3A0ZA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
b'MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0zA00
4FCQA 1B62A 3CRKA 3ZXOA 4ASFA 4MB9A 5F5RA 4XTJA 4EGIA 3RLPA 4HXZA 4XIPA 4KFGA 4BQJA 4URNA 2YEAA 3SL2A 1UY8A 4I3HA 4JASA 4L91A 4MPNA 1Z59A 4HXWA 4KTNA 3ZM7A 1BXDA 4CE3A 4HYPA 3EKOA 5M4HA 4DZYA 4EMVA 4CWRA 4NH9A 2BREA 5J71A 1PVGA 2XX4A 4L8ZA 1AM1A 1NHHA 5IN9A 2O1WA 4MOTA 2O1UA 4ZKIA 3R4OA 4YKQA 2BU7A 3RLRA 4AWOA 4BAEA 5GGZA 1THNA 2WI1A 4XD8A 2Q8IA 1TILA 3B25A 2ZBKB 3OMUA 1Y4UA 2FYPA 2YEBA 4PL9A 2E0AA 4EFUA 3R4PA 5FNDA 4QPKA 3EKRA 4XKKA 3O0IA 5CTYA 3G7BA 3TZ2A 1UY9A 2YKJA 5L3JA 4WUCA 3T0ZA 4GEEA 2XJGA 3Q5KA 2XDUA 5D6QA 3FT5A 1UYEA 4MPEA 1KZNA 3G75A 2FWZA 4FPPA 3KE6A 1UYLA 1MX0A 1YT0A 2XK2A 2BU2A 2YJWA 3VADA 4YKYA 5CTUA 2YI6A 3GIEA 3PEJA 2H55A 3R92A 1GJVA 1QY8A 4YKZA 5IDMA 1Y8PA 2YE2A 5D7DA 4EGHA 4EEHA 3FT8A 1UYKA 4BXIA 3LNUA 5D7CA 1BYQA 5FWKA 1A4HA 1B3QA 4R3AA 1Y4SA 3VHCA 4CWOA 2YK9A 5BODA 3O2FA 4U93A 3RKZA 4K4OA 2YE5A 2BT0A 2WEPA 2CGFA 2Q8HA 1EA6A 1Z5CA 2YGFA 1ID0A 2YECA 2YE7A 5CTXA 1B63A 2YE4A 2JJCA 4I5SA 2YEIA 2BYHA 1MU5A 3LPSA 4XCLA 4B7PA 3EHGA 3ZXQA 2VCJA 2YGAA 1YESA 2QFOA 2XX5A 4NH7A 2YEGA 1AH8A 1UYMA 4W7TA 5M4NA 3B27A 3RLQA 4AWQA 2QF6A 4X9LA 2C2AA 4CWTA 1GKZA 4L94A 4URLA 4ASAA 4HY6A 4U7NA 3HYYA 2HKJA 2IWXA 3R4MA 2CCUA 3FV5A 3GIGB 1AH6A 3A0WA 4ASGA 3T0HA 1BGQA 4GGLA 2VW5A 5FNCA 2ESAA 3T2SA 5M4PA 3EHFA 1S14A 2YEEA 3A0XA 4GFNA 2BTZA 4HZ5A 2PNRA 1NHJA 2BU8A 4FCPA 2YEJA 4XKOA 3MNRP 1Y8NA 1UYHA 4EGKA 3OW6A 4EM7A 1I5AA 3A0YA 4CWFA 4U7OA 4E02A 3A0TA 3K97A 3TTZA 1UYIA 2K5BA 4JQLA 4XKAA 3D0BA 4KSGA 1YC3A 2BSMA 5BOCA 1NHIA 2ZKJA 4URMA 3H80A 1TIDA 3GIGA 5D6PA 5M4KA 1YT1A 4YKXA 3C0EA 4XDMA 2FXSA 3U2DA 4BIZA 4P7AA 2XD6A 3TZ5A 4JAUA 1QZRA 2CCSA 4LWIA 2HG1A 1I5BA 1Y8OA 1TBWA 3JZ3A 3Q5JA 4KSHA 4E01A 4XIRA 4B6CA 2XDKA 4HZ0A 2IORA 1S16A 2BU5A 4V26A 4YKRA 4P8OA 4AS9A 2CH4A 4PRXA 3OWDA 4ASBA 3INWA 3T1KA 2YE8A 2XHTA 2BU6A 2YI5A 2VWCA 2YI7A 2GFDA 4HY1A 2ZDXA 2XDLA 4XE2A 3INXA 4O07A 3HHUA 5C93A 4CE1A 2BZ5A 4MPCA 1EI1A 3K99A 1R62A 1H7SA 1U0ZA 2YI0A 2WI6A 2QG2A 2VCIA 2WI5A 4CWNA 3CWVA 2FWYA 3O6OA 1H7UA 1YC1A 2WI7A 5FNFA 1I5DA 2YK2A 2YEDA 3D36A 4CWSA 4UROA 4O09A 1YSZA 4YKTA 3B28A 3A0ZA 1YT2A 4R1FA 4YKWA 4XC0A 3D2RA 3WHAA 3BMYA 4H85A 3IEDA 1YETA 2XJXA 2WI4A 1Z5AA 3CGZA 4XCJA 3VHDA 2BRCA 3U67A 3A0RA 4LWEA 1ZWHA 1ZW9A 2Q2EB 2YEHA 2YKCA 4V25A 2XCMA 5CF0A 2IOPA 2H8MA 2JKIA 4CWPA 4LWHA 3VHAA 5M4MA 4LWGA 2YKBA 3EHJA 2YE6A 4FCRA 2WI2A 4R3MA 4YKUA 2WEQA 4PU9A 3R4NA 4O04A 1AMWA 5D7RA 2YKEA 2Q8GA 2BYIA 4BIUA 1KIJA 5J6AA 4QPJA 5CTWA 3B24A 1I5CA 3HZ1A 3PEHA 1UY6A 2YEFA 4KP4A 4LPBA 4PRVA 4CWQA 2XHRA 4MP2A 1JM6A 1L0OA 4XITA 1QYEA 4GQTA 1ZXMA 3B26A 1I59A 2AKPA 1TC0A 3TZ4A 3ZKBA 1US7A 5IDJA 4BQGA 5M4EA 1ZXNA 3BM9A 4H81A 4LP0A 1BKNA 1I58A 2IOQA 1TH8A 3T10A 2YJXA 1UYFA 4MBCA 2IWUA 1YERA 3CGYA 4FMTA 1YS3A 3ZKDA 2XDXA 2EXLA 2ZDYA 3TUHA 2HCHA 4XIQA 4L93A 3H4LA 2QG0A 3HEKA 4CE2A 2WI3A 2UWDA 2YE9A 3OWBA 3CRLA 2WERA 3HYZA 2GQPA 1TC6A 2YE3A 2CCTA 4DUHA 4MP7A 2XHXA 4O05A 1YSRA 4WUBA 4H7QA 2XABA 3EHHA 1Z5BA 3QTFA 2YGEA 5CPHA 3DGEA 3NMQA 4NH8A 1UY7A 4HYMA 1AJ6A 2O1VA 2YKIA 1U2OA 3U2KA 4JAVA 4E00A 3GIFA 2XX2A 1GKXA 3WQ9A 1YC4A 3HZ5A 3R91A 3TZ0A 4LWFA 2IWSA 4Q20A 5F3KA 1OSFA 4O0BA 2XJJA 3K60A 4ZVIA 4WUDA 3OPDA 2CG9A 4AWPA 4KQVA 4GCZA 2XDSA 3K98A 2Q8FA 4L90A 1UYGA 4EFTA 3G7EA 3QDDA 1UYCA 4GT8A 3C11A 3Q5LA 1UYDA
