A;  1B63 A;  3G7E A;  2FWZ A;  1YET A;  2ZDY A;  3B24 A;  2YK2 A;  4AWO A;  5IN9 A;  2HHI A;  3CYG A;  4NH8 A;  4ASA A;  2BU5 A;  2O1W A;  2IWS A;  2CGF A;  1UYC A;  3B26 A;  3CRK A;  2WI4 A;  3D36 A;  4MOT A;  2JJC A;  2BU7 A;  4BQG A;  3CWV A;  2WER A;  4QPJ A;  3TZ2 A;  1UYM A;  2XJX A;  2YI6 A;  2WI2 A;  2BU8 A;  4KSH A;  4O04 A;  2BU6 A;  1UY6 A;  5CF0 A;  4MP2 A;  3FV5 A;  1YSZ A;  2YE8 A;  2YGA A;  3VHA A;  2XK2 A;  4MPE A;  4EFT A;  1TID A;  2XDS A;  2YEC A;  2CCT A;  2WEP A;  4L8Z A;  5FWK A;  3U2D A;  2XDU A;  3O0I A;  3PEJ A;  1PVG A;  4FPP A;  4YKX A;  4CWS A;  4FCQ A;  3D2R A;  1AM1 A;  2XJJ A;  4ASG A;  4B7P A;  4JAS A;  5D6Q A;  4WUD A;  4L90 A;  1GKZ A;  4MPN A;  4MBC A;  2CH4 A;  3PEH A;  4KTN A;  2Q2E B;  2EXL A;  3G75 A;  2YEA A;  2XHT A;  4V25 A;  2WI7 A;  3VAD A;  2Q8F A;  5J71 A;  2YJX A;  1BKN A;  2QG0 A;  4EGI A;  2HCH A;  2QF6 A;  1JM6 A;  3INX A;  1YT0 A;  1Z59 A;  5M4P A;  2WI1 A;  1H7U A;  4MP7 A;  2BRC A;  2VW5 A;  5CPH A;  2XDX A;  4MPC A;  1MU5 A;  4L91 A;  2IWU A; 
#chains in the Genus database with same CATH homology
 2BTZ A;  4CWN A;  2IOQ A;  2JKI A;  1TH8 A;  4XIP A;  1UY8 A;  3CGY A;  4U7N A;  3G7B A;  3TZ0 A;  4LWI A;  4GFN A;  2YI5 A;  4JQL A;  3OWB A;  3LNU A;  4R1F A;  4AS9 A;  3SL2 A;  5FNF A;  4E00 A;  5GGZ A;  4URM A;  3A0W A;  1QZR A;  2FYP A;  1H7S A;  2BSM A;  3NMQ A;  4CE3 A;  3RKZ A;  3K60 A;  3OWD A;  3TUH A;  4V26 A;  3KE6 A;  1I5C A;  4W7T A;  5M4E A;  3OPD A;  2CG9 A;  2XX4 A;  2C2A A;  3HZ5 A;  3OW6 A;  2ZKJ A;  4YKY A;  4XKA A;  4WUC A;  1YC4 A;  1UYK A;  2HG1 A;  4EM7 A;  4KFG A;  2Q8G A;  5J6A A;  2WI6 A;  1S16 A;  3WQ9 A;  1UY7 A;  2Q8I A;  2YEG A;  3WHA A;  2YEJ A;  3B25 A;  4NH9 A;  2XDK A;  5CTY A;  2QG2 A;  1UYI A;  1L0O A;  1A4H A;  1GKX A;  2YEI A;  3B28 A;  4O07 A;  4XCL A;  3HYZ A;  4XIQ A;  3ZXO A;  1KIJ A;  4XC0 A;  4AWP A;  1B3Q A;  5F5R A;  2QFO A;  1BYQ A;  5IDM A;  1KZN A;  1YC3 A;  1ZXM A;  3BMY A;  1Z5C A;  3B27 A;  4H85 A;  