3A1FA

The crystal structure of nadph binding domain of gp91(phox)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
163
Chain Sequence
IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NADPH binding domain of gp91(phox)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Cytochrome b-245 heavy chain
total genus 56
structure length 163
sequence length 186
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08030 NAD_binding_6 Ferric reductase NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3a1fA00
1BX0A 3LRXA 4YALA 1EWYA 1FNCA 3OJXA 1JB9A 5H5JA 2RC6A 4AF7A 3JQRA 1EP3B 3W5HA 1DDGA 3LVBA 5EMNA 2XNJA 4YAOA 1AMOA 1JA1A 4FK8A 2VNHA 3FPKA 3FJOA 4Y7CA 3W2EA 1E63A 4YAFA 1OGJA 3OZUA 4G1BA 1FRQA 2B5OA 5GV7A 1QH0A 1GVHA 3W2HA 3ZBUA 1GO2A 1FNBA 1B2RA 1W34A 1GJRA 2RC5A 2BMWA 1H42A 3OZVA 2EIXA 1JA0A 1BJKA 3ZC3A 1NDHA 5KSWB 1OGIA 1QUFA 2VZLA 3QFTA 3W2GA 2OK7A 4K1XA 1FRNA 4P6VF 1QX4A 2QDXA 5FA6A 2BGIA 2BPOA 3VO1A 1TLLA 1E62A 1EP2B 3LYUA 4YAWA 5GV8A 4Y9UA 2VNIA 3A1FA 1FNDA 2R6HA 1DDIA 1QG0A 1QFYA 1QGYA 1KRHA 1F20A 1SM4A 2BF4A 3QFRA 1IB0A 3W2IA 3QFSA 3W2FA 3ZBTA 1GR1A 2VNKA 2OK8A 1CQXA 1QUEA 3JQQA 5THXA 3LO8A 3MHPA 1A8PA 3QE2A 1BQEA 1TVCA 4AF6A 4BPRA 2BGJA 4WQMA 2CNDA 3OZWA 1GAWA 4Y9RA 2QTZA 3OJWA 4DQLA 1QGAA 5TR9A 1QFZA 3VO2A 1J9ZA 1H85A 3JQPA 4EH1A 2PIAA 4F7DA 1I7PA 3W5UA 3QFCA 1EP1B 3W5VA 2GPJA 4U9UA 1BX1A 2XNCA 2QTLA 4YAUA 1UMKA 5H59A 3CRZA 2VNJA 2X3UA 1QFJA 4G1VA 1W35A 1QGZA 4B4DA 4DQKA 2BSAA 2VYQA 4UAJA 1CNEA 1E64A 2BN4A 1GAQA 1W87A 3ES9A 4C43A 4YHBA 1FDRA 1CNFA
chains in the Genus database with same CATH superfamily
3G9XA 4YPOA 3LXUX 4JBWA 4QU5A 1X42A 4RMGA 4YYEA 3FG9A 4A2QA 4TYNA 1JDVA 1H1LA 4LJ5A 1IULA 1JG3A 1H0RA 1XKTA 4I3HA 4IZ6A 3I2JA 3MWDA 2CNNA 4AUEA 1V0JA 1J24A 3U4CA 3E1KA 2CJWA 1C3OB 2ZGVA 4LJKA 1MQSA 2KE5A 4BRWA 3BX1A 1D5CA 4E15A 4ZN6A 1EK0A 3B2QA 2YBEA 3IESA 5FXMA 3VGPA 3IUEA 1WQ1R 5DEIA 1TD1A 3B60A 4ZK2A 3PX2A 5A7GA 4X1YA 3ZH2A 2VA8A 3MTIA 1YDFA 2A67A 2YYAA 4GOKA 3WBBA 3OZUA 1I24A 4A0GA 3ADCA 1GAXA 3H17A 2IXEA 3O8OA 2O7QA 2UVDA 2ATIA 3IKTA 4HTAA 1RYZA 4XSHA 3TIFA 4MUXA 5KOYA 2PGXA 1JZQA 2FUCA 2PZ8A 3GOQA 1H2XA 3DUFA 4QGGA 1TGYA 1K3UB 4CT4B 4R1LA 1JQJC 2KYRA 5IMSA 4JLOA 3MNFA 2BCGY 2VHYA 4JR1A 4E5KA 1T3ZA 4ALMA 2C95A 4NDAA 4X5OA 1T10A 1XCGB 4E12A 5C3MA 1QC5B 5HTKA 2AFHA 3ZU5A 4CNQA 3V8VA 3FWYA 3QQPA 3UWDA 1G2QA 1YE3A 1VZ2A 3QU2A 4FOOA 1TF2A 4QEKA 3IPYA 5H83A 1UDCA 3RASA 2VATA 2VQ3A 4TYPA 4X0EA 3RAGA 3ZDXB 3ASYA 1DXOA 5FBHA 1Z26A 4BNUA 2IBTA 4CEHB 1E0DA 2OV8A 3BIWA 4IIJB 4F4UA 3ORFA 2W70A 3VYTB 4B4KA 5A3JA 1QORA 3VX4A 1TUBB 4YNBA 4I8XA 5C5DA 5CH3A 2VCEA 1GR1A 1JW9B 4LV5B 2QI9F 3SVZA 5J58A 3MMNA 2JLZA 1DBQA 3G85A 5D7BA 3QVUA 3FWPA 3PDJA 1J8VA 4G6ZA 1WVMA 5HG0A 4PYRA 1F14A 1ZN9A 2BONA 4M3NA 4EOGA 4Q4AB 4NZMA 1SOWA 5IAAA 5CG1A 2C96A 4AP6A 1J33A 2D5CA 1GARA 1PJQA 2VEDA 2YJ3A 4LMPA 3UTDA 4HN2A 1HFKA 5JXGA 3EXG2 1WXIA 4IXWA 6REQA 2ADOA 3MMSA 5IAJA 2QE6A 2EOAA 5ESWA 2ID8A 4OBWA 3OY7A 4G1UC 1SA0B 2I2FA 3KDSE 3RVKA 3TSZA 3DLTA 4G0XA 1Z0ZA 2ERXA 2E2WA 3RSSA 5D5PA 3U0VA 4C87A 4DLNA 3BHMA 1Z0DA 3LU1A 4Q9IA 4DHWA 2GM3A 2GNPA 3FVQA 5DKFA 2FDCA 4INPA 3R7FA 3SZGA 4YMSA 2AYXA 3HXTA 3ND9A 3FTFA 4Z6KA 3KETA 3A6PC 3BDIA 3TXAA 2P5SA 4O63O 3B13B 5HFNA 3X1YA 1YVDA 1OIWA 3GJXC 1A9PA 4GC9A 4U8HA 5AJWA 4JLNA 1P2UA 2EFHB 4HH0A 4DA6A 1G6Q1 2R47A 3V9PA 1RHQA 3EBLA 4NJEB 5TVGA 4EPRA 1QZUA 5C53B 4XQ0A 1Z82A 3BMXA 1P0MA 4X24A 2DHCA 3Q0IA 4X71A 3HPQA 4MRAA 2CB0A 2GD0A 3BGDA 4RYDA 5AVJA 2NTVA 3OESA 3IAFA 4UOZA 5KSYA 1DAGA 4ZQHA 2I2CA 1IAVA 4R1SA 2VSFA 2CXPA 5A2QA 3PC8C 2CXOA 4UDOA 1PS0A 5TSDA 4UTRA 2OB1A 3C3XA 2RARA 4GPBA 1C3LA 1JB1A 1K5DA 1TTQB 2V7QA 2Y67A 3E18A 5ILQA 1KU0A 4FM9A 4EW2A 4NCNA 1PU2A 4HLUC 2XAUA 1JHAA 2KLHA 1ADCA 4TTIA 4UHBA 2VHVA 4L9SA 3SXPA 4EG6A 4J43A 3SSNA 3V46A 4DR7B 3O4FA 3O8OB 1P1CA 4L15A 5AW5A 5FWNA 3VUFA 2R1UA 3AIOA 1IXRC 3UAZA 3U4IA 5D51S 4AJEA 3LOQA 4BLQA 4E4TA 2WU4A 2Q5JA 1BWPA 4HNRA 1T8WA 1T5TA 3C6XA 3P32A 4C7OA 2H00A 3ONEA 1W4BA 5KSPA 2H1HA 4TRNA 3B6JA 4PC7A 4QDOA 5CT6A 5C32A 1OB5A 1W36D 5A0FA 2C5EA 2VG8A 2XRYA 3BEDA 5BNZA 3DMYA 1E4OA 2OSBA 2WWVD 4MVJI 1EHYA 1LBQA 2J0EA 3IVXA 5EIWA 3TSOA 1YD7A 3WLAA 5IHPA 3GMSA 1UDWA 2FPUA 3LQ1A 3CVXA 4P7GA 3LDGA 4J1NA 4A27A 2V55B 4GLJA 5G0TA 5BWBA 1ZI6A 3HO6A 4TMTA 2ES4A 5KC9A 2PTGA 3EFHA 4OXRA 4LKOA 4DJJA 1IZ8A 1T0BA 2DTDA 2ZR8A 4DLWA 3PPVA 3C24A 4ZIRB 5BN5A 4NXNB 2IQIA 2X9GA 1GM5A 1SVUA 