3A0ZA

Catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
152
structure length
147
Chain Sequence
MEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 56
structure length 147
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3a0zA00
1Y8NA 1TBWA 2BU2A 3OW6A 2IOPA 3ZKDA 3HEKA 5M4EA 4EFUA 2XHTA 1YESA 3RKZA 1UYGA 1TC0A 4V26A 4E01A 1I59A 5BODA 4FCRA 1GKZA 3K99A 1UYFA 3D2RA 2YKJA 1YT2A 2C2AA 4Q20A 4HXWA 1I58A 4ZVIA 3GIGA 4L90A 3VHDA 1UYKA 3A0WA 4PRVA 2WERA 4JAUA 2HKJA 4FMTA 2HG1A 4ASAA 1QYEA 1Z5BA 3FV5A 1Y4SA 2BU5A 4URMA 4KP4A 1AJ6A 4BIZA 4HZ0A 3CGZA 4CWNA 2BU8A 2K5BA 2CCTA 4KFGA 2HCHA 3TUHA 4JAVA 2YEDA 3K60A 3BM9A 2Q2EB 4R3MA 1BYQA 3R91A 3D0BA 1YSRA 2IWSA 1ZW9A 4YKYA 4H7QA 2GFDA 4QPJA 2Q8GA 2ZDYA 3G7EA 1Y4UA 1BKNA 1B3QA 3K98A 2ZDXA 2QFOA 2YI6A 4GEEA 4MBCA 3CWVA 4XIPA 4BQJA 3B24A 4LWHA 1S16A 2XDSA 5M4MA 1MX0A 1YC1A 4H85A 4CWTA 4CE1A 1I5BA 3O2FA 4ASGA 2VCJA 5M4HA 4AWQA 2YEJA 4YKWA 2YKIA 1QY8A 2YEAA 3H4LA 4URNA 4HY1A 3C11A 3GIEA 2AKPA 2XDUA 1UYIA 3LNUA 4GCZA 4XKOA 4HZ5A 4CWQA 3TZ2A 4YKUA 4MOTA 2YI7A 1I5CA 2YEGA 4LP0A 1OSFA 3GIFA 3QTFA 5CTXA 5M4PA 2XX5A 3TZ4A 4O07A 1US7A 2YK9A 2YI0A 2ZBKB 4GFNA 1NHHA 4HYPA 4XCLA 3R92A 1YERA 2FWYA 2WI3A 2YGEA 3R4PA 4XCJA 2VWCA 4HYMA 2O1UA 1YETA 4WUBA 1H7UA 4L8ZA 2WI7A 2YEIA 3Q5LA 3FT5A 2YGAA 3DGEA 2YE4A 3EKRA 2XDXA 2H55A 3ZM7A 4XD8A 3INXA 1UYEA 1ID0A 1NHIA 3GIGB 4MPNA 4GQTA 3OMUA 3WHAA 4NH9A 2XDLA 1KZNA 3EHHA 1R62A 1ZXMA 4AWPA 1TIDA 3T0HA 3TTZA 3T2SA 3KE6A 1ZXNA 4BIUA 2YKBA 4LWGA 4CWRA 2XABA 5FNCA 4JQLA 3VHAA 2BU6A 4XIRA 4QPKA 5FNDA 4ASBA 1AH8A 1B62A 1UY8A 4HY6A 4LPBA 4PL9A 3WQ9A 5IDMA 2YE7A 2EXLA 3OWDA 1H7SA 3ZKBA 2FYPA 2YEFA 3A0RA 2FXSA 3MNRP 4P8OA 2WI4A 3D36A 2JKIA 2XX2A 2YEEA 2ESAA 4U7OA 2O1VA 1NHJA 1YS3A 4I3HA 2BZ5A 2IOQA 3CRLA 3K97A 5F5RA 3FT8A 3C0EA 4XKKA 2UWDA 5C93A 2YI5A 2WI2A 3NMQA 2YE5A 3OWBA 1AH6A 5D7CA 3HYYA 4U7NA 5J71A 1Z5AA 2YK2A 4CWSA 5GGZA 4YKRA 1PVGA 4CWPA 3QDDA 4MPEA 2BYHA 3G75A 4EFTA 2XHXA 1UYCA 2CG9A 1U2OA 2XJGA 1UY7A 4L93A 1B63A 3T1KA 3RLPA 5M4KA 5L3JA 3IEDA 4NH7A 4UROA 4B7PA 1ZWHA 2JJCA 3O6OA 4L91A 3HHUA 1TC6A 1GJVA 2VCIA 2XHRA 4MP7A 3OPDA 5J6AA 2PNRA 4EGIA 4LWIA 2WI5A 2IORA 3EHJA 4KTNA 3R4NA 2E0AA 3A0TA 1A4HA 1BGQA 5CTUA 5FWKA 2WEPA 4O0BA 3A0XA 2XCMA 3U2DA 4HXZA 1TH8A 2YJWA 3HZ5A 3TZ5A 4R3AA 1TILA 3PEHA 1Y8PA 3A0YA 2Q8IA 5BOCA 2YECA 5D6PA 5D7RA 2BREA 5CTYA 2XD6A 4EMVA 4B6CA 3VHCA 4XC0A 2CGFA 5D7DA 1UYMA 2FWZA 1MU5A 3EHGA 1UY9A 1YT0A 4O09A 2ZKJA 4EM7A 4LWEA 2XDKA 1YT1A 3R4OA 4YKQA 3PEJA 2XJXA 4W7TA 1KIJA 4DUHA 3BMYA 2YJXA 3B25A 1UYHA 2YKEA 4FCQA 1YC3A 4MP2A 4EEHA 4NH8A 3O0IA 2Q8HA 2XX4A 1EA6A 4URLA 4YKTA 1I5DA 4EGKA 2QG2A 4E02A 2WEQA 2YKCA 4AS9A 4YKXA 1UY6A 3RLQA 2CH4A 5CTWA 1EI1A 4R1FA 4I5SA 1YSZA 4XDMA 4WUCA 2XJJA 4K4OA 5FNFA 2BTZA 3B28A 2BSMA 1AMWA 1YC4A 3R4MA 4XIQA 4WUDA 3Q5JA 2BU7A 4DZYA 4XITA 3SL2A 4BQGA 3HYZA 4KSGA 4CE2A 4PU9A 3LPSA 2BT0A 2YE2A 2YE9A 4E00A 1Z59A 1JM6A 4EGHA 4GT8A 3RLRA 2CCSA 2IWXA 5CPHA 5F3KA 4L94A 2BYIA 1BXDA 2IWUA 3VADA 3B26A 3HZ1A 4CE3A 2BRCA 2QG0A 5CF0A 4O05A 3U2KA 2O1WA 3T10A 5IDJA 1THNA 2YE6A 2VW5A 3T0ZA 2YGFA 3A0ZA 2YE3A 2CCUA 2YEHA 2YEBA 4CWFA 3EKOA 1GKXA 2WI1A 3ZXQA 4AWOA 2Q8FA 1UYDA 1L0OA 3Q5KA 2GQPA 2WI6A 4YKZA 1AM1A 4JASA 4LWFA 1I5AA 4MPCA 3ZXOA 4CWOA 5M4NA 5IN9A 1S14A 4X9LA 1QZRA 4FCPA 3INWA 3EHFA 4XE2A 3G7BA 3CGYA 4U93A 4V25A 1U0ZA 4PRXA 3TZ0A 4H81A 4GGLA 4XTJA 4BXIA 1Z5CA 2H8MA 4FPPA 3U67A 4O04A 2YE8A 3B27A 4MB9A 4XKAA 2XK2A 5D6QA 2QF6A 3H80A 4KSHA 1UYLA 4KQVA 4ASFA 4P7AA 3CRKA 1Y8OA 4BAEA 4ZKIA 3JZ3A