chains in the Genus database with same CATH superfamily
4FCQA 1B62A 3CRKA 3ZXOA 4ASFA 4MB9A 5F5RA 4XTJA 4EGIA 3RLPA 4HXZA 4XIPA 3S5TA 4KFGA 4BQJA 4URNA 2YEAA 3SL2A 1UY8A 4I3HA 4JASA 4L91A 4MPNA 1Z59A 4HXWA 4KTNA 3ZM7A 1BXDA 4CE3A 4HYPA 3EKOA 5M4HA 4DZYA 4EMVA 4CWRA 4NH9A 2BREA 5J71A 1PVGA 2XX4A 4L8ZA 1AM1A 1NHHA 5IN9A 2O1WA 4MOTA 3LMMA 2O1UA 4ZKIA 3R4OA 4YKQA 2BU7A 3RLRA 4AWOA 4BAEA 5GGZA 1THNA 2WI1A 4XD8A 2Q8IA 1TILA 3B25A 2ZBKB 3OMUA 1Y4UA 2FYPA 2YEBA 4PL9A 2E0AA 4EFUA 3R4PA 5FNDA 4QPKA 3EKRA 4XKKA 3O0IA 5CTYA 3G7BA 3TZ2A 1UY9A 2YKJA 4E72A 5L3JA 4WUCA 3T0ZA 4GEEA 2XJGA 3Q5KA 2XDUA 5D6QA 3FT5A 1UYEA 4MPEA 1KZNA 3G75A 2FWZA 4FPPA 3KE6A 1UYLA 1MX0A 1YT0A 2XK2A 2BU2A 2YJWA 3VADA 4YKYA 5CTUA 2YI6A 3GIEA 3PEJA 2H55A 3R92A 1GJVA 1QY8A 4YKZA 5IDMA 1Y8PA 2YE2A 5D7DA 4EGHA 4EEHA 3FT8A 1UYKA 4BXIA 3LNUA 5D7CA 1BYQA 5FWKA 1A4HA 1B3QA 4R3AA 1Y4SA 3CYGA 3VHCA 4CWOA 2YK9A 5BODA 3O2FA 4U93A 3RKZA 4K4OA 2YE5A 2BT0A 2WEPA 2CGFA 2Q8HA 1EA6A 1Z5CA 2YGFA 1ID0A 2YECA 2YE7A 5CTXA 1B63A 2YE4A 2JJCA 4I5SA 2YEIA 2BYHA 1MU5A 3LPSA 4XCLA 4B7PA 3EHGA 3ZXQA 2VCJA 2YGAA 1YESA 2QFOA 2XX5A 4NH7A 2YEGA 1AH8A 1UYMA 4W7TA 5M4NA 3B27A 3RLQA 4AWQA 2QF6A 4X9LA 2C2AA 4CWTA 1GKZA 4L94A 4URLA 4ASAA 4HY6A 4U7NA 3HYYA 2HKJA 2IWXA 3R4MA 2CCUA 3FV5A 3GIGB 1AH6A 3A0WA 4ASGA 3T0HA 1BGQA 4GGLA 2VW5A 5FNCA 2ESAA 3T2SA 5M4PA 3EHFA 1S14A 2YEEA 3A0XA 4GFNA 2BTZA 4HZ5A 2PNRA 1NHJA 2BU8A 4FCPA 2YEJA 4XKOA 3MNRP 1Y8NA 1UYHA 4EGKA 3OW6A 4EM7A 1I5AA 3A0YA 4CWFA 4U7OA 4E02A 3A0TA 3K97A 3TTZA 1UYIA 2K5BA 4JQLA 4XKAA 3D0BA 4KSGA 1YC3A 2BSMA 5BOCA 1NHIA 2ZKJA 2FTKA 4URMA 3H80A 1TIDA 3GIGA 5D6PA 5M4KA 1YT1A 4YKXA 3C0EA 4XDMA 2FXSA 3U2DA 4BIZA 4P7AA 2XD6A 3TZ5A 4JAUA 1QZRA 2CCSA 4LWIA 2HG1A 1I5BA 1Y8OA 1TBWA 3JZ3A 3Q5JA 4KSHA 4E01A 4XIRA 4B6CA 2XDKA 4HZ0A 2IORA 1S16A 2BU5A 4V26A 4YKRA 4P8OA 4AS9A 2CH4A 4PRXA 3OWDA 4ASBA 3INWA 3T1KA 2YE8A 2XHTA 2BU6A 2YI5A 2VWCA 2YI7A 2GFDA 4HY1A 2ZDXA 2XDLA 4XE2A 3INXA 4O07A 3HHUA 5C93A 4CE1A 2BZ5A 4MPCA 1EI1A 3K99A 2C1GA 1R62A 1H7SA 1U0ZA 2YI0A 2WI6A 2QG2A 2VCIA 2WI5A 4CWNA 3CWVA 2FWYA 3O6OA 1H7UA 1YC1A 2WI7A 5FNFA 1I5DA 2YK2A 2YEDA 3D36A 4CWSA 4UROA 4O09A 1YSZA 4YKTA 3B28A 3A0ZA 1YT2A 4R1FA 4YKWA 4XC0A 3D2RA 3WHAA 3BMYA 4H85A 3IEDA 1YETA 2XJXA 2WI4A 1Z5AA 3CGZA 4XCJA 3VHDA 2BRCA 1IXMA 3U67A 3A0RA 4LWEA 1ZWHA 1ZW9A 2Q2EB 2YEHA 2YKCA 4V25A 2XCMA 5CF0A 2IOPA 2H8MA 2JKIA 4CWPA 4LWHA 3VHAA 5M4MA 4LWGA 2C1IA 2YKBA 3EHJA 2YE6A 4FCRA 2WI2A 4R3MA 4YKUA 2WEQA 4PU9A 3R4NA 4O04A 1AMWA 5D7RA 2YKEA 2Q8GA 2BYIA 4BIUA 1KIJA 5J6AA 4QPJA 5CTWA 3B24A 1I5CA 3HZ1A 3PEHA 1UY6A 2YEFA 4KP4A 4LPBA 4PRVA 4CWQA 2XHRA 4MP2A 5JENA 1JM6A 1L0OA 4XITA 1QYEA 4GQTA 1ZXMA 3B26A 1I59A 2AKPA 1TC0A 3TZ4A 3ZKBA 1US7A 5IDJA 4BQGA 5M4EA 1ZXNA 3BM9A 4H81A 4LP0A 1BKNA 1I58A 2IOQA 1TH8A 3T10A 2YJXA 1UYFA 4MBCA 2IWUA 1YERA 2HHIA 3CGYA 4FMTA 1YS3A 3ZKDA 2XDXA 2EXLA 2ZDYA 3TUHA 