3A1FA

The crystal structure of nadph binding domain of gp91(phox)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
163
Chain Sequence
b'IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-245 heavy chain
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of NADPH binding domain of gp91(phox)
rcsb
total genus 56
structure length 163
sequence length 186
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08030 NAD_binding_6 Ferric reductase NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3a1fA00
1NDHA 1JA1A 1QG0A 4YHBA 5FA6A 1FNDA 2BSAA 4Y9RA 2GPJA 1FRQA 3LYUA 1W34A 3QFTA 1TVCA 1J9ZA 1H42A 2CNDA 5GV8A 3W5HA 4YAUA 1QUEA 1QFYA 5EMNA 3W5UA 1I7PA 4U9UA 3VO1A 3W2EA 3A1FA 4K1XA 1E62A 3CRZA 3QFCA 4YAFA 1GVHA 1W35A 4P6VF 2QDXA 1QFZA 3QFRA 1GJRA 2BPOA 2BF4A 1H85A 1FDRA 4YAWA 1QX4A 1BX0A 2BGJA 2RC6A 2EIXA 3MHPA 1B2RA 1UMKA 4Y7CA 2VNHA 4G1VA 3ZBTA 5KSWB 3W2IA 1GR1A 1OGJA 1QFJA 3ES9A 4Y9UA 5H5JA 4G1BA 1CNFA 1IB0A 4BPRA 1AMOA 1BQEA 3JQPA 1F20A 4WQMA 5H59A 3W2FA 4AF6A 1EWYA 1QUFA 3OZWA 3QFSA 1DDIA 2QTLA 1EP2B 1E63A 4AF7A 2X3UA 1E64A 3VO2A 3W5VA 2R6HA 4F7DA 1OGIA 3JQQA 1TLLA 2XNCA 4DQLA 1EP3B 3OJXA 1QH0A 4UAJA 3QE2A 2B5OA 1JA0A 1GAWA 1EP1B 3ZC3A 1QGAA 3ZBUA 2QTZA 2OK7A 1FNCA 3LVBA 2OK8A 1SM4A 3LO8A 4DQKA 2PIAA 1CQXA 5GV7A 1GO2A 1QGYA 4YALA 5THXA 2XNJA 2VNJA 4B4DA 1BX1A 4FK8A 2VYQA 2VNKA 1FRNA 3OZUA 2VNIA 2BGIA 2RC5A 3LRXA 3W2GA 3OZVA 1DDGA 4YAOA 4EH1A 4C43A 3OJWA 1A8PA 3W2HA 2VZLA 1FNBA 1KRHA 1W87A 3FPKA 1GAQA 2BMWA 3JQRA 1QGZA 1JB9A 1CNEA 2BN4A 3FJOA 1BJKA 5TR9A
chains in the Genus database with same CATH superfamily
4LEIA 1B8PA 2FGJA 5A3VA 4QJ5A 1L5MA 1GUBA 1FDIA 1ODLA 4GQAA 4MPDA 5BSEA 2XSZD 2O8BB 4A7PA 3RIYA 5AW8A 2AKYA 1SHKA 3A4YA 4A3SA 3WOHA 3FKJA 4Q7JB 1VYHA 5KPDA 5LMZA 1RJDA 1N2ZA 2IQIA 2DU8A 3BILA 5GM2A 3LZCA 3NAQA 2PTGA 3ZXIA 4JENA 1ZGGA 2H8GA 3VU0A 4KXUA 821PA 3S8YA 1NA5A 4HYTA 3RVDA 4LVOA 2CV1A 3SSAA 4RQBA 3H2KA 1XPRA 2CVFA 1UBUS 5SV2A 4O08A 1RQPA 4IDEA 5J43A 2Y0DA 2FGKA 3WJ7A 3IKMB 4K6KA 3B1YA 3G13A 1C7FA 4MULA 3D3NA 1H3NA 4IDBA 5DVZA 1TCCA 2B6NA 1U4SA 5J23A 2FMFA 5DNEA 3ZQUA 2FZ5A 2ON6A 1BWRA 2HIMA 3IJ5A 4JUBA 1W44A 3DC7A 4QDXA 5JRZA 2O52A 2BM8A 2JKVA 1CB0A 3C87A 2I3BA 1PTJA 1S01A 4QPNA 4CDNA 1RVDA 5KQGA 4P0PB 3KFVA 4YV1A 3F6YA 4FT2A 4BLSA 4ETWA 2RHWA 4Z2YA 3TS1A 2VYFA 1QV7A 2ZYDA 4U8HA 2EF1A 3NAMA 4JODA 3CXUA 1H2WA 1OAKA 4LOIA 4P3OA 4PGGA 4EHBA 2YFYA 3HDYA 3CGWA 3L07A 1E8DA 1C4KA 2HMVA 1GG9A 1TXGA 2XUKA 4JL6A 4OFBA 3UK1A 3HCNA 3P97A 2ZJFA 1RWMA 3WFZA 1JHAA 3HJGA 3LSYA 4FCCA 4I6JA 2XB2A 1RKVA 3KD2A 5TARA 2FQYA 4OBEA 5CVUA 2IA5A 1K4KA 4IXNA 4L2IA 3D0RA 3ITKA 4CQMB 3WIBA 2XDWA 3ZOKA 1KQFA 1NBOA 1ZD2P 1O89A 2VCYA 4HOYA 3MCTA 5IVKA 1HXHA 2L0XA 4Y6PA 2P11A 5C7IO 2IX9A 5A4DA 2O59A 1KJNA 2O2ZA 4CQLB 2NUAB 2G9ZA 5SYAA 2KHZA 4NYIR 3ZGYA 3HXKA 1RAEA 3C7AA 5KSPA 1ZCAA 1A7UA 1TYAE 3BS4A 4JQYA 3W2TA 3WP1B 5EIBD 1M6EX 3SFTA 4X45A 1E2KA 1UK7A 3BD7A 3PFNA 4ZYYA 3AJRA 2YHIB 2AEJA 5IT9A 1ZD3A 3WLLA 2HTEA 1G98A 2X2OA 4G07A 2NVOA 1GNQA 2BMJA 2D4HA 4RMHA 4RPLA 3U48A 4AUKA 4OUDA 2E5WA 4WL0A 4CETA 3NC1C 1U5AA 4YQEA 1PFVA 3WLJA 4R69A 3C15C 4HAZA 3ROZA 3ZZTA 4K9LA 2JD2A 1PU2A 2JKZA 2OYCA 1G16A 3GG9A 2ZXUA 1GPBA 1ZEMA 1U5BB 3L8CA 1R7RA 1THTA 1ZC4A 4ZHQA 5CBKA 3F6EX 4XM1A 1ODTC 5AK5A 1L5YA 1MG5A 2VJLA 4NDZA 4OHBA 4QRHA 3VR6H 1RQGA 4HEHA 5H9VA 1DXYA 2Q62A 4KR2A 3E9YA 4IBOA 2IRWA 3R4VA 1FNSA 5IW8A 2BEVB 5CB8A 4AWBA 2XJ9A 3EF1A 4H59A 4QNMA 4B79A 4FP9A 1E2DA 1ZOSA 3DULA 3OMLA 1LS6A 4QRDA 1I51A 1U2TA 1QHHA 3LX6A 2Z43A 4IH4A 4XCVA 3K70D 4DCJA 1JH8A 1PQ4A 2D3WA 2XD9A 3B51X 5KPJA 3DHNA 1NUAA 2I67A 1O0CA 5TJ9A 1VE1A 1IY0A 1VTKA 3RVOA 1E4OA 2PZAA 5LWHA 5A0FA 4KSBA 1TZJA 5JZBA 1ORRA 4W7IA 3C1OA 2Z8XA 3EGDA 1U02A 2JEOA 4CKCA 1YUMA 3JYQA 1EFHA 4PAOA 2EARA 1NVXQ 2WLSA 3K0EA 1R6XA 5JDCA 1HE2A 4XQCA 1WOMA 3PGA1 1T5LA 3DT8A 3K96A 5DNWA 2R85A 4U6SA 3SS7X 3DOJA 4BWYA 5AFSA 1PG0A 3OZGA 1NJ5A 2O1XA 2XWBF 3T9FA 3LL7A 3IQHX 5EIXA 5HILA 5BSGA 5CW2A 1W5FA 1VCOA 1YBVA 4DY6A 3FYUC 1X2EA 4PINA 5GQSA 2NU8B 4DKJA 1WMFA 1FP7A 4MCIA 5JYDA 3DE5X 4I50F 2QG4A 3PPWA 1GJRA 4Y1GA 4LSGA 4QUGA 1GPJA 1P4HA 4FOLA 1PVOA 4QPJC 1ZHOA 2FTKE 3I01M 1FQJA 3DV2A 3IPCA 4BP1A 2W6PA 2WYHA 2B3TA 3UWKA 5BR4A 4FQ7A 2VUSA 1MO6A 3DHVA 3UHOA 2K7ZA 2OMEA 1F8GA 4AKGA 4YCDA 4C5AA 1LDEA 3OCXA 3EH2A 3F8TA 1UIMA 1LF0A 4IY1A 4WZBB 2YJTD 2Z4TA 1ICIA 4N5LA 2W2KA 1GILA 3IAXA 4GPIB 4LXGA 3ZTWA 4TTPA 4WJZA 3WLIA 4Z7JA 4PCLA 3VZPA 3OQVA 3GD7A 2H0RA 1G5TA 2X5KO 3A58B 3V4OA 1DPGA 3BFPA 2X3FA 4HYEA 4KIJA 1OKKD 4WNIA 4QVGA 4DRXB 5CLGA 4EOGA 3V5NA 4C5BA 3DOFA 2DBYA 2R5FA 3D7NA 3G8BA 4P83A 3IQXA 4D41A 1M2WA 1JFFA 3GGCA 4WT7A 4DNQA 1U1FA 3GGGA 1R0RE 1O3YA 1SG6A 1NWHA 2C1ZA 4HMQA 3VJLA 5CB6A 5K0SA 2IYVA 1RP7A 1Z75A 1YA4A 4J7AA 3UJ6A 3QEBZ 2RAVA 2R2GA 3QE4A 2B7BA 1UDBA 5JO0A 1WRBA 2IZ1A 1EP1B 4BYMA 3U5TA 3K09C 1ZW6A 3ZBUA 4JOBA 2YYAA 4G8DA 2XMSA 3M4ZA 4QJ3A 1XZGA 3DUFB 3FYTA 3KB2A 2YYZA 5GP1A 3WL8A 3DOCA 2BP7A 4EDFA 1KU6A 4JY7A 1IOWA 5H3HA 1M54A 4YNBA 4IAOA 1YQ9A 1CUFA 3SHOA 3RVPA 3ETDA 1J0BA 3UJHA 4WKOA 1DIGA 1CP2A 3IUEA 