chains in the Genus database with same CATH superfamily
1Y8NA 1TBWA 2BU2A 3OW6A 2IOPA 3ZKDA 3HEKA 5M4EA 4EFUA 2XHTA 1YESA 3RKZA 1UYGA 1TC0A 4V26A 4E01A 1I59A 5BODA 4FCRA 1GKZA 2C1GA 3K99A 1UYFA 3D2RA 2YKJA 1YT2A 2C2AA 4Q20A 4HXWA 1I58A 4ZVIA 3GIGA 4L90A 3VHDA 1UYKA 3A0WA 4PRVA 2WERA 4JAUA 2HKJA 4FMTA 2HG1A 4ASAA 1QYEA 1Z5BA 3FV5A 1Y4SA 2BU5A 4URMA 4KP4A 1AJ6A 4BIZA 4HZ0A 3CGZA 4CWNA 2BU8A 2K5BA 2CCTA 4KFGA 2HCHA 3TUHA 4JAVA 2YEDA 3K60A 3BM9A 2Q2EB 4R3MA 1BYQA 3R91A 3D0BA 1YSRA 2IWSA 1ZW9A 4YKYA 4H7QA 2GFDA 4QPJA 2Q8GA 2ZDYA 3G7EA 1Y4UA 1BKNA 1B3QA 3K98A 2ZDXA 2QFOA 2YI6A 4GEEA 4MBCA 3CWVA 4XIPA 4BQJA 3B24A 4LWHA 1S16A 2XDSA 5M4MA 1MX0A 1YC1A 4H85A 4CWTA 4CE1A 1I5BA 3O2FA 4ASGA 2VCJA 5M4HA 3LMMA 4AWQA 2YEJA 4YKWA 2YKIA 1QY8A 2YEAA 3H4LA 4URNA 4HY1A 3C11A 3GIEA 2AKPA 2XDUA 1UYIA 3LNUA 4GCZA 4XKOA 4HZ5A 4CWQA 3TZ2A 4YKUA 4MOTA 2FTKA 2YI7A 1I5CA 2YEGA 4LP0A 1OSFA 3GIFA 3QTFA 5CTXA 5M4PA 2XX5A 3TZ4A 4O07A 1US7A 2YK9A 2YI0A 2ZBKB 4GFNA 1NHHA 4HYPA 4XCLA 3R92A 1YERA 2FWYA 2WI3A 2YGEA 3R4PA 4XCJA 2VWCA 4HYMA 2O1UA 1YETA 4WUBA 1H7UA 4L8ZA 2WI7A 2YEIA 3Q5LA 3FT5A 2YGAA 3DGEA 2YE4A 3EKRA 2XDXA 2H55A 3ZM7A 4XD8A 3INXA 1UYEA 1ID0A 1NHIA 3GIGB 4MPNA 4GQTA 3OMUA 3WHAA 4NH9A 2XDLA 1KZNA 3EHHA 1R62A 1ZXMA 4AWPA 1TIDA 3T0HA 3TTZA 3T2SA 3KE6A 1ZXNA 3S5TA 4BIUA 2YKBA 4LWGA 4CWRA 2XABA 5FNCA 4JQLA 3VHAA 2BU6A 4XIRA 4QPKA 5FNDA 4ASBA 1AH8A 1B62A 1UY8A 4HY6A 4LPBA 4PL9A 3WQ9A 5IDMA 2YE7A 4E72A 2EXLA 3OWDA 1H7SA 3ZKBA 2FYPA 2YEFA 3A0RA 2FXSA 3MNRP 4P8OA 2WI4A 3D36A 2JKIA 2XX2A 2YEEA 2HHIA 2ESAA 3CYGA 4U7OA 2O1VA 1NHJA 1YS3A 4I3HA 2BZ5A 2IOQA 3CRLA 3K97A 5F5RA 3FT8A 3C0EA 4XKKA 2UWDA 5C93A 2YI5A 2WI2A 3NMQA 2YE5A 3OWBA 1AH6A 5D7CA 3HYYA 4U7NA 5J71A 1Z5AA 2YK2A 4CWSA 5GGZA 4YKRA 1PVGA 4CWPA 3QDDA 4MPEA 2BYHA 3G75A 4EFTA 2XHXA 1UYCA 2CG9A 1U2OA 2XJGA 1UY7A 4L93A 1B63A 3T1KA 3RLPA 5M4KA 5L3JA 3IEDA 4NH7A 4UROA 4B7PA 1ZWHA 2JJCA 3O6OA 4L91A 3HHUA 1TC6A 1GJVA 2VCIA 2XHRA 4MP7A 3OPDA 5J6AA 2PNRA 4EGIA 4LWIA 2WI5A 2IORA 3EHJA 4KTNA 3R4NA 2E0AA 3A0TA 1A4HA 1BGQA 5CTUA 5FWKA 2WEPA 4O0BA 3A0XA 2XCMA 3U2DA 4HXZA 1TH8A 2YJWA 3HZ5A 3TZ5A 4R3AA 1TILA 3PEHA 1Y8PA 3A0YA 2Q8IA 5BOCA 2YECA 5D6PA 5D7RA 2BREA 5CTYA 2XD6A 4EMVA 4B6CA 3VHCA 4XC0A 2CGFA 5D7DA 1UYMA 2FWZA 1MU5A 3EHGA 1UY9A 1YT0A 4O09A 2ZKJA 4EM7A 4LWEA 2XDKA 1YT1A 3R4OA 4YKQA 3PEJA 2XJXA 4W7TA 1KIJA 4DUHA 3BMYA 2YJXA 3B25A 1UYHA 2YKEA 4FCQA 1YC3A 4MP2A 4EEHA 4NH8A 3O0IA 2Q8HA 2XX4A 1EA6A 4URLA 4YKTA 1I5DA 4EGKA 2QG2A 4E02A 2WEQA 2YKCA 4AS9A 4YKXA 1UY6A 3RLQA 2CH4A 5CTWA 1EI1A 4R1FA 4I5SA 1YSZA 4XDMA 4WUCA 2XJJA 4K4OA 5FNFA 2BTZA 3B28A 2BSMA 1AMWA 1YC4A 3R4MA 4XIQA 4WUDA 3Q5JA 2BU7A 4DZYA 4XITA 3SL2A 4BQGA 3HYZA 4KSGA 4CE2A 5JENA 4PU9A 3LPSA 2BT0A 2YE2A 2YE9A 4E00A 1Z59A 1JM6A 4EGHA 4GT8A 3RLRA 