3MTAA 4TQ9A 5HM8A 4D8WA 4DEYA 1Z5VA 4S2EA 2FUKA 2NPOA 4HB3A 1F17A 2AMLA 1Q7RA 4ITVA 4JJKA 1NUHA 4B6SA 5MHTA 2H0AA 3PZRA 4FFPA 4UEWA 4R2XA 5LQRA 3NBXX 2ZUFA 4DV0B 2E4VA 1I2AA 3KOMA 2KHZA 6ADHA 4WLOA 3MWKA 2XXAA 3WP1B 2O4CA 3PUKA 1MU0A 5G3ZA 1WZEA 5JI2E 3A3NA 4EENA 3P9PA 1U4OA 5JVDB 2QEQA 1II0A 4C9BA 4MVJD 3IL2A 3QLVC 3IDQA 2ZBQA 3OCCA 3TM4A 2I6QA 4G4IA 4DBZA 1I7SB 2V1XA 4UPDA 2P8SA 1NR7A 3D43A 1PAUA 3ZWBA 1NBMA 1PJLA 2SBTA 3MIZA 4GP6A 2AI3A 3KKOA 4WK2B 3EW9A 1X1QA 4QWMA 1E4VA 4M9RA 4JITA 2CCKA 4BMCA 4EHBA 1L8XA 3S27A 1IXZA 3EGWA 3B2EA 3OFND 5DLEA 3UV7A 1R74A 3WQQA 2JI9A 4WXEA 3CB2A 1JR6A 3BIXA 5T57A 1HRDA 3LY7A 2H6EA 2PKQP 2W2VA 1V37A 5JECA 5JC1A 3OZRA 4MGEA 2ZR0A 1WW2A 3CR7A 3ECCA 4FQ8A 3D6JA 4E7PA 1UEIA 2JI6A 4PG5A 4FVTA 121PA 1O5IA 4Q03A 1JHQA 3EVDA 1N5MA 4CU5A 3IEUA 4FMCF 3VR0A 5ALHA 3CW8X 3ZD6A 1EDBA 2XIQA 2RGXA 2AXEA 2BEWB 3HXPA 3IBFA 3KKKA 4PHFA 3PQ6A 4ZWNA 1LI5A 3FAKA 5JD5A 3RC8A 5AVUA 1DC5A 1UMDB 4OUDA 3KZXA 4JENA 4PVCA 1N6IA 3RVJA 1CNFA 2QT9A 1E32A 1MN6A 1W4CA 2BRUA 3KKNA 3LG2A 3OJ0A 4TYQA 4E31A 4LJRA 5F5XA 4OFBA 4JEUA 2R00A 2WT9A 3CSSA 1K3TA 2HNKA 3H5NA 1YACA 3TQFA 4E3ZA 1XZKA 3BRCA 4Z7QB 5A0VA 1GRCA 3KPYA 2AVNA 2APJA 3SM3A 1W9MA 3THYB 2NO9A 5HVNA 3KFLA 4EECA 1Z0IA 4IDFA 3VNUA 1UBLS 4MQBA 4CT0A 4J07A 4U2KA 1HFWA 5FO0A 3PR2B 4EHJA 1TUEA 4YMWA 4DSAA 1GTSA 2JA2A 3PKZA 3ZWNA 3T7CA 5KVQA 1LPOA 1YS4A 2HJWA 5GV7A 1W8DA 2IXFA 3PRKE 4KIWA 1FPQA 4PLZA 1Z9BA 3DV0B 4XTCS 3SYLA 1A9OA 1CJUC 1U0RA 1KJIA 1CUVA 1RW4A 4WBXC 4LNUB 3QZUA 4H7JA 1CRZA 3SIPA 4P22A 3UUWA 2OCPA 3TKYA 2QZ4A 2QYOA 3K09A 2HADA 3K9QO 4GU5A 4LYJA 3DVQX 4Y2RA 1O4VA 1YCGA 2QGFA 3N0WA 3RRZA 1QWSA 1FXWF 4ZJYA 2BFWA 3FPJA 1KSHA 4F97A 3EFOB 2AN5A 3NEJA 4WJZA 2PWYA 1C4OA 3CZ4A 1YZGA 4D9BA 2PSFA 2J3EA 1KDTA 1DAKA 1L8LA 3GT7A 4FGLA 4Y0AA 2VF8A 4L16A 4B2PA 4BNGA 4F3YA 2TMKA 5KYVA 4CMGA 1XRNA 5FNVB 4FMDB 4PZYA 1EAYA 1TIBA 4LOAA 4PSAA 4C6RA 3ORQA 4WFJA 4EWLA 5JVDA 4XGIA 1IHPA 2XT0A 2P2NA 3CZPA 4KWCA 4GAEA 1SKQA 3AG5A 3LVRE 2RGCA 4N9WA 1YQEA 3S8EA 2PZFA 3CH4B 4EA9A 1WB6A 3U7QB 5CVEA 5DBHX 1L4MA 1ZUD1 4EL0A 3IUBA 1UL1X 4XSVA 4MQMA 2QLFA 2EW8A 4MI1A 5CIQA 5EZQA 5LZ8A 4Q21A 4QYSA 3RKUA 1BROA 1NF9A 4MCIA 1HWYA 3WL4A 2HHJA 1USVA 3VZCA 4BFCA 3JYPA 4ZYUA 1M2WA 1QTNA 2E4ZA 3HJBA 3LP8A 4KAJA 5FA8A 2ISCA 4MVJE 1Q7EA 1KJYA 2PRIA 1TKBA 2P4SA 3WKCA 4A5OA 5GOZA 1ETUA 3C4JA 2A7QA 3LPNA 3RWBA 1IM8A 1KMQA 3IHTA 5PNTA 4LXIA 1PRYA 2HA7A 3ZZMA 1ZCJA 4DS3A 3NEYA 1ZA2A 4KE8A 3NDRA 2OCXA 4LCJA 3C48A 5KOIA 2P90A 2NO0A 3HB4X 1RLMA 3ZTWA 4TTRA 4UC0A 3USZA 1HG0A 1O77A 4X90A 1R88A 2CEAA 1NYTA 4XJSA 4TWBA 4PZZA 2C03A 2J3QA 3HA5A 3NH9A 4OFXA 4I55B 4G2TA 3PFCA 1S2DA 4C0QC 2AZMA 4JHXA 1FVHA 4L4YA 2GZ1A 3NLLA 4ZQCB 1D4OA 3EISA 4B40A 3M5WA 3PR3A 4PZ9A 3NHZA 3KT6A 5K3DA 1ZM9A 2AD1A 4AYXA 4WY5A 1VZ3A 1IHYA 2TECE 3CFYA 2AFVA 3BWEA 3I9KA 2V98A 4GZ3A 1WB5A 1CERA 1UZUA 3B85A 4HVLA 4RKRA 3PLNA 4ZO6A 4ZANA 4BV8A 1D6JA 4XQEA 3C3YA 3P2JA 4JL6A 2AFIA 3L1IA 4DCNA 4MYSA 4EVQA 2N75A 3P52A 4OFZA 4EELA 2X76A 3DOUA 3TG8A 3T0IA 1G20E 4EYKA 4XGKA 4ZTZB 1LB1B 2V9CA 1HO3A 2HL6A 3IUJA 3KKQA 4MK4A 4RA9A 5CPFA 3KE9A 3MTGA 4RXUA 4RZQA 1SXQA 1AKRA 2EJTA 4P3OA 1UBFA 2B0CA 5TGTA 2V59A 4PPYA 1WL8A 2FPXA 3O2JA 3FCUB 4PX2A 4QYIB 5ECGC 1Y8ZA 1OB2A 1HFEL 3R09A 3UXEA 2G0AA 4YP9A 3HJAA 3PGVA 2GJ9A 4I50A 4L75A 4A2WA 4BO8A 2QROA 2DR0A 3LVQE 3IDFA 3N2NA 3ZNPA 1K27A 3KWFA 3ZBUA 5DISB 4ANFA 1L2TA 1P2TA 1VC2A 3T1TA 1VA4A 2Y99A 2P3SA 1X39A 3BFXA 4EP1A 4YCMA 1BHJA 1H0KA 2DULA 2I1LA 4KDFA 1L0BA 5I51A 1E7WA 5HOQA 1P9LA 4FX5A 3F7TA 1YU6A 4H6XA 4OQ4A 1A2BA 1KO7A 1WUYA 2PS3A 3KSRA 3ZWWA 4FFBA 5DYYA 2WHPA 3I9MA 3LQKA 4X6UA 1GQ2A 5H4GA 2E55A 1M2KA 3GP3A 3V4RA 3UYLA 1ZK1A 2QS9A 3GCXA 1XHFA 2F17A 3LC1O 1JPVA 2B7CA 4H7FA 3GOHA 4BWFB 1KR2A 1VLZA 2FPGB 5HXAA 4D5GA 2O54A 3RH0A 1ENYA 4KMOA 2H4XA 3L3BA 1AHIA 1K98A 1TVKB 1H2WA 4RF4A 2WHXA 3FCEA 3R8CA 1X0VA 2J5QA 3PKJA 4EG8A 1IDN1 3HK2A 2G0TA 1MHPA 3VJKA 5L3VA 1HYBA 4B32A 3BS4A 1T4MA 3JYNA 3PUYA 4RIGA 1NF3A 1L7EA 2A4KA 2X42A 1AUXA 1N5OX 1LZKA 1IHXA 2INGX 3D3NA 3OTHA 1HYQA 3MQ2A 4A0SA 2DLDA 5EESA 5FORA 1CR2A 2QG9A 4G5GA 4L3VA 4EKNB 2BRUC 4ZAGA 2ET6A 4BNXA 2VJYA 3OLVA 3DR5A 3L7CA 4YJHB 3ILXA 2I2XB 1WZUA 2DSNA 1SFRA 3WIEA 3SR4A 3V4FA 1PDOA 1P1IA 2ZJOA 4C0LA 1I7PA 5KYKA 4O33A 4WPGA 2H06A 2QUBA 1E79A 4E5SA 1RXCA 1CUYA 2WYIA 4OH1A 3HN2A 3FJ1A 5A5VA 2HRRA 2B69A 4QYXA 3VNRA 1PGQA 1XXHE 4KQMA 1MFPA 1RKUA 1P2DA 1J0AA 2MOKA 4K1LA 