2HCHA 4XIQA 4L93A 3H4LA 2QG0A 3HEKA 4CE2A 2WI3A 2UWDA 2YE9A 3OWBA 3CRLA 2WERA 3HYZA 2GQPA 1TC6A 2YE3A 2CCTA 4DUHA 4MP7A 2XHXA 4O05A 1YSRA 4WUBA 4H7QA 2XABA 3EHHA 1Z5BA 3QTFA 2YGEA 5CPHA 3DGEA 3NMQA 4NH8A 1UY7A 4HYMA 1AJ6A 2O1VA 2YKIA 1U2OA 3U2KA 4JAVA 4E00A 3GIFA 2XX2A 1GKXA 3WQ9A 1F51A 1YC4A 3HZ5A 3R91A 3TZ0A 4LWFA 2IWSA 4Q20A 5F3KA 1OSFA 4O0BA 2XJJA 3K60A 4ZVIA 4WUDA 3OPDA 2CG9A 4AWPA 4KQVA 4GCZA 2XDSA 3K98A 2Q8FA 4L90A 1UYGA 4EFTA 3G7EA 3QDDA 1UYCA 4GT8A 3C11A 3Q5LA 1UYDA
chains in the Genus database with same CATH topology
4FCQA 1B62A 3CRKA 3ZXOA 4ASFA 4MB9A 5F5RA 4XTJA 4EGIA 3RLPA 4HXZA 4XIPA 4KFGA 4BQJA 4URNA 2YEAA 3SL2A 1UY8A 4I3HA 4JASA 4L91A 4MPNA 1Z59A 4HXWA 4KTNA 3ZM7A 1BXDA 4CE3A 4HYPA 3EKOA 5M4HA 4DZYA 4EMVA 4CWRA 4NH9A 2BREA 5J71A 1PVGA 2XX4A 4L8ZA 1AM1A 1NHHA 5IN9A 2O1WA 4MOTA 2O1UA 4ZKIA 3R4OA 4YKQA 2BU7A 3RLRA 4AWOA 4BAEA 5GGZA 1THNA 2WI1A 4XD8A 2Q8IA 1TILA 3B25A 2ZBKB 3OMUA 1Y4UA 2FYPA 2YEBA 4PL9A 2E0AA 4EFUA 3R4PA 5FNDA 4QPKA 3EKRA 4XKKA 3O0IA 5CTYA 3G7BA 3TZ2A 1UY9A 2YKJA 5L3JA 4WUCA 3T0ZA 4GEEA 2XJGA 3Q5KA 2XDUA 5D6QA 3FT5A 1UYEA 4MPEA 1KZNA 3G75A 2FWZA 4FPPA 3KE6A 1UYLA 1MX0A 1YT0A 2XK2A 2BU2A 2YJWA 3VADA 4YKYA 5CTUA 2YI6A 3GIEA 3PEJA 2H55A 3R92A 1GJVA 1QY8A 4YKZA 5IDMA 1Y8PA 2YE2A 5D7DA 4EGHA 4EEHA 3FT8A 1UYKA 4BXIA 3LNUA 5D7CA 1BYQA 5FWKA 1A4HA 1B3QA 4R3AA 1Y4SA 3VHCA 4CWOA 2YK9A 5BODA 3O2FA 4U93A 3RKZA 4K4OA 2YE5A 2BT0A 2WEPA 2CGFA 2Q8HA 1EA6A 1Z5CA 2YGFA 1ID0A 2YECA 2YE7A 5CTXA 1B63A 2YE4A 2JJCA 4I5SA 2YEIA 2BYHA 1MU5A 3LPSA 4XCLA 4B7PA 3EHGA 3ZXQA 2VCJA 2YGAA 1YESA 2QFOA 2XX5A 4NH7A 2YEGA 1AH8A 1UYMA 4W7TA 5M4NA 3B27A 3RLQA 4AWQA 2QF6A 4X9LA 2C2AA 4CWTA 1GKZA 4L94A 4URLA 4ASAA 4HY6A 4U7NA 3HYYA 2HKJA 2IWXA 3R4MA 2CCUA 3FV5A 3GIGB 1AH6A 3A0WA 4ASGA 3T0HA 1BGQA 4GGLA 2VW5A 5FNCA 2ESAA 3T2SA 5M4PA 3EHFA 1S14A 2YEEA 3A0XA 4GFNA 2BTZA 4HZ5A 2PNRA 1NHJA 2BU8A 4FCPA 2YEJA 4XKOA 3MNRP 1Y8NA 1UYHA 4EGKA 3OW6A 4EM7A 1I5AA 3A0YA 4CWFA 4U7OA 4E02A 3A0TA 3K97A 3TTZA 1UYIA 2K5BA 4JQLA 4XKAA 3D0BA 4KSGA 1YC3A 2BSMA 5BOCA 1NHIA 2ZKJA 4URMA 3H80A 1TIDA 3GIGA 5D6PA 5M4KA 1YT1A 4YKXA 3C0EA 4XDMA 2FXSA 3U2DA 4BIZA 4P7AA 2XD6A 3TZ5A 4JAUA 1QZRA 2CCSA 4LWIA 2HG1A 1I5BA 1Y8OA 1TBWA 3JZ3A 3Q5JA 4KSHA 4E01A 4XIRA 4B6CA 2XDKA 4HZ0A 2IORA 1S16A 2BU5A 4V26A 4YKRA 4P8OA 4AS9A 2CH4A 4PRXA 3OWDA 4ASBA 3INWA 3T1KA 2YE8A 2XHTA 2BU6A 2YI5A 2VWCA 2YI7A 2GFDA 4HY1A 2ZDXA 2XDLA 4XE2A 3INXA 4O07A 3HHUA 5C93A 4CE1A 2BZ5A 4MPCA 1EI1A 3K99A 1R62A 1H7SA 1U0ZA 2YI0A 2WI6A 2QG2A 2VCIA 2WI5A 4CWNA 3CWVA 2FWYA 3O6OA 1H7UA 1YC1A 2WI7A 5FNFA 1I5DA 2YK2A 2YEDA 3D36A 4CWSA 4UROA 4O09A 1YSZA 4YKTA 3B28A 3A0ZA 1YT2A 4R1FA 4YKWA 4XC0A 3D2RA 3WHAA 3BMYA 4H85A 3IEDA 1YETA 2XJXA 2WI4A 1Z5AA 3CGZA 4XCJA 3VHDA 2BRCA 3U67A 3A0RA 4LWEA 1ZWHA 1ZW9A 2Q2EB 2YEHA 2YKCA 4V25A 2XCMA 5CF0A 2IOPA 2H8MA 2JKIA 4CWPA 4LWHA 3VHAA 5M4MA 4LWGA 2YKBA 3EHJA 2YE6A 4FCRA 2WI2A 4R3MA 4YKUA 2WEQA 4PU9A 3R4NA 4O04A 1AMWA 5D7RA 2YKEA 2Q8GA 2BYIA 4BIUA 1KIJA 5J6AA 4QPJA 5CTWA 3B24A 1I5CA 3HZ1A 3PEHA 1UY6A 2YEFA 4KP4A 4LPBA 4PRVA 4CWQA 2XHRA 4MP2A 1JM6A 1L0OA 4XITA 1QYEA 4GQTA 1ZXMA 3B26A 1I59A 