2CCSA 2IWXA 5CPHA 5F3KA 4L94A 2BYIA 2C1IA 1BXDA 2IWUA 3VADA 3B26A 3HZ1A 4CE3A 2BRCA 2QG0A 5CF0A 4O05A 3U2KA 2O1WA 3T10A 5IDJA 1THNA 2YE6A 2VW5A 3T0ZA 2YGFA 3A0ZA 2YE3A 2CCUA 2YEHA 2YEBA 4CWFA 3EKOA 1GKXA 2WI1A 3ZXQA 4AWOA 2Q8FA 1UYDA 1L0OA 3Q5KA 2GQPA 2WI6A 4YKZA 1AM1A 4JASA 4LWFA 1I5AA 4MPCA 3ZXOA 4CWOA 5M4NA 5IN9A 1S14A 4X9LA 1QZRA 4FCPA 1IXMA 3INWA 3EHFA 4XE2A 3G7BA 3CGYA 4U93A 4V25A 1U0ZA 4PRXA 3TZ0A 4H81A 4GGLA 4XTJA 4BXIA 1Z5CA 2H8MA 4FPPA 3U67A 4O04A 2YE8A 3B27A 4MB9A 4XKAA 2XK2A 5D6QA 2QF6A 3H80A 4KSHA 1UYLA 4KQVA 4ASFA 4P7AA 3CRKA 1F51A 1Y8OA 4BAEA 4ZKIA 3JZ3A
chains in the Genus database with same CATH topology
1Y8NA 1TBWA 2BU2A 3OW6A 2IOPA 3ZKDA 3HEKA 5M4EA 4EFUA 2XHTA 1YESA 3RKZA 1UYGA 1TC0A 4V26A 4E01A 1I59A 5BODA 4FCRA 1GKZA 3K99A 1UYFA 3D2RA 2YKJA 1YT2A 2C2AA 4Q20A 4HXWA 1I58A 4ZVIA 3GIGA 4L90A 3VHDA 1UYKA 3A0WA 4PRVA 2WERA 4JAUA 2HKJA 4FMTA 2HG1A 4ASAA 1QYEA 1Z5BA 3FV5A 1Y4SA 2BU5A 4URMA 4KP4A 1AJ6A 4BIZA 4HZ0A 3CGZA 4CWNA 2BU8A 2K5BA 2CCTA 4KFGA 2HCHA 3TUHA 4JAVA 2YEDA 3K60A 3BM9A 2Q2EB 4R3MA 1BYQA 3R91A 3D0BA 1YSRA 2IWSA 1ZW9A 4YKYA 4H7QA 2GFDA 4QPJA 2Q8GA 2ZDYA 3G7EA 1Y4UA 1BKNA 1B3QA 3K98A 2ZDXA 2QFOA 2YI6A 4GEEA 4MBCA 3CWVA 4XIPA 4BQJA 3B24A 4LWHA 1S16A 2XDSA 5M4MA 1MX0A 1YC1A 4H85A 4CWTA 4CE1A 1I5BA 3O2FA 4ASGA 2VCJA 5M4HA 4AWQA 2YEJA 4YKWA 2YKIA 1QY8A 2YEAA 3H4LA 4URNA 4HY1A 3C11A 3GIEA 2AKPA 2XDUA 1UYIA 3LNUA 4GCZA 4XKOA 4HZ5A 4CWQA 3TZ2A 4YKUA 4MOTA 2YI7A 1I5CA 2YEGA 4LP0A 1OSFA 3GIFA 3QTFA 5CTXA 5M4PA 2XX5A 3TZ4A 4O07A 1US7A 2YK9A 2YI0A 2ZBKB 4GFNA 1NHHA 4HYPA 4XCLA 3R92A 1YERA 2FWYA 2WI3A 2YGEA 3R4PA 4XCJA 2VWCA 4HYMA 2O1UA 1YETA 4WUBA 1H7UA 4L8ZA 2WI7A 2YEIA 3Q5LA 3FT5A 2YGAA 3DGEA 2YE4A 3EKRA 2XDXA 2H55A 3ZM7A 4XD8A 3INXA 1UYEA 1ID0A 1NHIA 3GIGB 4MPNA 4GQTA 3OMUA 3WHAA 4NH9A 2XDLA 1KZNA 3EHHA 1R62A 1ZXMA 4AWPA 1TIDA 3T0HA 3TTZA 3T2SA 3KE6A 1ZXNA 4BIUA 2YKBA 4LWGA 4CWRA 2XABA 5FNCA 4JQLA 3VHAA 2BU6A 4XIRA 4QPKA 5FNDA 4ASBA 1AH8A 1B62A 1UY8A 4HY6A 4LPBA 4PL9A 3WQ9A 5IDMA 2YE7A 2EXLA 3OWDA 1H7SA 3ZKBA 2FYPA 2YEFA 3A0RA 2FXSA 3MNRP 4P8OA 2WI4A 3D36A 2JKIA 2XX2A 2YEEA 2ESAA 4U7OA 2O1VA 1NHJA 1YS3A 4I3HA 2BZ5A 2IOQA 3CRLA 3K97A 5F5RA 3FT8A 3C0EA 4XKKA 2UWDA 5C93A 2YI5A 2WI2A 3NMQA 2YE5A 3OWBA 1AH6A 5D7CA 3HYYA 4U7NA 5J71A 1Z5AA 2YK2A 4CWSA 5GGZA 4YKRA 1PVGA 4CWPA 3QDDA 4MPEA 2BYHA 3G75A 4EFTA 2XHXA 1UYCA 2CG9A 1U2OA 2XJGA 1UY7A 4L93A 1B63A 3T1KA 3RLPA 5M4KA 5L3JA 3IEDA 4NH7A 4UROA 4B7PA 1ZWHA 2JJCA 3O6OA 4L91A 3HHUA 1TC6A 1GJVA 2VCIA 2XHRA 4MP7A 3OPDA 5J6AA 2PNRA 4EGIA 4LWIA 2WI5A 2IORA 3EHJA 4KTNA 3R4NA 2E0AA 3A0TA 1A4HA 1BGQA 5CTUA 5FWKA 2WEPA 4O0BA 3A0XA 2XCMA 3U2DA 4HXZA 1TH8A 2YJWA 3HZ5A 3TZ5A 4R3AA 1TILA 3PEHA 1Y8PA 3A0YA 2Q8IA 5BOCA 2YECA 5D6PA 5D7RA 2BREA 5CTYA 2XD6A 4EMVA 4B6CA 3VHCA 4XC0A 2CGFA 5D7DA 1UYMA 2FWZA 1MU5A 3EHGA 1UY9A 1YT0A 4O09A 2ZKJA 4EM7A 4LWEA 2XDKA 1YT1A 3R4OA 4YKQA 3PEJA 2XJXA 4W7TA 1KIJA 4DUHA 3BMYA 2YJXA 3B25A 1UYHA 2YKEA 4FCQA 1YC3A 4MP2A 4EEHA 4NH8A 3O0IA 2Q8HA 2XX4A 1EA6A 4URLA 4YKTA 1I5DA 4EGKA 2QG2A 4E02A 2WEQA 2YKCA 4AS9A 4YKXA 1UY6A 3RLQA 2CH4A 5CTWA 1EI1A 4R1FA 4I5SA 1YSZA 4XDMA 4WUCA 2XJJA 4K4OA 