3OICA 1AMUA 1AZTA 4WOBA 3ONNA 1KAHA 2WG2A 2AYZA 4AZ0B 1PR2A 2YHAA 1WDLA 2CFSA 2AKAB 1AUVA 1NXVA 3Q5GA 4MICA 3TM5A 1KSGA 1WCIB 2IYLD 1XMIA 2Y6UA 3FXAA 4XD2A 2WFMA 3CUWA 3W79A 3GLHA 1IVSA 4PEVA 2LKCA 2ZTHA 4LXUA 4RWZA 5CA1F 5JHGB 3LUPA 2DBVO 5AM4A 1P1BA 4K9DA 4I1RA 1UAAA 3R0QA 1UK7A 1T1IA 1T6ZA 3EVEA 4NICA 1RYFA 1YQXA 5BOVA 3D59A 3OWXA 4DNXA 3R9XB 2XLBA 1QKIA 4S0ZA 2PBZA 1BC5A 1CE8B 1II8A 1KZ9A 1P3DA 2FSVC 3ENQA 3L1KA 4GQBA 4YRCA 3RR2A 5EKXA 2ZDGA 4BFTA 4X65B 3ENNA 3IKJA 5JIBA 4WKGA 2CJYA 2J3DA 3OZ7A 2NTJA 5GTDA 2IBSA 4GI5A 3FKQA 4B5LA 2GD1O 1QE5A 1ZU4A 3ZV7A 4ZXPA 1J8DA 1U31A 4II2A 5C8VA 3KVNA 2P5UA 3ETHA 1BQ3A 4NENB 2VAPA 1FFXB 5TS3A 1R8JA 3FBWA 4ZRNA 5IJ0B 1FNMA 3QW2A 4M0EA 1EBFA 3I61A 2BEWA 3JD0A 4MUKA 2ZRDA 4TSFD 2QK4A 2BFEA 4GP9A 1MX9A 3LV8A 3R0JA 4UU1A 3TSYA 5I4KA 2Q8QA 4EK9A 3BWYA 1UQUA 3LFUA 4XW2A 3CRMA 1RBZA 4YRTA 3ZU6A 3I2GA 1UJMA 3B89A 1TUIA 3Q11A 1CQJB 3H5WA 2HXSA 2GCNA 2QXYA 2WYVA 3P4YA 4LOLA 1QHNA 1YMUA 2ID4A 3I73A 2YCLA 4G85A 2DFNA 4EDFA 1SC6A 3F6EX 1IPEA 1ZGHA 2JEOA 1GP2A 1XCMA 2C4HA 2C59A 3TSWA 5KVCA 3IT1A 4G5YA 1XDZA 2X6TA 3A1FA 3M6IA 3IA2A 1L5QA 4ZAXA 1QFYA 1QGUA 2QSJA 1ZINA 2ZU0C 4E5VA 1O3YA 1U63A 3G9QA 3DT6A 3LZDA 4L28A 3AKCA 4ZVNA 2J4CA 2KM1A 4EMUA 3LCCA 1Q17A 4MAMA 3RI3A 3SEZA 3Q1KA 4NYMQ 2RMKA 5C1DA 2W00A 3KPVA 3V97A 4RDHA 4CLRA 3PZBA 4CLDA 1G7SA 3M5PA 2H65A 5AKKA 5FR2A 4JXXA 4Y9RA 4KFSA 4RMIA 2CZQA 1QGDA 1T2EA 4I2VA 4JBXA 3BWXA 3UK2A 4KQHA 1TJ5A 2Z2ZA 2Q4OA 3OE5A 4K9LA 3WBJA 4U3JA 3AEZA 2LPMA 5G40A 3PD7A 4WUVA 4CPDA 1K8ZB 2W93A 3LBYA 4P81A 3W3AA 1G42A 5D3QA 4YUVA 5UKDA 1CV2A 3E4DA 1I3MA 2B94A 4B09A 3O4JA 4AZTA 4BEJA 3KQLA 1IBLB 3I04A 3VI3B 3B78A 5AK0A 1OVGA 2JZCA 3Q72A 4Y2QA 5TDHA 3ABOB 3E9CA 3RJZA 1TO1E 1DTWA 4GIBA 1YOVA 3ENKA 1QTIA 2Q6VA 4OEHA 2RHCA 3C41J 3H4VA 1P0QA 3HS3A 3K6JA 1B43A 1JEJA 2G1AA 1VL0A 2QYSA 2Y1XA 2GILA 2YFYA 2FRDC 2B82A 3RU9A 2F3PA 3O3MB 1QS0B 2G08A 3FSEA 4LZOA 3RKRA 4MITA 1LRKA 3K3PA 3IR5A 4L08A 4LYGA 4WBSA 2HF8A 2REQB 1ONPA 1JQLB 2GESA 4EQ6B 3AT1A 4CKCB 3KZKA 3DVLA 2C4VA 1IATA 4AURA 4S12A 3BBPA 2N0SA 4R98A 1Z2NX 4EY3A 3U7FB 4PFKA 3IQIX 3K1JA 3L8FA 1I13A 3RU7A 4UEKA 3ZI0A 3T41A 4EHKA 3PF9A 3G82C 3FTQA 4O08A 1U8CB 5EJIA 2LRHA 2J0VA 3AWIA 1WXDA 3HKBB 1LLDA 4L3WA 3RUCA 2OXCA 3A27A 4ZYZA 2I4LA 5BPFA 1DQRA 3RF7A 3C8HA 3PK0A 1XL0A 5BN3A 4V1CB 2X0IA 1UXJA 1E8MA 2Q41A 4N7MA 4CDGA 4BQEA 2JH8A 2WM2A 4N5MA 4J3JA 1NI4A 1NN3A 1Z33A 2PZAA 5C5IA 5CD9A 5JS1A 2XGJA 2VWQA 3WZ2A 1OGIA 5L3QA 3TVYA 3TR6A 3U49A 4TRRA 1SQ6A 1Y34E 4LXGA 3WIBA 1DC7A 4JP1A 2X0EA 4L8WB 1CUEA 3LRPA 4UAGA 4AMUA 1B0AA 1OAAA 3GQBB 2RKWA 3NANA 1TAHA 2HU5A 1LFAA 3R5SA 4QNNA 1I8TA 3SSOA 2RIPA 1ZNQO 3A3PA 2VYFA 3JAWA 4E46A 3T15A 3UYKA 3GRRA 1E79D 1XLTA 4ZCTA 2LVBA 3NTLA 3BTUA 4OI2A 4S2UA 4PWYA 1FNDA 3UFXA 4ARIA 4MMZB 4E09A 1VL1A 2C88A 1R64A 1KK1A 1TJYA 1JE1A 3H7AA 3RREA 2WICA 2CCJA 3L6UA 4I1OA 2XBMA 2Q99A 4DLVA 4WOKA 5EEGA 1CIJA 4HWTA 2IVZA 1RM0A 3R7BA 4DIOA 1N8NA 1QVZA 2BCJQ 1VP3A 4FNOA 4AROA 3AQ4A 3CINA 3F3KA 4DILA 1BMDA 4WGFA 4ND7A 3SU8A 5ALFA 3UWSA 5K0JA 3JRWA 4I4LA 2M98A 3ETNA 4FKBA 4G65A 4TV8B 2V3CC 4P4SB 1VJDA 1IBCA 1E6KA 2ZIUB 3R77A 4E88A 1H1LB 1X7YB 2R1TB 4E4RA 1YFLA 4BLVA 1KARA 3NAZA 2BJWA 1WV0A 4BO9A 4KO2S 2CWDA 5JPCA 2ZCUA 1THMA 4KH0A 3EAGA 1ZMTA 2BZSA 2JK1A 4Y98A 1WBDA 1KSJA 4LF5B 1EA5A 5C34B 4JK3A 3V3TA 1JKIA 2ZQ5A 4XYMA 2FZKA 3G2PA 2HA3A 2BBSA 5AUOB 3N39C 721PA 4WZAB 3QIAA 1S7CA 1A5TA 4S3MA 3DP7A 4GBGA 4AUMA 5KKCA 4OIMA 2DETA 5D1HA 3LUAA 1E58A 4GI3A 4B84A 1T3GA 2EWVA 4BP3A 3CLRC 2D7DA 3NMUF 1APBA 1TM4E 2FRXA 2Y2VA 4XM1A 1I3KA 1CP2A 4JIGA 4TRMA 2HA5A 3FD8A 4JFAA 3FDZB 1L7XA 3DEKA 3M1YA 4UBMA 1QK5A 4KQ2A 1E1DA 4M0KA 3H5RA 2MJLA 4JT2A 1ML3A 5HK8A 1NQWA 3G2MA 2VHWA 4IQ4A 5JJCA 1FFSA 2O2EA 4IYJA 3KG2A 3WGJA 3QX9A 5DX8A 2I3AA 3NW9A 3EWSA 1JLKA 4K2AA 3N74A 4RPHA 1GL7A 2EFYA 4RULA 3QXCA 1OGYA 3AVPA 4KN8A 3MYYA 3WSWA 1R5NA 3VYWA 5GJWC 4G0PA 1O2DA 3O1HB 3N86A 4NCIA 4EEKA 1CUSA 2YQZA 4YONB 1NMQA 3D6MA 4G41A 1FRQA 4M21A 3M9WA 4PAOA 2IE8A 4QU9A 1PT8A 4NS4A 4MQUA 1FFXA 1GT6A 1GZ3A 2V45A 2ZQYA 2ZRPA 2I65A 3JQ7A 3LDFA 1Y63A 3ZWPA 4WKCA 2MSLA 1JHMA 3CPEA 2Z4SA 2EW1A 3LLVA 2PGOA 1JMYA 1Y89A 1ENZA 3ENVA 4AKSA 1J00A 1ONOA 4B85A 2G4VA 4WH0A 2ZRIA 3EXHC 3LBNA 4KPUB 2ZUCA 2QPTA 5LPNA 2C92A 3U9LA 5BSMA 3B51X 3DZGA 1GKIA 5DNVA 4DJDC 2D2IA 5JWOA 3IUSA 2RBGA 3UH0A 3H11A 1V1MA 3FDXA 3G7NA 3K15A 3NUQA 1PUXA 3KO8A 3T5TA 3OIWA 5IXJA 3DAHA 3E81A 2OR3A 