2AKPA 1TC0A 3TZ4A 3ZKBA 1US7A 5IDJA 4BQGA 5M4EA 1ZXNA 3BM9A 4H81A 4LP0A 1BKNA 1I58A 2IOQA 1TH8A 3T10A 2YJXA 1UYFA 4MBCA 2IWUA 1YERA 3CGYA 4FMTA 1YS3A 3ZKDA 2XDXA 2EXLA 2ZDYA 3TUHA 2HCHA 4XIQA 4L93A 3H4LA 2QG0A 3HEKA 4CE2A 2WI3A 2UWDA 2YE9A 3OWBA 3CRLA 2WERA 3HYZA 2GQPA 1TC6A 2YE3A 2CCTA 4DUHA 4MP7A 2XHXA 4O05A 1YSRA 4WUBA 4H7QA 2XABA 3EHHA 1Z5BA 3QTFA 2YGEA 5CPHA 3DGEA 3NMQA 4NH8A 1UY7A 4HYMA 1AJ6A 2O1VA 2YKIA 1U2OA 3U2KA 4JAVA 4E00A 3GIFA 2XX2A 1GKXA 3WQ9A 1YC4A 3HZ5A 3R91A 3TZ0A 4LWFA 2IWSA 4Q20A 5F3KA 1OSFA 4O0BA 2XJJA 3K60A 4ZVIA 4WUDA 3OPDA 2CG9A 4AWPA 4KQVA 4GCZA 2XDSA 3K98A 2Q8FA 4L90A 1UYGA 4EFTA 3G7EA 3QDDA 1UYCA 4GT8A 3C11A 3Q5LA 1UYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCQ A;  1B62 A;  3CRK A;  3ZXO A;  4ASF A;  4MB9 A;  5F5R A;  4XTJ A;  4EGI A;  3RLP A;  4HXZ A;  4XIP A;  4KFG A;  4BQJ A;  4URN A;  2YEA A;  3SL2 A;  1UY8 A;  4I3H A;  4JAS A;  4L91 A;  4MPN A;  1Z59 A;  4HXW A;  4KTN A;  3ZM7 A;  1BXD A;  4CE3 A;  4HYP A;  3EKO A;  5M4H A;  4DZY A;  4EMV A;  4CWR A;  4NH9 A;  2BRE A;  5J71 A;  1PVG A;  2XX4 A;  4L8Z A;  1AM1 A;  1NHH A;  5IN9 A;  2O1W A;  4MOT A;  2O1U A;  4ZKI A;  3R4O A;  4YKQ A;  2BU7 A;  3RLR A;  4AWO A;  4BAE A;  5GGZ A;  1THN A;  2WI1 A;  4XD8 A;  2Q8I A;  1TIL A;  3B25 A;  2ZBK B;  3OMU A;  1Y4U A;  2FYP A;  2YEB A;  4PL9 A;  2E0A A;  4EFU A;  3R4P A;  5FND A;  4QPK A;  3EKR A;  4XKK A;  3O0I A;  5CTY A;  3G7B A;  3TZ2 A;  1UY9 A;  2YKJ A;  5L3J A;  4WUC A;  3T0Z A;  4GEE A;  2XJG A;  3Q5K A;  2XDU A;  5D6Q A;  3FT5 A;  1UYE A;  4MPE A;  1KZN A;  3G75 A;  2FWZ A;  4FPP A;  3KE6 A;  1UYL A;  1MX0 A;  1YT0 A;  2XK2 A;  2BU2 A;  2YJW A;  3VAD A;  4YKY A;  5CTU A;  2YI6 A;  3GIE A;  3PEJ A;  2H55 A;  3R92 A;  1GJV A;  1QY8 A;  4YKZ A;  5IDM A;  1Y8P A;  2YE2 A;  5D7D A;  4EGH A;  4EEH A;  3FT8 A;  1UYK A;  4BXI A;  3LNU A;  5D7C A;  1BYQ A;  5FWK A;  1A4H A;  1B3Q A;  4R3A A;  1Y4S A;  3VHC A;  4CWO A;  2YK9 A;  5BOD A;  3O2F A;  4U93 A;  3RKZ A;  4K4O A;  2YE5 A;  2BT0 A;  2WEP A;  2CGF A;  2Q8H A;  1EA6 A;  1Z5C A;  2YGF A;  1ID0 A;  2YEC A;  2YE7 A;  5CTX A;  1B63 A;  2YE4 A;  2JJC A;  4I5S A;  2YEI A;  2BYH A;  1MU5 A;  3LPS A;  4XCL A;  4B7P A;  3EHG A;  3ZXQ A;  2VCJ A;  2YGA A;  1YES A;  2QFO A;  2XX5 A;  4NH7 A;  2YEG A;  1AH8 A;  1UYM A;  4W7T A;  5M4N A;  3B27 A;  3RLQ A;  4AWQ A;  2QF6 A;  4X9L A;  2C2A A;  4CWT A;  1GKZ A;  4L94 A;  4URL A;  4ASA A;  4HY6 A;  4U7N A;  3HYY A;  2HKJ A;  2IWX A;  3R4M A;  2CCU A;  3FV5 A;  3GIG B;  1AH6 A;  3A0W A;  4ASG A;  3T0H A;  1BGQ A;  4GGL A;  2VW5 A;  5FNC A;  2ESA A;  3T2S A;  5M4P A;  3EHF A;  1S14 A;  2YEE A;  3A0X A;  4GFN A;  2BTZ A;  4HZ5 A;  2PNR A;  1NHJ A;  2BU8 A;  4FCP A;  2YEJ A;  4XKO A;  3MNR P;  1Y8N A;  1UYH A;  4EGK A;  3OW6 A;  4EM7 A;  1I5A A;  3A0Y A;  4CWF A;  4U7O A;  4E02 A;  3A0T A;  3K97 A;  3TTZ A;  1UYI A;  2K5B A;  4JQL A;  4XKA A;  3D0B A;  4KSG A;  1YC3 A;  2BSM A;  5BOC A;  1NHI A;  2ZKJ A;  4URM A;  3H80 A;  1TID A;  3GIG A;  5D6P A;  5M4K A;  1YT1 A;  4YKX A;  3C0E A;  4XDM A;  2FXS A;  3U2D A;  4BIZ A;  4P7A