3A1FA

The crystal structure of nadph binding domain of gp91(phox)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
163
Chain Sequence
IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NADPH binding domain of gp91(phox)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Cytochrome b-245 heavy chain
total genus 56
structure length 163
sequence length 186
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08030 NAD_binding_6 Ferric reductase NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3a1fA00
4C43A 5THXA 1B2RA 4Y9UA 3JQQA 1DDGA 1FNBA 4YHBA 1BJKA 1CNFA 1QGAA 1SM4A 2OK8A 3W2HA 1A8PA 1W34A 1E64A 1H85A 1AMOA 1QUEA 1GAQA 2X3UA 4YALA 1QUFA 1OGJA 2QTZA 4DQKA 5GV8A 1W35A 1DDIA 4YAWA 2BGJA 4YAFA 3OZUA 4BPRA 4K1XA 5KSWB 4AF7A 4EH1A 5EMNA 3W5HA 4Y9RA 3OJWA 4F7DA 3QFRA 1OGIA 1NDHA 2PIAA 2VNKA 1KRHA 4WQMA 1F20A 3VO1A 1E63A 2CNDA 2RC6A 1GO2A 3FJOA 1GAWA 1TVCA 2BF4A 1QFZA 1QH0A 1QFYA 3ZC3A 1QG0A 3QFTA 3QFSA 3VO2A 3OJXA 4Y7CA 4YAOA 3QE2A 4U9UA 3W5VA 3LRXA 3QFCA 5H59A 3OZWA 1EP3B 2VZLA 2B5OA 3JQRA 4P6VF 1H42A 1EWYA 1GVHA 3LO8A 5FA6A 1BQEA 3CRZA 3OZVA 3LVBA 3JQPA 2XNJA 3W5UA 2QDXA 1CQXA 1IB0A 1UMKA 2BPOA 2BMWA 1QGYA 1FDRA 4G1VA 3W2EA 3ZBTA 1QX4A 1I7PA 2GPJA 5GV7A 2VYQA 2OK7A 3FPKA 1W87A 1QFJA 4FK8A 1JB9A 3W2FA 2VNIA 1EP2B 3LYUA 3W2GA 3MHPA 2QTLA 2RC5A 3W2IA 2BN4A 2BSAA 4G1BA 1BX1A 2VNHA 1JA1A 4B4DA 4UAJA 3ZBUA 4AF6A 2XNCA 1JA0A 1GJRA 1TLLA 2R6HA 1CNEA 1FRNA 1FNCA 2EIXA 5H5JA 1BX0A 1J9ZA 3ES9A 5TR9A 4YAUA 3A1FA 1QGZA 4DQLA 2BGIA 1EP1B 1FNDA 2VNJA 1FRQA 1GR1A 1E62A
chains in the Genus database with same CATH superfamily
1ZSNA 3ED5A 4HDQB 4UBJA 1Q7BA 1BVYF 3O4HA 4A6PA 2G07A 4DCSA 1WPXA 3O4VA 1OXTA 2ESRA 2EBFX 3TZ6A 1SELA 3OFND 1JI3A 3MNFA 4GPAA 1WZ2A 2YYSA 4TLMB 3FPBA 5MN6A 2OTCA 1C9NA 3FGNA 3ONEA 4RA6A 4WLOA 3UXMA 1KZ4A 1T2UA 4GBMA 4RF4A 3HR7A 5SZJA 4NJMB 3U9TA 3CH4B 2PD3A 3RUFA 1EQUA 4K46A 1NZJA 2Q8NA 4U2KA 4YP6A 1N4DA 3E5HA 1QUEA 3OZFA 3TTXA 1JHQA 1LWNA 5IKEA 1D5CA 1C9MA 2I4RA 2OBNA 4KL8S 1NWHA 4PWYA 1YAHA 3DR5A 3EIHA 3VH1A 4BVBA 3E2MA 3MS4A 1FYFA 1UBMS 4TLEA 4O4JB 1NR1A 3HRIA 1EWKA 4S12A 2BKAA 3P0RA 2QB5A 1NX9A 3SYRA 2BSQA 1QH8B 1AKRA 3KOMA 3BG5A 5C1IA 3UHFA 5KMGB 3QXHA 3COSA 4D8UA 2G80A 3PENA 1CY0A 2M1XA 2J7KA 3AESB 4U4AA 3BBLA 1R4AA 5KTPA 3KQLA 3JQ8B 2IZZA 4DCNA 3X1ZA 1E63A 2ZRQA 1IG3A 3HWSA 3RG2A 3EOBI 4Z3DA 4RTKA 4KYUA 5IM5A 2G7ZA 5GM1A 4F5ZA 3MCVA 4NH0A 2B4YA 5EMJA 3GD7A 1OTHA 2Y8EA 4KLZA 5JCPA 3ASZA 4RJJA 3X1KA 4DJFC 4IV5A 1CZUA 3EXHC 3QPWA 3E22A 4MW9A 1S8NA 2A9KA 3FSRA 4FYKA 3GA0A 1O97D 3RNOA 3LKZA 3PIDA 4X93A 5C37A 2XDQA 1X7GA 1GL6A 3QYAA 4FEAA 4MWSA 2AYZA 2V4MA 721PA 1KJIA 2FSVA 1S01A 4JL5A 3OX1A 4ARVA 4MQFB 4IDFA 4B5KA 3KR9A 1H69A 4MLZA 1TAGA 1XXLA 1WMFA 4C0JA 4HUQB 4D4HA 2R47A 2VJAA 3N8KA 4OXNA 4QDOA 4TWAA 2EFHB 1W47A 4YJ3B 4CM9A 3AY0A 3B53X 4UVEA 5G4KB 3VU9B 3KJEA 4DC9A 4DUGD 5C5IA 2B4RO 2Y0BA 1FUIA 2H2WA 3WP1B 1BW9B 2ZIXB 3FYTA 3AOEA 3TW0A 4BIMA 3QXJA 3VNQA 2J5QA 1XHEA 3GJRA 3PFGA 1DELA 1IYZA 1I3MA 3SG0A 4RETA 1RU3A 5B1IA 4G1MB 5J59A 1NXSA 2EQBA 2G7MC 3H1PA 3LLCA 3BM5A 4BUCA 2JAUA 4RA9A 1YI1A 5IULC 1XYVA 3FYDA 3VKFA 3JWHA 4RE5A 1ECPA 3K9NA 3R9KA 5JBQA 4L9SA 1VI6A 1GNLA 1H93A 1WQ1R 1Z5UA 2OE2A 3FTPA 3FVWA 2FPIA 4L72A 3W90A 5IZCA 2XODA 4PBSA 4DJ5X 1TO6A 1V6SA 3NIGB 3KTAB 3PUVA 3T9DA 2BH2A 5JYEA 1YDGA 2PGAA 3AGQA 4CLRB 2HRBA 4IIUA 1L4GA 1XOIA 3B9RA 2RSLA 3DZHA 4X1OA 3D59A 2A30A 3NWBA 4XW2A 4PPQA 3HY4A 3KAQA 1Y37A 1J0DA 2NTEA 3PK0A 5J2TF 4ZMSA 1KS9A 5FH9A 1PEAA 1PZGA 1QHXA 2HXGA 2QUHA 2D7JA 1PWYE 2TMDA 4I8XA 4AJNA 3F9CA 3ORFA 4QUAA 3UJ6A 1Z68A 1ZD1A 4B8ZA 4P4UA 4JNKA 2I5PO 3H83A 4UXIA 4ZVUA 1FDTA 4B7XA 4BNUA 4FSDA 2EG5A 3ROPA 3K0CC 5JU6A 1JUDA 1CEYA 2F90A 2BCJQ 5H3HA 3NASA 1QHNA 2ILVA 4UUNA 1QRTA 1UAAA 1QNLA 4N82A 1O57A 3R3SA 4XJSA 4L6CA 2DWCA 5BORA 1XLUA 2EX0A 2RDMA 3ELBA 1JQJC 4B83A 4BO7A 1JHOA 4KQXA 5CT9A 2ZBGA 1Y8QB 2JGKA 2IUTA 1YZ3A 3JAKB 3LVRE 1A3CA 1G66A 4JQZA 1AH2A 1MJGM 4NV3A 3B36A 5ESXA 1NT4A 3LCJA 4JLBA 2WHPB 5JXIA 2WT4A 3QPUA 3AU8A 2ERCA 4JBHA 5K0NA 3KJQA 3RVKA 3MF4A 1QRAA 4X61A 5A62A 4MUGA 1S2IA 4M2LA 3UXHA 1YD7A 1ODFA 2J3LA 3HKEA 4F9TA 5BSUA 2X1LA 3LC2O 4YRDA 1ZL2A 5C35A 4ZZ2A 4TTIA 2X40A 4A2PA 4K6OA 4JBIA 3VH4A 2O3UA 1SHKA 4P3YA 3G02A 5AJXA 5DGTA 5LDGA 3MBKA 4D80A 4DA7A 2X0NA 3F90A 3BQ9A 3GRYA 2OG1A 1XMVA 2JGMA 3IMKA 3W6UA 4ALKA 1UIMA 3F4BA 1TM2A 1NXOA 1Q91A 4LNUB 1RMQA 3O38A 4P81A 1D9ZA 1JLKA 3AXSA 3HB9A 4PO9A 2P27A 3R7AA 1BHQ1 1ZUWA 2NUPA 1ACMA 2ZJFA 3ISTA 4YJKA 3O0DA 1PDVA 4HWOA 4YQZA 2IS6A 2F48A 4ZMRA 2EKQA 3STUA 4QARA 3N3BC 1C29B 2RJOA 3A1TA 3QVOA 5EHIA 4UCFA 5CYGA 2QRKA 4MVXA 1JQBA 1V8DA 2AX4A 4MUYA 5AHWA 3GUUA 3H9UA 5JI3E 1F51E 3N8DA 2NU7B 1HXHA 1PT8A 3E8MA 3GVHA 1ENOA 4ZO9A 3RU7A 4AXBA 3JVDA 2CJPA 3AVUA 3MM4A 1GPNA 6ADHA 1WWKA 1LTKA 2YXNA 2VH1A 8MHTA 1LLUA 1RZRD 4Z7JA 3TRIA 4P5EA 3NTLA 2WT8A 4O2BA 2ZPAA 2VYQA 3QWFA 2P9GA 3A6LA 1UMCB 4RZ2A 4E6PA 4ARZB 4KH1A 2P0AA 4BO8A 2GJSA 1ZIXA 3L8CA 1AS3A 3A1DA 3B60A 3M4XA 3P2JA 4V38A 2L19A 5IC4A 1GGNA 1RPAA 4RULA 3ULKA 1PF7E 2NUAA 1FVOA 3ER8A 3O6VA 2O48X 4GW3A 