3A0ZA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0zA00
2BSMA 2YJWA 4O07A 4Q20A 1YERA 3IEDA 3LNUA 1Z5BA 1UYHA 1QYEA 4ASBA 3CRKA 4V26A 5M4EA 4XKOA 1UY8A 1TIDA 1ZWHA 2IWSA 2XX2A 1TC6A 3VHAA 5IN9A 3INWA 3OMUA 2YEDA 4MB9A 4U7NA 4XIQA 1MX0A 1BYQA 3HZ5A 4I3HA 2C2AA 3A0YA 4EEHA 2YKJA 1YC4A 5CTXA 4L91A 5D6PA 4BXIA 4XCJA 5L3JA 2E0AA 3OW6A 3WHAA 1Y8PA 2YEHA 3HHUA 4CWQA 4X9LA 4ASGA 1Z59A 1AJ6A 4EFTA 3TZ5A 2YKCA 2YK2A 2IOQA 1TC0A 3RLQA 2HCHA 1Y8OA 1QY8A 1I5DA 3TUHA 1MU5A 2XJXA 4BQJA 5CTUA 2QFOA 5M4PA 3EHJA 2YEBA 3HEKA 2YI0A 3O2FA 2YE3A 2XJGA 3INXA 4ZKIA 3B25A 1YS3A 3GIFA 4YKTA 4DUHA 4P8OA 4BQGA 5FNFA 2PNRA 3HYZA 1S16A 4BIZA 3A0WA 2WI4A 2QF6A 2EXLA 2ZDXA 2Q8FA 2CH4A 4QPKA 2VW5A 1UY7A 3K98A 3K97A 4ASAA 4B6CA 1EA6A 2FWYA 3T0ZA 1AH6A 1AH8A 1B3QA 2BTZA 1NHIA 4LPBA 2JJCA 2UWDA 2XX4A 4FCPA 3T0HA 3HYYA 2YEAA 5F3KA 3EHGA 2XDSA 3TTZA 5M4KA 2YEGA 2O1UA 1YT1A 2ZDYA 2BU5A 2CCSA 3EKRA 3EKOA 4R3MA 1R62A 3G7BA 4CWPA 3U2DA 2YK9A 4XIPA 4XE2A 3OWDA 3GIGA 5IDMA 5D7CA 1Z5AA 3KE6A 2YGFA 2IWXA 2FYPA 2XD6A 4JAUA 5J71A 4XITA 2HG1A 5BODA 2Q8HA 1YT0A 4AS9A 3OPDA 1UYIA 4R1FA 1QZRA 2BU7A 4EGHA 3ZXQA 3FT5A 4B7PA 2BU6A 3Q5LA 3ZXOA 2YE5A 3MNRP 3OWBA 4HY6A 4CE2A 4CWFA 1NHJA 3CGYA 3R4MA 1TH8A 4XDMA 4KTNA 3H80A 4NH7A 2GQPA 4GFNA 3Q5JA 4EMVA 2BU2A 1UYMA 5M4NA 1YETA 4UROA 2XHRA 3CRLA 4NH8A 4XKKA 2IORA 4LWEA 2IOPA 3A0XA 2WI2A 3VHCA 4HYMA 1YT2A 2YGEA 3ZKBA 3A0ZA 3R4NA 5M4HA 4XTJA 1Z5CA 1YC1A 4I5SA 3K99A 2XHXA 4E01A 4WUCA 2VWCA 4PRXA 2BZ5A 3VHDA 3CGZA 4O09A 5CF0A 5F5RA 4YKZA 2XDXA 2O1VA 2XHTA 1YSRA 2WI6A 4XKAA 2XX5A 1I5BA 1UYDA 4O05A 4XC0A 4BAEA 4L94A 4R3AA 3DGEA 4YKUA 3WQ9A 1U2OA 3U2KA 1U0ZA 2CCUA 5D7DA 5GGZA 2ESAA 3HZ1A 1I58A 4CE3A 4MOTA 4LWHA 4CE1A 4L93A 1TILA 4WUDA 2YE6A 2ZKJA 1L0OA 3R4OA 2YKEA 3R92A 4H81A 4JAVA 4YKQA 4EFUA 2K5BA 4HY1A 4E02A 5IDJA 1AMWA 1UYEA 4AWOA 1ZW9A 3GIEA 3B27A 3TZ0A 4O04A 1UYFA 3B24A 1UYGA 2WERA 2CGFA 3D2RA 3T1KA 1I5AA 5CPHA 2YGAA 4URNA 1S14A 2WI5A 2O1WA 2YEJA 2YI6A 4PU9A 1GJVA 1I59A 3SL2A 3ZM7A 2XDLA 1AM1A 4GEEA 3RLPA 2YECA 4PRVA 3O6OA 1BXDA 3G75A 4YKRA 4FPPA 1TBWA 4P7AA 1A4HA 2YEEA 1BKNA 1THNA 2XCMA 4GGLA 4E00A 3RKZA 1YC3A 3D0BA 1I5CA 1PVGA 4ZVIA 4HXZA 2WEPA 3VADA 2CCTA 1UY9A 4GT8A 5C93A 1BGQA 2FWZA 4KSGA 4CWRA 3K60A 1YESA 5J6AA 2XDUA 2BT0A 1GKZA 4KP4A 3TZ2A 4FMTA 2VCJA 5D7RA 2YJXA 4WUBA 4CWSA 3A0RA 3GIGB 4XIRA 3QDDA 3A0TA 2XJJA 2HKJA 2Q8IA 2WEQA 1YSZA 1KIJA 2AKPA 2GFDA 2YEIA 4O0BA 3RLRA 2WI3A 3PEJA 1Y8NA 4FCRA 1ID0A 4ASFA 5FNCA 2WI1A 4KSHA 2XABA 3BM9A 2BU8A 2YKIA 2H55A 1UYLA 4H85A 4EM7A 1H7UA 4K4OA 3B26A 2YEFA 3D36A 4PL9A 2YE4A 4DZYA 1H7SA 4FCQA 5M4MA 4KQVA 1OSFA 5D6QA 3U67A 3NMQA 4CWOA 4GCZA 3ZKDA 4H7QA 1B62A 2YKBA 5FNDA 4NH9A 2YE9A 2QG0A 3C0EA 2YE7A 4URLA 3B28A 2YI5A 2Q2EB 3PEHA 5BOCA 3FV5A 4GQTA 3QTFA 4CWNA 3EHHA 4AWPA 3JZ3A 4HYPA 4BIUA 1ZXMA 1US7A 1B63A 4EGKA 2XK2A 3FT8A 2FXSA 5CTYA 2H8MA 4U93A 4HXWA 1KZNA 4HZ5A 4CWTA 3TZ4A 4JQLA 2XDKA 3R4PA 1Y4SA 1UYKA 2YE8A 1GKXA 2BYIA 3LPSA 2WI7A 4LWFA 3C11A 4JASA 4MPCA 1UYCA 4LWIA 3H4LA 4LWGA 5CTWA 1UY6A 4HZ0A 3T10A 2ZBKB 2BYHA 4XCLA 2IWUA 3G7EA 1EI1A 2Q8GA 1JM6A 3T2SA 2CG9A 3CWVA 3R91A 2JKIA 4URMA 4MP2A 1NHHA 4YKYA 2YE2A 2BREA 3O0IA 4L8ZA 4W7TA 4LP0A 4U7OA 4AWQA 4QPJA 4EGIA 2VCIA 1ZXNA 4YKWA 4V25A 3BMYA 2YI7A 5FWKA 4MBCA 3EHFA 3Q5KA 4YKXA 4MPNA 4MP7A 4XD8A 4MPEA 2BRCA 4KFGA 1Y4UA 4L90A 2QG2A