4NG5A 2OFFA 4YO7A 3BF7A 1UXHA 3L49A 4BRUA 1PS8A 5F12A 2JI7A 1RRFA 2ALJA 2HJSA 1FUKA 3J7TA 2ZM5A 1YBHA 1NM5C 1R74A 1NGSA 1F7VA 1VLHA 4DEYA 3R09A 4MJ3A 4I3FA 2HAEA 4CT4B 1TCBA 2WSIA 3JWEA 3F2IA 1X8JA 3MWEA 3S2YA 4DYHA 1XT6A 1GPAA 1R0LA 5CFNA 3P1JA 2E5LB 1ADBA 3TDNA 1RI1A 1Q0UA 1VLVA 3AG5A 1CY4A 1XDZA 2Y67A 3BE5A 1V4BA 5AXDA 2JIZD 2QNRA 3DBVO 4I81A 2OFWA 1NIJA 4KPUB 5FA6A 3TE6A 1CR6A 3VNVA 1Q6ZA 1QK5A 3EN0A 1OC2A 2G71A 4KC0A 4CIAA 4Z53A 2BFDA 4AMZA 4WPGA 1RLIA 2W0MA 3PT5A 5IZCC 1Z06A 3C1UA 3LYUA 5DZSA 5EP4A 1XTTA 4NCHA 4QU9A 3QBVA 3JYHA 3AF0A 2ZJ1A 3OLZA 4PRKA 5FA8A 5T7BA 3ZDEA 1BNCA 1FP4B 1HORA 4V24A 3KUUA 1T36A 4FMDF 2W2NA 4QXMA 3TAXA 5AW4A 3R3VA 3ZK7A 1V71A 3AUUA 3ABSB 3KYIB 4OXYA 4EJSA 5JAUA 3LPMA 4IWNA 1EK1A 2WICA 1H65A 4MIYA 3SLGA 2AQHA 2WE7A 3MK31 3ISJA 3EF3A 4YFVA 4ZOCA 1JHDA 5BMVF 2GI4A 4KSYA 4CMEC 1I3LA 4ECEA 3EXHB 4KXNA 1ADJA 4RY9A 5AIBA 2J32A 3W4IA 3IKJA 1D6MA 3KELA 1B7GO 2EJCA 4GOND 3AU8A 3R40A 3BCSA 4TOIA 1G9SA 1FTYA 2ZI4A 4M9UA 4ZAYA 3T7DA 3CH5A 3CUTA 2PLNA 3AR3A 3PB3A 2F2TA 1F9AA 3CEAA 4ZAGA 3JATB 2KYRA 5EXTA 1B41A 1S02A 5LNK6 5K0NA 1P6XA 2XZTA 1SQ5A 2PJDA 3CUUA 5GAJA 1BZYA 1TO6A 1ENOA 1QAOA 4RDCA 2HWXA 4YMVA 2WQ7A 2P3OA 4UUBA 3PZBA 3I4LA 4Q9AA 2HHJA 4R4JA 4MGIR 4X8LA 3FRIA 4GF5A 1RXCA 4LPSA 1E3IA 2QYOA 4IIYA 3D6VA 4NL4H 4V0QA 4YGYA 4ZTZB 2IH2A 1Q91A 1SKUA 3GAAA 3U9LA 3IHKA 1NNEA 3K6SB 1P7PA 2H7XA 5GY7A 4EI9A 5CITA 3M4JA 4QYMA 2CHVA 1WPRA 5HRUA 5CX1B 4QEZA 4FOOA 2ZB8A 3KEFA 4YAKA 4G1UC 3WMFA 5IKMA 4PNEA 2XQGA 1QGUB 4KR0A 4ME6A 1KVQA 2OV1A 1I6LA 4B2YA 3EEBA 4RGYA 3EH1A 3HY4A 1WBBA 5K0FA 1AH2A 3ZE9A 4EA8A 4HGQA 5TVGA 2QTZA 3TJZA 3FNFA 3I39X 3E15A 2CNWA 1N8SA 2G1UA 3FRHA 3OOHA 2EXXA 4KTVE 1UKZA 2PMFA 4OA5A 4MI6A 1L3CA 2XKKA 4NPCA 4LF4B 3H5VA 3FETA 3BSSA 4EA7A 1YASA 4HH3C 3A2MA 2FMIA 4DARA 1KPHA 1VXRA 3TVTA 5DYGA 2PJUA 2HPVA 3P0HA 3PZRA 4MGEA 1Z0DA 5AXBA 4WA8A 5DLPA 1W1WA 1HGXA 2XLCA 3OIYA 4UPVA 3JD0A 3KJXA 2J9YB 4UTOA 2A94A 2FUKA 1FLVA 2WHPA 4LZPA 1WMAA 2D2XA 2G5CA 2ROQA 1SUAA 5TGDA 1KRHA 1XBTA 2IYTA 3D7SA 1K4YA 3QOWA 4K03A 1QP0A 5JCXA 3ZWAA 4GI7A 1OW3B 3CFYA 1SIBE 2WIGA 3DWEX 2GHIA 4O1HA 1BO6A 3CZCA 1WABA 1TW2A 3RT7A 2ZB3A 5CUQA 4I36A 4YYZA 4JHXA 4IEIA 3WYFA 2VRCA 4TN1A 5JLJA 2X9GA 3G2MA 4ESVA 4MV9A 3ZXXA 1E89A 3A9SA 1V35A 3KLOA 3OIVA 3GT7A 4FKBA 1D5CA 3CLSD 3ZDFA 3WGIA 1S2IA 3AFOA 3ZGZA 4YCCA 4RLSA 1MO3A 4OYLA 2YUIA 2QOEA 3HBMA 3F90A 4E03A 4FMCB 5GONF 2PNJA 2YYYA 1BKYA 4CQMA 1YRBA 5BO5A 1NBMD 5L3SB 3M81A 3L4JA 1QU3A 4FMCF 5GONB 5SICE 3P8ZA 4LGMA 3ZY3A 2WYOA 1RAFA 1Z4KA 3GNLA 1TLFA 4TWRA 4ACAA 3OLYA 1VQ1A 2WD8A 3I8XA 5I4KA 3QHPA 1IEVA 1GY8A 2D5AA 1R0SA 4FZ3A 4FZRA 1T4MA 3IQDB 4I08A 4JQOA 4MUGA 3QWIA 4F45A 1KOGA 1JFSA 1ZXBA 3PR1A 1WDLA 1Z28A 2R4TA 3KOYA 2X3YA 1GA6A 2HKIA 3K0AB 3LM8A 4QAJA 4F60A 2GUWA 5ICFA 3VAAA 1PGNA 4MVXA 4GVXA 1QX4A 4NU8X 3LY8A 4JA2A 4KXFB 4N54A 1N6RA 3L93A 3UJPA 4MCAA 4QVKA 3SYTA 2XWJI 4PZYA 4UEKA 3ITDA 3Q8KA 3RANA 1SIWA 2M98A 3PQ2A 3JALA 3OCJA 1Q3KA 3BL5A 3EEOA 1XTKA 4P5DA 1YZTA 4XCQA 3VH4A 1P5ZB 1RYZA 5FJJA 1EZZA 3BJZA 4NC9A 3SYRA 2A1UB 1ONOA 2GBIA 4QNNA 5F77A 2JFXA 2VP4A 1K63A 1DAOA 2ZYAA 3A25A 4RPGA 1A97A 5ESXA 2J41A 2QPTA 2PKQP 3CIFA 3JQGA 2MR6A 4TXLA 4AF7A 4PR0A 1U5CA 1SELA 2R8ZA 3KNZA 3T7AA 4YMGA 1HYGA 4PLGA 3PWSA 4QHSA 1Q84A 4EITA 2UZ1A 3QOXA 1U65A 1VKNA 2CLHB 2F9FA 4YWHA 1AKMA 2H17A 4MVJM 2M6KA 2CDNA 2AN9A 1XSEA 3R20A 3Q8XB 2IY9A 3CX7A 3O7WA 1B93A 2AB0A 3I9V1 4JOQA 5CRIA 3KZKA 1LPBB 2QL9A 4NXNB 3UNXA 2NUAA 2NT4A 3AIIA 2J5QA 4EY8A 1WJGA 1YOVB 1QOQB 2GETA 2WR8A 2MR5A 5CCDA 3PPYA 1FA9A 1I0IA 2WDPA 4TLAA 2WF5A 4MV4A 3HH8A 2CUKA 2II6A 3KKPA 2CXHA 4JI4B 1QBGA 1PW7A 2OKGA 1N7HA 3LQ4A 2P4HX 2CC2A 2XOEA 4I8XA 2JAPA 2Q3FA 1AKEA 2I3ZA 4URUR 4C1BA 1KJQA 2YVQA 1II0A 3B7WA 3OOJA 1YTUA 1KRXA 2G83A 2UXCB 4TXHA 3DDSA 1Z63A 4CNQA 2X9VA 2XA2A 3OM9A 1GTRA 4NCNA 4CM9D 5LQDA 1XTRA 2R8PA 3PCTA 4J0IA 4TUYA 3K92A 4XEHA 1SCKA 2AUNA 3KKQA 4K9SA 3SXUB 5I7FA 3MB5A 4Q66C 1KRWA 2HNKA 3KYCB 3TXAA 3NKVA 1V11A 2ZZNA 4GFDA 4X95A 1L4NA 1PBTA 1XAHA 2VRWA 1K6JA 3AVQA 4DCTA 5C1PA 4UAGA 3AM1A 1YUBA 2FI1A 1QK4A 3B85A 1HFJA 4X91A 3PC8C 3BQMB 2BN4A 1PQWA 4NBRA 5FWXA 1ZNWA 1NMYA 1KF0A 4QPCA 2AQIA 2PGLA 3BEDA 4M7PA 5TEWA 9LDTA 3KKMA 4MR8A 4MCJA 5GWXA 1SUEA 4X60A 1R64A 3K31A 4EY5A 5C37A 2R8XA 1C8KA 1Y42X 4IMRA 4JAVC 4DQUA 1W48A 1XCGB 5D2CA 3BF8A 1E3DA 3GFGA 4OEHA 5JTTA 2C57A 4KLZA 3EB9A 1FX0B 1W8DA 3UCXA 1RXUA 3HBFA 2GUGA 4R83A 4W1RA 2YVLA 3IO5A 3IAS1 4KU4A 5EMNA 3V8MA 3HL4A 3IJPA 4ZVSA 2YWEA 4I8DA 2XITA 3OFJA 4G09A 5EGNA 1FJ2A 4CHTA 1LWNA 4B6RA 5HS6A 2QZ4A 4Y1RA 4C06A 5K4HA 1FIUA 1TM2A 4N03A 4H3HB 1XMJA 2FK8A 1HSZA 2EJVA 4RTOA 3AVWA 3GFQA 4WZAB 2E1PA 2I4NA 3Q12A 3R6LA 8ATCA 4BNTA 2BGJA 3MD9A 3P71T 10MHA 3IULA 1JDJA 3P26A 4F3KA 3W6UA 3PHGA 4KR3A 2AOUB 1A8SA 3MMXA 3PD1A 1J5XA 5I48A 4Q9DA 3GLIA 3EUEA 4RULA 4XFKA 2XB9A 3DAOA 4X64B 1W25A 1YE5A 4C2UA 4XDYA 1J7KA 2YJ5A 4KXMA 4RXMA 1U0LA 3E1GA 2B3DA 4ENVA 2HRRA 4UTNA 1Y1TA 1CZLA 1KIMA 1NR1A 1UJ2A 2NZJA 3JZDA 4REMA 3RSGA 1KARA 3ZKAA 3EZNA 1SOMA 2J9ZB 3ZTYA 3HXOA 1BN6A 2X8LA 1PCXA 1Z5PA 1ZD8A 