5FNFA 2BTZA 3B28A 2BSMA 1AMWA 1YC4A 3R4MA 4XIQA 4WUDA 3Q5JA 2BU7A 4DZYA 4XITA 3SL2A 4BQGA 3HYZA 4KSGA 4CE2A 4PU9A 3LPSA 2BT0A 2YE2A 2YE9A 4E00A 1Z59A 1JM6A 4EGHA 4GT8A 3RLRA 2CCSA 2IWXA 5CPHA 5F3KA 4L94A 2BYIA 1BXDA 2IWUA 3VADA 3B26A 3HZ1A 4CE3A 2BRCA 2QG0A 5CF0A 4O05A 3U2KA 2O1WA 3T10A 5IDJA 1THNA 2YE6A 2VW5A 3T0ZA 2YGFA 3A0ZA 2YE3A 2CCUA 2YEHA 2YEBA 4CWFA 3EKOA 1GKXA 2WI1A 3ZXQA 4AWOA 2Q8FA 1UYDA 1L0OA 3Q5KA 2GQPA 2WI6A 4YKZA 1AM1A 4JASA 4LWFA 1I5AA 4MPCA 3ZXOA 4CWOA 5M4NA 5IN9A 1S14A 4X9LA 1QZRA 4FCPA 3INWA 3EHFA 4XE2A 3G7BA 3CGYA 4U93A 4V25A 1U0ZA 4PRXA 3TZ0A 4H81A 4GGLA 4XTJA 4BXIA 1Z5CA 2H8MA 4FPPA 3U67A 4O04A 2YE8A 3B27A 4MB9A 4XKAA 2XK2A 5D6QA 2QF6A 3H80A 4KSHA 1UYLA 4KQVA 4ASFA 4P7AA 3CRKA 1Y8OA 4BAEA 4ZKIA 3JZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8N A;  1TBW A;  2BU2 A;  3OW6 A;  2IOP A;  3ZKD A;  3HEK A;  5M4E A;  4EFU A;  2XHT A;  1YES A;  3RKZ A;  1UYG A;  1TC0 A;  4V26 A;  4E01 A;  1I59 A;  5BOD A;  4FCR A;  1GKZ A;  3K99 A;  1UYF A;  3D2R A;  2YKJ A;  1YT2 A;  2C2A A;  4Q20 A;  4HXW A;  1I58 A;  4ZVI A;  3GIG A;  4L90 A;  3VHD A;  1UYK A;  3A0W A;  4PRV A;  2WER A;  4JAU A;  2HKJ A;  4FMT A;  2HG1 A;  4ASA A;  1QYE A;  1Z5B A;  3FV5 A;  1Y4S A;  2BU5 A;  4URM A;  4KP4 A;  1AJ6 A;  4BIZ A;  4HZ0 A;  3CGZ A;  4CWN A;  2BU8 A;  2K5B A;  2CCT A;  4KFG A;  2HCH A;  3TUH A;  4JAV A;  2YED A;  3K60 A;  3BM9 A;  2Q2E B;  4R3M A;  1BYQ A;  3R91 A;  3D0B A;  1YSR A;  2IWS A;  1ZW9 A;  4YKY A;  4H7Q A;  2GFD A;  4QPJ A;  2Q8G A;  2ZDY A;  3G7E A;  1Y4U A;  1BKN A;  1B3Q A;  3K98 A;  2ZDX A;  2QFO A;  2YI6 A;  4GEE A;  4MBC A;  3CWV A;  4XIP A;  4BQJ A;  3B24 A;  4LWH A;  1S16 A;  2XDS A;  5M4M A;  1MX0 A;  1YC1 A;  4H85 A;  4CWT A;  4CE1 A;  1I5B A;  3O2F A;  4ASG A;  2VCJ A;  5M4H A;  4AWQ A;  2YEJ A;  4YKW A;  2YKI A;  1QY8 A;  2YEA A;  3H4L A;  4URN A;  4HY1 A;  3C11 A;  3GIE A;  2AKP A;  2XDU A;  1UYI A;  3LNU A;  4GCZ A;  4XKO A;  4HZ5 A;  4CWQ A;  3TZ2 A;  4YKU A;  4MOT A;  2YI7 A;  1I5C A;  2YEG A;  4LP0 A;  1OSF A;  3GIF A;  3QTF A;  5CTX A;  5M4P A;  2XX5 A;  3TZ4 A;  4O07 A;  1US7 A;  2YK9 A;  2YI0 A;  2ZBK B;  4GFN A;  1NHH A;  4HYP A;  4XCL A;  3R92 A;  1YER A;  2FWY A;  2WI3 A;  2YGE A;  3R4P A;  4XCJ A;  2VWC A;  4HYM A;  2O1U A;  1YET A;  4WUB A;  1H7U A;  4L8Z A;  2WI7 A;  2YEI A;  3Q5L A;  3FT5 A;  2YGA A;  3DGE A;  2YE4 A;  3EKR A;  2XDX A;  2H55 A;  3ZM7 A;  4XD8 A;  3INX A;  1UYE A;  1ID0 A;  1NHI A;  3GIG B;  4MPN A;  4GQT A;  3OMU A;  3WHA A;  4NH9 A;  2XDL A;  1KZN A;  3EHH A;  1R62 A;  1ZXM A;  4AWP A;  1TID A;  3T0H A;  3TTZ A;  3T2S A;  3KE6 A;  1ZXN A;  4BIU A;  2YKB A;  4LWG A;  4CWR A;  2XAB A;  5FNC A;  4JQL A;  3VHA A;  2BU6 A;  4XIR A;  4QPK A;  5FND A;  4ASB A;  1AH8 A;  1B62 A;  1UY8 A;  4HY6 A;  4LPB A;  4PL9 A;  3WQ9 A;  5IDM A;  2YE7 A;  2EXL A;  3OWD A;  1H7S A;  3ZKB A;  2FYP A;  2YEF A;  3A0R A;  2FXS A;  3MNR P;  4P8O A;  2WI4 A;  3D36 A;  2JKI A;  2XX2 A;  2YEE A;  2ESA A;  4U7O A;  2O1V A;  1NHJ A;  1YS3 A;  4I3H A;  2BZ5 A;  2IOQ A;  3CRL A;  3K97 A;  5F5R A;  3FT8 A;  3C0E A;  4XKK A;  2UWD A;  