3H2BA 4KLAA 5EWJB 1SXJE 3KSMA 1BZYA 1BWPA 1L7AA 5LZ7A 2NNWB 1JZTA 1NR7A 3FKJA 4JC0A 1LPMA 4LXHA 1O0BA 1AKQA 4O4HF 5CD9A 2OXRA 1YS4A 5CA1B 2H6EA 4DNXA 3RS0A 3F4KA 2IFTA 1PJSA 1VMDA 5ENDA 5HKLA 3SJ7A 4I9GA 1SCJA 2X9NA 4UEJA 1CIPA 3UQYS 1TC2A 4G63A 3URMA 1QOZA 3DDUA 2RKBA 5AW5A 1FP4A 1YL6A 3K94A 3ZJUA 1LDBA 2IYFA 2W6MA 2JCSA 1KC1A 4HWSA 5EQDA 5I9MA 3ZWYA 5CDSA 4DUZB 3I42A 1OFTA 2AWOA 3V1LA 2Q4EA 4P3OA 2BZGA 2I2XB 2PKCA 3C85A 2PNJA 1XO1A 4C3ZA 4C4PA 3KXKA 3UW3A 1VOTA 1ZU5A 2QTNA 3KPJA 3MELA 4WVFA 3PUZA 1XWFA 3HCCA 3RAFC 4LRTB 3RUCA 1CUUA 1C1YA 2ZRPA 2B9EA 3OWHA 1FX0A 1WKBA 1P33A 2R3SA 5FI3A 3PQ3A 2P75A 2ZKIA 3ONVA 2JH3A 3DNFA 1WKVA 1X70A 2IUEA 4TMYA 5TNXA 4Q93A 1EAMA 1SHUX 3MUOA 3NKFA 3O95A 3AW8A 1USVA 3C5HA 3DBIA 3OZIA 4Q5IA 4FOPA 4UUMA 4W6ZA 4XB1A 5IYZB 5KJCA 5E8JA 2PM8A 1YK1A 2RHDA 1C8LA 1XQWA 3MWLA 2HSDA 1JNXX 4Y2HA 1J42A 5JCJD 2C3MA 5HP4A 1Y8ZA 3ZWQA 2FWRA 3HBJA 2PZJA 2CHGA 2ZIFA 5COQA 1E66A 3LD9A 3LUCA 4MARA 1BKSB 3VR5H 4ISCA 2AFHE 3K1AB 1XL0A 4TXLA 4YAGA 2JI6A 3Q1LA 1X8JA 1R6XA 2VUSA 1ANKA 5TVGA 4RA6B 3KKKA 3DM9B 4HZIA 3NG1A 4PAOA 2CL5A 1ECFA 1Z18A 4UATA 4RH1A 2FPPB 4F56A 4IIVA 2FSGA 4D9FA 1PS9A 4C2TA 1KVTA 4K6CA 2DUUA 4K6MA 2LP4Y 3GFBA 4ZK2A 2R2GA 1JU9A 1NULA 1TIPA 1ZNYA 2IK8A 2E4XA 3FFBA 4WINA 4DLAA 4EA6A 3NCHA 4A26A 3VMFA 3F1LA 5HWSA 4JLKA 4YQEA 3E9RA 4JB8A 2IIQA 3ROXA 3JZMA 1ZS9A 3OSZA 1KYWA 1ZI8A 4FUQA 2I1WA 3V8EA 4EUKA 2FZLA 1IN6A 3R6DA 1UBSB 3P9QA 1T4CB 3PUKA 2IU6A 4LV8B 1ADBA 4NPHA 1G7TA 5TPZD 2Y68A 4ZZ0A 8LDHA 1JHAA 1FVFA 2JS7A 4ZC1A 3SLKA 4B8WA 2HH9A 1XRLA 1GFZA 3CVUA 4TMTA 2YHAA 4IKEA 4WLUA 4JEMA 3WBKA 1UINA 2FPGB 1RI5A 4NMHA 3QU4A 2BJVA 2ZB8A 2ISQA 4AROA 1XA3A 3D43A 1XEFA 3E4DA 4DA8A 5B7QA 4ENVA 4TVSA 1YSCA 2DQZA 3BILA 3CJQA 1B8OA 3JARA 2Q5EA 3ZH2A 5HJ7A 1OX6A 1P1KA 1JA1A 3O7MA 2OBYA 4MVJA 4HT3B 1R5BA 3H2IA 2YX1A 2HTEA 4PG7A 4PC1A 3GMSA 5C31A 1ZK4A 4CHGA 5C7LO 4ENQA 4YMUA 3RS2A 1OTYA 1NE7A 3A6PC 1KIMA 1W1IA 2VBCA 2XZTA 4B6OA 2FFHA 2XBUA 4QXRA 3I9V6 5KVCA 2AE1A 1GQFA 4LOLA 1M1XB 5FF9A 4C7KA 1GKUB 2O5RA 1VL0A 1QGZA 2EJBA 3L8GA 4LIPD 4BQPA 1BDJA 1AF4A 3RHFA 3AM1A 4V24A 2H52A 1ZONA 2F3UA 4B6QA 2YNMD 3VM6A 4DANA 1HOTA 3R74A 5AM2A 5J9FA 1NTOA 1OZAA 1JU4A 2Y1EA 3GZ4A 4N39A 3TQTA 4HFMA 3ZCUA 1QDUA 1A2BA 3HYRA 1VE5A 3AUSA 4RELA 3LCCA 4LVOA 4UEOA 3JQFA 2WZBA 1GZDA 4AJ4A 1ZICA 1IATA 1GZSA 3HN2A 3KTOA 5FYQA 1VYHA 4IKOA 4AYTA 4L0DA 3NP9A 2RHRA 4ND8B 5BV8A 2DR3A 3C5EA 3VSDA 4OB6A 3TLZA 1P5FA 4LDQA 2AS0A 1OH6A 5F4BA 4ROSA 5I5EA 3X2FA 2WTEA 3U3JA 2JIZA 4Q9NA 3ZY5A 4BQRA 4Z3OA 1N2BA 1AURA 3BL8A 3DOIA 2OUIA 1TX4B 3G68A 1YA8A 4ZO8A 3V48A 5BYJA 3SE7A 4GYYA 4B5LA 1NVBA 3GMIA 3UH0A 3GXBA 3PNOA 5E9JA 4TYPA 2FQWA 3HSSA 4QDKA 3WK9A 2E5FA 3MBIA 4OFZA 4Y18A 3U5TA 1YVPA 1UK9A 3NBAA 5BN5B 4GXNA 5SICE 5AVVA 1HL3A 4ZOLA 1P9WA 2X8JA 3WJAA 3PPWA 3HXPA 3K9WA 3FW1A 1N9ZA 2I6FA 3U7GA 1U04A 2KM1A 2L18A 4I4TF 5K6AC 4KSCA 4ER7A 3L8HA 1USKA 4DIEA 2PZFA 1HDOA 2B99A 2CLKB 3ENZA 4FFNA 2R6FA 2BJWA 5J63A 5AP9A 4PYMA 2BFDB 2J4CA 1TECE 5G4LA 4U8GA 3LCMA 3FF1A 4HNAA 5C52B 1VL5A 3DSRA 1TW3A 4LJSA 5EIOA 3Q5EA 1MV5A 2W8BB 2PUWA 3EFEA 3O31A 2PX5A 4J4TA 4TT8A 4HFJA 4X5OA 1LB1B 1WL8A 3NHMA 4DCGA 3ZIAA 1EFLA 2OORC 2ZXFA 4O4HB 2OBBA 3O8RA 2BR3A 3EC7A 5CJPA 4JT2A 4MRVA 1Z34A 1V48A 2XCOA 4OAQA 1KIFA 2GBLA 1KJ8A 5CT8A 2LNDA 1IHYA 2W6ZA 4MS4B 3U2QA 4AY5A 4IBOA 4C0KA 2GAJA 3CW8X 4HDSA 1E2HA 1O96A 1ETHA 4TKVB 3FFTA 2NUTB 4FCTA 1QG4A 1ZOOA 2P78A 3PXUA 4NENA 4QDUA 3MJRA 1I4LD 4H35A 3GFRA 5JSUA 4Z4GA 4XYGA 3HYTA 2HLNA 4N3BA 1BU5A 1GLNA 2I71A 1JQEA 4RZQA 2WDZA 1FQOA 4PLFA 4HRAA 5K51A 1KZ6A 5ADHA 2VWPA 1EE2A 1RYZA 3ESAA 2OOKA 2BE9A 5DEOA 3AKYA 2XRYA 1P1CA 3FIJA 1ZL0A 3PNBA 4KRFA 5DCWA 2QUBA 5LKAA 4UFOA 1XU7A 5AKHA 4C7OA 4NESA 1VSUA 2WM8A 5HIKA 1O6CA 1VLQA 4LZAA 1QH1A 4LECA 3IUNA 2KI5A 2AG5A 1A9RA 4REQA 2EIXA 5ABPA 2ZR7A 4GC9A 2X5XA 4LHSA 5HOQA 4N18A 2IX3A 3MGKA 4JS0A 4B73A 2OV1A 2HN9A 2YXLA 2HPZA 3BD8A 1ZIPA 1IOLA 1HYHA 4DAOA 2WU3A 1XZQA 2JPDA 2LRHA 3KLNA 3P9YA 1H3FA 2XNDD 3RUAA 4G0UA 4A92A 2Y1DA 3EB9A 4H7FA 4Q3LA 2XCUA 3GY0A 4IFEA 4XTCS 3WGMA 4CT4B 1ZSYA 5JCXA 1HZJA 1RRMA 4GI5A 4MRPA 2BGGA 1MDBA 1RHUA 3WQRA 3KQHA 1MU0A 3ZCRA 1JG6A 5CFOA 1XCGB 3BMNA 4OLFA 5DTEA 3GF4A 2BEVB 2JATA 4JC5A 1KQGA 3AL3A 2X86A 3F8SA 3ZKWB 1I2CA 3UYKA 4LF5B 5F33A 3DZGA 3NBYC 2GDJA 1AGXA 2P35A 3L7OA 4UQPA 1ESDA 4K86A 2HEIA 2C20A 4AXXA 4CFZA 5IMSA 4QSHA 5KYNA 1GR0A 2R6ZA 3H3JA 3QEKA 4HAWA 4BQNA 1KERA 1JLLA 1Y9JA 3I9KA 4IH1A 3ZWKA 1CR1A 1E64A 4MVJP 4XFKA 4NH4A 5JC1A 5JNLA 3KSBC 1EHYA 1ML3A 2IYSA 2Y9MB 1ORTA 4K9MA 2QTZA 1D2CA 2WWFA 5A7FA 4DUPA 3PC6A 3UYLA 3GDGA 5ECDA 1DAKA 1KK1A 2PWPA 1OLUB 1Z16A 2W2TA 1MQ8B 2I80A 3BFJA 3FLAA 3RTBA 3UV7A 3X1YA 2VZEA 1FK8A 5IVDA 5HUQA 4IGIA 2CUTA 3QOWA 1SHZA 4MQ6A 1TA0A 4FUTA 3LF2A 1U3TA 5LU9A 2P9CA 1VBNA 5ALMA 3ANMA 3F49S 1ENPA 4HYEA 4ZQEA 2N9UA 3UANA 4K26A 3TTUA 3KAPA 1N8NA 2W2PA 4M83A 5U4XA 4WT7A 4P22A 4R1TA 4LBYA 1AQYA 2ACVA 3MTQA 4AZ0A 4EEZA 3AVWA 2RHJA 5F5XA 2H0QA 3E3MA 3FG9A 4PGHA 2FK8A 3GJQA 1IAQA 3DPUA 1KQ3A 1LSSA 2IYAA 1XE3A 4MGIR 4OXYA 4HEQA 4YMWA 1BX3A 2FDRA 5K0ZA 