4BNWA 2AT1A 4W82A 4OLHA 1VE1A 4MUGA 5F51A 4KN9S 4FX2A 1DBSA 4B47A 4BLTA 4QOEA 1RIFA 3JQFC 2OKGA 2WWHA 4DT1B 2BGRA 2YHIA 1Z7WA 2O4UX 1Q91A 4BEWA 4EI8A 3OD1A 1HT1E 2NP6A 4MKFA 3ZWQA 4C4AA 2V3WA 3NC4A 4M83A 3N2KA 4D82A 1N0UA 3NHYA 3FSGA 4RLFA 5HF5A 4HMPA 1UT8A 2Q27A 2UZIR 2BIFA 5CT4A 5KTTA 1DJLA 4NCXA 4ZOAA 1ZNYA 3A9CA 2OV6A 4YN3A 1OZHA 5K1ZA 2B98A 4FFRA 3T7RA 4CU2A 1PFWA 3NRJA 4MI3A 1JEQA 3RV3A 4AF6A 4FW8A 3QVKA 5HKKD 2HA0A 4F72A 3AHIA 3VH2A 1VKJA 2PBLA 4JVMA 1USUA 3T95A 1P0IA 2PMFA 1J23A 1SVSA 3C3JA 2RH4A 4RTMA 4LXTA 2WR8A 2M6SA 3MC1A 4BEBA 3VMFA 1XXHA 3HB9A 3JQGA 2DTXA 4GMGA 4AXBA 4K5QA 4L5BA 4RTNA 2RHWA 4YMTA 1Y1QA 3V4PB 4BCBA 1KVTA 1S2LA 4O2BF 2GYUA 3QMWA 1LD3A 3WGOA 1OH7A 1PG2A 2MINB 1CB7A 4J0EA 2PH7A 4Z8YA 2R1ZA 5JD6A 1L5YA 1UKAA 1Y6JA 2RKOA 1M34E 4IIGA 1PYGA 4RPIA 4IY1A 3V6LA 3U40A 2EKLA 3W6PA 1FS5A 4JNCA 1U3VA 3WJAA 1OFUX 2EDCA 2XGOA 3KXLA 3LOUA 4G56A 1IUNA 2JD0A 2F48A 3F5DA 3WHKA 5AKYA 3DNPA 4BGVA 5TY0A 3OC0A 4JUFA 5EVCA 2MIIA 4I5FA 1Y3BE 1FDRA 5JNWA 4WERA 4E7OA 3I53A 5AKLA 4QAJA 1IN4A 3Q6MA 4MQ5A 4XLLA 2JLWA 4QUKA 4ZQIA 2O0MA 4WACA 4S1VA 1R0SA 3HYNA 1FFHA 4KBFA 3VNBA 3WYDA 3LJKA 4LZWA 1P19A 2VRBA 3W5HA 1ID1A 1H6BA 1KYZA 1LK0A 5C2JB 4KHPB 4CL0A 5LMZA 1I33A 4TV9B 1GQFA 3L8CA 1QH9A 1ZK4A 1NVVQ 4FFSA 3U4AA 4BVJA 5IJWA 3KR9A 2VNHA 1M0SA 3EGXA 3EZXA 1NWCA 2V6BA 2I7CA 5LWQA 3FH0A 5BYBA 1VKZA 1QPGA 1R16A 2AJLI 1CUGA 4UXHA 1T0IA 1SEPA 3F46A 4U7TB 1T2CA 1PI3A 3S2FA 4EIWA 1KEWA 5PGMA 3RJ5A 5KSZA 8ATCA 2JLXA 3O7MA 1F0PA 5A5DA 2VSXA 2NVBA 3NV7A 3VTFA 3IE0A 1EDEA 4NH0A 1E7SA 1EE2A 2EHDA 3E7XA 4I55A 4B7AA 2HFJA 3PL1A 4C1BA 3FZGA 2O52A 3RSZA 1RRFA 2CDAA 1WSBA 3GLFB 1QQBA 1L7BA 2CJFA 4ZAYA 1JT9A 3EBOA 2MR5A 1HSZA 2DFTA 3P4XA 5CB0A 5IAOA 2FSFA 4WXHA 3W7AA 4GOXA 4AU1A 4KQXA 2Z08A 1F51E 1NQTA 4X1OA 4XYBA 4B5KA 2FMTA 4Z2AA 3QUQA 1Y4UA 4TWZA 2RGWA 5IXSA 1JE0A 2IXBA 4EZBA 2VQ6A 1RYEA 1N77A 3DVSX 2M6RA 3ZDEA 3PDIB 3AF6A 2C7RA 1WAMA 2CCGA 2GO7A 2VAWA 2TSYB 2XZDA 3Q87B 1XZDA 1IZYA 2FKNA 2X1MA 3KPUA 3L07A 5H4HA 3OWOA 4UFPA 5CFZA 1LRJA 4UU0A 5TX7A 2EHJA 2IWRA 3VI4B 3UBMA 3THYA 1Q74A 1ZS9A 2QYTA 1XJ0A 3F9IA 3HB1A 5SZKB 2VBCA 2DPHA 2P7HA 4HPXB 5BSFA 3VTAA 1MEJA 1ZW6A 4JKYA 3S1AB 1R4MB 4YUAA 1XEXB 3W5IA 4DHEA 5JWRA 1QXSA 3LBFA 3S2SA 1F0KA 1SVLA 2ATVA 2H2GA 4NJEA 3SKYA 1ZI9A 2E4WA 3UW1A 1X1CA 4EJ6A 3TKAA 2EKDA 2WP0A 5IJAA 4O2BA 2C0QA 2A30A 2MR6A 1BMTA 3ENWA 2A0KA 2YV2A 3P9KA 4OUDB 5E0KB 3CRNA 5D5HA 5ALMA 3P2EA 5AVKA 1A76A 3OHPA 2I4IA 4V0QA 1FP4A 1BIFA 1EFLA 3D64A 3MLAA 1ZNWA 5C7YA 1OW3B 2CFTA 3A7EA 4MQFA 5DTEA 4P84A 5SY9A 4F60A 2DHEA 3VU0A 4F9GA 2QGZA 3FKSD 4MOWA 4DDWA 4X41A 4U4AA 1PWEA 3AX6A 5CLGA 5DGXA 4N6GA 5HBGA 4XYLA 4Q19A 5MN4A 1UC8A 2OZPA 1AXRA 4G37A 2K7ZA 1FJGB 1WJGA 2CL0X 1W5AA 2FEKA 2I22A 5FI5A 3TJRA 1L7MA 2PSEA 2JFOA 3GRZA 3HSSA 3A6EA 3GV0A 1GGFA 2O0LA 3GJ6A 1VYTA 4WKNA 3EAQA 3O8NA 2G28A 4Q4CA 3GCGA 1CQWA 2OQ2A 2YJTD 4HR7A 1O6CA 5F9HA 1E3QA 3G9TA 3UMFA 2NPIA 1U2SA 3PQCA 4GWGA 1SXJC 5AKGA 1RZRA 1YB2A 2CWWA 2OCYC 2W2TA 3CTPA 3KXDA 3OPYB 4NBUA 3TLCA 4UOEA 1C0KA 3WWDA 5IM5A 1K88A 4KIGA 3N58A 1LDMA 3I58A 2BFMA 3ZV6A 1MX5A 3RK1A 5JAHA 2BEVB 3QKWA 3FTCA 1E61A 4AJ4A 2VK1A 4JXZA 3ZJ4A 4TSKA 4LGYA 1DDOA 5FBKA 3A3KA 5K7SA 4KXLA 4PIVA 4F93B 2FDXA 3UN1A 3KPWA 1RMQA 3MHTA 3DFUA 3IMKA 1N32B 3UVEA 1OKKD 3O9ZA 1OBOA 1RI4A 4YAIA 3FDFA 1V5EA 5I9BA 4KAFA 2IYXA 1ESCA 1RZVA 3JQ6A 4YC7A 2OOSA 2ZITA 3SEQA 2IP1A 4R41A 3QJGA 3KOWA 3PUVA 1PJSA 4FBLA 4JAVC 1LI4A 4R8KA 1B6RA 2BMWA 4Y6OA 5EUQB 4BV9A 4OJYA 4CM9D 2PEZA 5CYGA 4P0QB 3GIWA 4AZ0A 1KEUA 2VC2B 4KX5A 3S7ZA 1EWVA 1A4RA 3JYOA 1R7RA 3G8DA 3F47A 4XCVA 2FFHA 5I7AA 3HU2A 2GVDC 3E61A 4ND3A 4B35A 4DLRA 5J4YA 2J45A 3ZVLA 4X8LA 1SG6A 1XQVA 3JQCA 1L8OA 3ADPA 3TTVA 3ZZ1A 5LA6F 4IZIA 4DN6A 5KMGA 5KNBA 1G8YA 1EG7A 5EIAA 3TVDA 2HJHA 4BGEA 3OQ1A 1DGQA 4G4SO 4URVR 1O54A 1QJCA 1YT5A 2OG2A 4QXAA 4P38A 3I39X 4HWRA 5JEEA 4HDSA 2YV1A 3DEAA 1XROA 2JI8A 2SKDA 3WKBA 1RADA 3K0EA 1KI3A 2EJVA 3KJQA 3PNQA 4W6ZA 3EDQA 3R24A 3CTMA 1QPBA 3HJCA 4UBJA 1NVWQ 1HFJA 5ERGB 1MH9A 3WRXC 1NLZA 2H7YA 5AR1A 3UHPA 3NTXA 3GUHA 4KXFB 3EVZA 1YJXA 1LFDB 5FRDA 1TEXA 4WASA 3ZZTA 4ADSG 1W6UA 2QVBA 2EG5A 1YZLA 3DEJA 3OZSA 3DZDA 4W8GA 4UMEA 5D7NA 3I1JA 5TT0A 1GZUA 4H7EA 1GUZA 4A16A 3AJ9A 4NP6A 4RLQA 1KHTA 4WSOA 2OBBA 2NYVA 4WKOA 4DCCA 2W4IA 2Y77A 5IVHA 3SN6A 5DTMA 3WRYA 1JG6A 3T52A 3AETA 4G5OA 2UVQA 4EABA 4W7IA 1YUMA 2ZUSA 3QF4B 4JV5B 1NASA 3KYIB 3Q9NA 3TNJA 3G2QA 4E1BA 