5C93 A;  2YI5 A;  2WI2 A;  3NMQ A;  2YE5 A;  3OWB A;  1AH6 A;  5D7C A;  3HYY A;  4U7N A;  5J71 A;  1Z5A A;  2YK2 A;  4CWS A;  5GGZ A;  4YKR A;  1PVG A;  4CWP A;  3QDD A;  4MPE A;  2BYH A;  3G75 A;  4EFT A;  2XHX A;  1UYC A;  2CG9 A;  1U2O A;  2XJG A;  1UY7 A;  4L93 A;  1B63 A;  3T1K A;  3RLP A;  5M4K A;  5L3J A;  3IED A;  4NH7 A;  4URO A;  4B7P A;  1ZWH A;  2JJC A;  3O6O A;  4L91 A;  3HHU A;  1TC6 A;  1GJV A;  2VCI A;  2XHR A;  4MP7 A;  3OPD A;  5J6A A;  2PNR A;  4EGI A;  4LWI A;  2WI5 A;  2IOR A;  3EHJ A;  4KTN A;  3R4N A;  2E0A A;  3A0T A;  1A4H A;  1BGQ A;  5CTU A;  5FWK A;  2WEP A;  4O0B A;  3A0X A;  2XCM A;  3U2D A;  4HXZ A;  1TH8 A;  2YJW A;  3HZ5 A;  3TZ5 A;  4R3A A;  1TIL A;  3PEH A;  1Y8P A;  3A0Y A;  2Q8I A;  5BOC A;  2YEC A;  5D6P A;  5D7R A;  2BRE A;  5CTY A;  2XD6 A;  4EMV A;  4B6C A;  3VHC A;  4XC0 A;  2CGF A;  5D7D A;  1UYM A;  2FWZ A;  1MU5 A;  3EHG A;  1UY9 A;  1YT0 A;  4O09 A;  2ZKJ A;  4EM7 A;  4LWE A;  2XDK A;  1YT1 A;  3R4O A;  4YKQ A;  3PEJ A;  2XJX A;  4W7T A;  1KIJ A;  4DUH A;  3BMY A;  2YJX A;  3B25 A;  1UYH A;  2YKE A;  4FCQ A;  1YC3 A;  4MP2 A;  4EEH A;  4NH8 A;  3O0I A;  2Q8H A;  2XX4 A;  1EA6 A;  4URL A;  4YKT A;  1I5D A;  4EGK A;  2QG2 A;  4E02 A;  2WEQ A;  2YKC A;  4AS9 A;  4YKX A;  1UY6 A;  3RLQ A;  2CH4 A;  5CTW A;  1EI1 A;  4R1F A;  4I5S A;  1YSZ A;  4XDM A;  4WUC A;  2XJJ A;  4K4O A;  5FNF A;  2BTZ A;  3B28 A;  2BSM A;  1AMW A;  1YC4 A;  3R4M A;  4XIQ A;  4WUD A;  3Q5J A;  2BU7 A;  4DZY A;  4XIT A;  3SL2 A;  4BQG A;  3HYZ A;  4KSG A;  4CE2 A;  4PU9 A;  3LPS A;  2BT0 A;  2YE2 A;  2YE9 A;  4E00 A;  1Z59 A;  1JM6 A;  4EGH A;  4GT8 A;  3RLR A;  2CCS A;  2IWX A;  5CPH A;  5F3K A;  4L94 A;  2BYI A;  1BXD A;  2IWU A;  3VAD A;  3B26 A;  3HZ1 A;  4CE3 A;  2BRC A;  2QG0 A;  5CF0 A;  4O05 A;  3U2K A;  2O1W A;  3T10 A;  5IDJ A;  1THN A;  2YE6 A;  2VW5 A;  3T0Z A;  2YGF A;  3A0Z A;  2YE3 A;  2CCU A;  2YEH A;  2YEB A;  4CWF A;  3EKO A;  1GKX A;  2WI1 A;  3ZXQ A;  4AWO A;  2Q8F A;  1UYD A;  1L0O A;  3Q5K A;  2GQP A;  2WI6 A;  4YKZ A;  1AM1 A;  4JAS A;  4LWF A;  1I5A A;  4MPC A;  3ZXO A;  4CWO A;  5M4N A;  5IN9 A;  1S14 A;  4X9L A;  1QZR A;  4FCP A;  3INW A;  3EHF A;  4XE2 A;  3G7B A;  3CGY A;  4U93 A;  4V25 A;  1U0Z A;  4PRX A;  3TZ0 A;  4H81 A;  4GGL A;  4XTJ A;  4BXI A;  1Z5C A;  2H8M A;  4FPP A;  3U67 A;  4O04 A;  2YE8 A;  3B27 A;  4MB9 A;  4XKA A;  2XK2 A;  5D6Q A;  2QF6 A;  3H80 A;  4KSH A;  1UYL A;  4KQV A;  4ASF A;  4P7A A;  3CRK A;  1Y8O A;  4BAE A;  4ZKI A;  3JZ3 A; 
#chains in the Genus database with same CATH topology
 1Y8N A;  1TBW A;  2BU2 A;  3OW6 A;  2IOP A;  3ZKD A;  3HEK A;  5M4E A;  4EFU A;  2XHT A;  1YES A;  3RKZ A;  1UYG A;  1TC0 A;  4V26 A;  4E01 A;  1I59 A;  5BOD A;  4FCR A;  1GKZ A;  2C1G A;  3K99 A;  1UYF A;  3D2R A;  2YKJ A;  1YT2 A;  2C2A A;  4Q20 A;  4HXW A;  1I58 A;  4ZVI A;  3GIG A;  4L90 A;  3VHD A;  1UYK A;  3A0W A;  4PRV A;  2WER A;  4JAU A;  2HKJ A;  4FMT A;  2HG1 A;  4ASA A;  1QYE A;  1Z5B A;  3FV5 A;  1Y4S A;  2BU5 A;  4URM A;  4KP4 A;  1AJ6 A;  4BIZ A;  4HZ0 A;  3CGZ A;  4CWN A;  2BU8 A;  2K5B A;  