4U7GA 2DBRA 4G86A 1H1LB 1GCIA 4EY8A 2O8FB 4TYMA 3K1TA 4XLTA 4D43A 2FXVA 1J2JA 1FCJA 1OUMA 3D3WB 2C9BA 2W11A 1GKLA 2P6PA 2W90A 3QU5A 5DSZA 5HF5A 1KVSA 3WWCA 1HKHA 1ZMRA 1CQXA 4KUEA 3FMFA 4Q1CA 4ZRNA 1XCOA 1ULHA 1ORIA 1CNMA 2BMWA 4OSOA 4G09A 4OI4A 2CFRA 1YQTA 2RIRA 4IJWA 2DHDA 1JFFB 4H3SA 5J4VA 2ZWMA 5AHOA 5AVKA 1FBNA 2P9FA 4OHCA 1XMPA 4BX0A 4CCSA 3HO8A 4W63A 1GGJA 1W4AA 2AMLA 2GD1O 3CYFA 4LMAA 5CURA 3SM3A 1PZEA 3CH6A 3SMVA 3ZDYB 3HVRA 2C9ZA 1TU3A 4DMRA 2PUVA 3WIEA 4QHYA 1JEOA 3ZDXB 3IE1A 5F4ZA 5HBRA 1PLLA 2RC5A 3GHYA 4ML3A 4MWGA 2HYDA 1PO7A 3AR3A 4YJ3F 1HKUA 3KDSE 1OXKB 2DFNA 1RZUA 3BMXA 3PC8C 1HG1A 1JXMA 3DC2A 5D00A 4JBNA 1SXJD 5DNEA 5CHYA 5IW8A 3W5SA 2VJMA 4JWKA 1VYVA 5FLYA 4LCJA 1XN4A 4N7BA 4PLVA 2FRVA 5T4HA 4GM4A 4Q4DA 2IELA 5BMOA 1U2QA 3P9KA 2Z6UA 4F96A 2INGX 3S4YA 4DPMA 5KX5A 4IWNA 3G88A 4A7PA 4HGQA 4YCCA 1F5NA 2YS6A 2ATEA 2P2ZA 3ZWOA 4IDCA 4NFSA 3SN6A 2FDCA 2JRCA 3F3MA 3L7IA 4Y6OA 2C2MA 4ZHQA 4DCCA 4DDUA 3AUUA 1SCQA 3D3QA 2C88A 4JP3A 1W5TA 4E22A 4F0JA 5CW1A 1OGYA 2G3YA 1FX1A 2G4CA 1G5RA 2XBLA 3PC2A 1IEQA 3JRWA 3U3KA 2WWRA 1TT5A 5AHXA 1SRQA 3HDGA 1JPJA 1EIWA 1SZDA 5JVDB 1NP3A 2Z5VA 3JWEA 4EITA 3PV0A 4DSUA 2B61A 3R0IA 2FRXA 3FF4A 3WL3A 4RA9B 3PU6A 1LWOA 4KWEA 4ARIA 3RTAA 2IYLD 4L8WB 1F38A 1VLVA 1UP4A 2W9XA 4HDMA 2WYVA 1V16A 3LUPA 1MQ9A 3NATA 3FRJA 2HK6A 5C51B 5J2UB 5JJLA 1TIKA 4CT5A 1HSOA 2IOFA 1OZ0A 1HNZB 4NG4A 3W7AA 4QATA 4R2HA 4XPZA 1YZQA 3BMCB 3FYUC 3DAGA 4DA0A 1E3DA 1UBGA 1JFRA 1UJNA 3VOBA 3GAFA 5EC8A 4Z7QB 1R6UA 4WN9B 2XWBF 4BLWA 1MAVA 3NTVA 1VLZA 3NCTA 1SCKA 4CMHA 4CHTA 1A76A 4FJ1A 2Y4OA 5HRCA 3O21A 4ZVOA 3BX1A 4D26A 4CRWB 1FXUA 3UAZA 4WZAA 2G0AA 3PNVA 2X42A 1E1KA 3P8ZA 1V7CA 2AK3A 3KC2A 2CN1A 3WE7A 3R6TA 1EX7A 1TJ4A 1F0PA 3AP3A 4D5EA 3ZHQA 5E1MA 1J56A 5SY4A 4LDAA 4ZHQF 1QFYA 3U40A 2RHHA 1U8ZA 4HGOA 2PX2A 4KXMA 3DOEA 4RDIA 2E4UA 1EFUA 4A6EA 3G2NA 1JEYA 1KGDA 1R6VA 4Y9TA 1R00A 1Q95A 2ZUUA 1LA2A 3ZCQA 1JJVA 3S44A 2PCLA 4M0MA 1J24A 3ETNA 4J03A 2C42A 2CNWD 3LLSA 3LUJA 4LHYA 2J0VA 4MP3A 4OU4A 3UJHA 3WGVA 4B7CA 1IQUA 1OREA 1XVVA 2WNIA 2ZQ5A 4BV9A 3I5YA 2RI0A 1DE0A 3H5NA 2QQ0A 1Z7EA 3KKQA 3FSEA 3N2ZB 2GEUA 1YNSA 1GZHB 5AT1A 1PI3A 3CX8A 1UPFA 5H9WA 1IE3A 2FP4A 2CL0X 5AHKA 1OOEA 2Q4TA 1H22A 3EFBA 4WXRA 3FFWA 3MB8A 4JYBA 4LK3A 4JYMA 3I34X 5CIQA 5IC5A 1A4IA 1D6MA 1G4UR 3BKXA 3RH0A 3WRWA 1BHJA 3DO5A 1KA9H 2RGDA 1NI4A 4F84A 5KQRA 2X1VA 4M0FA 2K7FA 3OTQA 1NNSA 4DWWA 1S8OA 2ZUVA 1DRJA 1W2GA 4ZVPA 2J7PA 4NYJR 2BFFA 5KYUB 1JBKA 2VJOA 1FMCA 2POCA 1A9SA 2I4OA 1KJJA 4MO9A 3I9FA 2CDNA 3PS9A 4UCWA 2YRFA 2GYWA 2NQ8A 4XYEA 4ZGBA 2AEFA 2GEKA 3A25A 3TTYA 1JHYA 3KT8A 4M9QA 1EZZA 3TPZA 5BURA 4ILKA 5K8LA 3OQIB 4Z4IA 3C3KA 3L0CA 1VM6A 2VCHA 2HJ9A 3ES9A 2UAGA 4R84A 3M5CA 2CK3D 3CEAA 3TCXB 2G82A 5I9SA 3ZK8A 4X71A 3ZJ5A 4EZIA 2HF8A 2O8EB 3HABA 4FDLA 4PTYA 1Q83A 1DAPA 1K8ZB 2BP7B 2W22A 3AF0A 1YOVB 3IDSA 2ADOA 3NWOA 4GVXA 4OHPA 5CNMA 3WICA 3K8QA 1VIMA 2IL1A 3L6RA 2B1QA 1J06A 3KCNA 1VRCA 3ZHXA 2VG8A 5A3SA 2LXNA 1S1MA 1CIVA 5AKYA 5A03A 1H9CA 5CIWA 2J67A 1GRCA 3KUCA 3CT6A 4FXOA 1ECJA 4G85A 1K27A 1NW8A 3RTCA 4JK3A 1PNTA 3T94A 3R0ZA 3OD5A 3WYGA 5IU6A 1H2BA 3NDBB 4AZWA 3LK6A 4LFAB 4P53A 3ZVRA 3TM5A 1VPWA 3VV2A 2Z30A 3FHCB 5TS3A 3V33A 5EINA 2JBAA 3JQAA 2EGGA 1G2IA 1YJ8A 1U0JA 3EAFA 3D0KA 3P4UA 4NYMR 3HBFA 1F2DA 3NAMA 3IEMA 3GLIE 3IDAA 1YE5A 1SHTX 5C32A 3FHTA 1LBTA 1E9EA 1X2EA 1MA0A 1HK7A 3EXEA 2EIHA 1VDZA 3QE3A 2ORWA 3EFOB 3UK0A 4B48A 4YAWA 2ZZMA 2PBLA 2GETA 1RI4A 2IJGX 2O6LA 3HFSA 5JALA 2H1OA 1X87A 3LX5A 3PFWO 4FBMA 2AFIE 4JVLA 5SY9A 4EGAA 4EM6A 4KPEC 3ZX4A 4MS1B 2VP0A 2C2YA 4N7RA 3WLOA 1DKLA 1YQGA 3EA5A 3OY7A 4HYTA 3OFNA 4W1QA 4EJ6A 3B1YA 3KQOA 1B8VA 1CU1A 2E85A 4ADSG 1ZLXA 3ZQUA 2AJBA 4MW4A 4CR7A 1YQXA 4QULA 4HX5A 3ZGYA 4FB4A 5IJZA 1ADGA 5DHSA 3HB1A 5J4HA 1ZIYA 2JCXA 1WLSA 4E4YA 3OE7D 5LZ8A 3WA6A 3FUWA 5ADWA 3I9MA 2AN5A 3GLRA 3ILHA 3DLTA 2GK3A 5FTMA 4HAVA 1DG3A 1Z38A 2H1SA 1Z4NA 2IHTA 5FOVA 1XZCA 1E0DA 2GN4A 3RKSA 1L5HA 2YY7A 3OP1A 4EUSA 3ZLJA 4Q3CA 2G0NA 4X65B 1R8JA 1GKIA 2FFAA 1CQIB 1EVIA 3AP2A 1TPYA 2OFOA 4P3NA 1NN3A 4QRIA 2ZSBA 2HRRA 2WZQA 3OKCA 1U28A 4H60A 4R4JA 1R5JA 1RD4A 2GD2A 2LIPA 3GGJA 3L7MA 1PW7A 3EW7A 3ZWNA 3B1JA 4C4SA 1NI3A 4C6TB 1P7YA 1WXXA 2A67A 2VF4X 3DB1A 1KKMA 5KWVA 2I6XA 4Q03A 3W9UA 4LMRA 5JLAA 4ZYYA 3L0PA 4QRDA 5ED4A 1QHYA 1W6UA 3GBPA 1UMBA 5CU7A 1LUAA 4BQIA 4DEVA 1HDCA 1TQ4A 5HQ3A 2XQIA 2J46A 4J0EA 1EFAA 2NMVA 1V3QE 2REBA 8OHMA 1WP4A 2F1RA 2GCGA 4RGQA 3PGMA 3JVVA 3PJDA 1U1GA 4KE9A 1JFSA 4C7VA 1X8XA 2PEYA 1PRYA 5GONA 3IJPA 1S4QA 4YMSA 4NL4H 2H57A 3RYHA 3ZBUA 3J81k 1UR5A 5HK8A 2PJUA 2Q8PA 1FQKA 1X1CA 1X7DA 5ALVA 1SJ9A 2E7ZA 4CL2A 1AGPA 4EFNA 2GM4A 3IUBA 4II2A 2Y4NA 1AGNA 2VDWB 2WSMA 4M60A 3STXA 1TUEA 4P1ZA 4XM1A 1G6OA 2PG3A 3TINA 3ZW8A 2SHKA 2EXXA 2AYYA 1DJQA 5AW2A 3TD2A 3OCXA 3HXMA 4YAUA 2PT6A 4K8OA 2XTZA 1L5VA 2ONKA 2XRFA 2XWJI 1I4OA 4KOEC 1E94E 4OVKA 3TLJA 1U8FO 4JI4B 1VXRA 1UADA 1V2GA 3L0YA 4MO2A 1KPIA 1U3DA 2XVMA 1NJ5A 4BFYA 4CG0A 1U5CA 3QNWA 2Q9CA 1MN6A 3QJGA 4QOSA 1OYWA 1RKVA 1U2SA 2AXPA 3WHLA 4XASA 5I47A 1J2TA 4M1MA 4BFCA 1E1NA 