1FY2A 1N0HA 1HQDA 1UBUS 1WCXA 2GK4A 2F7SA 4EF4A 1NI5A 4DIFA 3BWVA 4XIJA 5BV2P 1UZMA 5EQFA 4UQLA 1QH8A 5DDIP 1JR3D 3EXHB 3ZCVA 5LDDC 5GZ6A 1FVOA 1L3BA 3NTVA 2OFFA 4QODA 1YA6A 3CKYA 5K4GA 1G2OA 1VHDA 2ZBRA 4CUKA 3DHVA 4MJLA 1OASA 2CMKA 1WG8A 2HNAA 1YBFA 2Z8YA 3FGPA 4YIKA 5A1TA 1VCMA 2EC5A 4IV8A 4KJXA 4PXSA 4FS8A 4A36A 2XI4A 3PYXA 5DI9A 1MTOA 4UM7A 2KPOA 3HJTA 1AB6A 2AG8A 1NRIA 2ZJYA 5FI3A 5JS8A 2J5XA 4G3XA 4CKZA 2FLKA 1AKEA 2HLDA 4UTVA 1SBIA 5L4NA 5P8WA 1X9IA 1G5RA 2BR3A 3UBTA 3H75A 3LVBA 4F4JA 4JJZA 1L8QA 2Z6VA 1BCSA 5C52B 4MVJG 2CVZA 2MINA 5A3VA 3P9YA 4CKBB 4D46A 1IJKA 3PXUA 1LV7A 3R3WA 1A2OA 5BRNA 4RK1A 4BN0A 1GCOA 3DE4X 5BN4A 4UZFA 1U6KA 1Z0AA 1C3JA 3GFBA 5FFMA 4CGYA 1AHPA 3R5JA 1WMEA 2BVNA 3C7TA 4A15A 1BVHA 1HDYA 2WMOB 3RBZA 1DKRA 1OSNA 2DYKA 2J9YB 4MRMB 1HK7A 1RM3A 1TDJA 3HYRA 3IDSA 3NT4A 5IUJC 2XYVA 4KKXB 1VE3A 3DEYX 5C9ZA 5JZOA 1THTA 1YI8A 4F86A 4MDHA 3CR8A 3HFRA 4JJ4A 1E9SA 4HS9A 4PPGA 4P98A 4Y1EA 5M7EA 5CJ2A 2AFRA 2XCOA 2YZKA 3BAZA 3AUJB 2WF7A 1V43A 1QG4A 4H59A 1E9DA 2GZ2A 4JCCA 4Y2TA 1KI6A 1OA1A 4HQKA 5CGQB 4ECEA 4Z7JA 5CDGA 4BXOA 4BZZA 2EZ9A 1CUJA 1U7OA 3WMEA 3E53A 5TC4A 4Z0NA 5KSWB 4WCFB 3PRYA 4DNPA 3ZHBA 2HZBA 1I10A 5JEDA 4GZ6A 2B4QA 1M6EX 1T0HB 4FR2A 4Q9DA 1UPAA 3SLRA 3THXB 1GPYA 2NZUG 3Q3IA 4NBVA 4GUAA 4XLTA 5T64A 4IDNA 4EFMA 2IYYA 1KVSA 2KWIA 1D6SA 2B1JA 3RS3A 1ZCZA 3L04A 1JDTA 1NTOA 2QQGA 3LYUA 2IEDA 3G79A 5AI4A 1C2TA 1A9SA 1CDZA 1E2MA 2WIFA 1Z08A 4URWR 1WD5A 5FUQA 4I1SA 2PLRA 1W93A 1VFNA 3LY9A 3R3HA 2XZPA 2BFFA 1A5SB 1G8FA 4RVFA 2NUBA 3K96A 1XTQA 4JL8A 4BQNA 1Z6PA 4MV3A 3CRRA 1E1KA 1G21A 1X8JA 3U9TA 1U2DC 2HXGA 3EODA 5LA6B 1P7WA 1BD4A 1P5FA 2PIDA 3JRNA 4YI3A 3NAGA 2HJSA 2FG7C 3N2GB 4IGKA 3UAWA 4MVJH 3Q8XB 1K4KA 5CNJA 3HH8A 3LKBA 4TL6A 4MHOA 2C9BA 4RUKA 1U8FO 1NKVA 3MCUA 5U4QA 4M0DA 3AXSA 3ZV5A 3N5KA 1ZK0A 5JI3E 1K4YA 3DTVD 4LI0A 4CGZA 1W2WB 4AJ2A 3RAJA 3IT0A 2OFOA 1YB1A 2HJRA 2QZJA 1CUWA 2AGVA 4TUYA 2IPXA 3GJ3A 3KU1A 1P1HA 3O9MA 3SIRA 2WUWE 4JBNA 2C4TA 2ZIGA 1QU2A 2H3HA 1B76A 2NZYA 1F9AA 2ZBPA 2I4NA 3UW3A 1NY5A 1AGYA 3A25A 3IOCA 4RYLA 4CMCA 1MGOA 2J0QA 1IN8A 1SKBA 4YLEA 1TL7C 1IZZA 1ZD8A 2JFFA 4XD7A 2F43B 1NJGA 1HETA 1T25A 3EGEA 3K5IA 1GDHA 3LLUA 1NUTA 4P9NA 3UXHA 2D59A 1JHPA 1OC2A 2CLIB 1XD2B 2G9RA 2NQTA 1ZO8A 2IHVA 3NHSA 5EJ2A 4BIMA 4DCJA 2GVZC 3O7WA 4BNDB 1OYOA 2NZ2A 5LNK6 1V2HE 5CAEB 1NC3A 2HSJA 3O90A 3QY0A 4LWZA 4MIKA 1BE1A 1PL0A 2AJCA 5FL7D 5ULLA 1X14A 4CIYA 4BNIA 1BMFD 5M04A 1J1IA 1F9EA 1UEXC 3AC0A 4IHJF 2H7XA 4K6HA 4GVPA 5K0NA 5FV4A 4OKNA 4HRYA 1A4XA 2OWDA 4YGYA 3DO8A 4WINA 4F1KA 3TFOA 1QRRA 4UREA 2COKA 1KPHA 1IHOA 2XTAA 3K9NA 3SKXA 5JJKA 2VJMB 5AVTA 2WDPA 1FVXA 3E3NA 5CURA 4O2AA 2IU0A 3LTNC 3AEUA 4U2GA 4D9HA 5K51A 2B5VA 3OCXA 2CL7X 3MMPA 3ADDA 4HDNA 4H0NA 2GAAA 4H1UA 4YH1A 1VJRA 4D6XA 1XTRA 3NBAA 1FYXA 4ROTA 2OD7A 3GY0A 1H0HA 3UNXA 2O1WA 1OYVA 1R1DA 1VI5A 1PGJA 2ZWPA 3L0IB 5AKZA 3M9LA 1RPAA 3QUCA 5IVIA 1BS2A 4QLBA 4KB5A 3N8GA 2J48A 2A5GA 3C39A 5JJIA 1Y6ZA 4BNFA 1AGXA 4R2JA 3TD9A 1KJZA 1AQYA 3HVKA 1DKNA 1JALA 3I3SR 4GPEA 5FLYA 1DEKA 1Y1KE 1YHZA 2FU5C 2PT7A 4DC1A 5EWMB 3AVOA 4L5JA 2WUVA 1C50A 1E2KA 3ROZA 1CU1A 3M6VA 1MAHA 2BDEA 5IC6A 4ARUA 4M55A 1UK6A 2G9VA 3EX7C 2AF3C 3EY9A 3GQVA 2E37A 1GTJ1 2RGEA 2WV9A 1C3VA 2D7JA 4NZ9A 2I4MA 1MT0A 3BFVA 3CKLA 4ZJZA 5JJBA 2WJ3A 1YZHA 3V2HA 4WV3A 4B2LA 2F4NA 1L5VA 3TLBA 1CUBA 4GBED 5C8YA 2XYGA 3HRHA 2Q45A 3WRWA 1PP4A 2A8YA 2G5PA 2GK3A 4UTOA 5LP1A 4COOA 2CV0A 1FJHA 2MSCB 1TLLA 1Y1LA 2J09A 3K4PA 3KEFA 4TPKA 4R3WA 4A0FA 4F4HA 2O8BB 3VBEA 2GBGA 3O4VA 1FYVA 1I2BA 1KMHB 2NZJA 5A4KA 2ZSHA 4LF9B 1AJEA 5A06A 2VPZA 2QTFA 3E84A 3MFYA 4WEOA 3D7KA 5JS6A 4HHEA 2OC9A 3TF5A 4Q6WA 4R1MA 5CA1B 4BNJA 4YRFA 2O8VA 4MHTA 2YOFA 1I1NA 1J5EB 2XRFA 2ZSBA 4O2LA 3SQMA 2PLAA 2B7LA 5C8ZA 1VHJA 2IDKA 4DL9A 2OKCA 1ISJA 1F4VA 3AW8A 1P8JA 3N2EA 4XFKA 4KR9A 1G66A 1T2FA 2V03A 1U3UA 4KGDA 4Q5IA 4YFVA 5JCOA 5JBNA 5LMCA 1BFDA 2G77B 3SFZA 1JIVA 5HNKA 2O2HA 3FHTA 4QVKA 3GFFA 2W2KB 4BCCA 3SEFA 3K0CC 2QU8A 1FLDA 3LA6A 4HEA6 3K0HA 4HMOA 3ZGLA 4EY4A 3KSBC 3UJNA 1LF0A 4MW5A 3TMKA 2G3YA 2ZDHA 2BISA 4LFBB 3MOSA 4PLCA 3AUXA 1JVNA 3IEPA 3QV1A 4NONA 2LCQA 1HDXA 1K6JA 2VJBA 2FGJA 3CG0A 2GPJA 3UKJA 4TSFA 1TI7A 2IH2A 1PG5A 3RYHB 4B1FA 1X87A 4JYZA 3ZEAA 4C7XA 4YAUA 1RACA 3ZYZA 4Q6BA 1JSZA 4OMCA 4CG0A 4Y18A 3AYXB 3AUTA 4RS3A 4KVZA 4D9NA 3USCS 1RWNA 1GNPA 1ZMXA 2WAAA 4RM2A 1EI9A 4IIDA 2EEZA 4M8IA 3FFTA 5EIBC 1EFAA 6Q21A 1XZBA 