A;  2XD6 A;  3TZ5 A;  4JAU A;  1QZR A;  2CCS A;  4LWI A;  2HG1 A;  1I5B A;  1Y8O A;  1TBW A;  3JZ3 A;  3Q5J A;  4KSH A;  4E01 A;  4XIR A;  4B6C A;  2XDK A;  4HZ0 A;  2IOR A;  1S16 A;  2BU5 A;  4V26 A;  4YKR A;  4P8O A;  4AS9 A;  2CH4 A;  4PRX A;  3OWD A;  4ASB A;  3INW A;  3T1K A;  2YE8 A;  2XHT A;  2BU6 A;  2YI5 A;  2VWC A;  2YI7 A;  2GFD A;  4HY1 A;  2ZDX A;  2XDL A;  4XE2 A;  3INX A;  4O07 A;  3HHU A;  5C93 A;  4CE1 A;  2BZ5 A;  4MPC A;  1EI1 A;  3K99 A;  1R62 A;  1H7S A;  1U0Z A;  2YI0 A;  2WI6 A;  2QG2 A;  2VCI A;  2WI5 A;  4CWN A;  3CWV A;  2FWY A;  3O6O A;  1H7U A;  1YC1 A;  2WI7 A;  5FNF A;  1I5D A;  2YK2 A;  2YED A;  3D36 A;  4CWS A;  4URO A;  4O09 A;  1YSZ A;  4YKT A;  3B28 A;  3A0Z A;  1YT2 A;  4R1F A;  4YKW A;  4XC0 A;  3D2R A;  3WHA A;  3BMY A;  4H85 A;  3IED A;  1YET A;  2XJX A;  2WI4 A;  1Z5A A;  3CGZ A;  4XCJ A;  3VHD A;  2BRC A;  3U67 A;  3A0R A;  4LWE A;  1ZWH A;  1ZW9 A;  2Q2E B;  2YEH A;  2YKC A;  4V25 A;  2XCM A;  5CF0 A;  2IOP A;  2H8M A;  2JKI A;  4CWP A;  4LWH A;  3VHA A;  5M4M A;  4LWG A;  2YKB A;  3EHJ A;  2YE6 A;  4FCR A;  2WI2 A;  4R3M A;  4YKU A;  2WEQ A;  4PU9 A;  3R4N A;  4O04 A;  1AMW A;  5D7R A;  2YKE A;  2Q8G A;  2BYI A;  4BIU A;  1KIJ A;  5J6A A;  4QPJ A;  5CTW A;  3B24 A;  1I5C A;  3HZ1 A;  3PEH A;  1UY6 A;  2YEF A;  4KP4 A;  4LPB A;  4PRV A;  4CWQ A;  2XHR A;  4MP2 A;  1JM6 A;  1L0O A;  4XIT A;  1QYE A;  4GQT A;  1ZXM A;  3B26 A;  1I59 A;  2AKP A;  1TC0 A;  3TZ4 A;  3ZKB A;  1US7 A;  5IDJ A;  4BQG A;  5M4E A;  1ZXN A;  3BM9 A;  4H81 A;  4LP0 A;  1BKN A;  1I58 A;  2IOQ A;  1TH8 A;  3T10 A;  2YJX A;  1UYF A;  4MBC A;  2IWU A;  1YER A;  3CGY A;  4FMT A;  1YS3 A;  3ZKD A;  2XDX A;  2EXL A;  2ZDY A;  3TUH A;  2HCH A;  4XIQ A;  4L93 A;  3H4L A;  2QG0 A;  3HEK A;  4CE2 A;  2WI3 A;  2UWD A;  2YE9 A;  3OWB A;  3CRL A;  2WER A;  3HYZ A;  2GQP A;  1TC6 A;  2YE3 A;  2CCT A;  4DUH A;  4MP7 A;  2XHX A;  4O05 A;  1YSR A;  4WUB A;  4H7Q A;  2XAB A;  3EHH A;  1Z5B A;  3QTF A;  2YGE A;  5CPH A;  3DGE A;  3NMQ A;  4NH8 A;  1UY7 A;  4HYM A;  1AJ6 A;  2O1V A;  2YKI A;  1U2O A;  3U2K A;  4JAV A;  4E00 A;  3GIF A;  2XX2 A;  1GKX A;  3WQ9 A;  1YC4 A;  3HZ5 A;  3R91 A;  3TZ0 A;  4LWF A;  2IWS A;  4Q20 A;  5F3K A;  1OSF A;  4O0B A;  2XJJ A;  3K60 A;  4ZVI A;  4WUD A;  3OPD A;  2CG9 A;  4AWP A;  4KQV A;  4GCZ A;  2XDS A;  3K98 A;  2Q8F A;  4L90 A;  1UYG A;  4EFT A;  3G7E A;  3QDD A;  1UYC A;  4GT8 A;  3C11 A;  3Q5L A;  1UYD A; 
#chains in the Genus database with same CATH topology
 4FCQ A;  1B62 A;  3CRK A;  3ZXO A;  4ASF A;  4MB9 A;  5F5R A;  4XTJ A;  4EGI A;  3RLP A;  4HXZ A;  4XIP A;  3S5T A;  4KFG A;  4BQJ A;  4URN A;  2YEA A;  3SL2 A;  1UY8 A;  4I3H A;  4JAS A;  4L91 A;  4MPN A;  1Z59 A;  4HXW A;  4KTN A;  3ZM7 A;  1BXD A;  4CE3 A;  4HYP A;  3EKO A;  5M4H A;  4DZY A;  4EMV A;  4CWR A;  4NH9 A;  2BRE A;  5J71 A;  1PVG A;  2XX4 A;  4L8Z A;  1AM1 A;  1NHH A;  5IN9 A;  2O1W A;  4MOT A;  3LMM A;  2O1U A;  4ZKI A;  3R4O A;  4YKQ A;  2BU7 A;  3RLR A;  4AWO A;  4BAE A;  5GGZ A;  1THN A;  2WI1 A;  4XD8 A;  2Q8I A;  1TIL A;  3B25 A;  2ZBK