2XJG A;  4BIU A;  1Y8P A;  4DZY A;  3LPS A;  3R4M A;  2YK9 A;  4FMT A;  3TZ5 A;  1YER A;  3GIG A;  1QY8 A;  1S14 A;  1UYF A;  4DUH A;  2E0A A;  2YE4 A;  1Y8N A;  4YKR A;  3Q5L A;  2BT0 A;  4HY1 A;  4CWO A;  2H8M A;  4LP0 A;  2AKP A;  3O2F A;  3CRL A;  4YKW A;  4GQT A;  2YE6 A;  1UYL A;  4O05 A;  4Q20 A;  1B62 A;  3U2K A;  4HXW A;  4BQJ A;  2PNR A;  3RLP A;  1R62 A;  4U7O A;  2K5B A;  3GIG B;  1Y8O A;  3K99 A;  5CTX A;  3INW A;  4YKZ A;  5C93 A;  3CGZ A;  1EA6 A;  3Q5J A;  3OMU A;  4URL A;  3TTZ A;  2IOR A;  4PRV A;  2YKB A;  4CWF A;  1ZW9 A;  1ID0 A;  3ZKD A;  4JAV A;  4EFU A;  1I5A A;  4XCJ A;  1YT1 A;  4YKT A;  4AWQ A;  4E01 A;  4L94 A;  1AH6 A;  4I5S A;  2YE5 A;  4EGH A;  3JZ3 A;  2XDL A;  4E02 A;  1UY9 A;  2YEH A;  4LWG A;  2BYH A;  2YEE A;  3T2S A;  3GIE A;  2BRE A;  3K98 A;  4U93 A;  1BXD A;  4O09 A;  3R92 A;  3O6O A;  2XCM A;  5BOD A;  4XIR A;  5FNC A;  4CE1 A;  2O1U A;  1TC0 A;  3FT5 A;  4EMV A;  2YKJ A;  4GT8 A;  4PU9 A;  1QYE A;  2YGE A;  4YKQ A;  4WUB A;  1UYG A;  1I5B A;  2HKJ A;  5D7D A;  4LWF A;  5D7R A;  3Q5K A;  2O1V A;  1NHJ A;  1U2O A;  2ESA A;  4XE2 A;  4FCR A;  3QTF A;  4HY6 A;  2FWY A;  4XKO A;  3FT8 A;  1I59 A;  1YS3 A;  2Q8H A;  1I58 A;  3VHC A;  4BIZ A;  1TIL A;  3A0X A;  4FCP A;  5FND A;  4QPK A;  5D6P A;  4O0B A;  4KSG A;  3C0E A;  3HZ1 A;  4LPB A;  1U0Z A;  1THN A;  4GCZ A;  2BU2 A;  4KP4 A;  3T10 A;  3HHU A;  4LWH A;  3K97 A;  3R4N A;  2YKI A;  3DGE A;  2VCI A;  3A0R A;  4R3A A;  4XIT A;  2YJW A;  4CE2 A;  1BGQ A;  3BM9 A;  2BZ5 A;  1AMW A;  4XD8 A;  4H81 A;  3R91 A;  2XAB A;  2GFD A;  3QDD A;  4NH7 A;  3EKR A;  4B6C A;  2YE9 A;  1Z5B A;  3C11 A;  3ZKB A;  4CWR A;  1AH8 A;  3U67 A;  4H7Q A;  3RLR A;  3EHF A;  5D7C A;  1ZXN A;  4HZ5 A;  2YGF A;  3RLQ A;  1EI1 A;  4BAE A;  1US7 A;  3T0H A;  4X9L A;  3ZM7 A;  4L93 A;  1ZWH A;  1UYH A;  3R4P A;  2VCJ A;  2IOP A;  2UWD A;  4JAU A;  1MX0 A;  1Y4S A;  3EHH A;  4HXZ A;  4ZKI A;  2ZDX A;  4XKK A;  4PRX A;  1GJV A;  2FXS A;  