chains in the Genus database with same CATH superfamily
2BSMA 2YJWA 4O07A 4Q20A 1YERA 3IEDA 3LNUA 1Z5BA 1UYHA 1QYEA 4ASBA 3CRKA 4V26A 5M4EA 4XKOA 1UY8A 1TIDA 1ZWHA 2IWSA 2XX2A 1TC6A 3VHAA 5IN9A 3INWA 3OMUA 2YEDA 4MB9A 3CYGA 4U7NA 4XIQA 1MX0A 1BYQA 3HZ5A 4I3HA 2C2AA 3A0YA 4EEHA 2YKJA 1YC4A 5CTXA 4L91A 5D6PA 4BXIA 4XCJA 5L3JA 2E0AA 3OW6A 3WHAA 2FTKA 1Y8PA 2YEHA 3HHUA 4CWQA 4X9LA 4ASGA 1Z59A 1AJ6A 4EFTA 3TZ5A 2YKCA 2YK2A 2IOQA 1TC0A 3RLQA 2HCHA 3S5TA 1Y8OA 1QY8A 1I5DA 3TUHA 1MU5A 2XJXA 4BQJA 5CTUA 2QFOA 5M4PA 3EHJA 2YEBA 3HEKA 2YI0A 3O2FA 2YE3A 2XJGA 3INXA 4ZKIA 3B25A 1YS3A 3GIFA 4YKTA 4DUHA 4P8OA 4BQGA 5FNFA 2PNRA 3HYZA 1S16A 4BIZA 2C1IA 3A0WA 2WI4A 2QF6A 2EXLA 2ZDXA 2Q8FA 2CH4A 4QPKA 2VW5A 1UY7A 3K98A 3K97A 4ASAA 4B6CA 1EA6A 2FWYA 3T0ZA 1AH6A 1AH8A 1B3QA 2BTZA 1NHIA 4LPBA 2JJCA 2UWDA 2XX4A 4FCPA 3T0HA 3HYYA 2YEAA 5F3KA 3EHGA 2XDSA 3TTZA 5M4KA 2YEGA 2O1UA 1YT1A 2ZDYA 4E72A 2BU5A 2CCSA 3EKRA 3EKOA 4R3MA 1R62A 3G7BA 4CWPA 3U2DA 2YK9A 4XIPA 4XE2A 3OWDA 3GIGA 5IDMA 5D7CA 1Z5AA 3KE6A 2YGFA 2IWXA 2FYPA 2XD6A 4JAUA 5J71A 4XITA 2HG1A 5BODA 2Q8HA 1YT0A 4AS9A 3OPDA 1UYIA 4R1FA 1QZRA 2BU7A 4EGHA 3ZXQA 3FT5A 4B7PA 2BU6A 3Q5LA 3ZXOA 2YE5A 3MNRP 3OWBA 4HY6A 4CE2A 4CWFA 1NHJA 3CGYA 3R4MA 1TH8A 4XDMA 4KTNA 3H80A 4NH7A 2GQPA 4GFNA 3Q5JA 4EMVA 2BU2A 1UYMA 5M4NA 1YETA 4UROA 2XHRA 3CRLA 4NH8A 4XKKA 2IORA 4LWEA 2IOPA 3A0XA 2WI2A 3VHCA 4HYMA 1YT2A 2YGEA 3ZKBA 3A0ZA 5JENA 3R4NA 5M4HA 4XTJA 1Z5CA 1YC1A 4I5SA 3K99A 2XHXA 4E01A 4WUCA 2VWCA 4PRXA 2BZ5A 3VHDA 3CGZA 1F51A 4O09A 2C1GA 5CF0A 5F5RA 4YKZA 2XDXA 2O1VA 2XHTA 1YSRA 2WI6A 4XKAA 2XX5A 1I5BA 1UYDA 4O05A 4XC0A 4BAEA 4L94A 4R3AA 3DGEA 4YKUA 3WQ9A 1U2OA 3U2KA 1U0ZA 2CCUA 5D7DA 5GGZA 2ESAA 3HZ1A 1I58A 4CE3A 4MOTA 4LWHA 4CE1A 4L93A 1TILA 4WUDA 2YE6A 2ZKJA 1L0OA 3R4OA 2YKEA 3R92A 4H81A 4JAVA 4YKQA 4EFUA 2K5BA 4HY1A 4E02A 5IDJA 1AMWA 1UYEA 4AWOA 1ZW9A 3GIEA 3B27A 3TZ0A 4O04A 1UYFA 3B24A 1UYGA 2WERA 2CGFA 3D2RA 3T1KA 1I5AA 5CPHA 2YGAA 4URNA 1S14A 2WI5A 2O1WA 2YEJA 2YI6A 4PU9A 1GJVA 1I59A 3SL2A 3ZM7A 2XDLA 1IXMA 1AM1A 4GEEA 3RLPA 2YECA 4PRVA 3O6OA 1BXDA 3G75A 4YKRA 4FPPA 1TBWA 4P7AA 1A4HA 2YEEA 1BKNA 1THNA 2XCMA 4GGLA 4E00A 3RKZA 1YC3A 3D0BA 1I5CA 1PVGA 4ZVIA 4HXZA 2WEPA 3VADA 2CCTA 1UY9A 4GT8A 5C93A 1BGQA 2FWZA 4KSGA 2HHIA 4CWRA 3K60A 1YESA 5J6AA 2XDUA 2BT0A 1GKZA 4KP4A 3TZ2A 4FMTA 2VCJA 5D7RA 2YJXA 4WUBA 4CWSA 3A0RA 3GIGB 4XIRA 3QDDA 3A0TA 2XJJA 2HKJA 2Q8IA 2WEQA 1YSZA 1KIJA 2AKPA 2GFDA 2YEIA 4O0BA 3RLRA 2WI3A 3PEJA 1Y8NA 4FCRA 1ID0A 4ASFA 5FNCA 2WI1A 4KSHA 2XABA 3BM9A 2BU8A 2YKIA 2H55A 1UYLA 4H85A 4EM7A 1H7UA 4K4OA 3B26A 2YEFA 3D36A 4PL9A 2YE4A 4DZYA 1H7SA 4FCQA 5M4MA 4KQVA 1OSFA 5D6QA 3U67A 3NMQA 4CWOA 4GCZA 3ZKDA 4H7QA 1B62A 2YKBA 5FNDA 4NH9A 2YE9A 2QG0A 3C0EA 2YE7A 4URLA 3B28A 2YI5A 2Q2EB 3PEHA 5BOCA 3FV5A 4GQTA 3QTFA 4CWNA 3EHHA 4AWPA 3JZ3A 4HYPA 4BIUA 1ZXMA 1US7A 1B63A 4EGKA 2XK2A 3FT8A 2FXSA 5CTYA 2H8MA 4U93A 4HXWA 1KZNA 4HZ5A 4CWTA 3TZ4A 4JQLA 2XDKA 3R4PA 1Y4SA 1UYKA 2YE8A 1GKXA 2BYIA 3LPSA 2WI7A 4LWFA 3C11A 4JASA 4MPCA 1UYCA 4LWIA 3H4LA 4LWGA 3LMMA 5CTWA 1UY6A 4HZ0A 3T10A 2ZBKB 2BYHA 4XCLA 2IWUA 3G7EA 1EI1A 2Q8GA 1JM6A 3T2SA 2CG9A 3CWVA 3R91A 2JKIA 4URMA 4MP2A 1NHHA 4YKYA 2YE2A 2BREA 3O0IA 4L8ZA 4W7TA 4LP0A 4U7OA 4AWQA 4QPJA 4EGIA 2VCIA 1ZXNA 4YKWA 4V25A 3BMYA 2YI7A 5FWKA 4MBCA 3EHFA 3Q5KA 4YKXA 4MPNA 4MP7A 4XD8A 4MPEA 2BRCA 4KFGA 1Y4UA 4L90A 2QG2A