2ZT8A 3VSCA 3O3OB 1OCEA 1UQRA 4R9NA 5FI5A 3KETA 2JGEA 4FFBA 1TD9A 3SJBA 1RLOA 3KXPA 1UQTA 2WHPA 1YHNA 4LRSB 1VBFA 4YPVA 1DBIA 2FSVC 3HZOA 4LWPA 2R6CA 1SA0B 4FTWA 5EJ5A 1QYWA 4UHCA 1NOJA 4EG6A 1B0UA 1Q0QA 1XXHB 2I1VB 3OX3A 5FDFA 3HXOA 1YIDA 2WJYA 3TFWA 5CAEA 2V1UA 1QYCA 4QXQA 4K1XA 4HEA6 3DMHA 3FM9A 1BCSB 2HMAA 3G9ZA 4IXWA 2JARA 4UUOA 4TLCA 4YJFA 4ZAFA 3VYWA 1E6UA 4U2EA 4RZIA 3TNYA 5H0IA 1NUTA 1FYXA 1D9XA 2XLBA 1LPOA 3AOEC 3PR1A 3CVJA 4U0KA 4AWAA 1KC3A 1QRRA 2F1IA 3I4CA 3G0GA 1NNI1 3EBOA 4AX8A 2BHNA 3H5RA 3K2BA 1TF5A 2IW3A 5E7QA 3OUZA 1XIVA 2C2XA 2P3QA 1FRFS 2KSQA 4B33A 1Q3KA 1VB3A 3KB6A 4JJAA 1FFAA 1YZNA 3D31A 4R2XA 2A0KA 5F76A 3GLGB 2PYDA 3GEIA 3SP1A 4ZHQB 5JSZB 2Q2WA 5CR9A 1FSPA 2V9PA 3BZWA 4OPMA 4BMVA 1VE9A 1Z0AA 3IV7A 4BV2A 4DBVO 3QI7A 1ABFA 2O5CA 1ILEA 2Q4OA 5LMCA 4PYIA 4I4TA 4W7HA 1U4OA 1Y7LA 4RK0A 3DDSA 2CMGA 2FEAA 4NAHA 4Z6KA 2W37A 1YQEA 4YDQA 4BEBA 5LJIA 2HWWA 4E2XA 2WICA 3JRNA 2EVWX 1LVUA 3K2QA 1YKSA 5F2EA 1SOAA 1WG8A 1RHKA 4NFLA 2XUIA 1NXVA 1QIIA 1QZTA 1W2HA 1AS0A 3FR8A 3QYPA 4J0QA 4KI0A 4GM0A 3RSSA 1UOOA 3KELA 3RODA 2DWQA 1QHFA 1WQ3A 2HSJA 1UMDB 3N39C 4BMSA 4QJ5A 4UOZA 3I2YX 4EDFA 1ULAA 3TMKA 3W2FA 3RV3A 4BLOA 1K5GA 2P2SA 3NOQA 4LC0A 2FFJA 3ZWWA 1DUVG 2H8GA 2ZJ6A 1FLAA 5K0TA 2VJPA 4PRLA 1KZYC 1M8GA 3WQQA 1R2QA 2ZDQA 4D0SA 5JVDF 3PXCX 4X1YB 1ZFNA 1DJLA 2VSFA 2GHRA 2ZYWX 1TI7A 1K5HA 2Y66A 1R0CA 2AG8A 4YGYA 4TQAA 2DPLA 4TX1A 2ZRIA 3FVVA 1MR3F 6AT1A 4I46A 1PJCA 4MICA 5T41A 1D2MA 2HEGA 2IT1A 2Q3JA 2W6QA 2WLTA 4E31A 1ZNWA 3COPA 1E4EB 1GPKA 3R09A 4BU1A 1RZRA 3PGKA 5K3AA 3PPYA 1JT9A 4CG1A 1EJ6A 3C16C 2WMYA 1ZD8A 2IVZA 4HNRA 3BK7A 4IVNA 3U09A 3ZOKA 2LKCA 4AL4A 1N6OA 4TKZA 1KSGA 5BT9A 1J7JA 3CY6A 2BWJA 1J33A 5C1BA 1FSGA 2LDBA 3S2IA 2AWNA 1GA6A 2WSBA 2NG1A 2XUHA 4IXMA 1GQQA 4R7ZA 1UXJA 4KR9A 5AFSA 4EG4A 5HM6A 1AGRA 2PZBA 4EKDA 4LY6A 5K0GA 4ACAA 5BYKA 5JFOA 4JXZA 4Q82A 5EUQB 5KDLA 3G5AA 4J4HA 2XCIA 4CI9A 4YUWA 5L8VA 1ESCA 5LD2B 3O5AA 1ORRA 3AP1A 1MVLA 3FSGD 3QLTA 2WC1A 3FKQA 2EZTA 1E8DA 3CG0A 1N2JA 1B6TA 4KDFA 3C48A 2IC5A 1IM8A 3H4VA 3VR5D 1I7QB 2OXEA 3T34A 4X3PA 5E6RA 3ZHOA 3C3PA 2VOEA 4YDSA 3QKTA 1C9KA 1D07A 4MQ4A 3TUIC 1GGVA 1AGYA 4LYGA 2GKGA 5HK9A 1N6HA 4QTYA 3T1VA 1OGIA 2HJGA 2VDQB 2VKQA 3DEHA 3HFGA 1RFLA 4IGAA 4KOAA 4M0KA 4AJKA 4MLDA 2R62A 2I22A 2Q0HA 2ZWAA 1GDDA 2AJTA 1TEHA 2D1SA 3GLVA 3L02A 3IR7A 1P5RA 3B5JA 1XGKA 1J23A 2OAEA 1ISPA 2CHUA 5AXBA 1HT2E 4NCKA 1F5SA 2BFNA 3H05A 1KIAA 4URUR 2ACEA 3AX6A 3ICPA 3E9MA 1G8AA 3FDIA 3WADA 3ZW7A 4BQOA 4G5XA 3CCCA 1E32A 3RYCA 4W5JA 4DYVA 4RDXA 3I8OA 3QFHA 5EMKA 3AUAA 1V3TA 3G85A 3I2JA 5BNZA 3V4OA 1VLLA 3G0OA 3OTHA 1EINA 3PZRA 4JOCA 4LHVA 5D85A 3SC2B 4BMCA 4D9NA 5IDQA 2G1PA 4TS4A 4AKIA 1JSLA 2A0YA 2BJHA 2VVTA 3CNLA 4OYYA 4QAJA 1ZRNA 4LJKA 1PV1A 2A14A 4IOKA 5BSTA 2OPHA 4PXAA 3DJFA 2NV2B 4UCXA 1QFSA 1HFJA 4F45A 1OZHA 2VS1A 1J9EA 1OV4A 2EZ9A 4FZRA 4Q7QA 4WPGA 5BXQC 2GEJA 2P4QA 3NU1A 1Y9ZA 1XU4A 2GNPA 2G5CA 3BGOS 3L5KA 4FQ8A 4K0KB 2VO1A 2NYRA 3PQFA 2HNKA 2VP3A 1J07A 1XZNA 2QUJA 1JDJA 4C30A 1TLFA 3NOXA 3GH3A 4XIFA 1Z63A 3O8CA 1T2VA 4H77A 4IWYA 2R8RA 1W96A 1KBZA 1WEKA 4PYNA 2A7XA 2ODWA 2IDZA 4G6ZA 5D87A 1CB7A 2ZU0C 2Q2OA 4HOYA 2AA3A 1II8B 2C29D 4HQKA 4J2HA 3HKCA 1UKBA 4YVFA 1TQ2A 2VHUA 2FZ4A 3H6KA 5LU8A 1VJ5A 1KO7A 5DYIA 1KMCA 2XNCA 2FV8A 2WG1A 4R01A 4YWHA 5JHGB 3ABQB 4DSOA 1IM5A 3A9VA 5CT6A 2H9AA 1W88B 5ARBA 3IAS1 1S02A 5B1EA 1TDJA 2JFOA 1FRNA 3A31A 4LDZA 2IEZA 4S05A 4MUFA 2F8MA 3RQIA 1FMFA 4BC1A 5CFNA 4OHZA 3D6VA 3ROQA 2CJWA 1ELOA 2IYXA 1GNRA 4XWYA 1RXVA 1NLFA 1G98A 4RK5A 1U8YA 1S2NA 2CFIA 3G5LA 1LLQA 3VHRA 5JH7B 1L7DA 1YGPA 2C5GA 3ELWA 4YDHB 4RJTA 3OCYA 4WK2B 2IA5A 5DDIP 4WX2B 1ZA1A 5CCBA 4RTLA 2CLEB 3BREA 2CYAA 3I6QA 2WTXA 3GJ4A 1ZUD1 3H1AA 3CF4G 4JR2A 1SZJG 2F1OA 4BP1A 3KYIB 4IFIA 5E6SB 2FZKA 2JGJA 4N1AA 4UAUA 5TQ0A 2ZR0A 1X19A 4UTRA 2C00A 5CG1A 3ZN2A 1DIRA 1EBFA 5LQNA 4Y2YA 3BK2A 4J9UE 1P18A 1G5HA 2EEPA 4BNJA 1SFRA 3L2OB 4F97A 4ID3A 3EDOA 3SYTA 1WY5A 4IO0A 1ZIDA 2HCBA 4EQZA 1EM6A 2R87A 4YV2A 5CCEA 1Z0DA 4V2UA 4CM6A 1K5DA 3NR2A 4KXFB 1KO4A 3UMSA 3DOCA 1YFLA 4IQGA 4YREA 3LYLA 4I7EA 4PSKA 3M89A 4MJ7A 3NV9A 3OZUA 3QU7A 2WU4A 4RIEA 4ZVKA 3TWOA 4NHOA 1L7VC 4CM7A 1N77A 3HXTA 5KHAA 1P9LA 4Z53A 3AF5A 2C96A 3IAS6 2YZGA 1EBUA 3MA0A 3R5KA 5ULLA 4XWGA 4ARBA 1QU3A 2AEMA 2P5SA 3B7GA 3N8NA 2RHLA 4J49A 5E1BA 3IUMA 3GT4A 3OKPA 5L3RA 2OQIA 2QL9A 1ENYA 4X3OA 4Z0HO 3K0AA 3TD6A 4G5YA 2RGUA 1TJ5A 1GTRA 2WKWA 4KXVA 1GPWB 3ETLA 4Q1DA 4WKPA 5GZ1A 3SF8A 2I62A 2ISSD 5KJFA 4P7KA 1PP4A 4RQAA 4ND3A 3FOCA 4QNNA 4ZKEA 3WSWA 5KWSA 3K70D 3QFCA 1J4AA 4EL5A 2BH9A 2WSYB 3NTXA 3AI2A 3O3CA 2BGKA 2OCGA 3RFFA 1C8BA 1AZLA 2IY7A 3VSAA 1AUOA 1C7FA 4ZAVA 3O4FA 1Z4MA 2PLAA 2G77B 3L0DA 3OT1A 4P82A 1CUSA 4MI3A 3KU4A 5KAPA 4EVQA 2HW8A 4CUJA 3VR3D 3AL0C 4I5IA 4MPJA 4HNTA 3AJ8A 1U7WA 3OP4A 2IRWA 3HB4X 2UV8A 4ZV4A 1D0IA 3FROA 3DC7A 3K0EA 4M0LA 4IKPA 1QGYA 1EJBA 3PUIA 4BMOB 4X41A 4J4BA 5EXSA 3OOYA 4YBRA 1N2SA 3G17A 1WZUA 3SZ3A 1MB9A 1VXOA 2R1ZA 2AOUB 2I54A 1QLWA 1K08A 2AOTB 3R3UA 5EE1A 3CMCO 3IR6A 4KN9S 1PR5A 4CKZA 4OI0A 3SYLA 1ULBA 1W8IA 