B;  3OMU A;  1Y4U A;  2FYP A;  2YEB A;  4PL9 A;  2E0A A;  4EFU A;  3R4P A;  5FND A;  4QPK A;  3EKR A;  4XKK A;  3O0I A;  5CTY A;  3G7B A;  3TZ2 A;  1UY9 A;  2YKJ A;  4E72 A;  5L3J A;  4WUC A;  3T0Z A;  4GEE A;  2XJG A;  3Q5K A;  2XDU A;  5D6Q A;  3FT5 A;  1UYE A;  4MPE A;  1KZN A;  3G75 A;  2FWZ A;  4FPP A;  3KE6 A;  1UYL A;  1MX0 A;  1YT0 A;  2XK2 A;  2BU2 A;  2YJW A;  3VAD A;  4YKY A;  5CTU A;  2YI6 A;  3GIE A;  3PEJ A;  2H55 A;  3R92 A;  1GJV A;  1QY8 A;  4YKZ A;  5IDM A;  1Y8P A;  2YE2 A;  5D7D A;  4EGH A;  4EEH A;  3FT8 A;  1UYK A;  4BXI A;  3LNU A;  5D7C A;  1BYQ A;  5FWK A;  1A4H A;  1B3Q A;  4R3A A;  1Y4S A;  3CYG A;  3VHC A;  4CWO A;  2YK9 A;  5BOD A;  3O2F A;  4U93 A;  3RKZ A;  4K4O A;  2YE5 A;  2BT0 A;  2WEP A;  2CGF A;  2Q8H A;  1EA6 A;  1Z5C A;  2YGF A;  1ID0 A;  2YEC A;  2YE7 A;  5CTX A;  1B63 A;  2YE4 A;  2JJC A;  4I5S A;  2YEI A;  2BYH A;  1MU5 A;  3LPS A;  4XCL A;  4B7P A;  3EHG A;  3ZXQ A;  2VCJ A;  2YGA A;  1YES A;  2QFO A;  2XX5 A;  4NH7 A;  2YEG A;  1AH8 A;  1UYM A;  4W7T A;  5M4N A;  3B27 A;  3RLQ A;  4AWQ A;  2QF6 A;  4X9L A;  2C2A A;  4CWT A;  1GKZ A;  4L94 A;  4URL A;  4ASA A;  4HY6 A;  4U7N A;  3HYY A;  2HKJ A;  2IWX A;  3R4M A;  2CCU A;  3FV5 A;  3GIG B;  1AH6 A;  3A0W A;  4ASG A;  3T0H A;  1BGQ A;  4GGL A;  2VW5 A;  5FNC A;  2ESA A;  3T2S A;  5M4P A;  3EHF A;  1S14 A;  2YEE A;  3A0X A;  4GFN A;  2BTZ A;  4HZ5 A;  2PNR A;  1NHJ A;  2BU8 A;  4FCP A;  2YEJ A;  4XKO A;  3MNR P;  1Y8N A;  1UYH A;  4EGK A;  3OW6 A;  4EM7 A;  1I5A A;  3A0Y A;  4CWF A;  4U7O A;  4E02 A;  3A0T A;  3K97 A;  3TTZ A;  1UYI A;  2K5B A;  4JQL A;  4XKA A;  3D0B A;  4KSG A;  1YC3 A;  2BSM A;  5BOC A;  1NHI A;  2ZKJ A;  2FTK A;  4URM A;  3H80 A;  1TID A;  3GIG A;  5D6P A;  5M4K A;  1YT1 A;  4YKX A;  3C0E A;  4XDM A;  2FXS A;  3U2D A;  4BIZ A;  4P7A A;  2XD6 A;  3TZ5 A;  4JAU A;  1QZR A;  2CCS A;  4LWI A;  2HG1 A;  1I5B A;  1Y8O A;  1TBW A;  3JZ3 A;  3Q5J A;  4KSH A;  4E01 A;  4XIR A;  4B6C A;  2XDK A;  4HZ0 A;  2IOR A;  1S16 A;  2BU5 A;  4V26 A;  4YKR A;  4P8O A;  4AS9 A;  2CH4 A;  4PRX A;  3OWD A;  4ASB A;  3INW A;  3T1K A;  2YE8 A;  2XHT A;  2BU6 A;  2YI5 A;  2VWC A;  2YI7 A;  2GFD A;  4HY1 A;  2ZDX A;  2XDL A;  4XE2 A;  3INX A;  4O07 A;  3HHU A;  5C93 A;  4CE1 A;  2BZ5 A;  4MPC A;  1EI1 A;  3K99 A;  2C1G A;  1R62 A;  1H7S A;  1U0Z A;  2YI0 A;  2WI6 A;  2QG2 A;  2VCI A;  2WI5 A;  4CWN A;  3CWV A;  2FWY A;  3O6O A;  1H7U A;  1YC1 A;  2WI7 A;  5FNF A;  1I5D A;  2YK2 A;  2YED A;  3D36 A;  4CWS A;  4URO A;  4O09 A;  1YSZ A;  4YKT A;  3B28 A;  3A0Z A;  1YT2 A;  4R1F A;  4YKW A;  4XC0 A;  3D2R A;  3WHA A;  3BMY A;  4H85 A;  3IED A;  1YET A;  2XJX A;  2WI4 A;  1Z5A A;  3CGZ A;  4XCJ A;  3VHD A;  2BRC A;  1IXM A;  3U67 A;  3A0R A;  4LWE A;  1ZWH A;  1ZW9 A;  2Q2E B;  2YEH A;  2YKC A;  4V25 A;  2XCM A;  5CF0 A;  2IOP A;  2H8M A;  2JKI A;  4CWP A;  4LWH A;  3VHA A;  5M4M A;  4LWG A;  2C1I A;  2YKB A;  3EHJ A;  2YE6 A;  4FCR A;  2WI2 A;  4R3M A;  4YKU A;  2WEQ A;  4PU9 A;  3R4N A;  4O04 A;  1AMW A;  5D7R A;  2YKE A;  2Q8G A;  2BYI A;  4BIU A;  1KIJ A;  