2GRJA 4URZR 4DNFA 3WLAA 4D3XA 1WZIA 1BMFD 1JG4A 1H0RA 3NOXA 4I1IA 4IF6A 4KL8S 5CJ2A 4YRNA 1ZRSA 1G20E 4F4HA 5LP6C 5TVKA 4MYCA 1JQ5A 1GDTA 1E0AA 1Y4AE 5KNDD 1P1BA 3FZGA 3I0NA 3QWHA 5FFFA 2YQ4A 2H08A 3JPYA 1E0JA 1C50A 2E55A 4K6OA 4ZT5A 5AXAA 2ACKA 3PE4A 4BFSA 1C14A 1GAWA 2YQZA 3Q7IA 1QGAA 5E9WA 4QA9A 2RHMA 2D1SA 4KJZA 5JWOA 1K8RA 1TD1A 5BN3B 2Y2UA 4ZANA 3GRCA 2DKNA 3ODGA 4FONA 2R68A 4COKA 4IIHA 3W9SA 1WETA 3JVEA 5JROA 1ONBA 2CMKA 2P9QA 1NJ8A 2EG5A 4B4OA 3CR7A 4KQKA 4Q7MB 5PGMA 2VNJA 1MJHA 3E9DA 3PI6A 1KAOA 2EZUA 4MGKR 3NBYC 2HSEA 4WGGA 3A05A 1AXGA 2C4VA 1USKA 2ZS8A 1A9PA 1FUUA 1E1QD 4CMKA 4EL0A 1V16A 4NOLA 1DDGA 1C29B 4GI5A 2G9RA 3G0CA 4X41A 2FLVA 2J6BA 3REGA 5JVDF 1E3EA 3OOSA 1NBWB 3NBMA 2SKCA 2EJTA 1H0HA 4MPTA 5FPTA 3VDMA 4EVQA 1BOOA 1I36A 2DQ4A 4PG6A 3IB6A 3UZUA 4D74A 2HPZA 2IZ0A 5DBFA 2OHFA 3QXJA 4BO9A 2LDBA 2DQKA 1IN4A 1F8UA 1W88A 2OE2A 2RG7A 4ZI7A 2BEUA 4CLRA 1MX5A 4WZAE 5KVSA 3KCNA 4HR7A 3TZBA 1Z3IX 2QW1A 1SD1A 3L7LA 1LJLA 1HLDA 3IEKA 5M2QA 1GITA 3RVLA 4GXNA 1FDOA 3ER6A 1SOWA 3WGOA 5B4TA 1T8PA 3OZSA 1ZA1A 2V8OA 4DV4B 1R6UA 4M9CA 4PXYA 4L16A 1NNUA 3EDMA 2CSUA 3CV3A 3H7AA 1DFIA 1T9DA 2R3SA 2VPIA 4JEUA 3SXPA 4P3PA 3MVEA 3OOEA 2HBYA 1KI1A 2ZJ2A 4XD2A 1P2UA 4IHJF 4UBNA 1X13A 2QDXA 4XYLA 5KYUB 1H94A 1C1YA 1M1ZA 4OMCA 1B0UA 1UXJA 2YRXA 3ZJYA 5KOJB 4I4NA 1JDPA 1WY7A 1U9CA 2WAAA 4LHZA 4QEDA 5FUYA 1E5DA 3IEXA 5KBYA 5BVHB 1KETA 4PFQA 4XJVA 4NCJA 4JV5B 2ZWPA 2VL7A 1GNTA 5ADVA 4IMJB 4ND4A 2I2DA 2M6SA 5LDGA 2X15A 5AVVA 4J0HA 4UNSA 3M2PA 5AI4A 2BKUA 1L4KA 4BLUA 4DB4A 3JYPA 4IZIA 4AJPA 2WJ3A 2CNBA 1SY7A 2R1VA 3LPAA 2OM2A 4WOPA 3RKUA 3VZCA 4EG4A 4BLWA 3CO5A 2F9LA 1FDVA 3GVCA 3FJ1A 4M1QA 4B85A 4XQ9A 2RGRA 2FUG1 2V98A 4RIFA 3G0DA 4U5QA 1WZEA 3GI1A 5BR7A 1SUBA 3H3FA 2HEGA 4MNTA 4YMWA 3VPCA 4EY3A 1SR8A 2XIQA 3AT1A 4K6FA 4TXMA 2F6RA 3PQ8A 2C97A 2CEAA 3KOXA 4QXAA 1YZVA 4B33A 4UFPA 4AYWA 1B00A 2ENUA 4DHWA 1D1SA 4FFMA 3TFWA 1B6TA 4O0LA 5TEVA 1E0DA 2W70A 5E1DA 4FFPA 1TAGA 3T9DA 1SOAA 2ZSUA 2QR3A 4MQBA 4OHPA 3WYDA 5AO9A 4N40A 5TT0A 4QZVA 2RGUA 4PSDA 5JC1A 5HF9A 1U1EA 2QN8A 3DMPA 3SHWA 5AVYA 1NYTA 3UB4A 1VHWA 1PEYA 1ETHA 3ELYA 1OWNA 4ZEMA 3NHPA 2PBZA 5HYVA 4IZ6A 4QQRA 4UHJA 3ZWWA 4RHXA 5E1MA 1OHHA 4JJFA 3U62A 2OORC 1EHIA 2DPGA 3IEUA 5C4MA 1BX1A 1KSJA 4J75A 3UPDA 5ETJA 5A3RA 2JGDA 3SQNA 1U2PA 2XTZA 3EWAA 3FDXA 4M0DA 2FZGA 3V2GA 2N1MA 4HLUC 5DCLA 4BNZA 1PKXA 2FVXA 1S8OA 3LPCA 3PFCA 3HWWA 5HF8A 2OENG 4WN9B 3F6SA 3OE7A 2XRZA 3THXB 1CUVA 5JJLA 3CF6R 4EJFA 1JJFA 1KPIA 2FUEA 3KHTA 1QCYA 4UNNA 4EW3A 4DMRA 3NTQA 4ZOAA 3EAGA 4WIAA 5HM8A 1UEIA 2FW6A 1UBOS 5F7JA 5K1ZA 2X14A 4PFKA 1EFPB 2BMVA 2YX1A 1NP3A 3GDGA 3PPXA 4HH0A 4RIHA 2BGGA 1WUHS 1YL7A 1VCNA 3H11B 4DNPA 1BWQA 1RLTA 2BZ1A 4MKHA 4ZC8A 3ZWPA 3ZQ4A 4PNHA 2C3MA 4CM4B 5JRJA 1TKRA 1GZ6A 1NVTA 2N47A 2ZYSA 4I4LA 4XIJA 5FO1A 3V6LA 1GL9B 721PA 3DNMA 4BAZA 1Z7GA 5ESWA 1I33A 1NFFA 2VP6A 5ALQA 2P8JA 3GD5A 5DTRA 1X8XA 1CUBA 1NE7A 2NYVA 3IAUA 3OOYA 3JRXA 2QYSA 2R44A 5JSQA 2IUFA 3THOA 5LP6B 2OV2A 1YK1A 4W8HA 1N0WA 1V8BA 4E15A 2YV2A 3C6ZA 4B7ZA 1Z29A 4BKRA 1NMQA 4J90A 4GYJA 1N25A 3VMFA 5J4HA 1O54A 4P6VF 4Z54A 2E37A 4ZI5A 2WWVD 3FPFA 4XM0A 3HGMA 3ZJ4A 4XPIB 2CDRA 1XXLA 3BRWA 3NDPA 3P9XA 4IIGA 4AF8A 5IDXA 1C30A 4YK7A 1N2CE 2ID4A 4NZOA 3IR6A 5H9WA 3DT6A 7ADHA 3SLKA 4AK9A 1PJ2A 3IA7A 1EB8A 3EGCA 4UD6A 3F3MA 3REQB 3UB3A 4ZK6A 3I61A 3E8XA 4X1YA 3SF8A 3OTIA 3UUGA 5BNTA 4G5XA 3VVCA 2HB6A 4TZ6A 1XA4A 3BDVA 4QUJA 4RMGA 1G8SA 3T3NA 2VHZA 3COYA 4KO2S 3MXOA 3ISTA 4GGOA 1K8XB 1W4AA 4H3KB 3W8DA 1UADA 3ZEIA 2PZLA 2RB5A 3KAKA 4TRNA 3BWVA 4H6XA 4HQRA 1E2QA 1F1BA 1KVSA 3GFRA 1HM5A 1JAIA 5K3FB 4D26A 1EP2B 4R2HA 3HKEB 2ZVDA 4GVPA 2R86A 2WD7A 3D4OA 3FFBA 3F5MA 2MU1A 2WTEA 2LD4A 5BR8B 2RGAA 2DP4E 3RARA 1JG3A 3S70A 1MF7A 1HZJA 1GSHA 1JKFA 1N5KA 1TQ6A 2WU8A 3NTLA 3V4SA 4C4TA 1BIFA 2OQVA 2C7PA 3KJGA 4WKPA 4EKYA 2A30A 1BROA 5JS7A 3F3SA 4PAMA 1EQAA 3MMZA 3DFUA 1IHDA 4WK6A 1Z9BA 4ZPJA 1YC2A 1SHZA 4BZQA 4CWAA 3C2QA 3ZKWA 3L0YA 2YZMA 1ZRNA 4M0UA 2ZBPA 2I66A 3OM8A 5H7XA 2W8BA 2QM8A 3Q5DA 4DIBA 4DLYA 1UPBA 2O54A 2H9YA 2DHRA 3QVLA 1XRSB 1UPUA 1WNTA 3QVOA 2GYYA 1LSOA 2W2OA 1ZN8A 5FWYA 1W47A 2GEJA 1J70A 1RFGE 3DZGA 3F6RA 3FUVA 4BB5A 2H52A 2FLWA 3A9TA 4P08A 1J0DA 2AFIE 3NZEA 3NPAA 4U39A 4FXOA 3TRHA 1QG4A 3K6JA 4DTCA 5JD3A 1IZ7A 2YJZA 2FZLA 3HKBA 5KX5A 4L08A 5M3BA 1Y4DE 3L4KA 1LX7A 3VNRA 2FR1A 2GM4A 3KU1A 1V3TA 4Y2HA 4F0JA 1FTNA 2VWPA 1A9TA 2VAPA 3EFOB 1A7KA 1RHQA 1IM2A 3AV0B 3OZRA 5DX8A 2PQ2A 1QONA 2YV3A 4HLCA 2JD0A 3EYAA 3JASB 5D85A 1PE0A 3OF5A 4R3WA 5LZ4A 1QCDA 2NPFA 3PEYA 2B25A 4IVPA 5EJ7A 1OB2A 4MR9A 4L4RA 1VJGA 3INRA 3H2ZA 2J59A 4FQ8A 4B7UA 1DQSA 4V0ME 1YVRA 1FDSA 1Y1RA 4LE0A 4QT0A 3CR3C 3ZZ1A 3CNHA 3I1YA 1XLWA 2HJWA 3PEFA 3FFTA 5FUQA 2DQZA 2HA7A 4MUAA 3BMOA 4WY8A 5TLSA 1KR2A 1S3GA 2NTNA 5CYPA 4F97A 3L18A 3LF2A 2QUHA 3V33A 1YJBA 1F38A 1E6KA 4F3YA 3FNIA 1NXSA 1IXKA 1C81A 3PNLA 5L9AA 4DCNA 4E32A 2XCTB 3JQAA 3TVYA 2PX8A 2CHUA 4L4YA 1UMCA 2JPDA 3KK0A 2OG2A 4GT1A 4BQOA 4DIUA 2PA0A 2A9FA 4M49A 2H8KA 4NV0A 3UENA 2H1SA 1PGQA 1GVNB 5E38A 4AZ0B 1X1DA 3EOAI 3ZHYA 