2CCT A;  4KFG A;  2HCH A;  3TUH A;  4JAV A;  2YED A;  3K60 A;  3BM9 A;  2Q2E B;  4R3M A;  1BYQ A;  3R91 A;  3D0B A;  1YSR A;  2IWS A;  1ZW9 A;  4YKY A;  4H7Q A;  2GFD A;  4QPJ A;  2Q8G A;  2ZDY A;  3G7E A;  1Y4U A;  1BKN A;  1B3Q A;  3K98 A;  2ZDX A;  2QFO A;  2YI6 A;  4GEE A;  4MBC A;  3CWV A;  4XIP A;  4BQJ A;  3B24 A;  4LWH A;  1S16 A;  2XDS A;  5M4M A;  1MX0 A;  1YC1 A;  4H85 A;  4CWT A;  4CE1 A;  1I5B A;  3O2F A;  4ASG A;  2VCJ A;  5M4H A;  3LMM A;  4AWQ A;  2YEJ A;  4YKW A;  2YKI A;  1QY8 A;  2YEA A;  3H4L A;  4URN A;  4HY1 A;  3C11 A;  3GIE A;  2AKP A;  2XDU A;  1UYI A;  3LNU A;  4GCZ A;  4XKO A;  4HZ5 A;  4CWQ A;  3TZ2 A;  4YKU A;  4MOT A;  2FTK A;  2YI7 A;  1I5C A;  2YEG A;  4LP0 A;  1OSF A;  3GIF A;  3QTF A;  5CTX A;  5M4P A;  2XX5 A;  3TZ4 A;  4O07 A;  1US7 A;  2YK9 A;  2YI0 A;  2ZBK B;  4GFN A;  1NHH A;  4HYP A;  4XCL A;  3R92 A;  1YER A;  2FWY A;  2WI3 A;  2YGE A;  3R4P A;  4XCJ A;  2VWC A;  4HYM A;  2O1U A;  1YET A;  4WUB A;  1H7U A;  4L8Z A;  2WI7 A;  2YEI A;  3Q5L A;  3FT5 A;  2YGA A;  3DGE A;  2YE4 A;  3EKR A;  2XDX A;  2H55 A;  3ZM7 A;  4XD8 A;  3INX A;  1UYE A;  1ID0 A;  1NHI A;  3GIG B;  4MPN A;  4GQT A;  3OMU A;  3WHA A;  4NH9 A;  2XDL A;  1KZN A;  3EHH A;  1R62 A;  1ZXM A;  4AWP A;  1TID A;  3T0H A;  3TTZ A;  3T2S A;  3KE6 A;  1ZXN A;  3S5T A;  4BIU A;  2YKB A;  4LWG A;  4CWR A;  2XAB A;  5FNC A;  4JQL A;  3VHA A;  2BU6 A;  4XIR A;  4QPK A;  5FND A;  4ASB A;  1AH8 A;  1B62 A;  1UY8 A;  4HY6 A;  4LPB A;  4PL9 A;  3WQ9 A;  5IDM A;  2YE7 A;  4E72 A;  2EXL A;  3OWD A;  1H7S A;  3ZKB A;  2FYP A;  2YEF A;  3A0R A;  2FXS A;  3MNR P;  4P8O A;  2WI4 A;  3D36 A;  2JKI A;  2XX2 A;  2YEE A;  2HHI A;  2ESA A;  3CYG A;  4U7O A;  2O1V A;  1NHJ A;  1YS3 A;  4I3H A;  2BZ5 A;  2IOQ A;  3CRL A;  3K97 A;  5F5R A;  3FT8 A;  3C0E A;  4XKK A;  2UWD A;  5C93 A;  2YI5 A;  2WI2 A;  3NMQ A;  2YE5 A;  3OWB A;  1AH6 A;  5D7C A;  3HYY A;  4U7N A;  5J71 A;  1Z5A A;  2YK2 A;  4CWS A;  5GGZ A;  4YKR A;  1PVG A;  4CWP A;  3QDD A;  4MPE A;  2BYH A;  3G75 A;  4EFT A;  2XHX A;  1UYC A;  2CG9 A;  1U2O A;  2XJG A;  1UY7 A;  4L93 A;  1B63 A;  3T1K A;  3RLP A;  5M4K A;  5L3J A;  3IED A;  4NH7 A;  4URO A;  4B7P A;  1ZWH A;  2JJC A;  3O6O A;  4L91 A;  3HHU A;  1TC6 A;  1GJV A;  2VCI A;  2XHR A;  4MP7 A;  3OPD A;  5J6A A;  2PNR A;  4EGI A;  4LWI A;  2WI5 A;  2IOR A;  3EHJ A;  4KTN A;  3R4N A;  2E0A A;  3A0T A;  1A4H A;  1BGQ A;  5CTU A;  5FWK A;  2WEP A;  4O0B A;  3A0X A;  2XCM A;  3U2D A;  4HXZ A;  1TH8 A;  2YJW A;  3HZ5 A;  3TZ5 A;  4R3A A;  1TIL A;  3PEH A;  1Y8P A;  3A0Y A;  2Q8I A;  5BOC A;  2YEC A;  5D6P A;  5D7R A;  2BRE A;  5CTY A;  2XD6 A;  4EMV A;  4B6C A;  3VHC A;  4XC0 A;  2CGF A;  5D7D A;  1UYM A;  2FWZ A;  1MU5 A;  3EHG A;  1UY9 A;  1YT0 A;  4O09 A;  2ZKJ A;  4EM7 A;  4LWE A;  2XDK A;  1YT1 A;  3R4O A;  4YKQ A;  3PEJ A;  2XJX A;  4W7T A;  1KIJ A;  4DUH A;  3BMY A;  2YJX A;  3B25 A;  1UYH A;  2YKE A;  4FCQ A;  1YC3 A;  4MP2 A;  4EEH A;  4NH8 A;  3O0I A;  2Q8H A;  2XX4 A;  1EA6 A;  4URL A;  4YKT A;  1I5D A;  4EGK A;  2QG2 A;  4E02 A;  2WEQ A;  2YKC A;  4AS9 A;  4YKX