2ZRJA 3OTOB 2IXEA 2QTFA 3DGEC 2XCSB 3OUUA 3ZHZA 4DIFA 2Q9BA 1U0BB 1W0KD 2YH2A 1T2EA 3O9VA 5KU7A 3CUSA 1QVAA 2JK0A 1ATZA 1MEEA 4AFNA 1RHRA 4JQCA 2I2FA 1V5FA 4YP1A 5CNIA 3VU8A 1P2BA 3T06B 4PQYA 1I6KA 4OFBA 4RTNA 1H5NA 1W85B 3FSGA 1I24A 3ROFA 4AMBA 1M6WA 4PO1A 1EVZA 1P2FA 1Q1EA 1IDOA 2D1FA 2PA0A 2YOHA 1OKKA 3NPAA 3ZI4A 5K4HA 1C0KA 2UZ0A 4NZOA 2X6QA 5JTTA 3ZS8A 5EP2A 3RVQA 4RKWA 2O50A 1G0OA 4HO1X 3G5MA 4GU5A 4Q0MA 1B3RA 4KCGA 3TTWA 4TTRA 2VQ6A 3RU3A 3D8HA 2OBLA 1ZO8A 2H1VA 3N07A 5ERGB 2CXRA 4QUEA 4CDNA 2Y71A 4BCCA 3CEPB 2WJAA 1EGQA 3P9RA 2J9RA 1TZCA 4GEKA 4ZTBA 1G5TA 3NETA 3GEPA 3BFXA 1BRMA 4US1R 1SVNA 3HUTA 2OK8A 4Q18A 3DKIA 2ZYHA 3OZDA 3G6WA 1ZM7A 1OU0A 2V6IA 4EJ0A 1UXKA 3ZOZA 1YTLA 2ZKLA 2VDVE 3HWRA 3K09A 5G3YA 2EFJA 4TLDA 4MIEA 3L4EA 1UAYA 2FP3A 1DRVA 2GKSA 4ENUA 1KTIA 2XVXA 2CV1A 4JKOA 1NQVA 1QQ5A 1UL1X 1SHLA 4LBZA 1IVNA 4FHZA 5J47A 1RBMA 3NORA 4PFKA 2R6AA 2L2QA 3C3YA 4NCNA 4H31A 1MO6A 1SQFA 5DGDA 1QP4A 2VJDA 4UEWA 5TT0A 3NIDB 4GE3A 3IUEA 2C7RA 2XXAA 3PLNA 4LZOA 1W36C 4J1TC 3W5HA 7MDHA 1YE8A 2YWFA 1J2EA 1CEXA 3K05A 2ZEJA 1WW8A 3G2KA 3WS7A 4ECAA 3V1NA 3BCSA 1IQRA 3HJRA 3JD2A 4CMIB 4WOCA 4X6XA 1V26A 3ZDBA 4ESHA 1IZ9A 2JIPA 3ZDCA 1KI1A 1NBAA 4UUBA 5FA5A 1EP9A 4BWFB 3N5CA 1NXTA 4ZVQA 1U80A 1NVVR 3LUDA 1P4GA 2GPWA 4HRYA 4EDHA 2D2VA 3EVDA 1AB5A 3FNIA 1TD1A 3G3EA 3JYNA 2NPFA 4D0RA 5HPYB 4MQBA 1GZ6A 1E3LA 2PRSA 5HBGA 3U4AA 4BNVA 5AW0A 4K1LA 2QUZA 2XE7A 1GYPA 1CR0A 1NN1A 4YB8A 5DMXA 5HIIA 5JYCA 1L8QA 4YJFB 3LLVA 1VDMA 2CBZA 3QW2A 4ZEXA 2O0JA 3VPGA 4RY2A 4B43A 4Q02A 2GZ1A 5K20A 4CEHB 2PX0A 3H6HA 3RSFA 2IH5A 2FQ1A 2VHZA 5CLHA 4C3VA 1Q1QA 1FZTA 1VG8A 4MP8A 4YASA 5DWQA 2CLIB 4XCXA 5IZCC 1KOJA 4V0KA 2X1MA 3NEYA 3KNZA 1OLSB 3OTWA 2XB8A 2J9FA 4TVBA 5C34B 1DSSG 4OJMX 2HXSA 3WFJA 2CE7A 2V7UA 2H31A 4ZVTA 3P4XA 1WSDA 1Z4QA 5JS8A 5I51A 5IK2D 4AJ9A 2JAHA 4W8HA 1XG5A 3FPFA 3OPYA 4GI2A 4N47A 3QF4A 3QTTA 4P5PA 5SV2A 2J5BA 4DAEA 1PJ3A 4YAIA 5CA0F 3FOFC 3HGQA 3AFIA 1FJGB 2FG6C 2BN4A 2WJIA 1NDQA 3TMYA 2CGEA 1C1DA 2X8BA 4YQYA 4N6GA 5EI5A 4BKQA 3R23A 3TRJA 2O14A 1WSBA 3QOXA 4NE9A 4WNAB 3H42B 3S3TA 2P40A 1ISGA 1R7RA 3PNLA 5LKRA 5KJ1A 1JE0A 3CLRC 3ZS9A 1NUPA 4OBWA 4R81A 2ACKA 4MVJM 4BO0A 1Z6AA 4G1EB 4GBED 4MWBA 1E6WA 2VFAA 4G5FA 1I4TD 4BNTA 1NMEA 3ILSA 3NC4A 4ZO7A 3SDZA 4NCHA 1VI2A 3WKAA 3NXKA 1JKMA 1DO8A 4HDCA 2FW6A 3VR6A 1NZDA 3WMXA 1YE3A 2FCAA 3I6IA 2JLRA 3EGXB 1PDWA 3MYYA 4LCEA 3TL3A 1QGDA 3N87A 3S2UA 1JLHA 2ZJOA 3DF7A 4KK3A 4YRLA 3VQTA 3E03A 4OHVA 4UXJA 1I7DA 1BCRB 4M6WA 1FNBA 3ONDA 1CX9B 2JFVA 1QHIA 2XAUA 4R40A 2XB6A 4GDMA 4V2IA 2JCYA 5SZHB 5JXHA 4DV6B 1U0EA 4H3VA 1ZSVA 1N3LA 3QUSA 2OR3A 4IW3B 4DWVA 1Y8CA 2OD7A 2PQMA 4L22A 4ETWA 1NP6A 3NNSA 1PFYA 4KFRA 4Z8YA 1CJMA 1ZM9A 3OEHD 4HXGA 1XVAA 3NX4A 4AMGA 2Q6OA 2BT4A 5D5QA 3GWZA 5EKUA 3KAKA 3REQA 1M2EA 2A9VA 4DL9A 2PFKA 4L02A 1UDRA 3EBPA 4QELA 2DC1A 1YKGA 1RJDA 3JALA 3LCRA 5LUBA 1X77A 1ZK3A 4YI5A 3Q1KA 1P6XA 3SC4A 4TQGA 3WYDA 4BPRA 1QC5A 4CW7A 3EHDA 1N2EA 1VHLA 4Y9RA 3UWKA 5K5EA 3H5AA 3JAMA 2AUMA 4O2AA 3MK31 3WAJA 2D00A 3LQ4A 3O47A 1L7OA 1Z4JA 4LVCA 4PX3A 2XGJA 2I4TA 2PV7A 2XECA 2BBWA 3WP0A 1GA1A 2Q29A 2V45A 5C7OO 3JWGA 3NNDA 5FL3A 4DSZA 1B0ZA 2X76A 4MRRA 5L6MB 3QVTA 2WZCA 1Y80A 5DYNA 4M1OA 3FNQA 3WRXA 1KRWA 4NCBA 1FQWA 4EY6A 3GNQA 2QV7A 3KVRA 1SUCA 1RXYA 1P0MA 4D3XA 5EWMA 3AR2A 5IRCD 1PL0A 3UJAA 4BX9A 3ZI7A 3N7AA 2PZ8A 3LV8A 2BEUA 5J1SB 1DOZA 2RGWA 1EPUA 3WK5A 5IF3A 1KH1A 4P6VF 2OA0A 4KQGA 2YN2A 1D2EA 3SR3A 3PFCA 3W3ZB 4EOGA 2JA2A 2BGTA 1L7EA 2V9CA 1E3EA 4KC0A 1XT6A 3GG9A 1B93A 4LOIA 2CLMB 2GD6A 2XAAA 1DX4A 1P1RA 2QN7A 2VDWA 3FOWA 3A10A 1RYHA 1ZX1A 2XYQA 2YJZA 3IDFA 1R5NA 4BHTA 3ESQA 5LQSA 3V8VA 1U2ZA 1V9CA 3DZFA 3S28A 2MHCA 3PXBA 3TH5A 1R0XA 2JC3A 2PGLA 2ZK7A 1TGVA 1ZCAA 4HWGA 3R8CA 2EF1A 1Z26A 1STOA 4HZGA 4KAXA 3EFHA 4GF5A 5DCYA 2XKJE 4UAVA 3LXRA 3LYUA 3D2CA 5G4KA 1OJ7A 2Q49A 3LS2A 2OXTA 3PQ4A 1YZFA 3QKRB 3AR4A 3EIXA 4RLHA 1X80A 4JHXA 1O87A 3U19A 2YASA 3AEUA 4EJSC 2D7CA 2QQEA 3LWZA 3K0SA 1JEQA 2QW8A 3CNEA 1OX4A 3WL4A 5ER9A 1FNNA 1T4BA 2P69A 4FYVA 4EG7A 5LA6B 4ZALA 4MQEA 4C4ZA 1NV9A 2ZCVA 3UKDA 3TOCA 1V95A 1R0YA 2HHJA 1T4CA 3JY6A 5IKPA 4GXQA 4NZMA 2EZ4A 1WCYA 1CP3A 1F2VA 1RC1A 3BRWA 3HXKA 5D8DA 5TT1A 4IDGA 3S40A 1M75A 3PA6A 5DBGA 5AUPB 5JVDA 1I2ZA 3A1EA 1BS2A 2LUOA 5I9LA 2Y1FA 1J97A 3D0QA 2W83A 4JI6B 2YV4A 1DEHA 2YWRA 4NARA 5KYVA 3TFOA 3CR8A 1K7FB 3EE6A 4KVAA 1ZN9A 5DX0A 1QORA 3O93A 2C2HA 2QRQA 3BULA 4IQ8A 5JXWA 3WRXC 5EQTA 4EHJA 4IZ6A 3F96A 4E1VA 5I6DA 3A14A 3R1IA 2GH1A 4ZWNA 2C9YA 4JGBA 1N2IA 1IHUA 4QO8A 3WDLA 2YZNA 3A3PA 5E7JA 1H5QA 2QPTA 5ESRA 3QVSA 5CM2Z 4D3ZA 1JFVA 1TAQA 2WAAA 1VKOA 3U44A 5B30A 3D1LA 2PQ2A 4DDVA 3KZCA 1RQNA 2NZJA 2XXJA 4O2BB 1K4KA 3EUFA 1VCHA 2Y1LA 3PHGA 4F4HA 2PS9A 3P0HA 3OF2A 3GA7A 2PD4A 4HMPA 1L1RA 1SQSA 4ND4A 2JDID 4NZ9A 3GNLA 4OCZA 10MHA 4CGZA 2Q6KA 4L2IB 3GFTA 2CDRA 3G6KA 3EASA 1SPBS 2GZ3A 4NJMA 3LRTA 2ETVA 4GX2A 3LY5A 3U1BA 4N6NA 4XARA 1HURA 1AHNA 1WXEA 5DNDA 5BSVA 3R5FA 1D03A 4TQ9A 4ER0A 2VPTA 1OPRA 1UBOS 1Y4AE 4I4IA 1A5SB 3UHJA 2A84A 2OWDA 3C8UA 5ESDA 3GLGE 1PGJA 1AKMA 3LVQE 