chains in the Genus database with same CATH topology
2BSMA 2YJWA 4O07A 4Q20A 1YERA 3IEDA 3LNUA 1Z5BA 1UYHA 1QYEA 4ASBA 3CRKA 4V26A 5M4EA 4XKOA 1UY8A 1TIDA 1ZWHA 2IWSA 2XX2A 1TC6A 3VHAA 5IN9A 3INWA 3OMUA 2YEDA 4MB9A 4U7NA 4XIQA 1MX0A 1BYQA 3HZ5A 4I3HA 2C2AA 3A0YA 4EEHA 2YKJA 1YC4A 5CTXA 4L91A 5D6PA 4BXIA 4XCJA 5L3JA 2E0AA 3OW6A 3WHAA 1Y8PA 2YEHA 3HHUA 4CWQA 4X9LA 4ASGA 1Z59A 1AJ6A 4EFTA 3TZ5A 2YKCA 2YK2A 2IOQA 1TC0A 3RLQA 2HCHA 1Y8OA 1QY8A 1I5DA 3TUHA 1MU5A 2XJXA 4BQJA 5CTUA 2QFOA 5M4PA 3EHJA 2YEBA 3HEKA 2YI0A 3O2FA 2YE3A 2XJGA 3INXA 4ZKIA 3B25A 1YS3A 3GIFA 4YKTA 4DUHA 4P8OA 4BQGA 5FNFA 2PNRA 3HYZA 1S16A 4BIZA 3A0WA 2WI4A 2QF6A 2EXLA 2ZDXA 2Q8FA 2CH4A 4QPKA 2VW5A 1UY7A 3K98A 3K97A 4ASAA 4B6CA 1EA6A 2FWYA 3T0ZA 1AH6A 1AH8A 1B3QA 2BTZA 1NHIA 4LPBA 2JJCA 2UWDA 2XX4A 4FCPA 3T0HA 3HYYA 2YEAA 5F3KA 3EHGA 2XDSA 3TTZA 5M4KA 2YEGA 2O1UA 1YT1A 2ZDYA 2BU5A 2CCSA 3EKRA 3EKOA 4R3MA 1R62A 3G7BA 4CWPA 3U2DA 2YK9A 4XIPA 4XE2A 3OWDA 3GIGA 5IDMA 5D7CA 1Z5AA 3KE6A 2YGFA 2IWXA 2FYPA 2XD6A 4JAUA 5J71A 4XITA 2HG1A 5BODA 2Q8HA 1YT0A 4AS9A 3OPDA 1UYIA 4R1FA 1QZRA 2BU7A 4EGHA 3ZXQA 3FT5A 4B7PA 2BU6A 3Q5LA 3ZXOA 2YE5A 3MNRP 3OWBA 4HY6A 4CE2A 4CWFA 1NHJA 3CGYA 3R4MA 1TH8A 4XDMA 4KTNA 3H80A 4NH7A 2GQPA 4GFNA 3Q5JA 4EMVA 2BU2A 1UYMA 5M4NA 1YETA 4UROA 2XHRA 3CRLA 4NH8A 4XKKA 2IORA 4LWEA 2IOPA 3A0XA 2WI2A 3VHCA 4HYMA 1YT2A 2YGEA 3ZKBA 3A0ZA 3R4NA 5M4HA 4XTJA 1Z5CA 1YC1A 4I5SA 3K99A 2XHXA 4E01A 4WUCA 2VWCA 4PRXA 2BZ5A 3VHDA 3CGZA 4O09A 5CF0A 5F5RA 4YKZA 2XDXA 2O1VA 2XHTA 1YSRA 2WI6A 4XKAA 2XX5A 1I5BA 1UYDA 4O05A 4XC0A 4BAEA 4L94A 4R3AA 3DGEA 4YKUA 3WQ9A 1U2OA 3U2KA 1U0ZA 2CCUA 5D7DA 5GGZA 2ESAA 3HZ1A 1I58A 4CE3A 4MOTA 4LWHA 4CE1A 4L93A 1TILA 4WUDA 2YE6A 2ZKJA 1L0OA 3R4OA 2YKEA 3R92A 4H81A 4JAVA 4YKQA 4EFUA 2K5BA 4HY1A 4E02A 5IDJA 1AMWA 1UYEA 4AWOA 1ZW9A 3GIEA 3B27A 3TZ0A 4O04A 1UYFA 3B24A 1UYGA 2WERA 2CGFA 3D2RA 3T1KA 1I5AA 5CPHA 2YGAA 4URNA 1S14A 2WI5A 2O1WA 2YEJA 2YI6A 4PU9A 1GJVA 1I59A 3SL2A 3ZM7A 2XDLA 1AM1A 4GEEA 3RLPA 2YECA 4PRVA 3O6OA 1BXDA 3G75A 4YKRA 4FPPA 1TBWA 4P7AA 1A4HA 2YEEA 1BKNA 1THNA 2XCMA 4GGLA 4E00A 3RKZA 1YC3A 3D0BA 1I5CA 1PVGA 4ZVIA 4HXZA 2WEPA 3VADA 2CCTA 1UY9A 4GT8A 5C93A 1BGQA 2FWZA 4KSGA 4CWRA 3K60A 1YESA 5J6AA 2XDUA 2BT0A 1GKZA 4KP4A 3TZ2A 4FMTA 2VCJA 5D7RA 2YJXA 4WUBA 4CWSA 3A0RA 3GIGB 4XIRA 3QDDA 3A0TA 2XJJA 2HKJA 2Q8IA 2WEQA 1YSZA 1KIJA 2AKPA 2GFDA 2YEIA 4O0BA 3RLRA 2WI3A 3PEJA 1Y8NA 4FCRA 1ID0A 4ASFA 5FNCA 2WI1A 4KSHA 2XABA 3BM9A 2BU8A 2YKIA 2H55A 1UYLA 4H85A 4EM7A 1H7UA 4K4OA 3B26A 2YEFA 3D36A 4PL9A 2YE4A 4DZYA 1H7SA 4FCQA 5M4MA 4KQVA 1OSFA 5D6QA 3U67A 3NMQA 4CWOA 4GCZA 3ZKDA 4H7QA 1B62A 2YKBA 5FNDA 4NH9A 