A;  1UY6 A;  3RLQ A;  2CH4 A;  5CTW A;  1EI1 A;  4R1F A;  4I5S A;  1YSZ A;  4XDM A;  4WUC A;  2XJJ A;  4K4O A;  5FNF A;  2BTZ A;  3B28 A;  2BSM A;  1AMW A;  1YC4 A;  3R4M A;  4XIQ A;  4WUD A;  3Q5J A;  2BU7 A;  4DZY A;  4XIT A;  3SL2 A;  4BQG A;  3HYZ A;  4KSG A;  4CE2 A;  5JEN A;  4PU9 A;  3LPS A;  2BT0 A;  2YE2 A;  2YE9 A;  4E00 A;  1Z59 A;  1JM6 A;  4EGH A;  4GT8 A;  3RLR A;  2CCS A;  2IWX A;  5CPH A;  5F3K A;  4L94 A;  2BYI A;  2C1I A;  1BXD A;  2IWU A;  3VAD A;  3B26 A;  3HZ1 A;  4CE3 A;  2BRC A;  2QG0 A;  5CF0 A;  4O05 A;  3U2K A;  2O1W A;  3T10 A;  5IDJ A;  1THN A;  2YE6 A;  2VW5 A;  3T0Z A;  2YGF A;  3A0Z A;  2YE3 A;  2CCU A;  2YEH A;  2YEB A;  4CWF A;  3EKO A;  1GKX A;  2WI1 A;  3ZXQ A;  4AWO A;  2Q8F A;  1UYD A;  1L0O A;  3Q5K A;  2GQP A;  2WI6 A;  4YKZ A;  1AM1 A;  4JAS A;  4LWF A;  1I5A A;  4MPC A;  3ZXO A;  4CWO A;  5M4N A;  5IN9 A;  1S14 A;  4X9L A;  1QZR A;  4FCP A;  1IXM A;  3INW A;  3EHF A;  4XE2 A;  3G7B A;  3CGY A;  4U93 A;  4V25 A;  1U0Z A;  4PRX A;  3TZ0 A;  4H81 A;  4GGL A;  4XTJ A;  4BXI A;  1Z5C A;  2H8M A;  4FPP A;  3U67 A;  4O04 A;  2YE8 A;  3B27 A;  4MB9 A;  4XKA A;  2XK2 A;  5D6Q A;  2QF6 A;  3H80 A;  4KSH A;  1UYL A;  4KQV A;  4ASF A;  4P7A A;  3CRK A;  1F51 A;  1Y8O A;  4BAE A;  4ZKI A;  3JZ3 A; 
#chains in the Genus database with same CATH homology
 1Y8N A;  1TBW A;  2BU2 A;  3OW6 A;  2IOP A;  3ZKD A;  3HEK A;  5M4E A;  4EFU A;  2XHT A;  1YES A;  3RKZ A;  1UYG A;  1TC0 A;  4V26 A;  4E01 A;  1I59 A;  5BOD A;  4FCR A;  1GKZ A;  3K99 A;  1UYF A;  3D2R A;  2YKJ A;  1YT2 A;  2C2A A;  4Q20 A;  4HXW A;  1I58 A;  4ZVI A;  3GIG A;  4L90 A;  3VHD A;  1UYK A;  3A0W A;  4PRV A;  2WER A;  4JAU A;  2HKJ A;  4FMT A;  2HG1 A;  4ASA A;  1QYE A;  1Z5B A;  3FV5 A;  1Y4S A;  2BU5 A;  4URM A;  4KP4 A;  1AJ6 A;  4BIZ A;  4HZ0 A;  3CGZ A;  4CWN A;  2BU8 A;  2K5B A;  2CCT A;  4KFG A;  2HCH A;  3TUH A;  4JAV A;  2YED A;  3K60 A;  3BM9 A;  2Q2E B;  4R3M A;  1BYQ A;  3R91 A;  3D0B A;  1YSR A;  2IWS A;  1ZW9 A;  4YKY A;  4H7Q A;  2GFD A;  4QPJ A;  2Q8G A;  2ZDY A;  3G7E A;  1Y4U A;  1BKN A;  1B3Q A;  3K98 A;  2ZDX A;  2QFO A;  2YI6 A;  4GEE A;  4MBC A;  3CWV A;  4XIP A;  4BQJ A;  3B24 A;  4LWH A;  1S16 A;  2XDS A;  5M4M A;  1MX0 A;  1YC1 A;  4H85 A;  4CWT A;  4CE1 A;  1I5B A;  3O2F A;  4ASG A;  2VCJ A;  5M4H A;  4AWQ A;  2YEJ A;  4YKW A;  2YKI A;  1QY8 A;  2YEA A;  3H4L A;  4URN A;  4HY1 A;  3C11 A;  3GIE A;  2AKP A;  2XDU A;  1UYI A;  3LNU A;  4GCZ A;  4XKO A;  4HZ5 A;  4CWQ A;  3TZ2 A;  4YKU A;  4MOT A;  2YI7 A;  1I5C A;  2YEG A;  4LP0 A;  1OSF A;  3GIF A;  3QTF A;  5CTX A;  5M4P A;  2XX5 A;  3TZ4 A;  4O07 A;  1US7 A;  2YK9 A;  2YI0 A;  2ZBK B;  4GFN A;  1NHH A;  4HYP A;  4XCL A;  3R92 A;  1YER A;  2FWY A;  2WI3 A;  2YGE A;  3R4P A;  4XCJ A;  2VWC A;  4HYM A;  2O1U A;  1YET A;  4WUB A;  1H7U A;  4L8Z A;  2WI7 A;  2YEI A;  3Q5L A;  3FT5 A;  2YGA A;  3DGE A;  2YE4 A;  3EKR A;  2XDX A;  2H55 A;  3ZM7 A;  4XD8 A;  3INX A;  1UYE A;  1ID0 A;  1NHI A;  3GIG B;  4MPN A;  4GQT A;  3OMU A;  3WHA A;  4NH9 A;  2XDL A;  1KZN A;  3EHH A;  1R62 A;  1ZXM A;  4AWP A;  