4EATA 1QG0A 3AZOA 3P2EA 4HSEA 1ZGBA 2OBXA 3EVGA 3VTAA 2HQBA 2F62A 4RXMA 3RS8A 3C45A 1ST2A 3U7RA 3JQAD 2V8BA 3FCUB 3T0IA 3ZTTA 1EWYA 5L9AA 4OYRA 4P35A 4TYQA 4PC7A 4WLVA 2WG0A 2JCBA 5A4KA 2CXSA 2M6KA 5BW5A 1EVKA 3GZTB 1OX4B 1XCBA 3GJZA 1PQUA 1HE4A 1TAHA 4L51A 5CNKA 1KEEB 4KODA 5F7OA 3DGFC 1SC3A 1QRUA 3K1YA 4YO8A 5IBPA 2JD2A 1FPQA 3ZE8A 4F9EA 2VT2A 2N47A 2H00A 2W43A 3U4IA 5EXDA 5I4IA 3HQ4O 3LFTA 1QF9A 4QU8A 4CKBA 3QENA 4RKRA 4BC0A 1L4HA 1LK0A 3P0EA 3CXUA 4OQYA 4RYDA 3T0GA 5KYUA 2AUNA 4QHTA 1T8RA 2CLSA 1X7YB 3AHEA 4EHLA 5C1DA 2EGHA 1DV1A 5AVUA 1J8MF 2NUAB 1R0WA 4CV0A 1W0JA 2PDAA 4ND5A 3QVWA 2GN0A 1JILA 3JCZA 4DJJA 1R74A 3F3KA 3VPSA 3G9QA 1AQNA 1FFBA 2YJTD 1A8IA 2F1JA 1LJ8A 2PRZA 3EGDA 1P1HA 2Q1XA 1Q0TA 2NYVA 5SYNA 1W93A 1M2FA 1L2TA 1S2GA 2GZAA 1KOGA 1U1EA 1AKYA 5LB2A 2DBVO 2JHFA 6GPBA 2XMDA 1KXJA 1QJCA 3BORA 4GRDA 2NW6A 2FSFA 4WKBA 5C4GB 3TTSA 3ZDEA 2ZUEA 3ZCVA 3G9TA 3AINA 4M9CA 1GUYA 3HDTA 3RWOA 2WK1A 5EXEA 1FA9A 1LNZA 1S7CA 4YIHA 3CLKA 5GZ6A 5ALQA 4JH0A 2IV3A 1VMKA 3DL2A 4P3KA 2DP4E 4ZIRB 4F5EA 4FGLA 1PJTA 3V4ZA 3V97A 2DUNA 2IDMA 3TW8B 2FW0A 4QUGA 1YRYE 2FPIB 3LT5A 2NP7A 5KBYA 2WYUA 3H5IA 3H2SA 2O0LA 4H4CA 2A9OA 4CDMA 5CVJA 3TG2A 1RRGA 1UM8A 3KQNA 1P5ZB 4Y30A 7GPBA 1HETA 4PG6A 4YT5A 5I7FA 3ETJA 2AUTA 3DBRA 3ANNA 3I2FA 1Q1NA 1Q7TA 3GR6A 3CLSC 1RWNA 2FAXA 4YRFA 4P9NA 2YMPA 4R2JA 5BNWA 1WCIB 3BXZA 3C8DA 3PJRA 4QGAA 1EUQA 5CXUA 1KFCB 2ZJ3A 3ZGVA 2C9MA 3IEPA 5A6VA 2X3UA 4UBKA 2Y2UA 1J6UA 2IV2X 1JT2A 1N5KA 4IP0A 4MCJA 3DXXA 4B85A 4MJ3A 4Z4CA 5GV8A 1XEWY 1SPXA 3DZIA 2PQ6A 3TKAA 3E15A 5KNDD 3WGOA 5CFLA 3AIMA 4MQMA 4AULA 4URXR 5HUHA 1M33A 2Q6IA 2D59A 2F3RA 1H8HD 2PUHA 4QQFA 1JP7A 1M8PA 1PJ2A 2P5YA 2FQYA 3K31A 3W6NA 3UJ7A 4DXHA 5IKMA 1IVSA 1FNSA 1Z8FA 2Q50A 1T3LA 3EA4A 3SXPA 3H13A 4L95C 1OC2A 3IC5A 3RC3A 1E1CB 4ALLA 1OZFA 2QSYA 4HQOA 3PICA 2IX9A 1H2EA 3OIDA 2GFIA 1CJBA 2QZSA 3P19A 3E22B 4OATA 1U7UA 4MV7A 3O1JC 2ONJA 1F1BA 3B52X 1RWBA 1OJLA 2HSZA 5KVQA 1O08A 1OWNA 2WWGA 1DGQA 1NMYA 2G4VA 1XKTA 4BMPB 2ZWVA 4OMUA 1BYUA 2CLFB 3EVFA 4J7UA 4OV6B 1OILA 1KJYA 4UMVA 5CTJA 1AZSC 4REMA 3L1IA 1T9HA 4G41A 2C7QA 3G0HA 4QYTA 4F9FA 1NVVQ 3EISA 3ZYZA 4CCYA 2WUEA 3RT9A 2VYVD 2B1GA 3OIYA 2GRJA 2QXTA 2WM3A 2A5DA 4J3JA 5GOTA 2QD4A 2J87A 4RAQA 1IHOA 5LN1A 3SAJA 2P6OA 1W88A 2W93A 3RR2A 2C84A 4A0HA 2B4AA 5H68A 1I5OA 2W4MA 2IY9A 3ETEA 4R9RA 5NULA 3R8XA 4BFZA 2AJLI 1G20B 1OF1A 2ECKA 2MSCB 3DBVO 4ZVNA 4OXKA 4LJLA 1QHHA 2ENWA 1PVVA 4Z5XA 2GAIA 2CB0A 3K7EA 2IHNA 1K3FA 3D3NA 4Q48A 1SVUA 3IQGX 1VCMA 1VJTA 4ZU3A 2I1LA 3R6LA 2ZTLA 3KSZO 3BWXA 3F6CA 2OVBA 2AI1A 3VNAA 5LSAA 1NF8A 1PD0A 1A8QA 2D8MA 2IPLA 2OBMA 3C3XA 3KL4A 4J7CA 5FOWA 5KTOA 2CL6X 3A4IA 4I6EA 3TRFA 3RKRA 2IOHA 1X9IA 2J0EA 2GB4A 2OECA 4BBZA 2VDRB 2NO5A 1GGFA 4RWEA 4LGCA 3T5AA 3BQNB 1H9AA 3ZLUA 4B4VA 1L4MA 4RD0A 4M46A 5JS1A 2J0UB 5CB4B 4N48A 1YACA 1KAEA 3ITEA 4W8GA 3WOHA 1D4OA 5DBIA 5HUJA 3R7WA 3B51X 1M1YB 2WAYA 2FDXA 2I03A 2XITA 3F67A 3HJTA 1V71A 4FOLA 4CKEB 3PNYA 3LKDA 5JNRA 4ZD6A 2QTWB 2A88A 1JQLB 1CUDA 3K1ZA 4NE7A 3SZMA 4AG5A 3D4LA 5L3VA 3HO1A 1Y63A 3OZRA 3C8MA 1BC5A 1T1IA 2PPLA 4H7HA 4W7SA 4QYMA 3UUGA 4QM6A 4YHBA 3P45A 1VJRA 2PEZA 3U0BA 2H51A 1CZHA 1DWPA 1K3UB 1L8OA 2HMSA 5ANRB 1V1JA 1FXWF 2WABA 1YZKA 3OFKA 2I9PA 3DA8A 5DE3A 1PZFA 2I87A 2XVYA 4Q24A 4G0QA 4CM8A 3AF2A 2WM2A 4BGEA 4X84A 2YWGA 1DQZA 1U7XA 3W9SA 2WTNA 3S0JA 2CJFA 4JP8A 4B82A 3ROMA 2JBAB 3F97A 1S2LA 3NTOA 4X63A 2Q6VA 3HTXA 1GPH1 3ZNNA 3IP1A 1L5LA 5AHRA 4Y9DA 1HSZA 2Y77A 1NP7A 3DT8A 3HCEA 2QMZA 1CUGA 1RRVA 4EELA 3MGAA 2OORA 1XTJA 4PBTA 1RQPA 4JU9A 3IBYA 4U7TB 3V3KA 3ZXSA 1Z2EA 1EHCA 4M7RA 3UAWA 4CKYA 4UUAA 2FY8A 1FP6A 3O4JA 3USZA 1NJ1A 3V7UA 3IEXA 5KINB 4CF3A 3JXEA 4XUGB 4Y1RA 3NTQA 3T35A 1A82A 4HDNB 2Q3DA 1NJ8A 2DZDA 4E7PA 3IOMA 1Z8NA 4GR9A 1ZGCA 5FOUA 5BR4A 3CKKA 4YUYA 1P6QA 1JKJB 3RK0A 5AD1A 4FD3A 4C7MA 3GLHA 4BU0A 1F60A 5CBKA 3VR4A 3CNBA 3KZKA 2WLSA 2E4WA 4S0XA 4JLMA 3W4IA 4CUKA 3JQRA 3VYUB 3AZPA 3CBQA 5JWHA 4JI3B 1UFKA 2CYBA 1N7JA 3VR5A 1JKIA 4DV0B 2IUSA 1XZJA 1TQ8A 2XNJA 3CEHA 1A95A 2OT3B 3ZUPA 4G67A 3SIXA 2YXEA 3HYSA 4GICA 1MGPA 2SKEA 1YFZA 2B36A 3BWCA 3VU0A 3A1SA 1IWPB 3VX4A 3MAJA 3N7TA 3Q2IA 1A04A 3AIIA 4O1HA 2AR0A 3MUEA 4B4OA 4YCSA 4Z1MD 1A1SA 2HIGA 3VUFA 3DEZA 5F3WB 3E7FA 2B3TA 5K3BA 1KFEB 4EEXA 2AXQA 4B3RB 1XZIA 3EXFA 4N65A 1LLCA 3O0TA 3C43A 4L28A 2ZPUA 3H16A 4PYKA 2N3ZA 4EG5A 4FNOA 3GXOA 4FB5A 3EXEB 3VYSB 1GZUA 1SB8A 4LG1A 4KGDA 3OZEA 1T2FA 1RWKA 3LECA 2PMFA 4O08A 4B3BA 3E8XA 3MCTA 1IOZA 5A5FA 2TMKA 3PKZA 3Q98A 1FFSA 2AB0A 1UAGA 4ZXFA 2PSJA 5JAZA 4RS3A 3DB2A 3R7LA 5KYXB 2QI9F 1I4EB 3UMRA 4JLSA 1ZMBA 1N8SA 4G81A 4NV1A 3ETHA 3IQZA 5BOVA 1CS0B 4CM8B 4YMVA 4CLRA 1DKOA 1BXRB 5ALJA 4RTMA 4EX6A 1JLMA 3D3KA 3MWGA 1F0NA 2GLTA 3UFXB 4AUNA 3N2GA 2PGOA 3VJKA 4URZR 2Y99A 3GRRA 2IE8A 5KOJB 5LDDC 2M6LA 1R6BX 1J2YA 1KMHB 2G28A 1C9EA 5CYPA 1Z5OA 2YHBA 2YV1A 3L0IB 4JLWA 4NNPA 2Q2QA 5ALYA 4C4OA 5A9SA 1LPSA 3L4SO 3ORHA 1EZ1A 4B7UA 5IDVA 3TAXA 3HA7A 4GLLA 2G8NA 1YC5A 4EX7A 2BHRA 5FUQA 3NXSA 4QBFA 1PGOA 1HNWB 3WB1A 4OMDA 1RW4A 3M1YA 4GM1A 4JHLA 1U02A 4K9RA 