2VWC A;  3R4O A;  5CTW A;  4EGK A;  5M4M A;  3T0Z A;  4HYP A;  4PL9 A;  2XHR A;  3EHJ A;  1NHH A;  4K4O A;  4HZ0 A;  4ASB A;  4URN A;  4KQV A;  3EKO A;  2CCU A;  2XHX A;  5BOC A;  4LWE A;  1NHI A;  2XD6 A;  1YT2 A;  2YE7 A;  5CTU A;  4P8O A;  2YI7 A;  3HYY A;  2IWX A;  4XTJ A;  3ZXQ A;  4P7A A;  5M4N A;  1AJ6 A;  1UYE A;  2YKE A;  3D0B A;  1Z5A A;  3A0T A;  2ZBK B;  1OSF A;  1YC1 A;  4XDM A;  3TZ4 A;  2XX2 A;  2WI5 A;  2YKC A;  3HEK A;  1I5D A;  3T1K A;  2WEQ A;  4YKU A;  2WI3 A;  5L3J A;  3IED A;  2YE3 A;  2XX5 A;  3MNR P;  5IDJ A;  5M4K A;  1Y4U A;  2YED A;  4ZVI A;  3A0Z A;  4CWT A;  4HYM A;  4GEE A;  3A0Y A;  4MB9 A;  4EEH A;  4CWP A;  3H4L A;  2YEF A;  4BXI A;  4ASF A;  1TBW A;  1UYD A;  3VHD A;  2GQP A;  2CCS A;  4R3M A;  1YES A;  2YI0 A;  2YE2 A;  2H55 A;  1TC6 A;  5F3K A;  2YEB A;  3EHG A;  3GIF A;  4GGL A;  4URO A;  3H80 A;  5M4H A;  2BYI A;  4I3H A;  1YSR A;  4CWQ A;  1B63 A;  3G7E A;  2FWZ A;  1YET A;  2ZDY A;  3B24 A;  2YK2 A;  4AWO A;  5IN9 A;  4NH8 A;  4ASA A;  2BU5 A;  2O1W A;  2IWS A;  2CGF A;  1UYC A;  3B26 A;  3CRK A;  2WI4 A;  3D36 A;  4MOT A;  2JJC A;  2BU7 A;  4BQG A;  3CWV A;  2WER A;  4QPJ A;  3TZ2 A;  1UYM A;  2XJX A;  2YI6 A;  2WI2 A;  2BU8 A;  4KSH A;  4O04 A;  2BU6 A;  1UY6 A;  5CF0 A;  4MP2 A;  3FV5 A;  1YSZ A;  2YE8 A;  2YGA A;  3VHA A;  2XK2 A;  4MPE A;  4EFT A;  1TID A;  2XDS A;  2YEC A;  2CCT A;  2WEP A;  4L8Z A;  5FWK A;  3U2D A;  2XDU A;  3O0I A;  3PEJ A;  1PVG A;  4FPP A;  4YKX A;  4CWS A;  4FCQ A;  3D2R A;  1AM1 A;  2XJJ A;  4ASG A;  4B7P A;  4JAS A;  5D6Q A;  4WUD A;  4L90 A;  1GKZ A;  4MPN A;  4MBC A;  2CH4 A;  3PEH A;  4KTN A;  2Q2E B;  2EXL A;  3G75 A;  2YEA A;  2XHT A;  4V25 A;  2WI7 A;  3VAD A;  2Q8F A;  5J71 A;  2YJX A;  1BKN A;  2QG0 A;  4EGI A;  2HCH A;  2QF6 A;  1JM6 A;  3INX A;  1YT0 A;  1Z59 A;  5M4P A;  2WI1 A;  1H7U A;  4MP7 A;  2BRC A;  2VW5 A;  5CPH A;  2XDX A;  4MPC A;  1MU5 A;  4L91 A;  2IWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...