2QN6A 1VDZA 3KJIA 2FFBA 3J80A 5FWXB 3U0BA 5TPZA 3CSUA 4AJ4A 4PCAA 2GZ3A 1L5NA 4BNKA 3A1CA 1GEGA 2JLYA 4G1VA 1D04A 5DHAA 2YN2A 3FHLA 3AFMA 1GKIA 3LZDA 3GUZA 4CU2A 3H3JA 2VJBA 1J4AA 1KBOA 1M7HA 4NCKA 1JEDA 5AM4A 3T15A 3WK8A 5ADUS 2AKEA 4BUZA 1H2AS 2PZEA 4BP8A 2UVDA 3ASZA 2GJ9A 4GPTA 1DFGA 1X1AA 5A2QA 1CV2A 2YOGA 5DO9A 3KQKA 1D2EA 2IE8A 5BR1A 2XE8A 1U9IC 4UAVA 2QTLA 2KBEA 4OLFA 5K3EA 3NTOA 3IXMA 3EZXA 2BRUC 1YE3A 5IBQA 2PRJA 2BDTA 1K1EA 3H84A 2EW2A 4Q16A 3FOAA 4WNAB 1X77A 2G5PA 1MQ9A 2O7VA 3DO8A 3ESBA 3HB9A 4DUYB 1EJBA 3OC6A 3HKDB 4QOIA 2W00A 4C21A 2V1XA 4ZI3A 1L7NA 1LPAB 1R5JA 1YI8A 2KLHA 5AW1A 4N76A 4L9RA 4D5EA 3RSSA 5IARA 1CT9A 2WP8J 2ZRCA 1OWLA 5B3KA 1BDHA 2GPBA 3GAFA 4D9NA 1H8EA 4DSUA 5TX7A 4LGVA 2BR5A 4CL8A 4D0RA 3JX9A 2PFKA 4LIPD 2JJ8A 3LBNA 2P91A 3B2NA 5CIYA 4ZOQI 3W77A 1EFRD 4L50A 1PLLA 2OHVA 1SZPA 1KBZA 5CT4A 3HKCB 3AR4A 5F3DA 4YROA 2ACVA 3QXCA 3B1WA 2B4AA 5DLQC 3QM1A 4TPKA 4DV2B 1L5OA 2NO5A 2OAGA 3LQKA 2PRZA 4OQPA 1H9BA 5LIPA 1DPFA 1K06A 1OFIA 3DE6X 3WWPA 3W1WA 1ZM7A 2REQB 1E2EA 2J9RA 3N39C 2OXRA 3PPVA 1GYRA 4D9EA 1G8PA 4NZPA 4KGDA 1A2BA 5C7YA 4QM7A 4CTJA 5JMOA 1WCIA 5ELXA 4G4GA 3L6CA 3MJCA 1U63A 1C1DB 2PVPA 1P0FA 2NX2A 2QENA 2A67A 1B3BA 4TSFA 4UNQA 3TZCA 2WAXA 5HP4A 5HHTA 1RIFA 4C1NA 4YTEA 4JWKA 2C0PA 2GHQA 2BE7A 3PU6A 3GLIE 2J3DA 3D3EA 2CLKB 2WTAA 2P2DA 3I76A 2FF5A 5AJTA 4ZV9A 4BP3A 3BZBA 2GNOA 1AMNA 4CM1A 3PXDA 2P65A 3FDZA 4PLYA 3QY0A 2IQ5A 3LGXA 1NN3A 4OHFA 1PJ8A 4DMHA 3AFHA 4BO4A 2DKOA 5EHNA 2JLWA 4MUEA 5G1PA 3NDJA 2H2GA 3CNEA 2J67A 4EG6A 5DYTA 3D8UA 5JSUA 1JF8A 1P5FA 1KIAA 1Q1GA 3CGGA 1J42A 2ID9A 3LUHA 4FEEA 4L5JA 1EDDA 5F73A 2ZTLA 2UUPA 4RJLA 1Q1BA 1KEEA 2ZZKA 4URHA 3B1JA 3GLGA 3CJRA 4F85A 2WUDA 5F7XA 2IU0A 4A23A 3DAPA 1F6BA 4IJVA 2E89A 2GR9A 1N6KA 2XX3A 3B20A 4IGEA 4P0QB 2PMWB 4XX1A 3AX6A 2WJWA 5BVHA 4BX8A 1QFJA 1NV9A 1XA0A 3Q8WA 4PR3A 4G86A 4TMFA 1L7OA 4J0JA 4FZ5A 3BM5A 3TLCA 3ZCUA 4ESHA 3UOWA 4M8IA 1W46A 3AG6A 3C97A 3CX3A 4NZNA 3JQBA 3WDLA 5KYTA 3R7LA 1PJ3A 3ETEA 5DTJA 1YMQA 2D1QA 3B5JA 3DDZX 2CL6X 4D4MA 1GZDA 4HV4A 1KY4A 3T41A 5KDOA 1QFXA 2BGLA 1H22A 3B89A 1Y82A 4F5EA 3QUTA 3W3AA 2Q3BA 1JDBC 1RPZA 1SG9A 2X0JA 3O2NA 4L0CA 5D00A 2F59A 3F4LA 3VRHA 5KOHB 1EXDA 4OOEA 4MVJD 2RGEA 2YXLA 4AICA 1G21E 3CPHA 4MUNA 4X97A 1UAYA 1JLSA 2DB3A 3I2GA 2PX5A 3QNUA 3FUTA 1ATZA 3GQVA 4AJ1A 1LLUA 2P4UA 3TM4A 1O6CA 5LQSA 1SVUA 3ZW9A 1L3IA 3PDCA 5T4HA 4DQXA 4F3CA 1PEAA 3T3HA 2QTCA 2WG0A 2N1BA 3KL4A 1HLGA 3HWSA 4H08A 1K5GA 2OK8A 1L8OA 2CF6A 3BMQB 3O73A 3LOQA 1AUPA 4PGFA 2WJHA 3O4GA 5HMMA 1QORA 4D8XA 3TZKA 1O8BA 1XEXB 2JHPA 3TMAA 3DZJA 3E27A 3ORFA 3BD9A 4K6GA 1GRCA 1A1SA 1A27A 3MCAA 2VKTA 7REQA 3AMVA 1CUHA 1KP2A 3EZFA 1N92A 3IJEB 2X76A 4YAEA 1V16B 1OZAA 3QWBA 4FINA 3TQHA 1PJLA 2D4AA 1R8SA 4WESB 2Y1WA 1HE4A 4I1YA 3FCOA 2AOXA 2OD9A 2NQ2C 4DYDA 2PUWA 2E9SA 3BYZA 4R1UA 2YJ6A 3UW3A 3V80A 4LFAB 4JU9A 3TW8B 5FAKA 3O8RA 1X7DA 1YBAA 5AKJA 4OMFG 4Q3EA 2DQSA 1PF7E 1V8DA 2GVZC 2HF8A 2WZCA 2YJ4A 3KT0A 1JB9A 3LQQA 4KO4S 4B8WA 3O75A 3THRA 5DBEX 2QY6A 2HO4A 1L4GA 4ZICA 4LOKA 3BWCA 5L3ZA 3JS5A 2PSSA 1JTVA 2BSAA 3OBBA 1N6HA 3I2HA 1SQ6A 3B7GA 5REQB 2AI2A 4KWTA 4Y2RA 1Z4JA 1NXXA 5A3SA 3TCXB 3AVOA 3QG5A 4YCBA 3QITA 4OB6A 2FRVA 1BXRA 2O1WA 2RKBA 3BXEA 3D8NA 3N28A 1ZK0A 3DBLA 3AETB 4JC0A 1FMTA 3ELBA 3S2EA 1I5OA 1NXQA 1ZW1A 4HDKA 1E6MA 3AH8A 3ZGOA 4BLVA 2OQ2A 1GGMA 3G8DA 1Z5GA 3PR2B 2FRXA 4O2AB 3L1HA 5KJ6A 1Z5OA 2AF4C 4GKVA 2D8MA 2LUOA 1UFRA 4MRVA 4QE3A 1XVLA 1CR4A 3FSGA 3LXRA 1A4IA 3R3YA 4S24A 5C8ZA 4N5MA 1E3MA 4LVNA 1S1MA 1MVOA 1Y3CE 1J1ZA 2FA9A 1V5GA 3DAFA 1FBTA 1G6OA 3DTTA 2Y0EA 1UBNA 1K7SN 2NZ8A 4B4KA 2IPLA 4MEJA 5GINE 3TFOA 1P74A 4N7JA 5MN5A 3BC1A 3QF4B 4QBHA 1N3LA 1OFTA 2GCIA 3L0CA 4EHNA 1W2WB 1O4VA 5ALHA 2A33A 3TIVA 1PK7A 1Q74A 3GP5A 4FNMA 1QAMA 4FZVA 2GK4A 4MRAA 2F8LA 4AMVA 4ENSA 3NT2A 4LBYA 3HPRA 5A05A 2WVJA 4DNOA 1IHXA 4QUKA 3FLAA 4KH1A 5IH7A 2BZGA 5JWHA 4JNKA 1P3JA 4F9GA 5K0GA 3LGAA 2CB9A 4L3WA 4MWOA 3UK6A 3OAAD 1GCAA 5DMHA 5FPKA 3E58A 5BWBA 3Q10A 1XJCA 2PSHA 2VHQA 1EBUA 1NI4A 2C95A 2YV1A 2XZOA 4RSRA 1JJVA 1E79A 2O1EA 3TK1A 1ORVA 2VI5A 3HHPA 1DKOA 3K0AA 4RYDA 3TRKA 4MYTA 3VPBA 3DEKA 3CUWA 2ODNA 4M3NA 3U61B 3NHSA 2XGSA 4CEHB 1PZGA 3LD9A 4RK4A 4D57A 2QEQA 4MJLA 1YH3A 2HU5A 4ZMBA 1DUVG 1WB4A 2VSFA 3C3BA 4RTJA 3AI7A 5H82A 1E79D 4E5YA 1PLJA 1DRVA 1JECA 3DZBA 3S2UA 6ADHA 2HXYA 4OSPA 2AYZA 1S8FA 2P3LA 4TYPA 3BXHA 1NFRA 4PLFA 5AK0A 2ZETA 3RHTA 3TCNA 1UDXA 3PKZA 1EIWA 4BKMA 3DZFA 1I5RA 2A57A 3GLUA 1O97C 1OTYA 2J6HA 4MGZR 2DLCX 1BFDA 1UC8A 2QLFA 3HUTA 1KK2A 2QTTA 4UBLA 2I8LA 5GPBA 2Q5JA 1JEYA 2ZRMA 4HDCA 4F38A 4PRYA 1NKVA 2C31A 3IPRA 1YB6A 5FTWA 5KOHA 1XAGA 2CHEA 2CFOA 2P35A 4JJ8A 2NP6A 1MEJA 1YB5A 1Z8HA 2GN2A 2PGXA 2RC5A 3A6FA 4WKNA 3AP3A 1FJHA 4J9VA 5I9TA 3UMGA 5KSYA 3GJ4A 3L1JA 2GARA 2TYSB 3Q0EA 1IOVA 1Z4PX 1GKYA 4X1IB 2C4NA 3GLRA 1TA9A 1ODCA 1EXWA 1J6UA 1ZCFA 3KUCA 2C92A 2VDLB 4P81A 1DOAA 1OPXA 1R50A 4ROTA 2PQ0A 4ZQGA 5JMTA 4Z8XA 3RUIA 4YUWA 5L4NA 5C52B 1J39A 3CONA 3LCUA 4LJLA 3C3MA 1OHHD 5FUBA 3VBCA 5B3LA 3WY9A 2FZ4A 3B52X 4R98A 4W6ZA 3FMOB 1OWOA 1HDEA 