4RVUA 2W98A 2P1ZA 1OIXA 2JVKA 2ZTSA 3COZA 3ET5A 3VC2A 3VDQA 2DM6A 1B8PA 3FYUA 4DB2A 3PUYA 1JS1X 5CVTA 5CFZA 4RCYA 3LA6A 1XTKA 2VTKA 3EC2A 2IXDA 1ZN8A 3A4MA 4Q34A 4ZI5A 1K8YB 4CMAA 5A3RA 2HO5A 1Y1KE 1U1FA 2ZI7A 5AKEA 1K5PA 1T0IA 4J94A 4E1AA 3PWTA 2EERA 1OYVA 1GKKA 1QLJA 2P6NA 3RLFA 3DLHA 3EAGA 3W5BA 2GXUA 4ND7A 2CVQA 2I55A 2HI0A 1CCWA 2LIVA 1YU6A 1R0KA 1YC2A 3ABIA 3IQFA 4MXDA 4LFCB 1R0SA 5KVSA 1G38A 2Z1DA 4J2OA 2UZ4A 1ZH2A 4M7OA 2QRMA 1C2YA 3L0SA 4AVYA 2PK3A 2RK3A 1M2HA 1ZYUA 3T99A 4I2NA 3ZHUA 4PGGA 2BGUA 3V8NA 1SXGA 2GILA 4OQMA 1BFKA 3EC1A 4FHFA 1V5IA 3KXDA 3WHIA 2YL2A 3PG5A 3E9ZA 4ZAZA 3KB8A 5F3DA 1BOOA 1Z35A 1G5FA 2ZDGA 4ENTA 2JLAA 3H5LA 4WY2A 4DFDA 4YXFA 3CVWA 1CUEA 5A4FS 3P5BA 2X5KO 3D4IA 5FNVA 3RLIA 2A8YA 1FFDA 3EQ2A 4ID9A 1R4ZA 4RVNA 3UG6A 4YCDA 3U4QB 1ONNA 1YJAA 4AKHA 3JQ7A 3SVLA 3FZEA 2VUIB 1KZHA 1KOLA 1MH9A 2W42A 3HN7A 5AVTA 2YJ6A 1NFRA 2A3RA 3FMIA 3ZZNA 4C88A 1U3CA 1GTMA 1GSIA 1XDGA 2JFQA 4KP7A 1Q3TA 4AO7A 2CZGA 2PMCA 2X9GA 3BGDA 1Z4OA 2VF5X 3H11A 3R7FA 4ZRMA 1RJWA 1E1CA 3CKLA 2W48A 2XYHA 2IDJA 3WQSB 2PBZA 4C4YA 4JCCA 5HA5A 1USUA 4M9XA 4BYGA 3GVIA 3LCVB 3WR5A 1E92A 4Y2GA 1JFFA 2XF2A 4M8NE 5SY6A 4LVNA 2BEJA 1PR1A 1DTWA 1O58A 1V2HE 3PEEA 4L15A 4LYHA 3RS4A 3RABA 3OQHA 4UJ3A 4DR2B 1N33B 2JEYA 4F6CA 3ND7A 3W8DA 1IWBB 2ZI4A 3QMMA 4MROA 2FUG1 2WP0A 2ZI5A 4IJKA 3K4PA 4PQFA 4BP8A 1P0CA 2UUAB 2BMAA 1ZMXA 2G04A 3GP8A 4QOHA 2MSDB 4Q7KA 1EFPA 3FNFA 4R2LA 4PY2A 3PHJA 3DZBA 3G7SA 2JG3A 1M2VA 3WV5A 1D1PA 3OZSA 4OYLA 3G2PA 5IFKA 5MGNA 4MNTA 2IE0A 2LWIA 3OZCA 1T2DA 1REQA 5AIAA 5CYFA 1FNDA 4NZPA 3Q7TA 5EZSA 4Z1OA 2ZDHA 3D7NA 3W77A 4D6XA 3USCS 2Q3EA 5JD3A 3HYLA 4R2IA 1PWHA 3QIVA 4O4LA 4QGGA 5JAMA 3VMMA 4CN9A 5LJLA 5EJ9A 1ECBA 3QTBA 3CR3C 3SWWA 1RMYA 1K8RA 3OM9A 3H4TA 1CY1A 1XRSB 3GDHA 4RIFA 5KYWB 1B4DA 4FYWA 3X1DA 3EDRA 3Q7SA 4ZT3A 5F78A 1P0FA 4O8ZA 3AIOA 5F1PA 4E14A 2HCFA 1EM8B 2OP0A 2WFMA 4MW7A 3ZJ4A 1W7AA 2A9PA 3ICOA 4ZU6X 1NXWA 4HLNA 2FMFA 4GDFA 4X44A 3DQPA 4I99A 4XFDA 1P3JA 2GZDA 4NMWA 2DPYA 1WXWA 1N92A 1YS2X 2NQTA 3PUJA 2B4KA 1E3TA 1OAOA 3O94A 2ET6A 4M9UA 1L5KA 2F43A 5A0VA 2ZB7A 4Y2TA 5AJTA 3NQ41 1Z0UA 1DDOA 2WU1A 4X3CA 2Q3FA 3CNHA 3A6KA 3PI7A 1JV2B 2WILA 4G8DA 5J1TB 5G1OA 5M5BA 1T4DA 5H8WA 4YAFA 1TF7A 4MA5A 5KSWB 2OYSA 2VPIA 3K70B 3LX6A 1KQFA 3IOCA 4HG2A 4GSKA 2HUNA 4HLQB 4JASB 4PX5A 5J40A 3OQMA 5KAMA 1NNEA 1I2DA 4NZNA 1YDHA 3GJ6A 1AG9A 3ORYA 2P2LA 5IZ4A 1F20A 2FJPA 2C07A 2NUPB 3FCEA 4OHBA 5CM8B 2K6GA 1X1DA 5H02A 4DBZA 3M6FA 1SC6A 1O9GA 1TUGA 4U7WA 2HIMA 2J6IA 1TL7C 2Z04A 3DE5X 5ALEA 4CMEA 3X3HA 2DECA 5E4FA 3RIGA 4DLZA 2DHRA 2QBYA 1POWA 3H7AA 5BQXA 4CMGA 4JJIA 2PZMA 2E3JA 4ALJA 2GZHA 2WIGA 2QUKA 2JEOA 2BCGY 4OG2A 4GR4A 1BEEA 1VP3A 1MIOB 4YCJA 1YJBA 1L5ZA 3G1TA 2QJWA 2BL4A 4EB8A 5KWEA 1PW5A 1Z6QA 3BIXA 4G4GA 1U2GA 4H0CA 4DJTA 2OKGA 4HDKB 1RDFA 2ONYA 4CLOA 4C0SA 2DUJA 2QAIA 2QA5A 1ZA2A 3N76A 4WA8A 2HRDA 3U3DA 4EMBA 2Q5QA 1FLDA 1TVKB 1AA9A 1XJ0A 2OD2A 4UHDA 4AKEA 2QZPA 3SYNA 1G60A 1LF0A 3FNEA 2CDAA 4LZLA 4N5DA 1RMTA 2H11A 4KN6A 4A03A 1LPPA 1Q16A 3WGLA 3T1QA 4MMZB 3ZD9A 4BPBA 2X8LA 3DV0A 2XPCA 2D54A 1LV8A 4LYEA 2CD9A 4A6DA 5IVKA 3LDHA 4NABA 3SC6A 3H5OA 1RTTA 4CM4B 3UT6A 1M1NA 9ATCA 4V0ME 2PTGA 4L3OA 4S1VA 2W0SA 1GUBA 1V5EA 2QTTA 3PJEA 3OZXA 2GARA 4N49A 4RL6A 5DT2A 4KRXA 1HG0A 1NLYA 3RS3A 1R37A 3NKLA 2IYUA 2C5EA 4QKQA 4XR9A 3BDIA 2IYYA 3ADDA 4J1SA 3DUFA 3H1FA 1MTOA 1FSZA 2PMDA 4KGZA 5HFNA 5C8DA 3EIUA 2IITA 5IM4F 4IQ0A 1X7ZB 2I3AA 2PCJA 2QL7A 1P7ZA 2FI1A 4E5NA 3EPJA 4XE5A 2CXNA 2X9QA 4AIIA 4GEGA 4ZRDA 2G72A 3CHYA 3RFUA 3K1JA 2X9VA 3BMNB 1T36A 1FW6A 4A27A 1KY3A 3ECAA 1SBNE 3LIIA 4MGZR 4MV3A 4YMTA 4PANA 1RAFA 3N8HA 3PVZA 2NV0A 2D06A 2GYYA 2OAQ1 4K6GA 1U3WA 2EW8A 2H7YA 3KOUA 5G0UA 2WYOA 3ZR4B 4B2PA 2X8JB 3PC3A 1Y5IA 2Z58A 1TLTA 3H5VA 3M2TA 4BKOA 1Z3CA 3CN9A 4N54A 2I7XA 5KYKA 1SA0A 3AM5A 3AG6A 1CE8A 3PQ5A 4ITRC 4X7PA 3W5CA 4PXSA 4EHKA 4WDQA 5DEIA 5BXYA 2FYTA 4P7FA 1QMPA 3TRDA 4QLBA 3GBSA 5BR7A 1WSWA 4RTJA 1XNQB 4U1RA 1N3BA 4Q9LA 2N1MA 2VAPA 3VU9A 3K8ZA 4AZ3A 1YS7A 4KBYA 4TL7A 1RLUA 2PWYA 3PUWA 4MVWA 4RFSB 1OBVA 3MB5A 4PNHA 1WKCA 4D4KA 2D5CA 1YU9A 3VR6D 3QELB 3F7MA 1RBYA 4F2PA 3ROGA 1G1AA 2GNAA 5KTTA 1W1WA 1UJ2A 3BE6A 4JI7B 1PD1A 4PE5B 4KQ9A 2DT8A 1O0SA 2AOXA 1K2VN 4MR8B 3MT8A 5F2KA 2NUTA 3L4JA 2PD6A 5DCUA 1FTSA 1P5HA 4D74A 1I3CA 2BKEA 4K8RB 1RPZA 4XRRA 2MR6A 3LG2A 4I1YA 3TXYA 5FO1A 5IPFA 4I4TB 2C7BA 3S6JA 4AQYB 2IS4A 1H6BA 1L5NA 3V9AA 4MDFA 3HU1A 2FZEA 4YRKA 1JPNA 4PG5A 4YBZA 3PWKA 1LZLA 4O0LA 4URYR 3WIOA 3ETDA 3ACDA 4FS8A 3BWMA 3W05A 1UT6A 4LS3A 1NUQA 4IHQA 4YV1A 4IS3A 1OWOA 4PQRA 5L3QA 4LRUA 3U3ZA 1GOTA 1ZXLA 2AF4C 2JKVA 4RZUA 3I72A 4PZUA 1QH8A 4RGBA 4JVOA 3ITKA 2VHVA 3C8ZA 1KDVA 3UJBA 4ZN6A 1I80A 4E03A 2XQFA 2GLUA 1T5LA 1Y0BA 3UH1A 3O4RA 4S1NA 1N9KA 4WFKA 2WNHA 3QA9A 3HP1A 2FUCA 3SBOA 4R8KA 2VT7A 5IVPA 1EFCA 5AI0A 4KMOA 3SZUA 3QXGA 3QZUA 4KPGA 2NSHA 4NECA 2KWIA 3M2PA 3I83A 5AM4A 2D0IA 4FDMA 4BMZA 1JG3A 1MB4A 4LJ4A 2OILA 1W73A 2I6TA 2XQJA 2H2IA 1ACJA 3ERCA 1CUXA 1RJFA 3HJFA 4UU1A 3UUFA 1D4AA 1TM7E 1I30A 3WYBA 3I04A 3GRUA 2FEXA 4RF5A 3DBOB 1PT9A 