2YE9A 2QG0A 3C0EA 2YE7A 4URLA 3B28A 2YI5A 2Q2EB 3PEHA 5BOCA 3FV5A 4GQTA 3QTFA 4CWNA 3EHHA 4AWPA 3JZ3A 4HYPA 4BIUA 1ZXMA 1US7A 1B63A 4EGKA 2XK2A 3FT8A 2FXSA 5CTYA 2H8MA 4U93A 4HXWA 1KZNA 4HZ5A 4CWTA 3TZ4A 4JQLA 2XDKA 3R4PA 1Y4SA 1UYKA 2YE8A 1GKXA 2BYIA 3LPSA 2WI7A 4LWFA 3C11A 4JASA 4MPCA 1UYCA 4LWIA 3H4LA 4LWGA 5CTWA 1UY6A 4HZ0A 3T10A 2ZBKB 2BYHA 4XCLA 2IWUA 3G7EA 1EI1A 2Q8GA 1JM6A 3T2SA 2CG9A 3CWVA 3R91A 2JKIA 4URMA 4MP2A 1NHHA 4YKYA 2YE2A 2BREA 3O0IA 4L8ZA 4W7TA 4LP0A 4U7OA 4AWQA 4QPJA 4EGIA 2VCIA 1ZXNA 4YKWA 4V25A 3BMYA 2YI7A 5FWKA 4MBCA 3EHFA 3Q5KA 4YKXA 4MPNA 4MP7A 4XD8A 4MPEA 2BRCA 4KFGA 1Y4UA 4L90A 2QG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSM A;  2YJW A;  4O07 A;  4Q20 A;  1YER A;  3IED A;  3LNU A;  1Z5B A;  1UYH A;  1QYE A;  4ASB A;  3CRK A;  4V26 A;  5M4E A;  4XKO A;  1UY8 A;  1TID A;  1ZWH A;  2IWS A;  2XX2 A;  1TC6 A;  3VHA A;  5IN9 A;  3INW A;  3OMU A;  2YED A;  4MB9 A;  4U7N A;  4XIQ A;  1MX0 A;  1BYQ A;  3HZ5 A;  4I3H A;  2C2A A;  3A0Y A;  4EEH A;  2YKJ A;  1YC4 A;  5CTX A;  4L91 A;  5D6P A;  4BXI A;  4XCJ A;  5L3J A;  2E0A A;  3OW6 A;  3WHA A;  1Y8P A;  2YEH A;  3HHU A;  4CWQ A;  4X9L A;  4ASG A;  1Z59 A;  1AJ6 A;  4EFT A;  3TZ5 A;  2YKC A;  2YK2 A;  2IOQ A;  1TC0 A;  3RLQ A;  2HCH A;  1Y8O A;  1QY8 A;  1I5D A;  3TUH A;  1MU5 A;  2XJX A;  4BQJ A;  5CTU A;  2QFO A;  5M4P A;  3EHJ A;  2YEB A;  3HEK A;  2YI0 A;  3O2F A;  2YE3 A;  2XJG A;  3INX A;  4ZKI A;  3B25 A;  1YS3 A;  3GIF A;  4YKT A;  4DUH A;  4P8O A;  4BQG A;  5FNF A;  2PNR A;  3HYZ A;  1S16 A;  4BIZ A;  3A0W A;  2WI4 A;  2QF6 A;  2EXL A;  2ZDX A;  2Q8F A;  2CH4 A;  4QPK A;  2VW5 A;  1UY7 A;  3K98 A;  3K97 A;  4ASA A;  4B6C A;  1EA6 A;  2FWY A;  3T0Z A;  1AH6 A;  1AH8 A;  1B3Q A;  2BTZ A;  1NHI A;  4LPB A;  2JJC A;  2UWD A;  2XX4 A;  4FCP A;  3T0H A;  3HYY A;  2YEA A;  5F3K A;  3EHG A;  2XDS A;  3TTZ A;  5M4K A;  2YEG A;  2O1U A;  1YT1 A;  2ZDY A;  2BU5 A;  2CCS A;  3EKR A;  3EKO A;  4R3M A;  1R62 A;  3G7B A;  4CWP A;  3U2D A;  2YK9 A;  4XIP A;  4XE2 A;  3OWD A;  3GIG A;  5IDM A;  5D7C A;  1Z5A A;  3KE6 A;  2YGF A;  2IWX A;  2FYP A;  2XD6 A;  4JAU A;  5J71 A;  4XIT A;  2HG1 A;  5BOD A;  2Q8H A;  1YT0 A;  4AS9 A;  3OPD A;  1UYI A;  4R1F A;  1QZR A;  2BU7 A;  4EGH A;  3ZXQ A;  3FT5 A;  4B7P A;  2BU6 A;  3Q5L A;  3ZXO A;  2YE5 A;  3MNR P;  3OWB A;  4HY6 A;  4CE2 A;  4CWF A;  1NHJ A;  3CGY A;  3R4M A;  1TH8 A;  4XDM A;  4KTN A;  3H80 A;  4NH7 A;  2GQP A;  4GFN A;  3Q5J A;  4EMV A;  2BU2 A;  1UYM A;  5M4N A;  1YET A;  4URO A;  2XHR A;  3CRL A;  4NH8 A;  4XKK A;  2IOR A;  4LWE A;  2IOP A;  3A0X A;  2WI2 A;  3VHC A;  4HYM A;  1YT2 A;  2YGE A;  3ZKB A;  3A0Z A;  3R4N A;  5M4H A;  4XTJ A;  1Z5C A;  1YC1 A;  4I5S A;  3K99 A;  2XHX A;  4E01 A;  4WUC A;  2VWC A;  4PRX A;  2BZ5 A;  3VHD A;  3CGZ A;  4O09 A;  5CF0 A;  5F5R A;  4YKZ A;  2XDX A;  2O1V A;  2XHT A;  1YSR A;  2WI6 A;  4XKA A;  2XX5 A;  1I5B A;  1UYD A;  4O05 A;  4XC0 A;  4BAE A;  4L94 A;  4R3A A;  3DGE A;  4YKU A;  3WQ9 A;  1U2O A;  3U2K A;  1U0Z A;  2CCU A;  5D7D A;  5GGZ A;  2ESA A;  3HZ1 A;  1I58 A;  