4ZHQA 2CVHA 1OAKA 2PQMA 1E64A 3CVOA 3TZ6A 1QHGA 3K2QA 1SQ5A 3V48A 1A04A 1E77A 4EBFA 2FN7A 3CLSD 1PZEA 2R0QC 3TW6A 3ABQB 1Q50A 3K30A 1E3TA 2ID7A 2IQ5A 3PTLA 2XITA 3VJLA 2H16A 5IYZF 1JR4A 4TMFA 1JLRA 3CLVA 1QIMA 1RKBA 1R0ZA 2R97A 1IXKA 3BGSA 5K6TA 2RGNC 2WVGA 2XNDA 3QKSA 4G86A 1CR4A 3LUFA 3O8QA 1JKXA 4I1PA 4LCEA 3E82A 4XQCA 4EPXA 4ENUA 1ISGA 1FQOA 4UNRA 1X19A 3BL5A 3A04A 3GFRA 4DQUA 2QTVA 3F6PA 4YRLA 5CVTA 1V5WA 4AZSA 5IU6A 1NXTA 1W59A 1OLOA 1Y82A 1ZQ9A 4R31A 2BCEA 5IDVA 1KE2A 3RG8A 1VSQA 4YCBA 2Q4RA 3GELA 3RBXA 4HWGA 3IEKA 3SC3A 4MA0A 2FZCA 3MCTA 3ZIUA 1ZR4A 1XVUA 3ZIDA 3G5UA 4DIDA 5FH9A 1K7YA 1SHJA 4MR8B 4AULA 4DMFA 3NOXA 1M2NA 3MZ0A 2O1XA 4PYJA 3RIYA 1DWOA 1F3OA 5JC8A 2XKJE 3FOEC 3ZGZA 1ODKA 2EDAA 4F4IA 4RFVA 3CWZA 4FOSA 4BC0A 1BWQA 1U3FA 5FOUA 4MO2A 2Z04A 3RFTA 1NU6A 3ZHVA 4JVSB 4RVDA 4URYR 5AKJA 3HWWA 4ZU3A 1EXDA 3ANSA 3P9QA 3OX1A 1E3WA 2WFLB 1BA3A 1EZ4A 2V58A 4RZIA 4RKFA 3MTDA 1M8GA 3VDMA 1TZMA 1WXWA 4PHGA 5B2EA 1MZPA 1ZUNA 1HNWB 1FFAA 2VWGA 5DHTA 5TEVA 3T3HA 3ZCTA 1EP2B 4QO7A 1ODSA 3IO3A 2R1VA 3PUJA 4TLCA 4YAJA 2B37A 5AI9A 3FFBA 1K4MA 2Y0BA 1Q22A 3JR7A 2IXGA 2R8XA 4KR3A 4LDZA 3DL7A 2IDJA 3GEGA 2M1ZA 2PFGA 3IVGA 1PFVA 1XUOA 4N18A 2VHUA 1UUFA 5F3DA 4C7OB 1QHXA 5K3BA 3CX3A 4F6CA 5LCXA 4BTLA 2LZ0A 5A7HA 1BX3A 4MVCA 4MRRA 1K0FA 3R20A 5CEJA 2WAXA 3KJHA 3CIOA 2CJWB 3CYFA 4Y2UA 1WE2A 1YB6A 2O7SA 4I3FA 3GXBA 4JYBA 4R4JA 3UY4A 2LDXA 1UWLA 3A6JA 1BXKA 3ZHRA 1XK6A 3TFQA 2FXIA 4LRUA 3WNQA 1X7ZB 3U16A 3VGJA 1OH5A 2Q3MA 4LUCA 1LNZA 3ZU2A 2CV2A 1R8XA 2IUEA 3D7SA 2GPYA 4FBGA 3RG2A 2C9DA 1LEHA 1MNAA 2C54A 3CA8A 3KTDA 3ICPA 1OFTA 1EIZA 2VDQB 3ZY4A 2OORA 2H52A 3R1IA 4LMRA 1EH5A 1PWYE 5KYXA 5DYWA 3S44A 1N9GA 3TIXB 2ZS9A 5AVSA 3OOWA 4KFUA 2ZT7A 4ZQGA 4YY3B 4J0HA 4B4DA 5HQ3B 4QVIA 2JVJA 2EU8A 1JIIA 4QEDA 1WXXA 5CVUA 1J97A 4JN6B 3SJUA 2ZCVA 2Y1FA 1ZH6A 1M2JA 1V2GA 3N3BC 3NJRA 1K1EA 1OI4A 3P0HA 4K9SA 4LWPA 3VFDA 1Z63A 4TYWA 3FZEA 4F2GA 1VGQA 2YWDA 3PIRA 3QOXA 4HFMA 2KB0A 5ER9A 3WRXA 2VHCA 2BELA 2ZZMA 1BOFA 3OT4A 3SFVA 3NKVA 1S2MA 1TZKA 3DOCA 4UUMA 4ZI3A 1JVBA 1F2UA 4BPBA 4TS3A 2EBWA 3ME5A 1E3LA 1QHHA 3B82A 4R8RA 1BVUA 4YO8A 3TIVA 4A4DA 4ETNA 4RH1A 5K2OA 1YJCA 2Y27A 4YRAA 4PX9A 1ISFA 3OTWA 4B8WA 1M2EA 4Q47A 5JAMA 3L7DA 4I55F 2BTEA 4IWYA 2YJZA 3LBAA 3N6VA 1RM5A 2VDPB 3BE6A 4QJ5A 3IO5A 1YIAA 1RXIA 5D84A 5IT4A 4ENSA 4NESA 3IAS1 3HDGA 3T8YA 2EP7A 1YKSA 5IASA 3AJEA 4EKYA 1PL7A 2HWXA 1RI1A 4GI1A 4QYTA 3CNEA 7YASA 4M8NE 1T9ZA 1UMDA 1KYQA 2W37A 2XF2A 3D1JA 4YJ2F 1J42A 4EPTA 4MLDA 3VU8A 5BNIA 2AJTA 2FCAA 2GBCA 2I3ZA 4UVIA 4KPUA 1V1JA 4GRAA 5DXAA 1C1YA 2EYQA 2SHKA 5C51B 1BJKA 4IQGA 5DNWA 3FI0A 3WLMA 1TKAA 3LX5A 1OLSA 1T1JA 2IW1A 2G4LA 3JAKB 2QXTA 3IQHX 3OJCA 3HL4A 3PC4A 3RC1A 2EP5A 1EB9A 3VDXA 1OH8A 3OG9A 5ES3A 2V7QD 4MWSA 4X6XA 4EJMA 4Z4QA 2CXHA 4NSNA 3SQXA 1G0OA 3H2BA 4NDZA 4O4JB 4QQFA 4DCTA 4MSUA 5BMVA 1SBZA 2CHQA 2DWUA 4A0HA 5HMLA 5F2OA 4C5CA 1T2AA 3CKMA 1FIUA 4LZJA 2JL1A 3ILYA 3PA8A 1N57A 2MMCA 2SCUA 3AO0B 4D98A 3FI9A 4GPTA 1DJQA 2YQ4A 3IQDB 1XA0A 3I5UA 3AQIA 2C58A 1BDMA 1K63A 1P1JA 4DREA 1RRMA 3FUCA 1OX5A 2W9XA 1UBCA 2ZT5A 3ACDA 3MCAA 2F1KA 2N1BA 3G68A 3UXMA 2CNWA 2FEPA 1UBRS 2PMKA 2V6IA 5SZIA 1OWLA 5HDBB 1XEWY 1FDVA 3HM9A 1SNYA 3E3LA 1U0HC 4EHDA 1LS1A 3TK1A 1VE6A 4ZO7A 4WD3A 1NKTA 4B9AA 2EF0A 4MPPA 4B6GA 3L77A 4YK7A 2D3WA 1LDNA 4KC0A 4J7XA 5C81A 4JJ6A 4Q3NA 3W7BA 2VYCA 4IXNA 1OZAA 4L95C 3ZCPA 4C03A 3L9WA 1YFZA 1IL0A 1CJTC 1QO7A 2GJSA 2P67A 4A0RA 8ABPA 1CS4C 4LE2A 3R0ZA 3K1AA 1Z36A 3EGXB 4G0UA 1LH0A 3BB1A 2NU8B 1SU7A 3GJZA 1JYFA 4RFLA 1O87A 5I9LA 3COVA 2PGAA 5EGSA 2V0CA 2GXAA 1U0TA 5EIXA 1G3UA 4OHKA 4AB1A 4HYQA 3TJZA 3K2IA 1FMTA 1RJ9A 3NHJA 4BLSA 2BI7A 3NNNA 1G5TA 3BJIC 3EIFA 3WO1A 4D92A 1UIMA 4N47A 5J5AA 3FY4A 3K9WA 4F9TA 1D1QA 2X6QA 2YJ4A 2WTMA 4HI0E 4ZD6A 3VU9B 4H77A 1DHTA 1GZ7A 3BXHA 3OE7D 2DQZA 3DTVA 1E2GA 5CFNA 1JSCA 1M6VB 3T7JA 4NJMB 4YALA 2RI0A 3UWMA 1Y4DE 2FJPA 3E3OA 4HUQA 4NULA 3UOGA 1NJ8A 1WLSA 1DKQA 4BN4A 1XEXA 4FKMA 1M1NB 1WMFA 3L06A 4D96A 5EZYF 5DH9A 3DP9A 3JWEA 1QG2A 5ED4A 3ANYB 1GQRA 4TVBA 4H4EA 4JC4A 3NORA 1MOQA 4BQPA 1B8VA 1ECPA 1SVKA 1MRZA 1ZJ5A 1PNRA 2WPDD 1SEVA 4ZV7A 3GZNA 4RENA 3QEAZ 1DELA 3PYLA 4M88A 2WJAA 1YC5A 1OTXA 3L6CA 4GYJA 1I4DD 2AK3A 1RS0A 1DT3A 4DB4A 4AJPA 1FK8A 4U8GA 2JI4A 3BA1A 1XAGA 3VQTA 2FXVA 4DMLA 2ZJAA 2GHRA 3VNQA 3KAPA 1CEEA 3AEKA 3DBRA 3ZS8A 4ZKEA 2P5TB 2J6IA 5HCIA 1Y7PA 2JD1A 2PS9A 2QVLA 1C4KA 4QHYA 4I9NA 4ZVMA 