2QORA 5K0CA 3O2SB 3OVMA 3H65A 3QTBA 2AZTA 2F8MA 4ER5A 1UUFA 3KQVA 1FP4A 2UZIR 3HCWA 4FPXA 4HPXB 5HGXA 2R66A 3QU7A 3WMRA 3DDUA 1UT5A 4WESA 4S12A 3Q7EA 5I9MA 3RRZA 3LKVA 4V0NA 1LZLA 2VA9A 3KIPA 1Y5MA 3ZS9A 3I6MA 5AKEA 3HYCA 4KBFA 3H8SA 4PZ0A 4N3GA 1G7TA 3M6UA 3EFHA 3UWSA 3L1UA 1WDWB 1KEVA 3R6GA 3VKUA 2HGSA 4FSXA 1P44A 4OGWA 1AQIA 1RE1A 3AHDA 4KSCA 4TLLB 3JQCA 2JDID 1G7RA 2IHJA 2E1RA 3OEEA 2MDTA 1KMCA 1EM8B 2O7RA 3NKLA 1BX0A 4J1SA 4CV3A 5E7JA 1G7SA 3BORA 2CNOA 2DEUA 3N2IA 3DZHA 1LRJA 1OH8A 3JYNA 3R5HA 4NATA 2NSDA 3CN9A 3DQPA 5FBLB 2H59A 3SZGA 1N1DA 3JZFA 3WGNA 5C1BA 2OAQ1 2WHRA 2G04A 2ZRHA 3V7NA 1W8IA 1V3QE 2MMCA 1ZCZA 4MRMA 3BZUA 4IDAA 1SKYB 2BFCB 3GLHE 1EFRA 3NS7A 1NX6A 3B82A 2JGIA 3OIFA 4XOIA 4O2AA 3IR7A 3QFSA 3KEMA 2ZBFA 3O82A 2A0YA 3U7JA 1ZGHA 4BVKA 3GZ4A 4KBYA 4JP1A 4O8ZA 2XNDA 4K6CA 4KAFA 3UC5A 1QIJA 3W5SA 3I5YA 4DLUA 5CFMA 1HDGO 3AV3A 4ZEWA 2FN7A 1XL0A 3LVQE 2GM3A 4TXJA 3B5EA 2NMVA 1U0RA 1UK8A 1W0KA 4EPYA 3HFGA 5CJPA 4EI2A 5IAEA 1IVNA 4HDMA 1E0SA 1G21B 3NT5A 2LWIA 3HY6A 3OICA 3CX8A 1EHCA 5LPNA 2BMEA 1NNSA 3DMNA 3IDOA 1QK3A 3A11A 4KN8A 1E9RA 2X2PA 1BMDA 2Y9PB 5A2GA 1W0KD 3FCCA 3KSZO 3LVBA 1HYQA 4NBUA 1HR0B 3BBPA 1DBVO 3AUXA 4MXDA 5DTIA 1VIMA 2QTRA 2XNJA 4A0SA 4L8YA 2QMHA 2N9UA 2JFGA 2EYQA 2O4CA 2X4IA 3ZE0B 5FP0A 1QO0A 4X6XA 1E20A 2DKFA 4AN1A 1TK9A 1QIKA 1XYVA 3E5NA 3OIGA 4TN5A 1L3BA 4XJTA 1Z6AA 5HFNA 3TDKA 1EP9A 2BDUA 2YWXA 3LRXA 2C98A 2XGOA 2F90A 5EKXA 5F78A 5CB4B 1MP0A 1B1CA 4PZZA 1D5WA 1FYVA 4NI5A 4R1LA 3CUVA 4DNXA 4FFLA 2OGZA 4JLVA 4WKGA 2CXQA 3L4BC 4WA7A 4I0WB 4KPGA 3MINB 2IZ5A 3H1GA 3FB1A 2FX5A 1VFNA 2VWGA 3CKYA 5TNXA 2PUFA 4C2TA 3U7FB 4HGPA 3OE5A 4OQZA 4INJA 5JJBA 4Q9IA 3PP8A 2EKBA 1T9KA 2HCJB 4UUQA 1BEUB 2VQEB 3QNMA 4X1OA 4RS4A 2FPGB 2PWPA 5KVQA 1IOLA 4A16A 1TOAA 1JDVA 2WKPA 2V1UA 1J49A 3WMWA 3CNQS 3KJHA 4C3OB 2Q4RA 3TPZA 5K45A 1GKKA 2RMKA 1V1MB 3M4NA 4QUIA 4X8MA 3ZWOA 5CFQA 1V7PC 2PGAA 2YXNA 3AUAA 3U3RA 3U5ZB 1ZFNA 2A0WA 4EFNA 2GNPA 3PR3A 4K8OA 4XB6B 1KH3A 2RAPA 2XQKA 3QMVA 1T1GA 3JD4A 4HNRA 1YQDA 2VDRB 4KX5A 2PXAA 4LI3X 3T7TA 3H75A 1RPNA 4MJXA 1C8VB 2FMHA 1ZQ9A 1I01A 1RM3A 2BEUB 1QZ3A 4GR5A 4RTSA 2NTVA 3BH6A 4QPPA 2LBPA 5K3FA 2PRKA 4DB2A 1XFAA 4YAFA 3BUSA 4KACA 1K3UB 1MOPA 2PX0A 1JSRA 3TQOA 1GM5A 3TNFA 2O06A 1PYDA 3OMXA 2WEKA 5AOAA 5I01A 3KLMX 4YN3A 4DJDC 1VRCA 3UT6A 4L0MA 1FUEA 5JQGF 3RC3A 3RTGA 5KJFA 2XTAA 2PKEA 3R6WA 1X70A 3WGYA 1OTHA 3UMSA 5J5AA 4M1ZA 3L7IA 4XFDA 1ZPDA 2ZATA 3F5FA 4G4SP 4DMCA 1AG9A 2XMCA 3NX4A 3PYMA 4MAAA 4YWJA 3RIXA 2TMKA 2PPVA 3HR8A 3KM0A 1YO6A 3JD1A 2R6GA 2QRNA 3WJ2A 1CZRA 3JQPA 1Y8RA 4JCCA 3RB8A 1GZHB 1IBCA 3QVMA 1US8B 1C1XA 4ZGGA 2VDWB 1V9CA 2Q1UA 4N7RA 4LDPA 1SAYA 1D9XA 3ED1A 3HXPA 4FI3C 3AEKA 3BWEA 3SKVA 5FLYA 2X1MA 5CX1A 5CFLA 3MAAC 2Q46A 4AG6A 1M7BA 3JD2A 1NVDA 3HM2A 5F23A 2BEWB 2KS6A 2OCKA 4UEWA 2XNCA 2NYRA 3UKDA 4P22A 3G5MA 3IESA 1N9KA 4RFSB 1NONA 4CEHA 5KAMA 4FMBB 3R24A 1X94A 3FWKA 1PUXA 1T5BA 4K46A 4PG7A 1CUXA 1W93A 5K09A 4RKRA 3QPUA 3LTNC 1K66A 3RUDA 3P27A 5I7OA 3K9FC 1FVHA 1B2LA 1L5WA 2Z1MA 2AZ4A 4HYQA 3JARB 1JIJA 2PBLA 3WV4A 4AY5A 2ZQYA 3QENA 4EHJA 1KOFA 2H1CA 2RCYA 2YY6A 2Z3WA 5F35A 4EM6A 9MHTA 1CUJA 2PRSA 3NCHA 3CG4A 1G19A 4BNHA 3QLUA 3YASA 1VBFA 2A84A 4QDKA 5JARA 1KFBB 2XWSA 1E1MA 4JZYA 1D8TA 3PRJA 2B2NA 4MA4A 1KR5A 2OV3A 3H04A 3N6VA 1FRNA 1F17A 3N5KA 2BOVA 1PNRA 2PPLA 2F1HA 2ZQZA 5A7FA 5DEOA 1RZ3A 1USWA 1U3GA 4WLEA 3ADBA 2D1FA 1JQAA 2HBRA 2ASVA 4CFYA 2P62A 3G5LA 4I1RA 3CPJB 1SZJG 2G80A 3NOQA 1LFDB 3DJFA 5IKPA 3E4CA 5MDHA 2NQTA 5C7OO 1RVV1 2QVZX 3H2GA 2GCGA 5FL7D 5FWNA 1DEHA 2AOUA 4OX9B 3A28A 4MV3A 1GCIA 3IHLA 1X8KA 3KOUA 4NBNA 3KSDO 2MSEB 1XXHB 2OD7A 4YRFA 3JWIA 5JS8A 2OZPA 1K7XB 2FDRA 5HKLA 1QE5A 4EHHA 1VL1A 1U0OC 3LDUA 1D2AA 1KZ4A 3QWFA 3GJ3A 1MNQA 4EO4A 4I46A 1ZQ1A 4EB3A 4EYEA 2CBZA 4JBLA 1C4XA 3CISA 1XDSA 3RRXA 1G8YA 4JZKA 1KYIA 2OBYA 4L28A 3ZU5A 4HX2A 3S6JA 3WIOA 5EWMB 5IUKC 2D13A 3D31A 4HDOB 1FFDA 4I1UA 4J16A 4N0QA 1JI3A 1IDN1 2HPHA 2LIPA 3HWX1 4RPCA 4S0ZA 4D4HA 2Z2XA 1XU4A 5I6DA 1R6BX 2QN3A 4M1EA 2QYTA 1CTQA 1OXSC 1R16A 4BE7B 5JNTA 4NS4A 1E1NA 1BQ4A 2QV0A 3SQXA 2XNSA 3BGWA 3RUCA 1JIXA 3K0FB 1EFTA 1V8FA 5K0EA 3CZPA 4P35A 5KO2A 4B44A 2IHNA 3O9MA 5JNWA 1E2HA 1JJIA 1QKJA 3PUXA 2GZRA 4LV5B 1KWGA 4F4IA 1C4WA 3K9QO 5COQA 4BRWA 2WTNA 2D7JA 2F8SA 3HEAA 1PTJC 2RKOA 3GRVA 4W9RA 3WYAA 2A35A 3D7RA 4G89A 4E4RA 1XYGA 1OPRA 2Z08A 1RYBA 3CINA 4AZ3A 2WYVA 3P32A 3PNSA 1V4NA 1MKYA 2ATCA 2XR1A 3IODA 3O5AA 5B1IA 1JVSA 4P98A 3G8AA 3ESAA 3N8IA 1AHIA 3RS2A 5A02A 4NVRA 5BUSA 1NW3A 3W3AH 4DBVO 2EFYA 2AJLI 2AC7A 2ODQA 2P68A 3L0OA 4CEIA 1ISPA 3UT5A 5K03A 3VHLB 2EDCA 1T24A 3RSLA 3JYLA 5LYJB 5DWQA 4BVAA 2MYTA 1AO0A 5DHSA 2VP0A 3BAFA 4EHLA 3AF6A 3DLHA 5I7RA 3GOHA 4B6PA 5KEIA 2VN8A 5G41A 2R1TA 2ZPUA 3FIUA 3OSUA 2F4VB 3TRIA 1K9VF 5U4XA 1PV2A 5AKZA 1B0ZA 2X0NA 4H77A 1KI9A 1ACMA 5JJIA 1PR6A 2Z4SA 3JVDA 1GGEA 3LCMA 2VBIA 4DCPA 3VR4D 2QMQA 3JZAA 2O8NA 1MU0A 1YT5A 2XY4A 1PTKA 1X7XA 4KGVA 3JPWA 1Z7YA 3G49A 5G1OA 5IBCA 2BHNA 1YS4A 2VVTA 5KHLB 3I2KA 2BFFA 1M2FA 3D8HA 1CUDA 1KAEA 1X0VA 3Q4GA 4ZAVA 2EJWA 3CLRC 3TTSA 