4CE3 A;  4MOT A;  4LWH A;  4CE1 A;  4L93 A;  1TIL A;  4WUD A;  2YE6 A;  2ZKJ A;  1L0O A;  3R4O A;  2YKE A;  3R92 A;  4H81 A;  4JAV A;  4YKQ A;  4EFU A;  2K5B A;  4HY1 A;  4E02 A;  5IDJ A;  1AMW A;  1UYE A;  4AWO A;  1ZW9 A;  3GIE A;  3B27 A;  3TZ0 A;  4O04 A;  1UYF A;  3B24 A;  1UYG A;  2WER A;  2CGF A;  3D2R A;  3T1K A;  1I5A A;  5CPH A;  2YGA A;  4URN A;  1S14 A;  2WI5 A;  2O1W A;  2YEJ A;  2YI6 A;  4PU9 A;  1GJV A;  1I59 A;  3SL2 A;  3ZM7 A;  2XDL A;  1AM1 A;  4GEE A;  3RLP A;  2YEC A;  4PRV A;  3O6O A;  1BXD A;  3G75 A;  4YKR A;  4FPP A;  1TBW A;  4P7A A;  1A4H A;  2YEE A;  1BKN A;  1THN A;  2XCM A;  4GGL A;  4E00 A;  3RKZ A;  1YC3 A;  3D0B A;  1I5C A;  1PVG A;  4ZVI A;  4HXZ A;  2WEP A;  3VAD A;  2CCT A;  1UY9 A;  4GT8 A;  5C93 A;  1BGQ A;  2FWZ A;  4KSG A;  4CWR A;  3K60 A;  1YES A;  5J6A A;  2XDU A;  2BT0 A;  1GKZ A;  4KP4 A;  3TZ2 A;  4FMT A;  2VCJ A;  5D7R A;  2YJX A;  4WUB A;  4CWS A;  3A0R A;  3GIG B;  4XIR A;  3QDD A;  3A0T A;  2XJJ A;  2HKJ A;  2Q8I A;  2WEQ A;  1YSZ A;  1KIJ A;  2AKP A;  2GFD A;  2YEI A;  4O0B A;  3RLR A;  2WI3 A;  3PEJ A;  1Y8N A;  4FCR A;  1ID0 A;  4ASF A;  5FNC A;  2WI1 A;  4KSH A;  2XAB A;  3BM9 A;  2BU8 A;  2YKI A;  2H55 A;  1UYL A;  4H85 A;  4EM7 A;  1H7U A;  4K4O A;  3B26 A;  2YEF A;  3D36 A;  4PL9 A;  2YE4 A;  4DZY A;  1H7S A;  4FCQ A;  5M4M A;  4KQV A;  1OSF A;  5D6Q A;  3U67 A;  3NMQ A;  4CWO A;  4GCZ A;  3ZKD A;  4H7Q A;  1B62 A;  2YKB A;  5FND A;  4NH9 A;  2YE9 A;  2QG0 A;  3C0E A;  2YE7 A;  4URL A;  3B28 A;  2YI5 A;  2Q2E B;  3PEH A;  5BOC A;  3FV5 A;  4GQT A;  3QTF A;  4CWN A;  3EHH A;  4AWP A;  3JZ3 A;  4HYP A;  4BIU A;  1ZXM A;  1US7 A;  1B63 A;  4EGK A;  2XK2 A;  3FT8 A;  2FXS A;  5CTY A;  2H8M A;  4U93 A;  4HXW A;  1KZN A;  4HZ5 A;  4CWT A;  3TZ4 A;  4JQL A;  2XDK A;  3R4P A;  1Y4S A;  1UYK A;  2YE8 A;  1GKX A;  2BYI A;  3LPS A;  2WI7 A;  4LWF A;  3C11 A;  4JAS A;  4MPC A;  1UYC A;  4LWI A;  3H4L A;  4LWG A;  5CTW A;  1UY6 A;  4HZ0 A;  3T10 A;  2ZBK B;  2BYH A;  4XCL A;  2IWU A;  3G7E A;  1EI1 A;  2Q8G A;  1JM6 A;  3T2S A;  2CG9 A;  3CWV A;  3R91 A;  2JKI A;  4URM A;  4MP2 A;  1NHH A;  4YKY A;  2YE2 A;  2BRE A;  3O0I A;  4L8Z A;  4W7T A;  4LP0 A;  4U7O A;  4AWQ A;  4QPJ A;  4EGI A;  2VCI A;  1ZXN A;  4YKW A;  4V25 A;  3BMY A;  2YI7 A;  5FWK A;  4MBC A;  3EHF A;  3Q5K A;  4YKX A;  4MPN A;  4MP7 A;  4XD8 A;  4MPE A;  2BRC A;  4KFG A;  1Y4U A;  4L90 A;  2QG2 A; 
#chains in the Genus database with same CATH topology
 2BSM A;  2YJW A;  4O07 A;  4Q20 A;  1YER A;  3IED A;  3LNU A;  1Z5B A;  1UYH A;  1QYE A;  4ASB A;  3CRK A;  4V26 A;  5M4E A;  4XKO A;  1UY8 A;  1TID A;  1ZWH A;  2IWS A;  2XX2 A;  1TC6 A;  3VHA A;  5IN9 A;  3INW A;  3OMU A;  2YED A;  4MB9 A;  3CYG A;  4U7N A;  4XIQ A;  1MX0 A;  1BYQ A;  3HZ5 A;  4I3H A;  2C2A A;  3A0Y A;  4EEH A;  2YKJ A;  1YC4 A;  5CTX A;  4L91 A;  5D6P A;  4BXI A;  4XCJ A;  5L3J A;  2E0A A;  3OW6 A;  3WHA A;  2FTK A;  1Y8P A;  2YEH A;  3HHU A;  4CWQ A;  4X9L A;  4ASG A;  1Z59 A;  1AJ6 A;  4EFT A;  3TZ5 A;  2YKC A;  2YK2 A;  2IOQ A;  1TC0 A;  3RLQ A;  2HCH A;  