1DCTA 1QYDA 4Z4HA 3UB2A 4S04A 2BZ1A 3R8FA 2VEOA 2YYYA 3DT9A 2YN0A 4RE5A 5EFOA 2ZKLA 1U1IA 3KVRA 3FROA 3THOA 4E2WA 4EB0A 4P86A 2UZAA 4BP8A 2PRZA 1QIJA 2XZTA 4N76A 1TK3A 1AE1A 2EEPA 3W5AA 5F7ZA 3GAAA 5B6IA 4TUYF 2VTKA 1HDRA 1DE0A 2PRSA 1QLHA 1X7DA 3ESRA 1YL5A 3MJHA 1L7RA 3DCIA 4LGVA 1W36C 3IP1A 4LV8B 2RDMA 4WMLA 1K5PA 4J1SA 1D6NA 1EUYA 1QBKC 1U98A 1HMPA 1CETA 1JUDA 2ZBFA 3AVTA 2VKQA 4DDHA 2VNIA 3VKUA 2GYWA 5E6RB 1VIAA 3BQNB 4L6IA 1QG0A 1FP1D 1KRHA 1KQNA 3AMVA 2ZIXB 3IQEA 3D4BA 1XHLA 5DLDA 5EP1A 3MWLA 1N8SA 3JQ8B 5KNDD 3A4TA 1EDDA 3AY6A 1VHTA 5AKEA 3W4KA 3Q2KA 4EB6A 1ZRNA 4E6EA 4ZARA 4EDHA 3D6UA 1OHHA 5KO2A 1SRQA 3DVRX 3EAFA 3U0BA 1XTBA 1M6YA 1RQNA 3LK7A 3VVBA 5MN5A 1IN5A 2CNOA 4OD0A 3UK7A 5AVYA 5LXTB 2PWPA 3FPFA 1Y5RA 4ONEA 1FTQA 3LNCA 4MMYB 1LLFA 4KWHA 3TKLA 1XA3A 4I9UA 2ODWA 3T1HB 2JA1A 5ERYA 4EJSC 3RROA 5KWJA 5EKDA 1W9HA 4Y1RB 2C1EA 3A2NA 3MM4A 5DCWA 2RK3A 1L3CA 1SD5A 4IJMA 2PH3A 3GFVA 4ID9A 4O59O 4UNPA 1PLKA 3WMXA 2BUAA 1ZVJA 1YB4A 4JLJA 3UHJA 5JQGA 1E9VA 3P0FA 1N2ZA 4W5RA 2FZVA 4N3BA 2BSXA 4NK5A 1NT2A 3AI3A 5FBQB 3LLCA 4Y2XA 5DLPA 5IJ9A 4Y9TA 4YP0A 1CUUA 1PHPA 4FLMA 4RL6A 1T15A 3F9RA 5L3RA 1FS6A 1GL9B 3W6ZA 4PLHA 2NSLA 4LQ4A 1OMOA 3ZDDA 1JH8A 4M8SA 2O8DA 5CVCA 1GPUA 2VJOA 3HN6A 3C7AA 4FNGA 2F4VB 3LRXA 1QLWA 5JAQA 3HFGA 1QIEA 2ODQA 3IP9A 5CMLA 3KJIA 4CV2A 2CSXA 1Z4MA 3CLTD 1JFRA 1K8QA 2KW5A 5AJYA 1JMKC 2HF2A 4J49A 4NMMA 5AK4A 4HNSA 1JDBC 3K31A 3CUKA 4CUJA 4WK6A 1NNLA 4CIAA 1T8PA 4YROA 3RIGA 1UKCA 5E3HA 1QCYA 1R0CA 2NU7B 1E59A 3SSMA 2DJ5A 1IBRA 2EKQA 3C5HA 2XKBA 4KO3S 5DO9A 2IPMA 4GS5A 5FWXA 1PJZA 3KEMA 2FHPA 3OOEA 1ZJWA 2PPLA 3PTZA 5AHRA 2REXB 4U7DA 3KWJA 4Q3BA 3LVFO 2W2KA 1GXSA 3BUSA 4FFVA 5H1YA 1PQYA 3D2AA 1WCIA 4V0RA 5BSRA 1IN6A 4TN5A 3SI7A 3ZHYA 3C3PA 2FZGA 2C3UA 4HGOA 2D62A 1Z17A 3DQZA 3U09A 3TD6A 2C8VA 2CUNA 2NU9A 4ZCRA 2AUTA 2WTEA 4WK4B 4DV2B 1SUSA 2GCGA 2VXYA 2DG2A 4TTJA 1CHNA 5FUXA 4L73A 3VZSA 1ZGCA 4PNZA 5C8DA 3T0FA 4DMGA 3GPIA 1SGWA 4G8BA 1L4KA 5DE3A 1PR0A 4NE2A 5CA0B 1DX4A 3MWEA 1IAQA 2IRWA 5FUWA 1FRZA 4HF7A 1XC7A 1W76A 2V7TA 2A2ZA 2EJCA 4KUHA 3I45A 2A9PA 4CLXA 1E5DA 2OZKA 3DEFA 4LJ8A 1DTSA 1CK4A 1W49A 5F1YA 3T5BA 1XMPA 2FPKA 1Z5WA 1Z6QA 3NHFA 4FGUA 5AKXA 3SOPA 3U56A 4AJHA 5I7VA 3GLGE 3N07A 4EJFA 5K0BA 3SS8A 3REGA 3B7GA 3H84A 1OR8A 2BMVA 3K20A 1QK4A 5CH8A 5L4SA 5BO5A 1M54A 3FOWA 2FFRA 2X9QA 2VBFA 4XR9A 3M1LA 5J1TB 3Q2OA 4C0AC 3GLFE 5AKHA 2PVCA 1T2DA 3AP1A 5GZ3A 2OECA 5LZ7A 4MRSA 1JJVA 3AVWA 2VJPA 3A9WA 3OMXA 2QTZA 2QVXX 2JGNA 1XX6A 3PXEA 4GMHA 4PZAA 1G8SA 2A0FA 3H87A 1ES9A 2Z83A 4EH1A 4J76A 4PIPA 2P4QA 2ZR9A 2IEGA 2ZI7A 4XIGS 3UT5B 1BXGB 2EBHX 4GPZA 4CN8A 2NXCA 4ER5A 5C7IO 5JTUA 2OVFA 2ORYA 1US8B 2VAVA 5GONF 4IEIA 2CBGA 5E4JA 2GAIA 3UF0A 3GNTA 1UMKA 4JHLA 4PHCA 3LUJA 4BO4A 3WNDA 3X43A 1KAGA 1BG6A 2HREA 1T8UA 3GJYA 2C61A 2HMTA 1SK8A 2CDCA 1E1LA 2NSJA 3FOBA 3OQIB 4RVUA 2R96A 3ADOA 2ORVA 1JU9A 2Y93A 4ZU1X 1SXJA 2HRQA 3LQYA 4OATA 1SBQA 4QQKA 4U0KA 3TS1A 1Y8RA 3MAGA 3MJCA 3PI6A 4FZJA 2I9KA 4MTCA 1JG1A 5CLLA 4DV4B 5KVVA 1T43A 3EUAA 3NWJA 2XB2A 3T5MA 2NXJA 1ZN8A 2JIZA 5DTRA 3PEUA 4KFTA 5BQXA 4HN4B 3ZXYA 4XIFA 2JG3A 1TU4A 3BIFA 4OMDA 2PL1A 2VR1A 2J5BA 4RPCA 4F3RA 1A7UA 1JG7A 2FI1A 3GJQA 1P9RA 3IMEA 4GVLA 4KI7A 5AHWA 2YHUA 5IBCA 2WZBA 2V3VA 3NHMA 4BU1A 2I7XA 5HZGA 1N6KA 2X0RA 3RYFA 1Z73A 2XNJA 5FWYB 3ZVKA 1U7DA 3EXEB 3E8XA 4Y6QA 3QPCA 2DR3A 4LVUA 2CMDA 4WZBE 3KEGA 4D3XA 2W2PA 1MC1A 5HILA 4OQZA 4Y6LA 4NBNA 4HNUA 4X64B 5ANRB 2M6KA 1OLUA 1FDOA 1NQAO 4ZGGA 2IOYA 5JSQA 1SUWA 2B5OA 4GLBA 5KU1A 4B3DA 2HV9A 2A5FA 1OU0A 1JAHA 1OWMA 4X97A 3E70C 3E7DA 4GXRA 2VNSA 1BJTA 3L8HA 4DV6B 5KHAA 2G9UA 5A3RA 1KKUA 1Z38A 1UPUA 4F3CA 1D9ZA 3DZHA 3D2BA 4MQEB 1H3EA 2YWHA 3K6RA 2ZIAA 4KXQA 3FF1A 3ZC3A 1FBTA 1JEDA 3A4IA 4DDKA 3LY8A 5IF9A 5K8TA 4R7GA 2XCTB 2IW3A 3GGCA 2GLXA 1Y98A 4C78A 4G0VA 1NE7A 4GM1A 4MLCA 4RL4A 1UDBA 4IXMA 2VP5A 4HWKA 2QDXA 1TMGE 3D1VA 2Q6TA 4AAYA 1N9ZA 3PUXA 4FJ2A 2XLCA 2YDYA 5TMEA 4F8YA 5EZ5A 3S2YA 2JJYA 3BTOA 3HC7A 3TL6A 5KQPA 3O94A 5DVZA 3MELA 4PX3A 3QWFA 5FCDA 1ZIOA 1REQB 4FFLA 1L5GB 3AU9A 2O20A 4NKRA 4D4IA 3ZWXA 1F20A 1IB0A 5IMBA 2OHIA 1U0EA 2C42A 2NVOA 2HLDD 3R8XA 1DRJA 1IXYA 3ZV3A 3QK7A 1OXVA 2WSIA 4LBVA 4RETA 3WK5A 4X63A 4F84A 1JN0A 1TAQA 2V4ZA 5HIMA 4U2FA 2QLMA 1BWRA 1B16A 3G8AA 4Q4JB 1QRUA 1A2KC 1JYSA 4IVRA 4PF1A 2V7EA 3CBGA 1MJFA 2XE8A 5FJJA 3C3CA 1CZLA 3LWZA 1CT9A 3DBHA 1K8RA 3A11A 5BSGA 1B8UA 2WIDA 1S5PA 3G2OA 3QUSA 3STWA 