1R10A 4KIGA 2CHFA 4BNWA 1J8VA 2PT7A 1J07A 2JHCA 3UH1A 2XCIA 4LISA 2UU9B 3L6UA 4S04A 3VYRB 1W1IA 3ESDA 4WX2B 1JAZA 3OT5A 1NR5A 4YA6A 2H0AA 3C5EA 4B3JA 1K8QA 4GBED 1DIAA 2P4SA 5CB4F 4YJ2A 2X2EA 5KMGB 1H05A 1P2DA 4OUKX 4X7BA 2OV4A 4LQLA 4XWTA 4PSUA 1GYQA 5ALFA 4XB1A 3PNYA 1U7OA 5E6RA 1GZ5A 1KS2A 3OEWA 4YRJA 5JD4A 2EFDB 2WB4A 5EGSA 5J2TF 2HJGA 4UZSA 1XZCA 3S2IA 4BFTA 4EJ6A 1M0SA 4EJ2A 2F4NA 2BH9A 4GNRA 4PQFA 5TE9A 2I65A 3DMDA 2VJMB 4BXOB 1KZHA 1RWQA 2P1ZA 1JSZA 2YWJA 2NUBA 2RGBA 3MCZA 4FOTA 2I4LA 3C6KA 3AM5A 1AQUA 3VI3B 3LX4A 1YRHA 2RI1A 3A4NA 2JGAA 5JDCC 5K20A 5CCXA 5CNKA 3W04A 5LQMA 2G88A 4BMNA 4DWOA 2QXUA 4UTZA 4UBOA 5AM5A 4BMYA 4DLRA 4ZYXA 4Q7QA 3KWLA 2QPAA 4BEWA 1EB9A 2CLMB 3KE9A 3ICOA 1FSFA 3EIHA 2HOQA 3DKIA 4IOJA 4RTMA 2C5LA 1KERA 3BMNB 3H1TA 4UJ3A 1UDWA 3V2IA 1Z36A 1U0EA 4KB5A 3OZEA 3WGVA 3KPWA 4B3HA 1GA1A 3TECE 4O3MA 4X24A 3H9CA 4GDFA 1EUCB 1EE1A 1MRSA 3PCRB 4O2BB 4ZODA 4Z99A 4ADSG 3NP7A 5CA0F 1K3FA 1TIPA 3M1YA 1RACA 4XASA 3N76A 1YJQA 1VBKA 5EL0A 1A69A 4B6EA 3R9KA 4JH0A 3VH1A 4TSKA 4FJ1A 5CU7A 1WLSA 5C9ZA 4ARZA 3I72A 5KB3A 3GLGE 2CXUA 2QMZA 4PZAA 2NYAA 2A0KA 4M9ZA 3M9XA 4LRXA 2Q7XA 4M22A 3CN7A 3G8CA 4QTUB 4EPWA 3BHIA 1UBJS 4FW8A 2DY1A 1Z0IA 5SYNA 5AUNB 2QLJA 1HDCA 2ZRJA 2PQ6A 4UEJA 2HX1A 3X1JA 1U3VA 1DC3A 1U1GA 1X92A 2E82A 4MQ4A 5JNSA 1ESZA 3HV0A 3P2YA 3WQSB 3A9UA 2C4WA 1E8MA 1ZKDA 4FBGA 4AY6A 1G3UA 1WPGA 5B6JA 2AI1A 4YJHA 4CCWA 3ET4A 3HNOA 4G8BA 5IF3A 2BFBB 3GFBA 5G4LA 4J94A 3S40A 4NDAA 2OV8A 1L1FA 2EEPA 3DEAA 3H1FA 4BMPB 1D3AA 1T9ZA 1KDYA 3G2IA 3QKTA 3QA9A 4KNYA 3VNSA 1U0TA 1IMOA 3UXMA 3GWGA 4HFRA 3MERA 2DSNA 1PJTA 4C04A 5EFOA 3EIQA 4XJXA 4JLNA 3AEUA 4X9XA 3Q87B 2V7QA 3TCKA 4MWZA 4ID3A 3D8SA 4HEJA 2HCFA 4BJ3A 1JR3A 1JIQA 1XRJA 1ZLXA 1JEQA 3AL3A 1SUCA 5DYIA 4DAEA 4CJXA 1C7ZA 5J63A 4R7GA 3WWOA 4AYXA 2WWTA 4OG2A 3WVNA 1CK4A 4OXXA 4X44A 1BH2A 4S1WA 4YCAA 5BYJA 5ENDA 4BRSA 5AKHA 1B8UA 1RCTE 1ZUD1 2EBFX 2Y6UA 1P4GA 1XKXA 1PHRA 2MYNA 2DX7A 4ALLA 3COVA 2IBMA 4CLHA 3M82A 4YP9A 1QTRA 1JRLA 2IP4A 3RAPR 7YASA 2B7LA 3M2TA 2FU5C 4R31A 2WHQA 3DVSX 1U2RA 1ND5A 4ZZ1A 4OO3A 5B64A 3C7DB 1NY6A 4Y6QA 4Z9XA 4DV7B 1AKYA 1P7ZA 3E82A 4LMPA 2ZTUA 3VJRA 4W5HA 1E9AA 4PAGA 3X3HA 1KEPA 3G9TA 4DCGA 4EATA 5HW0A 2P4EA 4C14A 5CEJA 4G0NA 1RC0A 2B1IA 1FNDA 4H18A 1E99A 3B78A 4EL5A 4G8CA 1GFZA 1TJPB 3WJAA 1DHRA 4A8HA 1A1VA 4GGPA 1UJCA 2B37A 3P0IA 4Q01A 1APBA 5HE8A 2R5NA 3TQFA 3HO6A 5BW5A 4JEMA 1FDUA 3MGAA 3HVKA 4L8GA 4PNZA 3R5XA 3CLUC 3Q9NA 4QWWA 4WFKA 2IYNA 3PNKA 1ORWA 1VBNA 1Z0SA 3PICA 1DAMA 1I14A 2J7KA 3NNNA 3SKXA 2Q1WA 1QYCA 2OEPA 4KPUA 4UDXX 1X80A 2VDUE 1U7PA 4J0FA 2I71A 4ZREA 4CMEA 3HDTA 4DC1A 5C81A 2JBAB 3B13B 3KXIA 4ZQIA 1URPA 4J3FA 4L76A 3VR4H 3WL4A 4HXGA 2GZMA 1RCFA 5EZQA 3ZJUA 4M0EA 4J0CA 3LKZA 3AUTA 4F92B 3UJBA 3E3MA 3TTTA 5AD1A 4BCCA 4Q9NA 1E2JA 1GG8A 4KX3A 3GVPA 4M0CA 1LPNA 2J0UA 3GMDA 4G3XA 4XWYA 5L6MB 2AOVA 2ECQA 3LOPA 4R2JA 3C6YA 5IRCD 2PMBA 1WUJS 1UZUA 2E7ZA 4EY7A 4C30A 4HN9A 4C08A 3ES9A 3GR6A 2VHUA 2WJVA 4DWJA 1WS6A 1R6AA 2Q5HA 5FWYB 1A8UA 1PQYA 4FSHA 1AB6A 2C7BA 2HREA 2ZWAA 3L0BA 4INAA 5SY9A 4IV0A 5GGYA 4MDEA 2QK4A 1SXJC 4RORA 3RU7A 2OILA 3OURA 2C3OA 1N5MA 4ILEA 1O0SA 3SFZA 4MS3A 3CW8X 1WZUA 3EBOA 4FHFA 1XWFA 1GFWA 2XDQB 3ETJA 2IXGA 3QKRA 5FR1A 3J7AC 5DRTA 1GV0A 2FPMA 3U3XA 4LRSB 3HVJA 4AU1A 1L7RA 4CI0B 2PG3A 4L3OA 4EHFA 1GYPA 1X14A 5FIUA 5LOVA 1OYWA 1W4LA 2XQJA 1P0IA 3AI2A 3N2EA 5ILGA 3AR8A 4C4PA 1LDBA 1MO5A 3RVBA 1U2SA 2QVBA 1AHPA 1F8FA 3GEPA 2FQWA 3EOZA 2Q0SA 1V11B 3EC7A 1U3FA 1QG6A 1R6TA 1XDWA 1EINA 4GLBA 1VKJA 4YECA 4OGGA 2F9MA 1MO4A 3EUFA 2G5GX 2HHAA 2FKNA 1RYDA 4YX9A 4MUBA 4DPKA 2JL1A 3RKRA 1Z33A 1ZESA 4BQIA 1P7VA 4YDQA 5DPMA 3D1JA 4BE4A 3PV0A 2DUJA 1PR4A 1YZGA 1TAHA 2WILA 3MQ4A 3RSFA 1YR7A 3LCRA 3O93A 1JDTA 1QZUA 4GP9A 2G1PA 2G28A 3LCVB 4XD7D 3ZIAA 3RSHA 1TECE 3Q2OA 4HAWA 3ULKA 2ZSBA 4MYSA 1VPVA 1QGUA 1TMKA 2GBLC 4YMTA 4HRYA 1VI6A 1FP2A 2VBFA 1WAMA 4FGJA 2ZPTX 3BB4A 4N39A 3TOCA 4AECA 4BQQA 4DC9A 4W63A 1DEKA 2PV7A 5IM4A 2EQAA 4IJQA 1VA4A 2GXAA 3QEJA 3SN6A 1NJSA 2RAFA 4NFSA 3ZIDA 1MBZA 2MYPA 4DM7A 3LT1A 2JGEA 1C2TA 2CW5A 4TMKA 1XQYA 4MUIA 4Q6BA 4WK0B 3S4YA 4NP6A 3CJTA 1AGNA 3EPKA 5E9AA 2XMRA 3UWPA 4C20A 1GUDA 1DADA 4NBLA 2V3VA 1TK2A 4RTLA 1XZNA 1UWLA 2HU2A 2RGGA 3K8OE 4M76B 5CLLA 3G0HA 1P7CA 4GDMA 1F3OA 1FFCA 3DA8A 5KYWB 3AYZB 1ST3A 4UHDA 3AI3A 1ZM3A 1DC8A 3U9TA 2OBXA 2AFIA 3DP7A 4ER3A 4ERNA 3NBKA 5JZSA 3RVMA 2YY7A 4ZVQA 1Q16A 1J2YA 2J30A 1WHSB 3KRTA 1SKYE 2O05A 3CRQA 4S2EA 5FPSA 1HC7A 4AJNA 2HU8A 1JGTA 1JYSA 2I3DA 4G63A 3T7IA 4KQWA 2Q5EA 4L78A 3GOQA 1GL3A 3VPHA 4RVFA 3SC2B 1E3JA 4G5FA 1KGDA 2G1JA 4DGQA 5E2AA 2ZXFA 1GLNA 1WVMA 3H2JA 4JXZA 3I2IA 2P9JA 2EFCB 4RGVA 3A04A 3UK7A 4DY4A 1IOZA 1MORA 4ZU6X 5IWCA 1EFLA 2QMUA 3ECAA 4EQZA 5EJ5A 4C9BA 1FFSA 4MWGA 1JL3A 2W93A 5LXTA 2HF7A 1ND6A 5HFAA 2DXIA 1W76A 3N70A 4ID9A 1ZG3A 1Z17A 3A6HA 4LK3A 4ND7A 1ZCJA 3IELA 4OD0A 2PO5A 2AN1A 2P6OA 1G291 3N2LA 1O87A 4RS3A 3VX4A 1CUIA 1OE0A 3G6KA 3TBHA 2FB9A 1Y3FE 3H5RA 3K8ZA 2Z3ZA 5CGQB 2J45A 1Y98A 2GN9A 4KTTE 4BNLA 5JS6A 1ZVVA 1XALA 5AW6A 1KIFA 4ZO8A 1IDOA 