3S5T A;  1Y8O A;  1QY8 A;  1I5D A;  3TUH A;  1MU5 A;  2XJX A;  4BQJ A;  5CTU A;  2QFO A;  5M4P A;  3EHJ A;  2YEB A;  3HEK A;  2YI0 A;  3O2F A;  2YE3 A;  2XJG A;  3INX A;  4ZKI A;  3B25 A;  1YS3 A;  3GIF A;  4YKT A;  4DUH A;  4P8O A;  4BQG A;  5FNF A;  2PNR A;  3HYZ A;  1S16 A;  4BIZ A;  2C1I A;  3A0W A;  2WI4 A;  2QF6 A;  2EXL A;  2ZDX A;  2Q8F A;  2CH4 A;  4QPK A;  2VW5 A;  1UY7 A;  3K98 A;  3K97 A;  4ASA A;  4B6C A;  1EA6 A;  2FWY A;  3T0Z A;  1AH6 A;  1AH8 A;  1B3Q A;  2BTZ A;  1NHI A;  4LPB A;  2JJC A;  2UWD A;  2XX4 A;  4FCP A;  3T0H A;  3HYY A;  2YEA A;  5F3K A;  3EHG A;  2XDS A;  3TTZ A;  5M4K A;  2YEG A;  2O1U A;  1YT1 A;  2ZDY A;  4E72 A;  2BU5 A;  2CCS A;  3EKR A;  3EKO A;  4R3M A;  1R62 A;  3G7B A;  4CWP A;  3U2D A;  2YK9 A;  4XIP A;  4XE2 A;  3OWD A;  3GIG A;  5IDM A;  5D7C A;  1Z5A A;  3KE6 A;  2YGF A;  2IWX A;  2FYP A;  2XD6 A;  4JAU A;  5J71 A;  4XIT A;  2HG1 A;  5BOD A;  2Q8H A;  1YT0 A;  4AS9 A;  3OPD A;  1UYI A;  4R1F A;  1QZR A;  2BU7 A;  4EGH A;  3ZXQ A;  3FT5 A;  4B7P A;  2BU6 A;  3Q5L A;  3ZXO A;  2YE5 A;  3MNR P;  3OWB A;  4HY6 A;  4CE2 A;  4CWF A;  1NHJ A;  3CGY A;  3R4M A;  1TH8 A;  4XDM A;  4KTN A;  3H80 A;  4NH7 A;  2GQP A;  4GFN A;  3Q5J A;  4EMV A;  2BU2 A;  1UYM A;  5M4N A;  1YET A;  4URO A;  2XHR A;  3CRL A;  4NH8 A;  4XKK A;  2IOR A;  4LWE A;  2IOP A;  3A0X A;  2WI2 A;  3VHC A;  4HYM A;  1YT2 A;  2YGE A;  3ZKB A;  3A0Z A;  5JEN A;  3R4N A;  5M4H A;  4XTJ A;  1Z5C A;  1YC1 A;  4I5S A;  3K99 A;  2XHX A;  4E01 A;  4WUC A;  2VWC A;  4PRX A;  2BZ5 A;  3VHD A;  3CGZ A;  1F51 A;  4O09 A;  2C1G A;  5CF0 A;  5F5R A;  4YKZ A;  2XDX A;  2O1V A;  2XHT A;  1YSR A;  2WI6 A;  4XKA A;  2XX5 A;  1I5B A;  1UYD A;  4O05 A;  4XC0 A;  4BAE A;  4L94 A;  4R3A A;  3DGE A;  4YKU A;  3WQ9 A;  1U2O A;  3U2K A;  1U0Z A;  2CCU A;  5D7D A;  5GGZ A;  2ESA A;  3HZ1 A;  1I58 A;  4CE3 A;  4MOT A;  4LWH A;  4CE1 A;  4L93 A;  1TIL A;  4WUD A;  2YE6 A;  2ZKJ A;  1L0O A;  3R4O A;  2YKE A;  3R92 A;  4H81 A;  4JAV A;  4YKQ A;  4EFU A;  2K5B A;  4HY1 A;  4E02 A;  5IDJ A;  1AMW A;  1UYE A;  4AWO A;  1ZW9 A;  3GIE A;  3B27 A;  3TZ0 A;  4O04 A;  1UYF A;  3B24 A;  1UYG A;  2WER A;  2CGF A;  3D2R A;  3T1K A;  1I5A A;  5CPH A;  2YGA A;  4URN A;  1S14 A;  2WI5 A;  2O1W A;  2YEJ A;  2YI6 A;  4PU9 A;  1GJV A;  1I59 A;  3SL2 A;  3ZM7 A;  2XDL A;  1IXM A;  1AM1 A;  4GEE A;  3RLP A;  2YEC A;  4PRV A;  3O6O A;  1BXD A;  3G75 A;  4YKR A;  4FPP A;  1TBW A;  4P7A A;  1A4H A;  2YEE A;  1BKN A;  1THN A;  2XCM A;  4GGL A;  4E00 A;  3RKZ A;  1YC3 A;  3D0B A;  1I5C A;  1PVG A;  4ZVI A;  4HXZ A;  2WEP A;  3VAD A;  2CCT A;  1UY9 A;  4GT8 A;  5C93 A;  1BGQ A;  2FWZ A;  4KSG A;  2HHI A;  4CWR A;  3K60 A;  1YES A;  5J6A A;  2XDU A;  2BT0 A;  1GKZ A;  4KP4 A;  3TZ2 A;  4FMT A;  2VCJ A;  5D7R A;  2YJX A;  4WUB A;  4CWS A;  3A0R A;  3GIG B;  4XIR A;  3QDD A;  3A0T A;  2XJJ A;  2HKJ A;  2Q8I A;  2WEQ A;  1YSZ A;  1KIJ A;  2AKP A;  2GFD A;  2YEI A;  4O0B A;  3RLR A;  2WI3 A;  3PEJ A;  1Y8N A;  4FCR A;  1ID0 A;  4ASF A;  5FNC A;  2WI1 A;  4KSH A;  2XAB A;  3BM9 A;  2BU8 