1TID A;  3T0H A;  3TTZ A;  3T2S A;  3KE6 A;  1ZXN A;  4BIU A;  2YKB A;  4LWG A;  4CWR A;  2XAB A;  5FNC A;  4JQL A;  3VHA A;  2BU6 A;  4XIR A;  4QPK A;  5FND A;  4ASB A;  1AH8 A;  1B62 A;  1UY8 A;  4HY6 A;  4LPB A;  4PL9 A;  3WQ9 A;  5IDM A;  2YE7 A;  2EXL A;  3OWD A;  1H7S A;  3ZKB A;  2FYP A;  2YEF A;  3A0R A;  2FXS A;  3MNR P;  4P8O A;  2WI4 A;  3D36 A;  2JKI A;  2XX2 A;  2YEE A;  2ESA A;  4U7O A;  2O1V A;  1NHJ A;  1YS3 A;  4I3H A;  2BZ5 A;  2IOQ A;  3CRL A;  3K97 A;  5F5R A;  3FT8 A;  3C0E A;  4XKK A;  2UWD A;  5C93 A;  2YI5 A;  2WI2 A;  3NMQ A;  2YE5 A;  3OWB A;  1AH6 A;  5D7C A;  3HYY A;  4U7N A;  5J71 A;  1Z5A A;  2YK2 A;  4CWS A;  5GGZ A;  4YKR A;  1PVG A;  4CWP A;  3QDD A;  4MPE A;  2BYH A;  3G75 A;  4EFT A;  2XHX A;  1UYC A;  2CG9 A;  1U2O A;  2XJG A;  1UY7 A;  4L93 A;  1B63 A;  3T1K A;  3RLP A;  5M4K A;  5L3J A;  3IED A;  4NH7 A;  4URO A;  4B7P A;  1ZWH A;  2JJC A;  3O6O A;  4L91 A;  3HHU A;  1TC6 A;  1GJV A;  2VCI A;  2XHR A;  4MP7 A;  3OPD A;  5J6A A;  2PNR A;  4EGI A;  4LWI A;  2WI5 A;  2IOR A;  3EHJ A;  4KTN A;  3R4N A;  2E0A A;  3A0T A;  1A4H A;  1BGQ A;  5CTU A;  5FWK A;  2WEP A;  4O0B A;  3A0X A;  2XCM A;  3U2D A;  4HXZ A;  1TH8 A;  2YJW A;  3HZ5 A;  3TZ5 A;  4R3A A;  1TIL A;  3PEH A;  1Y8P A;  3A0Y A;  2Q8I A;  5BOC A;  2YEC A;  5D6P A;  5D7R A;  2BRE A;  5CTY A;  2XD6 A;  4EMV A;  4B6C A;  3VHC A;  4XC0 A;  2CGF A;  5D7D A;  1UYM A;  2FWZ A;  1MU5 A;  3EHG A;  1UY9 A;  1YT0 A;  4O09 A;  2ZKJ A;  4EM7 A;  4LWE A;  2XDK A;  1YT1 A;  3R4O A;  4YKQ A;  3PEJ A;  2XJX A;  4W7T A;  1KIJ A;  4DUH A;  3BMY A;  2YJX A;  3B25 A;  1UYH A;  2YKE A;  4FCQ A;  1YC3 A;  4MP2 A;  4EEH A;  4NH8 A;  3O0I A;  2Q8H A;  2XX4 A;  1EA6 A;  4URL A;  4YKT A;  1I5D A;  4EGK A;  2QG2 A;  4E02 A;  2WEQ A;  2YKC A;  4AS9 A;  4YKX A;  1UY6 A;  3RLQ A;  2CH4 A;  5CTW A;  1EI1 A;  4R1F A;  4I5S A;  1YSZ A;  4XDM A;  4WUC A;  2XJJ A;  4K4O A;  5FNF A;  2BTZ A;  3B28 A;  2BSM A;  1AMW A;  1YC4 A;  3R4M A;  4XIQ A;  4WUD A;  3Q5J A;  2BU7 A;  4DZY A;  4XIT A;  3SL2 A;  4BQG A;  3HYZ A;  4KSG A;  4CE2 A;  4PU9 A;  3LPS A;  2BT0 A;  2YE2 A;  2YE9 A;  4E00 A;  1Z59 A;  1JM6 A;  4EGH A;  4GT8 A;  3RLR A;  2CCS A;  2IWX A;  5CPH A;  5F3K A;  4L94 A;  2BYI A;  1BXD A;  2IWU A;  3VAD A;  3B26 A;  3HZ1 A;  4CE3 A;  2BRC A;  2QG0 A;  5CF0 A;  4O05 A;  3U2K A;  2O1W A;  3T10 A;  5IDJ A;  1THN A;  2YE6 A;  2VW5 A;  3T0Z A;  2YGF A;  3A0Z A;  2YE3 A;  2CCU A;  2YEH A;  2YEB A;  4CWF A;  3EKO A;  1GKX A;  2WI1 A;  3ZXQ A;  4AWO A;  2Q8F A;  1UYD A;  1L0O A;  3Q5K A;  2GQP A;  2WI6 A;  4YKZ A;  1AM1 A;  4JAS A;  4LWF A;  1I5A A;  4MPC A;  3ZXO A;  4CWO A;  5M4N A;  5IN9 A;  1S14 A;  4X9L A;  1QZR A;  4FCP A;  3INW A;  3EHF A;  4XE2 A;  3G7B A;  3CGY A;  4U93 A;  4V25 A;  1U0Z A;  4PRX A;  3TZ0 A;  4H81 A;  4GGL A;  4XTJ A;  4BXI A;  1Z5C A;  2H8M A;  4FPP A;  3U67 A;  4O04 A;  2YE8 A;  3B27 A;  4MB9 A;  4XKA A;  2XK2 A;  5D6Q A;  2QF6 A;  3H80 A;  4KSH A;  1UYL A;  4KQV A;  4ASF A;  4P7A A;  3CRK A;  1Y8O A;  4BAE A;  4ZKI A;  3JZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...