1HMYA 2V97A 4KLNA 1MVLA 4WFIA 5ALXA 5J59A 4YUZA 1AURA 1IC6A 2IEGA 4OK5A 4RJ2A 4CBVA 1NNLA 3LXXA 2I1QA 3I1FA 2J0EA 2OCYC 1N2CA 1Z0JA 2FVYA 3KAJA 4DBZA 2B61A 4RLFA 1EEXB 4PM4A 1RMQA 1BCRB 3NBZC 1I30A 1SGWA 2A4MA 2VSNA 1VHTA 4REOA 1NU6A 3T12A 3VQTA 2F8TA 2YRWA 2FFRA 3RYFA 4XGKA 1U8XX 1KJIA 3MT0A 3TYXA 3UM9A 4F4CA 1F14A 4J0KA 2JAUA 4X71A 1KJYA 5EMMA 1EA7A 3FPLA 4XM2A 4Y0VA 4CM5A 1H3FA 4MZDA 3I64A 3FDZB 1ZNYA 4CCSA 5EZYF 2QAJA 4YP5A 4C22A 4QREA 4ER0A 1BMQA 3GLQA 2AXQA 1IRXA 1JFVA 4BIMA 1IBLB 2E85A 2QRQA 3AU9A 3C3JA 3K0KA 3GMTA 4FFOA 1BGWA 1G6HA 3CKLA 3TPFA 3WIEA 1LKZA 4F6RA 2ZUFA 2ZI9A 5K3BA 3MJHA 1R2QA 4TT3D 2B20A 4BKPA 2EERA 4TGLA 3SZUA 2WF8A 4DZTA 6GPBA 3R9XB 3M9WA 2FX2A 4ZRDA 1PVDA 5K7SA 3M4YA 1XELA 2HGZA 3AIKA 1QGZA 1C9MA 1PHPA 1S0UA 3EDCA 1M2HA 3N0RA 3GUHA 2AN3A 3PDIB 3QVWA 4FFNA 4JJ4A 3L04A 1DKMA 1D4ZA 1DC7A 5BN1A 4RZSA 5GZ6A 4O1IA 4TUYB 4G37A 4Y1RB 1A8IA 5AIAA 4YJFA 1CZOA 4GLOA 3LY5A 4U2EA 3AY7A 4ZEXA 4ZJPA 5THKA 1NOJA 1LZKA 3PYLA 2O20A 3MTJA 4IO1A 2B4QA 2HMSA 3EWIA 1V2HE 4U5XA 3UV6A 1MJGM 4EG3A 2A0UA 3QI2A 4UHEA 4BLOA 5HKOA 1DC4A 5J4VA 2VQSA 5LYYA 4R7ZA 3USZA 4LTNA 4F6LA 4CKBB 1U2DA 5JDIA 1MA0A 5DNDA 1O1YA 3WGJA 3ZE2B 5A9TA 1F0PA 5HQJA 1MAWA 3ONVA 2FEWB 1GPYA 4HLQB 4QJBA 2OV6A 3EMVA 2ZBGA 3MAGA 4KXXA 5LQNA 1QIFA 4HDRA 1P9WA 1CYDA 3CBGA 1SFRA 4RQUA 3CRMA 1KNXA 1C0KA 1JEQB 2MOKA 2QRVB 2VH2A 4M9RA 4YT8A 1M8PA 3V1LA 3A06A 4UNIA 4X00A 1B76A 5BW4A 3C4VA 2YINC 3IAAA 2WF9A 2Q2OA 3B1VA 3ORRA 1W19A 1XEXA 2D59A 1QRDA 3KVVA 2HF9A 2XKJE 1T3HA 2DFPA 2TRSB 4AP5A 3AI1A 5G4KA 3HHEA 1E1QA 1GL6A 1I2CA 4X8OA 3Q3GE 4ALNA 4L7VA 3PXGA 4E4TA 3CF2A 1IWOA 4NOKA 2PUDA 3DE0X 4LC1A 1I3OA 1W6RA 3QMMA 5KI6A 4MLCA 2BC9A 2J3LA 6Q21A 1CEXA 1V3VA 2R9VA 1YR2A 3STUA 2HRDA 3CZQA 2VSYA 3PQ4A 2Z9BA 2X0KA 2K2QB 2DTEA 2GN4A 1XEWX 2P30A 4PLPA 3OT1A 4RVOA 2I1VB 5LQAA 1Z7EA 2DH5A 4H6PA 1IWBB 4BV2A 5FHRA 3JQ7A 2OZKA 2BUBA 3MS4A 2ZIAA 1XZJA 3GG2A 3E48A 2EWMA 4GKAA 1BW9B 2CUTA 2IX3A 5JASA 5FBHA 4NHEA 5CLFA 2ID7A 3QV1A 1KKUA 2GPAA 4G5SA 3NRBA 4RPKA 3DTYA 4HL6A 5T41A 4EY6A 5KNCD 3LS2A 3Q2IA 5KYVA 5HTOA 2JFVA 3EGXB 1NWCA 1LV8A 3EW9A 1I7DA 4XDGA 1NSFA 1I4WA 4U7TB 3IBSA 4TVSA 4KMMA 3MYRA 2W2LD 4IIEA 5I8ZA 2VQ3A 4HFJA 4JEHA 4CM7A 2GFQA 2P6PA 2ZT8A 1YA8A 2IV7A 4XYGA 1CLUA 5A6SB 3WK6A 5JVDA 2GCNA 2JS7A 2WBLC 3HVHA 1FVOA 1H1LA 2FZCA 4PYKA 5B1SA 2OXTA 4C0JA 4BP9A 5KTMA 5KTTA 4PWYA 4FDAA 4U02A 5C8DA 2CBGA 3S27A 3GLFE 3U4QA 3LQ2A 2DETA 4HZUA 3LW7A 4MB0A 4P86A 3UAZA 4RNDB 5EOVA 4Q1EA 1D1QA 1OTXA 2CZGA 4YMLA 4ZOBA 1RXSA 2AR0A 4F1KA 4EHIA 1EVYA 2QAGA 3O4IA 1WPQA 3GDFA 3KYJB 3R7SA 4D8VA 4CIBA 2X40A 2B2XA 3QEKA 2HJVA 4HAXA 1ULAA 3KTAA 4F21A 5REQA 1UKAA 1S4MA 2I4OA 1XAIA 2V6BA 2OAP1 2GPTA 3CPSA 3RS9A 3ICVA 5HTKA 2ERCA 2ESRA 5BYKA 1RWKA 1MENA 4QLBA 5K3DA 1NURA 5F4ZA 5CVEA 4J29A 3B1ZA 1FB5A 3H19A 4QDOA 3V34A 421PA 1RI2A 3A36A 4UW9A 1EFKA 4WEQA 2D0IA 2ZANA 2NUTA 3TIIA 1O9HA 2AFIB 1R4ZA 3GN2A 1O95C 1VJRA 3CR8A 3DW3X 4OY3A 3T94A 1Q7BA 2OCIA 4IHQA 2J3QA 2Q99A 4OYHA 3NB0A 2EATA 3VSAA 4WASA 4BECA 1DUIA 3GLKA 1F3LA 3H2SA 121PA 1GVHA 3NHUA 3NXKA 4U8GA 2FW7A 3WYGA 4FDLA 5JSZA 1WLYA 3M5CA 4YDRA 3TW4A 2ZIZA 1MC4A 4N0MA 3QVSA 1WUTA 4D25A 3R0VA 3E0QA 5DGHA 2FEKA 4B43A 2JJ2A 1ZR4A 2JGJA 1T4DA 4JUIA 4W5RA 1FFEA 4KPFC 3ONEA 1SA0A 2GZ1A 3GUVA 1Z2NX 1GNPA 2ZJ6A 4CL2A 3L7DA 1UEJA 3VKGA 4WBSA 1OASA 2BAGA 3WQBA 5LWQA 3K71B 5IAJA 2MYUA 1M2NA 1H2ZA 2J4CA 3M0EA 4MS4B 1BD4A 2X7HA 2TSYB 3H97A 4OHVA 3RS8A 5KYYA 1MOQA 1GTSA 1J8MF 2DHEA 2DYKA 4Q7LA 3UMVA 1QBKC 1WU8A 3LBYA 3ZK9A 1E64A 2Q6LA 1XRRA 1E6CA 2YQ5A 2V0GA 1WXEA 3BXOA 2NQ8A 5AKIA 3TBKA 1P2SA 3I5UA 3RWMB 2ATVA 1K2WA 2VHJA 1FU7A 2FEAA 3DBOB 4R5HA 4D3SA 1JIVA 4MW9A 4IIXA 3U7QB 2OAEA 4EYGA 5B1YA 1T1RA 2ORED 1B26A 4EGQA 3WGTA 4GL2A 3PHHA 3N8NA 3BE6A 5CXSA 2WA1A 3HK2A 3CTPA 4JC5A 3KQWA 3DOEA 1AS0A 1A50B 4NZYA 3GJ6A 2G72A 5HVNA 4E94A 4X8HA 3K6KA 4W5TA 4DIKA 1SM4A 2ZCUA 5GIPE 4Y2XA 2LR0A 4O1MA 1HOXA 2V9CA 4LBVA 4CQLA 3RYCB 4B4DA 4Q12A 3IAEA 1IK6A 1L1EA 1M2JA 2IP1A 4MRSA 3QF7A 3TTXA 3BB3A 3RT9A 1OYVA 4R8KA 3OG9A 1RAGA 2FEOA 3FOWA 3U49A 4WCFC 3O1HB 3DE7X 1DOHA 1YQWA 3MGCA 1A8PA 3KVRA 2P6UA 4WOJA 4QSMA 4IO0A 3N2ZB 4IW3B 3RTBA 4G4SO 1SXGA 1SHTX 2GRAA 4LW8A 5HQTA 4Y2TA 2B92A 1BW9A 4P32A 3ND5A 1E9BA 3H6GA 4X6UA 4D98A 1NG1A 2M1ZA 3L6BA 4KLAA 4U7FA 1YR8A 3HVUA 4YGXB 3H0EA 5TR9A 3SX4A 2B82A 3R3WA 5IJ9B 3AJ8A 4BX2A 1T6ZA 3HJHA 3RJMA 3M34A 3IP6A 2GZSA 2O1SA 4Z7QB 1E5QA 1YDWA 2GPJA 2ZE5A 5DBGA 2VPZA 5DE3A 3R8CA 3OPNA 3PC4A 4WOKA 2QG9A 3HJBA 2V65A 1H42A 3T6KA 3PTLA 2RFLA 4B2IA 3R5TA 4YAUA 1KI8A 3WLRA 2FSPA 4LZAA 4Z1OA 3AETA 1S8NA 3IIEA 4DDVA 4YJ3F 5IT5A 4ALIA 2Q3HA 2VA8A 4S0XA 5AR1A 2CYCA 1P2BA 2ECFA 4M6WA 2P27A 1XC7A 2O3JA 4PYMA 4F7WA 2D3TA 1QFMA 4TLDA 2QJOA 3A4TA 4MLPA 1Q0PA 3Q3VA 1UC4B 3D5QA 3N8GA 3MIIA 3RV4A 2WWHA 3OO1A 3C8HA 3JZIA 2X5OA 3ILVA 3C41J 5GJVC 4B4VA 5H3CA 3LK7A 5AVXA 2X0EA 4J3NA 5T4FA 2ISQA 4B71A 2DUWA 4WXHA 3WKBA 4HQ0A 2CLFB 5G3ZA 4Y2VA 3TLGA 1DQPA 3WAKA 3H9JA 4Q82A 4BB0A 3V1NA 2EEZA 2JLBA 4RIEA 1M2OA 2RHTA 4IICA 4U6QA 5DHQA 5CBPA 2VHXA 1F5NA 1CWUA 4LXYA 2QT0A 4BNMA 