A;  2YKI A;  2H55 A;  1UYL A;  4H85 A;  4EM7 A;  1H7U A;  4K4O A;  3B26 A;  2YEF A;  3D36 A;  4PL9 A;  2YE4 A;  4DZY A;  1H7S A;  4FCQ A;  5M4M A;  4KQV A;  1OSF A;  5D6Q A;  3U67 A;  3NMQ A;  4CWO A;  4GCZ A;  3ZKD A;  4H7Q A;  1B62 A;  2YKB A;  5FND A;  4NH9 A;  2YE9 A;  2QG0 A;  3C0E A;  2YE7 A;  4URL A;  3B28 A;  2YI5 A;  2Q2E B;  3PEH A;  5BOC A;  3FV5 A;  4GQT A;  3QTF A;  4CWN A;  3EHH A;  4AWP A;  3JZ3 A;  4HYP A;  4BIU A;  1ZXM A;  1US7 A;  1B63 A;  4EGK A;  2XK2 A;  3FT8 A;  2FXS A;  5CTY A;  2H8M A;  4U93 A;  4HXW A;  1KZN A;  4HZ5 A;  4CWT A;  3TZ4 A;  4JQL A;  2XDK A;  3R4P A;  1Y4S A;  1UYK A;  2YE8 A;  1GKX A;  2BYI A;  3LPS A;  2WI7 A;  4LWF A;  3C11 A;  4JAS A;  4MPC A;  1UYC A;  4LWI A;  3H4L A;  4LWG A;  3LMM A;  5CTW A;  1UY6 A;  4HZ0 A;  3T10 A;  2ZBK B;  2BYH A;  4XCL A;  2IWU A;  3G7E A;  1EI1 A;  2Q8G A;  1JM6 A;  3T2S A;  2CG9 A;  3CWV A;  3R91 A;  2JKI A;  4URM A;  4MP2 A;  1NHH A;  4YKY A;  2YE2 A;  2BRE A;  3O0I A;  4L8Z A;  4W7T A;  4LP0 A;  4U7O A;  4AWQ A;  4QPJ A;  4EGI A;  2VCI A;  1ZXN A;  4YKW A;  4V25 A;  3BMY A;  2YI7 A;  5FWK A;  4MBC A;  3EHF A;  3Q5K A;  4YKX A;  4MPN A;  4MP7 A;  4XD8 A;  4MPE A;  2BRC A;  4KFG A;  1Y4U A;  4L90 A;  2QG2 A; 
#chains in the Genus database with same CATH homology
 2BSM A;  2YJW A;  4O07 A;  4Q20 A;  1YER A;  3IED A;  3LNU A;  1Z5B A;  1UYH A;  1QYE A;  4ASB A;  3CRK A;  4V26 A;  5M4E A;  4XKO A;  1UY8 A;  1TID A;  1ZWH A;  2IWS A;  2XX2 A;  1TC6 A;  3VHA A;  5IN9 A;  3INW A;  3OMU A;  2YED A;  4MB9 A;  4U7N A;  4XIQ A;  1MX0 A;  1BYQ A;  3HZ5 A;  4I3H A;  2C2A A;  3A0Y A;  4EEH A;  2YKJ A;  1YC4 A;  5CTX A;  4L91 A;  5D6P A;  4BXI A;  4XCJ A;  5L3J A;  2E0A A;  3OW6 A;  3WHA A;  1Y8P A;  2YEH A;  3HHU A;  4CWQ A;  4X9L A;  4ASG A;  1Z59 A;  1AJ6 A;  4EFT A;  3TZ5 A;  2YKC A;  2YK2 A;  2IOQ A;  1TC0 A;  3RLQ A;  2HCH A;  1Y8O A;  1QY8 A;  1I5D A;  3TUH A;  1MU5 A;  2XJX A;  4BQJ A;  5CTU A;  2QFO A;  5M4P A;  3EHJ A;  2YEB A;  3HEK A;  2YI0 A;  3O2F A;  2YE3 A;  2XJG A;  3INX A;  4ZKI A;  3B25 A;  1YS3 A;  3GIF A;  4YKT A;  4DUH A;  4P8O A;  4BQG A;  5FNF A;  2PNR A;  3HYZ A;  1S16 A;  4BIZ A;  3A0W A;  2WI4 A;  2QF6 A;  2EXL A;  2ZDX A;  2Q8F A;  2CH4 A;  4QPK A;  2VW5 A;  1UY7 A;  3K98 A;  3K97 A;  4ASA A;  4B6C A;  1EA6 A;  2FWY A;  3T0Z A;  1AH6 A;  1AH8 A;  1B3Q A;  2BTZ A;  1NHI A;  4LPB A;  2JJC A;  2UWD A;  2XX4 A;  4FCP A;  3T0H A;  3HYY A;  2YEA A;  5F3K A;  3EHG A;  2XDS A;  3TTZ A;  5M4K A;  2YEG A;  2O1U A;  1YT1 A;  2ZDY A;  2BU5 A;  2CCS A;  3EKR A;  3EKO A;  4R3M A;  1R62 A;  3G7B A;  4CWP A;  3U2D A;  2YK9 A;  4XIP A;  4XE2 A;  3OWD A;  3GIG A;  5IDM A;  5D7C A;  1Z5A A;  3KE6 A;  2YGF A;  2IWX A;  2FYP A;  2XD6 A;  4JAU A;  5J71 A;  4XIT A;  2HG1 A;  5BOD A;  2Q8H A;  1YT0 A;  4AS9 A;  3OPD A;  1UYI A;  4R1F A;  1QZR A;  2BU7 A;  4EGH A;  3ZXQ A;  3FT5 A;  4B7P A;  2BU6 A;  3Q5L A;  3ZXO A;  2YE5 A;  3MNR P;  3OWB A;  4HY6 A;  4CE2 A;  4CWF A;  1NHJ A;  3CGY A;  3R4M A;  1TH8 A;  4XDM A;  4KTN A;  3H80 A;  4NH7 A;  2GQP A;  4GFN A;  3Q5J A;  4EMV