5J6A A;  4QPJ A;  5CTW A;  3B24 A;  1I5C A;  3HZ1 A;  3PEH A;  1UY6 A;  2YEF A;  4KP4 A;  4LPB A;  4PRV A;  4CWQ A;  2XHR A;  4MP2 A;  5JEN A;  1JM6 A;  1L0O A;  4XIT A;  1QYE A;  4GQT A;  1ZXM A;  3B26 A;  1I59 A;  2AKP A;  1TC0 A;  3TZ4 A;  3ZKB A;  1US7 A;  5IDJ A;  4BQG A;  5M4E A;  1ZXN A;  3BM9 A;  4H81 A;  4LP0 A;  1BKN A;  1I58 A;  2IOQ A;  1TH8 A;  3T10 A;  2YJX A;  1UYF A;  4MBC A;  2IWU A;  1YER A;  2HHI A;  3CGY A;  4FMT A;  1YS3 A;  3ZKD A;  2XDX A;  2EXL A;  2ZDY A;  3TUH A;  2HCH A;  4XIQ A;  4L93 A;  3H4L A;  2QG0 A;  3HEK A;  4CE2 A;  2WI3 A;  2UWD A;  2YE9 A;  3OWB A;  3CRL A;  2WER A;  3HYZ A;  2GQP A;  1TC6 A;  2YE3 A;  2CCT A;  4DUH A;  4MP7 A;  2XHX A;  4O05 A;  1YSR A;  4WUB A;  4H7Q A;  2XAB A;  3EHH A;  1Z5B A;  3QTF A;  2YGE A;  5CPH A;  3DGE A;  3NMQ A;  4NH8 A;  1UY7 A;  4HYM A;  1AJ6 A;  2O1V A;  2YKI A;  1U2O A;  3U2K A;  4JAV A;  4E00 A;  3GIF A;  2XX2 A;  1GKX A;  3WQ9 A;  1F51 A;  1YC4 A;  3HZ5 A;  3R91 A;  3TZ0 A;  4LWF A;  2IWS A;  4Q20 A;  5F3K A;  1OSF A;  4O0B A;  2XJJ A;  3K60 A;  4ZVI A;  4WUD A;  3OPD A;  2CG9 A;  4AWP A;  4KQV A;  4GCZ A;  2XDS A;  3K98 A;  2Q8F A;  4L90 A;  1UYG A;  4EFT A;  3G7E A;  3QDD A;  1UYC A;  4GT8 A;  3C11 A;  3Q5L A;  1UYD A; 
#chains in the Genus database with same CATH homology
 4FCQ A;  1B62 A;  3CRK A;  3ZXO A;  4ASF A;  4MB9 A;  5F5R A;  4XTJ A;  4EGI A;  3RLP A;  4HXZ A;  4XIP A;  4KFG A;  4BQJ A;  4URN A;  2YEA A;  3SL2 A;  1UY8 A;  4I3H A;  4JAS A;  4L91 A;  4MPN A;  1Z59 A;  4HXW A;  4KTN A;  3ZM7 A;  1BXD A;  4CE3 A;  4HYP A;  3EKO A;  5M4H A;  4DZY A;  4EMV A;  4CWR A;  4NH9 A;  2BRE A;  5J71 A;  1PVG A;  2XX4 A;  4L8Z A;  1AM1 A;  1NHH A;  5IN9 A;  2O1W A;  4MOT A;  2O1U A;  4ZKI A;  3R4O A;  4YKQ A;  2BU7 A;  3RLR A;  4AWO A;  4BAE A;  5GGZ A;  1THN A;  2WI1 A;  4XD8 A;  2Q8I A;  1TIL A;  3B25 A;  2ZBK B;  3OMU A;  1Y4U A;  2FYP A;  2YEB A;  4PL9 A;  2E0A A;  4EFU A;  3R4P A;  5FND A;  4QPK A;  3EKR A;  4XKK A;  3O0I A;  5CTY A;  3G7B A;  3TZ2 A;  1UY9 A;  2YKJ A;  5L3J A;  4WUC A;  3T0Z A;  4GEE A;  2XJG A;  3Q5K A;  2XDU A;  5D6Q A;  3FT5 A;  1UYE A;  4MPE A;  1KZN A;  3G75 A;  2FWZ A;  4FPP A;  3KE6 A;  1UYL A;  1MX0 A;  1YT0 A;  2XK2 A;  2BU2 A;  2YJW A;  3VAD A;  4YKY A;  5CTU A;  2YI6 A;  3GIE A;  3PEJ A;  2H55 A;  3R92 A;  1GJV A;  1QY8 A;  4YKZ A;  5IDM A;  1Y8P A;  2YE2 A;  5D7D A;  4EGH A;  4EEH A;  3FT8 A;  1UYK A;  4BXI A;  3LNU A;  5D7C A;  1BYQ A;  5FWK A;  1A4H A;  1B3Q A;  4R3A A;  1Y4S A;  3VHC A;  4CWO A;  2YK9 A;  5BOD A;  3O2F A;  4U93 A;  3RKZ A;  4K4O A;  2YE5 A;  2BT0 A;  2WEP A;  2CGF A;  2Q8H A;  1EA6 A;  1Z5C A;  2YGF A;  1ID0 A;  2YEC A;  2YE7 A;  5CTX A;  1B63 A;  2YE4 A;  2JJC A;  4I5S A;  2YEI A;  2BYH A;  1MU5 A;  3LPS A;  4XCL A;  4B7P A;  3EHG A;  3ZXQ A;  2VCJ A;  2YGA A;  1YES A;  2QFO A;  2XX5 A;  4NH7 A;  2YEG A;  1AH8 A;  1UYM A;  4W7T A;  5M4N A;  3B27 A;  3RLQ A;  4AWQ A;  2QF6 A;  4X9L A;  2C2A A;  4CWT A;  1GKZ A;  4L94 A;  4URL A;  4ASA A;  4HY6 A;  4U7N A;  3HYY A;  2HKJ A;  2IWX A;  3R4M A;  2CCU A;  3FV5 A;  3GIG B;  