2ZW9A 1E6UA 1JIUA 2A59A 1QF7A 2BEJA 2WM3A 3JQ6A 3MOSA 5H1YA 3DM5A 3AOGA 3CTMA 2G7MC 2X9QA 2ZRFA 1CRZA 3V7UA 5AW2A 3N05A 3BICA 3WMEA 1W1UA 4JT9A 4N0DA 1A0OA 4KUHA 3ZVKA 2IPXA 4MSUA 4OV6B 5FORA 2B0CA 1NN5A 3ZWNA 4KQ1A 4RVDA 5DNVA 3ZJ5A 4UVHA 2FPXA 5TMBA 3ILYA 3O0DA 3U3MA 3KLNA 5EJ9A 3MINA 2HWWA 2XAUA 2R7NA 5LMUB 1QRUA 4WADA 1I2BA 2FEXA 2FQQA 3KJQA 4IILA 2GD2A 3L7AA 1E60A 3MT9A 2VP5A 2CUNA 3NV7A 2FPPB 4Q1CA 5CAEA 3ZGLA 2E4ZA 4B74A 1GR0A 1SQFA 3FCEA 1MN6A 3CZ4A 1HG0A 5ENZA 1O7JA 5L45A 3TOXA 1IPHA 1VPTA 4ZRMA 4CTKA 4JXKA 2AMLA 2F62A 3BK1A 3I83A 4FW9A 4LJ7A 3PE3A 4AB1A 3K9HA 4E12A 1Y4ZA 3KQHA 1BVHA 1DWQA 2AFHE 1JQLB 3F6CA 4XZ3A 3LF1A 4PLTA 3RH0A 4DXHA 2DBRA 5THXA 5JXIA 3IV6A 4FMPA 1NPTO 2QI9C 2UYGA 4FFDA 2C7GA 4LY9A 4NCIA 5EEHA 1K89A 3R8XA 2OVBA 1W5TA 3EEQA 4RH0A 1PR3A 2EKDA 1KSFX 5B37A 1R4MA 3Q85A 1A2QA 1JQJC 2WU0A 1IH8A 5AHKA 3DZIA 4KYTA 1ISSA 1NRXA 3W2GA 1TUGA 1A9YA 1Z18A 3HUUA 5AJXA 5I7SA 3EPHA 5FLEX 3I28A 1XQ1A 4GMHA 1QIHA 1HT3A 2G9UA 4I7EA 4F6RB 4JBIA 2IIBA 1T8UA 1G20B 1W87A 2VHVA 4XTRA 1TNDA 3Q3JB 1A3CA 3TEMA 4GYYA 1UOOA 2CXRA 4PIMA 2NW6A 1Y7IA 2JFWA 3GRRA 3D6AA 1ORTA 4I5FA 4ZEVA 3L2OB 4NENB 3QHAA 5KWJA 3KG2A 2CN1A 2GLXA 4DLSA 1NQAO 2HK6A 3PWKA 4FZJA 2ZRQA 3BE4A 4XOUA 2CFIA 1Q1AA 3T1YB 3EXEA 2H57A 2M2IA 1UT6A 3BRQA 3VPAA 4C88A 1PGOA 1XZFA 3FWPA 4UU0A 1KI6B 2H63A 1PYGA 1AV6A 3K1JA 2ZAIA 3HEMA 3G5UA 3SBXA 1W73A 3LOUA 1VBMA 5HIAA 3LQYA 1EFVB 4QJ4A 3JVUA 1OLXB 1AE1A 3NHFA 4OMUA 4TROA 3ZD9A 1TZ2A 3ANYB 3L79A 3IHTA 2VUIB 4A0GA 4JB3A 1EG2A 1P5JA 2GTIA 4YFYA 4R2LA 1EG7A 1MGOA 1NRIA 1V5IA 2Z8YA 2XE7A 1H85A 1IXZA 1RHUA 2R00A 2VBGA 1AUOA 1AQ6A 3I6QA 4R0VA 2G0NA 4JUDX 4TS4A 3AF3A 2ZRLA 4FHEA 1PJCA 4NONA 3TO5A 1S2NA 4BFXA 1NE2A 3T8YA 1C7QA 2A14A 2V55B 4KNVA 1JG2A 1TE2A 2IOYA 1V4VA 2QE7A 3FYUB 3LPDA 3X1ZA 1PAUA 5NLLA 2VAVA 4C01A 1N6NA 1F0YA 4JKYA 1S2LA 3IP3A 4OQXA 2DBVO 4PQEA 3RGGA 5BY2A 2CJWA 3MCUA 4XDZA 2ZYGA 4CMCA 4P93A 4YBZA 3PFFA 2PUAA 4FE7A 1V8OA 1I9GA 2PA3A 2NUPB 4MW0A 1AZSC 1X6VA 2YZ7A 3GVHA 1HQCA 1UBEA 1DIBA 3CG0A 5AJVB 4A0RA 3NBQA 4BASA 2UAGA 4YDHB 4F5YA 1UJBA 3UFXA 1YB1A 1UJ5A 1Z12A 2XUZA 3K35A 6NULA 1B23P 1F6DA 3JAWB 4QUEA 4RUKA 3DZ8A 4XFJA 2DPXA 2A6PA 3QLTA 4X7PA 3UJ7A 5DK4A 3WIUA 3WWYA 3A8TA 1FFGA 3TXYA 1MO2A 4D99A 1MABA 1SUFA 2GKOA 2GFHA 2PR2A 3DFKA 3F9IA 3FZYA 5ALVA 4INPA 1E77A 4RPIA 3K1YA 3S8EA 1Z6GA 1JAYA 1YJ8A 4HNSA 3RUEA 3FPEA 1UP7A 3DEZA 3WDKA 5KOIA 3EY9A 1GGFA 1JDUA 4QYSA 5DIZA 3RVSA 4EPXA 3LA6A 1SWWA 5D3QA 3SPXA 3C70A 3UCFA 3GRKA 1EFAA 4PYQA 5AHOA 2PAFA 4RK7A 1C7JA 1T0PA 1OZGA 2NVUA 2FSIA 1UBTS 1V1RB 1YVEI 1G5RA 2GAOA 2GKGA 2W22A 4KEAA 4PZLA 3WLNA 3C5CA 4H4CA 2B1GA 1EZ4A 1F2DA 2GBPA 3F9CA 3MYYA 3OP4A 2CNLA 2X19A 4IX1A 2YTZA 3IAS6 4YREA 4BJ6A 5HKKA 1OWMA 1UAGA 3B6MA 3LP5A 1SUPA 2VT6A 4OIMA 4DCUA 3USCS 3AKZA 4BRZA 3I6ZA 2JFUA 2VOJA 1VLLA 4N5HX 3QOYA 1QJCA 3T5TA 4FFVA 2VZLA 2Q6IA 1M1YE 5FO0A 4QJIA 2BL4A 2I7XA 1ZH8A 3NG1A 4PO9A 4KRFA 1Z37A 3AKCA 4UUAA 4IIUA 1D0IA 4HS4A 5HJ5A 3HDQA 2O2GA 2GZDA 3PQFA 2W6ZA 3NAZA 4M0FA 1FQOA 4I5GA 4RVSA 2ZPAA 1OVMA 4Z9BA 4ACBA 3U4MA 1YFJA 1U9YA 2FQ1A 1FYEA 1WXWA 3KXKA 2BHLA 2ECPA 4HEQA 4IJ5A 3VPFA 5I3ZA 1BQ3A 1G8GA 2X86A 4LV6A 3TGLA 4P92A 5A3QA 4NAHA 3K9WA 1CF9A 5K6TA 1PUJA 2Y1EA 4DQVA 2I80A 2GLTA 4W8OA 3W5HA 4IXWA 2C2BA 4AW9A 4F04A 2ZTSA 1EDEA 3FSJX 1MJFA 1JQKA 1G4UR 5E7QA 2A3RA 2AYYA 3KPJA 3QXXA 3EASA 3NVDA 5IAOA 4KFUA 2IUYA 4HVAA 3O8CA 1RJWA 4TS3A 3ND6A 1NLYA 1PQUA 4IR7A 1EX7A 2AMFA 4M55A 5IULC 1T0BA 2ZTVA 3NM4A 1B3RA 1XTQA 1G3QA 2XBUA 3ZTTA 3UPUA 4E7PA 1XZAA 2ZAGA 4YAWA 3WGMA 3FNRA 4QUHA 2YFHA 3ZIAD 4EHDA 1JLRA 2EIXA 3A37A 3P9ZA 3AUYA 2YIDA 2GMWA 4KRYA 5J5VA 4YPFA 2YHBA 3DCYA 4GU5A 3WP0A 1BN7A 3ELDA 2QSUA 2H4WA 1UM9B 3EODA 1Z0UA 3P52A 3PIRA 3IE1A 2ZSIA 3UICA 2D5IA 4D4GA 2CYBA 2ZUTA 1WSWA 4UBKA 2JHGA 5AVJA 4O2BA 1WUYA 2QX9A 4C0LA 5DSTA 4D9JA 5JY6A 1Y1LA 2WINI 3PC7A 4QECA 2GJAA 3OKFA 1H23A 3NYQA 3U09A 4MIKA 4UVIA 4MIEA 1NIPA 4G36A 2PSDA 3WWZA 3FLBA 3SQMA 1I24A 1T26A 1SCQA 1VYTA 4JT8A 2WSBA 4RV4A 3QNWA 5DYNA 3J81A 1SQGA 3UHPA 2QQGA 3OJXA 3REOA 4RHYA 2W6NA 3ETNA 4KXLA 4HNVA 3L8DA 2X7JA 3FGNA 2VSQA 3GHYA 1CZNA 1CY2A 2G9QA 4KQJA 3PUZA 3EDRA 4P31A 1UBMS 1UPCA 2NU9A 2F3PA 2XA9A 3O3NB 5FXMA 3ZV3A 5JHGB 5TMEA 4E6PA 2H11A 3KYCA 1AQYA 2BTQB 3V8VA 2WOOA 2P5SA 1MX3A 5C3UA 4KO8A 3GJXC 3DGFC 5K8UA 3U60B 5B6PA 3D6NB 2IBSA 4JI8B 1LRKA 2ZRIA 4E09A 1O5OA 2VK8A 3R3SA 2O3SA 4U00A 4K1LA 3TZHA 5JADA 4H1HA 1Y8RB 4A2WA 1XFDA 3GPIA 4UXJA 5U1PA 2DTDA 1GUZA 4QO7A 2ZB4A 4OJYA 4M46A 2XVAA 4U9HS 3O4RA 2DTXA 2ZJZA 4I3HA 4PHCA 4OYYA 5FV4A 4PVCA 2BJHA 2C29D 2R84A 2W58A 3IBYA 3IXLA 4H7HA 3HUEA 3JAMA 3I3OA 2ZIEA 1XKLA 2WHEA 4KV9A 2XUPA 1N2SA 3OFVA 5ARBA 1C3EA 2DPLA 1PFKA 1I13A 4F8YA 2QRKA 1Q0ZA 3ZEAA 1OH7A 4X20A 2G63A 2LKCA 4YCNA 3T5GA 1YBFA 2ZJ5A 1VIAA 3NVAA 3DEYX 1MC8A 1ACJA 3HSYA 3K94A 3KLBA 2FPOA 1R9JA 3OY2A 3PHLA 3NWEA 3QLJA 1BA2A 3KPYA 2PZMA 4GM0A 1MV8A 4O4LF 5JE8A 1Q44A 1Y9DA 1FS6A 2VF5X 4JLAA 3UHJA 3ZXYA 2JCSA 1H4VB 3NETA 2XB8A 2XF2A 4I9GA 2W90A 3B53X 5U4QA 4EW2A 4NPHA 3QFTA 1W36B 4AJJA 2IPOA 4UCXA 3TDMA 9GPBA 3NU1A <