A;  2BU2 A;  1UYM A;  5M4N A;  1YET A;  4URO A;  2XHR A;  3CRL A;  4NH8 A;  4XKK A;  2IOR A;  4LWE A;  2IOP A;  3A0X A;  2WI2 A;  3VHC A;  4HYM A;  1YT2 A;  2YGE A;  3ZKB A;  3A0Z A;  3R4N A;  5M4H A;  4XTJ A;  1Z5C A;  1YC1 A;  4I5S A;  3K99 A;  2XHX A;  4E01 A;  4WUC A;  2VWC A;  4PRX A;  2BZ5 A;  3VHD A;  3CGZ A;  4O09 A;  5CF0 A;  5F5R A;  4YKZ A;  2XDX A;  2O1V A;  2XHT A;  1YSR A;  2WI6 A;  4XKA A;  2XX5 A;  1I5B A;  1UYD A;  4O05 A;  4XC0 A;  4BAE A;  4L94 A;  4R3A A;  3DGE A;  4YKU A;  3WQ9 A;  1U2O A;  3U2K A;  1U0Z A;  2CCU A;  5D7D A;  5GGZ A;  2ESA A;  3HZ1 A;  1I58 A;  4CE3 A;  4MOT A;  4LWH A;  4CE1 A;  4L93 A;  1TIL A;  4WUD A;  2YE6 A;  2ZKJ A;  1L0O A;  3R4O A;  2YKE A;  3R92 A;  4H81 A;  4JAV A;  4YKQ A;  4EFU A;  2K5B A;  4HY1 A;  4E02 A;  5IDJ A;  1AMW A;  1UYE A;  4AWO A;  1ZW9 A;  3GIE A;  3B27 A;  3TZ0 A;  4O04 A;  1UYF A;  3B24 A;  1UYG A;  2WER A;  2CGF A;  3D2R A;  3T1K A;  1I5A A;  5CPH A;  2YGA A;  4URN A;  1S14 A;  2WI5 A;  2O1W A;  2YEJ A;  2YI6 A;  4PU9 A;  1GJV A;  1I59 A;  3SL2 A;  3ZM7 A;  2XDL A;  1AM1 A;  4GEE A;  3RLP A;  2YEC A;  4PRV A;  3O6O A;  1BXD A;  3G75 A;  4YKR A;  4FPP A;  1TBW A;  4P7A A;  1A4H A;  2YEE A;  1BKN A;  1THN A;  2XCM A;  4GGL A;  4E00 A;  3RKZ A;  1YC3 A;  3D0B A;  1I5C A;  1PVG A;  4ZVI A;  4HXZ A;  2WEP A;  3VAD A;  2CCT A;  1UY9 A;  4GT8 A;  5C93 A;  1BGQ A;  2FWZ A;  4KSG A;  4CWR A;  3K60 A;  1YES A;  5J6A A;  2XDU A;  2BT0 A;  1GKZ A;  4KP4 A;  3TZ2 A;  4FMT A;  2VCJ A;  5D7R A;  2YJX A;  4WUB A;  4CWS A;  3A0R A;  3GIG B;  4XIR A;  3QDD A;  3A0T A;  2XJJ A;  2HKJ A;  2Q8I A;  2WEQ A;  1YSZ A;  1KIJ A;  2AKP A;  2GFD A;  2YEI A;  4O0B A;  3RLR A;  2WI3 A;  3PEJ A;  1Y8N A;  4FCR A;  1ID0 A;  4ASF A;  5FNC A;  2WI1 A;  4KSH A;  2XAB A;  3BM9 A;  2BU8 A;  2YKI A;  2H55 A;  1UYL A;  4H85 A;  4EM7 A;  1H7U A;  4K4O A;  3B26 A;  2YEF A;  3D36 A;  4PL9 A;  2YE4 A;  4DZY A;  1H7S A;  4FCQ A;  5M4M A;  4KQV A;  1OSF A;  5D6Q A;  3U67 A;  3NMQ A;  4CWO A;  4GCZ A;  3ZKD A;  4H7Q A;  1B62 A;  2YKB A;  5FND A;  4NH9 A;  2YE9 A;  2QG0 A;  3C0E A;  2YE7 A;  4URL A;  3B28 A;  2YI5 A;  2Q2E B;  3PEH A;  5BOC A;  3FV5 A;  4GQT A;  3QTF A;  4CWN A;  3EHH A;  4AWP A;  3JZ3 A;  4HYP A;  4BIU A;  1ZXM A;  1US7 A;  1B63 A;  4EGK A;  2XK2 A;  3FT8 A;  2FXS A;  5CTY A;  2H8M A;  4U93 A;  4HXW A;  1KZN A;  4HZ5 A;  4CWT A;  3TZ4 A;  4JQL A;  2XDK A;  3R4P A;  1Y4S A;  1UYK A;  2YE8 A;  1GKX A;  2BYI A;  3LPS A;  2WI7 A;  4LWF A;  3C11 A;  4JAS A;  4MPC A;  1UYC A;  4LWI A;  3H4L A;  4LWG A;  5CTW A;  1UY6 A;  4HZ0 A;  3T10 A;  2ZBK B;  2BYH A;  4XCL A;  2IWU A;  3G7E A;  1EI1 A;  2Q8G A;  1JM6 A;  3T2S A;  2CG9 A;  3CWV A;  3R91 A;  2JKI A;  4URM A;  4MP2 A;  1NHH A;  4YKY A;  2YE2 A;  2BRE A;  3O0I A;  4L8Z A;  4W7T A;  4LP0 A;  4U7O A;  4AWQ A;  4QPJ A;  4EGI A;  2VCI A;  1ZXN A;  4YKW A;  4V25 A;  3BMY A;  2YI7 A;  5FWK A;  4MBC A;  3EHF A;  3Q5K A;  4YKX A;  4MPN A;  4MP7 A;  4XD8 A;  4MPE A;  2BRC A;  4KFG A;  1Y4U A;  4L90 A;  2QG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...