2FZVA 3M1AA 3C3AA 3KBOA 3OJEA 2OHGA 3O4GA 2WKQA 1ISIA 1PKEA 3PQ8A 4NOJA 1J99A 1DTEA 3P71T 4KO3S 5AOAA 5EE0A 5EJ2A 4N6OA 1ZJ4A 1Y6FA 4M99A 1YRBA 1T8TA 1U3FA 3Q3VA 2AFHB 4UDXX 5F51A 5LBUA 5B36A 2V3VA 3Q10A 4ZEMA 1NVAA 5FKJA 4E5UA 4L8GA 4OEHA 1CNEA 2P4EA 1EDOA 3LDAA 2W2QA 3ZWCA 5K6AA 4HSGA 2HJVA 2H9IA 4IEIA 5T3UA 1Z15A 3WMGA 2I8CA 2C98A 4XYLA 3AEZA 1YQDA 3A36A 4L75A 2X5OA 1UEJA 1XU9A 2GBLC 4JFRA 1N2ZA 3PSHA 5GPBA 1G21E 3ZWPA 6PFKA 3PNMA 3Q5GA 5KHLB 3M9WA 4UM8B 4JI0B 2B78A 4XCVA 1Y6QA 3UFXA 5C7IO 1SGWA 4AJ2A 2V97A 4MQ5A 2ZVQX 5BSRA 5KOJA 3ROEA 2XBMA 5HFJA 3ZDRA 5HS4A 2VUHB 1EHIA 2AG6A 3BH7A 1PTJC 1V1RA 4EPXA 4JVSB 4R0MA 2KHZA 3OOSA 3R75A 3IBGA 4O8CA 1LPAB 3EVTA 3LCUA 4LBWA 5H82A 1WD5A 4N3CA 3KEMA 4KX5A 3NBKA 2CFCA 5FJJA 2O7NA 4HAZA 5EYPA 4F91B 3ICQB 1TZJA 5K0CA 1T6ZA 1ZGAA 4YCNA 2VTBA 1PTJA 2QRLA 2IW1A 3PB3A 4GZ6A 3A0RB 5JUWA 1AC5A 1L4KA 2DVMA 1LH0A 4XTRA 4BV8A 5LP6B 4H15A 3DO6A 4V39A 4CMBA 4NAVA 3PI6A 1NQXA 3QSGA 9GPBA 5DX8A 1JLLB 1OC4A 3CBGA 4Z9AA 2OAP1 1DEAA 3FYSA 4IXTA 1XMOB 4MDYA 3DMGA 5IJ0A 3SR4A 5MDHA 1ULTA 3WI7A 1DI0A 1AXRA 3B2QA 1IBKB 2J3EA 1KOFA 2JD0A 2H4FA 3IMGA 3E9QA 4KO8A 3T5TA 1PUJA 1JIVA 2YDYA 3UMMA 4LZPA 1OBCA 2E6KA 4JXJA 2Y1WA 3CX7A 4EBFA 1GV0A 2VDMB 4TYWA 3DCYA 4KVFA 5A9TA 4GVLA 3GUCA 5AW6A 2QN3A 5IBRA 4XQEA 3R9IA 3CMMA 2BFBB 3K9LA 3K6SA 1SXJC 3F2VA 1LC3A 3NTRA 5KB3A 5BQPA 1KVRA 3R5JA 1TUBA 1Z2AA 2IGBA 2J5KA 2CKDA 1AO3A 2YFYA 5JXJA 1QH1B 2CFOA 3BRSA 4JT4A 3O8NA 3WDSA 4CQNA 2REQB 2P2CA 4RHUA 4IIYA 1GLVA 3M1IA 2V58A 3HC7A 2O8BB 2C2KA 3CKYA 3ODGA 1XZAA 5UKDA 3C3DA 1C0LA 2EJCA 4BBPA 4YRIA 5KC8A 5MN4A 2UXCB 4D98A 1A5AB 1PK9A 2P5TB 3HA5A 4F86A 2YVAA 5KKAA 1SVKA 1PR2A 4N3NA 2NT3A 4TMWA 3HU5A 221PA 4IUDS 3WZLA 5E6UA 1G8JA 4FLFA 3N2KA 3TS1A 1B8NA 1FMTA 3UK7A 2I3GA 3A1WA 5E95A 1QFXA 3N05A 1N6RA 3H3XA 1DV2A 2OG2A 2XY4A 3MGGA 1KNQA 3OU6A 1EESA 4E0BA 2C78A 3M1LA 3NWEA 2ZFUA 5BV2P 5FFFA 3M6LA 3F78A 3OT1B 2R65A 4PPYA 3KEGA 3MOGA 1L1FA 5KNCH 2QP3A 1Z8HA 3TSYA 3AC0A 3LH5A 3LXMA 3NHLA 2P62A 3IGFA 3QHQA 5FOSA 4F6RB 4X7BA 2OB2A 1TKBA 2EC5A 3BQMB 3D4NA 4P4GA 3X1WA 1SU8A 2MSKA 3NC0C 4N76A 4CLOB 4JLNA 4DCPA 1RJ9B 2F55A 4LJRA 1EGVB 1FRZA 2ZSIA 5IAKA 2JASA 3K5IA 1FL9A 4A36A 3MJSA 4M1KA 4QU5A 2WVJA 4GZMA 5TJHA 4TZTA 3JQBA 1P9OA 5LOVA 1SQ0A 4RPHA 4MWDA 2FMKA 2XKBA 3BJZA 3F6EX 1FYVA 2Z3VA 3Q7RA 3N8GA 1GCAA 1NHWA 3EEQA 3MXTA 1P1FA 5LWHA 2Q6LA 3C74A 3E2IA 3KSRA 4GPEA 3HWWA 2Z08A 4F60A 4NCXA 4ANFA 1S2MA 2N0SA 2QJFA 1R3DA 2CEAA 3BCHA 4BGVA 1JHDA 1NN0A 2H92A 3PF8A 5AVQA 4CKWB 1UOPA 3COVA 3NPMA 3VI3B 4M0DA 5ALHA 2GF9A 4HQ6A 1PX0A 2CJXA 3FAKA 4EFLA 1W85A 4CM3A 4OGGA 4UMEA 4RV9A 4HAXA 4ZPXA 1ADJA 1K6XA 3F8WA 3ZW9A 3F3YA 3Q5DA 4BO1A 2B6HA 3O92A 1JLRA 3JD4A 4XWAA 5JRJA 1DJNA 4HJXA 2R8OA 1UWKA 2VNSA 1NW9B 2E4VA 3GP3A 2FPKA 5DGIA 3DE3X 4CKXA 3OQPA 1E99A 3AUYA 3U9LA 1Q20A 2JJ2A 2CBXA 3B13B 3M5WA 4B46A 3DMYA 3ZLBA 2DSNA 3ZBPA 4CIYA 5TE9A 1K4MA 4LJ8A 3LXUX 3NW9A 4DBLE 4DE5A 1MXHA 4S24A 2O23A 3TLYA 5KIAA 2X19A 1XBTA 1MD9A 1T3SA 1XA4A 2Q1YA 3C6KA 2AN9A 2J9GA 3KD3A 3NH9A 4HJRA 5E3HA 4EO4A 3FLEA 4DDWA 1PX2A 2P4SA 3TQIA 3RYFA 2CVHA 2P0YA 2RAUA 4W1SA 4O2AF 1NHGA 3G1WA 2Q0QA 3WNVA 1T9ZA 5HF9A 3P0IA 3SSNA 1UCFA 1U5AA 1CV2A 3OE1A 3BB3A 4OHXA 2PU5A 5DHAA 5L7YA 3QVMA 2P9HA 4ZZ1A 1ZESA 2Q8QA 1ZJ6A 1FUKA 5AOBA 3ROTA 2J6CA 5I8PA 5JMTA 1MAWA 3P5SA 4RTPA 2JIDA 1XWIA 3DMRA 2H2GA 1R0BA 4OF4A 5CJ2A 1WXGA 1XTVA 4HQLA 4HWPA 4NI5A 4WKNA 3LDGA 4GPBA 3L8ZA 4MOWA 2RJNA 2R5NA 1IZ7A 3KR2A 4UM5A 3TW4A 3WBFA 5HQJA 5C3UA 1OVGA 5AW4A 1LBEA 4RZHA 1E89A 2J3HA 3EIEA 3FZYA 3LUHA 4FI3C 3VKWA 5BNIA 1CC1S 3UV3A 4MUBA 1OASA 5EUBA 3BH6A 2YZKA 3ZCPA 1GYRA 5HJEA 2IPOA 4A0SA 2PL9A 4IS2A 2QENA 1KYYA 2OK7A 4MIKA 2CMDA 3E3LA 1K6IA 2F1KA 2NTYC 1RHQA 4PR3A 5K8VA 1O89A 4FJ0A 1XQ6A 2ASEA 2JW5A 5EAIA 3BZBA 3E58A 1GCGA 3MIIA 1ONOA 1Z0IA 1QPBA 4OQQA 1KJ9A 2QVCA 3B20A 2B2CA 4ZDIA 1AHIA 4L7VA 2IY8A 5GJCA 1O95D 1AV6A 3PQDA 4PZEA 3STWA 1YBFA 2PX8A 3WLHA 5DXAA 5CB4A 3DO8A 4FGJA 1OB2A 3HBMA 4WMLA 2IKQA 5J43A 3COWA 3L6UA 1TE2A 2H1IA 4FJ2A 5AKGA 4NBTA 4DA4A 3U37A 2FPMA 2HMTA 4CL0A 3LWBA 4UTOA 2XE6A 4LE0A 2YJGA 4B74A 1NJGA 2BKUA 3KPWA 4DB4A 4FZ3A 2H06A 1LS6A 1JVNA 2PGIA 3L0OA 3TLGA 1GAEO 1SBZA 4MHSA 4G0YA 3UWPA 1JDTA 4G5HA 2BV3A 5ADVA 3WAGA 4M1ZA 1GPLA 2DTEA 2XGOA 3HYNA 4RMJA 1KBOA 2IU3A 3WLNA 2Z9CA 1PFUA 1NBMA 2PQ0A 3IKTA 3Q2KA 2C4WA 2FPOA 3HEBA 3G2QA 4UOQA 3RCBA 4MYCA 3NV7A 4JBXA 1HLDA 4RJIA 1E9AA 1V5WA 1UKVY 3DULA 3MEQA 3QJ5A 16PKA 4RK6A 4HNUA 4TMXA 4DDTA 5JY1A 4AO6A 3ZVNA 3WV4A 1OIWA 1SG6A 3DW1X 3EOZA 1T1GA 3IHWA 3GRVA 4IILA 3KJFA 3F6BX 4U3JA 5BRNA 3HXQA 4EJSA 4I4NA 3KUKA 1L3IA 4LUCA 4MRMA 2B9VA 2GZSA 4CDRA 3E3NA 5DM2A 4KPFC 3UK1A 3Q8XB 4YUZA 1K8XB 5G40A 2VRCD 3RVJA 2ZRCA 4CMCA 5C9ZA 3MHTA 2ODNA 1GHTA 2VXOA 1BH2A 2O3JA 1L8XA 2PPVA 2PFSA 2XGGA 3OE4A 3QY9A 5TRTA 3DAOA 4BFUA 3PA8A 4E33A 1J22A 3THRA 4RANA 2FWIA 3P52A 3QLEA 5BMVF 5EE3A 5GWXA 5EJIA 2PO7A 3S68A 4B3DA 1Y1SA 2ZUSA 4B75A 4L85A 5IDXA 3T4XA 3PF9A 1MKYA 3S99A 5DM4A 2PZLA 5EFZA 2FA9A 3SXJA 1JIQA 4XJVA 1RT9A 4PLPA 4RTOA 3B8HA 3VO2A 4X0EA 2O8FA 3B3FA 1UDBA 4Q6BA