1AH6 A;  3A0W A;  4ASG A;  3T0H A;  1BGQ A;  4GGL A;  2VW5 A;  5FNC A;  2ESA A;  3T2S A;  5M4P A;  3EHF A;  1S14 A;  2YEE A;  3A0X A;  4GFN A;  2BTZ A;  4HZ5 A;  2PNR A;  1NHJ A;  2BU8 A;  4FCP A;  2YEJ A;  4XKO A;  3MNR P;  1Y8N A;  1UYH A;  4EGK A;  3OW6 A;  4EM7 A;  1I5A A;  3A0Y A;  4CWF A;  4U7O A;  4E02 A;  3A0T A;  3K97 A;  3TTZ A;  1UYI A;  2K5B A;  4JQL A;  4XKA A;  3D0B A;  4KSG A;  1YC3 A;  2BSM A;  5BOC A;  1NHI A;  2ZKJ A;  4URM A;  3H80 A;  1TID A;  3GIG A;  5D6P A;  5M4K A;  1YT1 A;  4YKX A;  3C0E A;  4XDM A;  2FXS A;  3U2D A;  4BIZ A;  4P7A A;  2XD6 A;  3TZ5 A;  4JAU A;  1QZR A;  2CCS A;  4LWI A;  2HG1 A;  1I5B A;  1Y8O A;  1TBW A;  3JZ3 A;  3Q5J A;  4KSH A;  4E01 A;  4XIR A;  4B6C A;  2XDK A;  4HZ0 A;  2IOR A;  1S16 A;  2BU5 A;  4V26 A;  4YKR A;  4P8O A;  4AS9 A;  2CH4 A;  4PRX A;  3OWD A;  4ASB A;  3INW A;  3T1K A;  2YE8 A;  2XHT A;  2BU6 A;  2YI5 A;  2VWC A;  2YI7 A;  2GFD A;  4HY1 A;  2ZDX A;  2XDL A;  4XE2 A;  3INX A;  4O07 A;  3HHU A;  5C93 A;  4CE1 A;  2BZ5 A;  4MPC A;  1EI1 A;  3K99 A;  1R62 A;  1H7S A;  1U0Z A;  2YI0 A;  2WI6 A;  2QG2 A;  2VCI A;  2WI5 A;  4CWN A;  3CWV A;  2FWY A;  3O6O A;  1H7U A;  1YC1 A;  2WI7 A;  5FNF A;  1I5D A;  2YK2 A;  2YED A;  3D36 A;  4CWS A;  4URO A;  4O09 A;  1YSZ A;  4YKT A;  3B28 A;  3A0Z A;  1YT2 A;  4R1F A;  4YKW A;  4XC0 A;  3D2R A;  3WHA A;  3BMY A;  4H85 A;  3IED A;  1YET A;  2XJX A;  2WI4 A;  1Z5A A;  3CGZ A;  4XCJ A;  3VHD A;  2BRC A;  3U67 A;  3A0R A;  4LWE A;  1ZWH A;  1ZW9 A;  2Q2E B;  2YEH A;  2YKC A;  4V25 A;  2XCM A;  5CF0 A;  2IOP A;  2H8M A;  2JKI A;  4CWP A;  4LWH A;  3VHA A;  5M4M A;  4LWG A;  2YKB A;  3EHJ A;  2YE6 A;  4FCR A;  2WI2 A;  4R3M A;  4YKU A;  2WEQ A;  4PU9 A;  3R4N A;  4O04 A;  1AMW A;  5D7R A;  2YKE A;  2Q8G A;  2BYI A;  4BIU A;  1KIJ A;  5J6A A;  4QPJ A;  5CTW A;  3B24 A;  1I5C A;  3HZ1 A;  3PEH A;  1UY6 A;  2YEF A;  4KP4 A;  4LPB A;  4PRV A;  4CWQ A;  2XHR A;  4MP2 A;  1JM6 A;  1L0O A;  4XIT A;  1QYE A;  4GQT A;  1ZXM A;  3B26 A;  1I59 A;  2AKP A;  1TC0 A;  3TZ4 A;  3ZKB A;  1US7 A;  5IDJ A;  4BQG A;  5M4E A;  1ZXN A;  3BM9 A;  4H81 A;  4LP0 A;  1BKN A;  1I58 A;  2IOQ A;  1TH8 A;  3T10 A;  2YJX A;  1UYF A;  4MBC A;  2IWU A;  1YER A;  3CGY A;  4FMT A;  1YS3 A;  3ZKD A;  2XDX A;  2EXL A;  2ZDY A;  3TUH A;  2HCH A;  4XIQ A;  4L93 A;  3H4L A;  2QG0 A;  3HEK A;  4CE2 A;  2WI3 A;  2UWD A;  2YE9 A;  3OWB A;  3CRL A;  2WER A;  3HYZ A;  2GQP A;  1TC6 A;  2YE3 A;  2CCT A;  4DUH A;  4MP7 A;  2XHX A;  4O05 A;  1YSR A;  4WUB A;  4H7Q A;  2XAB A;  3EHH A;  1Z5B A;  3QTF A;  2YGE A;  5CPH A;  3DGE A;  3NMQ A;  4NH8 A;  1UY7 A;  4HYM A;  1AJ6 A;  2O1V A;  2YKI A;  1U2O A;  3U2K A;  4JAV A;  4E00 A;  3GIF A;  2XX2 A;  1GKX A;  3WQ9 A;  1YC4 A;  3HZ5 A;  3R91 A;  3TZ0 A;  4LWF A;  2IWS A;  4Q20 A;  5F3K A;  1OSF A;  4O0B A;  2XJJ A;  3K60 A;  4ZVI A;  4WUD A;  3OPD A;  2CG9 A;  4AWP A;  4KQV A;  4GCZ A;  2XDS A;  3K98 A;  2Q8F A;  4L90 A;  1UYG A;  4EFT A;  3G7E A;  3QDD A;  1UYC A;  4GT8 A;  3C11 A;  3Q5L A;  1UYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...