5CA0A 3OEYA 4LE0A 4X7RA 4YGXB 3VKFA 2WFAA 4IW3B 2PO7A 1SUPA 2B1IA 3ABIA 1YMVA 2J31A 4KUGA 1K6EA 3RHFA 1W4AA 2PZMA 4DBVO 4EMSA 4AS2A 2CW5A 3EFBA 1GLGA 3EH1A 4NAHA 3FAZA 5JARA 4HGQA 1BE0A 4R05A 1P7PA 4IYRA 3HL0A 4WHMA 4CMAA 1HNXB 4FFNA 3RUPA 1HF3A 2H85A 4TV9F 2II6A 4KXWA 4W5JA 2RGRA 3BJMA 4RVOA 1E2BA 2V7PA 5B3KA 4FGJA 5H0IA 5L9AA 2FTKE 3FMVA 3SGLA 4AWXA 1QNFA 3HADA 4EA8A 1V26A 3K0AA 1TADA 2F1RA 3M2TA 3EF0A 4MW6A 1KO5A 5BMVB 3L8DA 1U04A 1X92A 2YOGA 3R7WA 1UFVA 4EVRA 4AUKA 1NBME 4UHJA 4PV7A 4JMLA 5JNRA 1GPAA 3HWSA 3MGBA 2X5NA 1G5PA 2WF6A 2LNDA 3FKSA 2FEOA 4I46A 5E3IA 2VIIA 2P9YA 2XVAA 4RPGA 1KI1A 1EP3B 5B2ZA 4XOIA 5CTAA 1VHWA 2DM6A 3WWZA 1Q0SA 1M74A 3DE5X 2GGSA 5TGDA 3L82B 1V3TA 2FPLA 4JR2A 3RD5A 4TKVA 1YAHA 2QRHA 2JPDA 4D0NA 1UPFA 2UUOA 1TJNA 1I7DA 1KMHA 2ZIWB 4FYIA 3VH3A 5KHOC 4MVJA 1KZHA 4XUGB 4MROA 2J7PA 4RIHA 1GFIA 2AF4C 1M8KA 2DY0A 1S9DA 4BMVA 2QTBA 2FSHA 3E3MA 3TPZA 1YGYA 1R6TA 2WG1A 2WT8A 1VPTA 2QPLA 5GAJA 2D13A 3HEMA 1S4MA 2GARA 4P7FA 2Q0XA 3EG5A 3E4CA 4CODB 4V0MA 3V2UA 3REOA 1KFCB 4GW3A 4XWGA 4DWVA 4L78A 2UYHA 3WXBA 2D8AA 1NNI1 1NPYA 3G1WA 4BNZA 4MGZR 3E9RA 3DV9A 4HPWA 1PJBA 4LDNA 2O7NA 3ACCA 4WGGA 3IBYA 3UWPA 4EPWA 2AZXA 5EPUA 3WVNA 1QVWA 1PQUA 4MWCA 2I87A 3BMCA 3JQFA 3V1KA 3WS7A 5LL6P 2PXCA 1CRPA 2VQFB 1ABEA 2CVFA 4J2HA 3ZGVA 4CDRA 4DGQA 4HB2A 4F5WA 2PA3A 3PLAE 2B83A 3CZAA 5DCLA 3S3TA 1Z0FA 3AKZA 4XM2A 1D04A 1JLLB 1DIHA 1I2ZA 1N2SA 1UC5B 2FSVA 2I9PA 3NV9A 4EO9A 1FW6A 2CLCX 4YJ3B 4BYGA 2ZIZA 1XEAA 2Y1CA 3N2GA 2AFIE 3DT8A 3CCFA 1ATZA 3M0EA 4BUCA 2ECFA 2X8AA 3C6QA 1U0SY 4FFWA 4WRRA 3S2ZA 4BNYA 4ENVA 4QXOA 1WDWB 4KR6A 1XMVA 1E6CA 2QL7A 3FSJX 4RLSA 2C94A 4BTVA 3G0HA 4EW3A 1EAMA 5BN5B 4DA7A 1NTRA 2O9JA 3H0CA 1X1BA 2MSNA 2Y9MB 4YP5A 2O2ZA 5HKLA 4M1QA 3GFGA 1E7RA 2VAMA 1QQ6A 3H9EO 5A3QA 4OKSA 3FWZA 3OLQA 3PEVA 3TAUA 3BK7A 3VZDA 2XMDA 5BMVF 4P7BA 3TIGA 3QYJA 4RDIA 4Q39A 3FPLA 5DBFA 4GPIB 1L1FA 3SK0A 3CT6A 1RPJA 1RD4A 3EWIA 4MLZA 3L1UA 2B2XA 2ZT6A 4LRYA 3GVHA 4LA4A 2ADFA 4C7BA 1UBKS 3F6CA 3HKCB 5B1YA 3CEJA 3K1YA 3LF2A 1U8ZA 1DC8A 1X3SA 1Y5MA 1S7GA 2IY9A 2W8BB 3IQXA 1VDMA 3QUAA 4RZHA 1QLJA 5J2UA 4U6NA 4OXNA 3H3FA 1N1DA 4MS4A 4QUDA 4GR5A 1KAQA 4LC0A 3MIIA 5KUTA 2VDNB 1E0AA 4C43A 5LWHA 4JXJA 2RAFA 3MUFA 3WYGA 3ZJVA 1TCVA 1YZTA 4G5FA 4QOSA 3RVQA 4DBLC 2WUGA 3K0AB 2VJLA 5BRAA 2IEAA 2VPYA 3L7NA 4GWLA 4Q1EA 4TXNA 5J2TA 4OO3A 2PJDA 3TDMA 4RJIA 4YJFB 4J2TA 3RT9A 3K32A 3HCFA 5KYNA 1M2VA 1VJTA 1F1JA 3VR2D 2D7CA 2ZG6A 4PGMA 3TW8A 2COUA 2HU8A 4NLLA 4WY8A 4O4HF 2WU0A 1ESEA 2ZE7A 1SXHA 1SWVA 5JPIA 4AS3A 3OIUA 1CUAA 3NHKA 1A8HA 5E1BA 3RC9A 4MDFA 4KR2A 3OX4A 1DOHA 2J85A 1MRSA 1RJWA 2WINI 4OYRA 4UE3S 1IY8A 5AXBA 1WXGA 2Z58A 4Q15A 4PLWA 4RJKA 1NGSA 3PPIA 4DCUA 3DE2X 3C6ZA 3QLJA 4RESA 3NPAA 5JR3A 4QJBA 2O2CA 3ZYCA 4FT4A 1GEGA 4U63A 1KGSA 1N75A 2NACA 2OAGA 2VDWB 3GGPA 3L93A 5KOJA 4NNJA 3I6YA 2VPXA 3Q98A 4WZBB 2WWXA 3ZX5A 4REMA 3NRBA 1LBHA 1UXGA 5LR6A 4RJTA 4KGXA 2ANBA 3QYPA 5TF4A 3TINA 3QTTA 1NIPA 3KK0A 3QFTA 4LX0A 3BT7A 4PCUA 3LHDA 4N40A 3ZS9A 1DHRA 5DNEA 4LTMA 1FRNA 1FTYA 5GVSA 5G41A 3H1AA 2I78A 1QSGA 3KFVA 3L5OA 4L7VA 5U9CA 2XHZA 1BVRA 2PKXA 4YQEA 3RRNA 1YR9A 4JU9A 3N05A 1B6GA 1ICIA 2G25A 3H18A 3G23A 4CF3A 5A4FS 3LQFA 2ZJ0A 1GFSA 3A2MA 3CLUD 2ZUTA 2QP4A 4C2TA 1P31A 3DMNA 5DHFA 3B1FA 1G6OA 2GXSA 5DGIA 1MC5A 4TLMB 2X23A 3V7YA 5KYYA 3W2IA 1ESDA 1U3TA 1Y6QA 3AR8A 1SC1A 4EFNA 4ZDWA 1DUVG 1QUEA 4O4LF 4WECA 3QEBZ 1ZIYA 4G4GA 4CBVA 1P8AA 1ZD1A 1KFKB 1NVUQ 1FTWA 1TKRA 1UQTA 1VYUA 2G5TA 3EY4A 3KYJB 3QE2A 2Z1NA 1FW8A 1T8SA 2GFQA 3ZY3A 3G59A 3MWYW 4MQEA 3I9V1 4HEHA 3H7IA 2H1OA 5CDTA 1H5QA 1AZSC 3QTBA 4I08A 1ZLYA 4JROA 1MABB 1T8TA 3MTJA 4OM7A 5K5EA 1EVKA 3ED5A 1RE1A 1YR7A 2VHTA 4D2IA 4E0BA 4N6NA 4YPVA 4OBXA 2QRUA 3AZPA 1PJ3A 3TOCA 1XRJA 1DRUA 2XQKA 3R44A 3V7UA 3CS3A 2J6CA 2WIAA 5F4ZA 4JI2B 3F73A 4NHOA 4RFSA 3TX6A 3FE2A 3JAKA 4MV6A 5L4LA 1S3SA 2EATA 2ZRNA 4P4GA 2W2XA 1WSWA 2H0RA 4PCVA 1SU6A 1VRWA 2ILTA 1WKVA 3F98A 2D1RA 3II6X 4OLJA 4MRNA 4M0CA 2RGYA 3IEXA 3VC7A 3D2CA 3H86A 3V8EA 1JZSA 3HYTA 1XQ1A 3Q9LA 1AXEA 1RC1A 3HLTA 3P9CA 4FD2A 1H9CA 4X84A 2B3DA 5DXFA 4HK4A 4BVGA 2VUHB 3W4JA 1VMDA 3IR6A 2E21A 4V39A 4FXPA 3QBEA 1Q19A 4AJ1A 4IDDA 3LIIA 4JUBA 4A2PA 4BVFA 3K70D 3B1ZA 1XJWA 1G5IA 3P2MA 5IC5A 3VZBA 1G64A 2B0JA 2R79A 2IWHA 1NOJA 2L19A 3TMAA 2FPRA 3H6HA 4C7JA 4Z3KA 1EHIA 2YFHA 5ED0A 5HR5A 4GZMA 2XMQA 1TT7A 5CGZA 1WDMA 5DIFA 1V8OA 2I29A 4J6EA 2BFBB 1PZMA 1XD8A 2EP8A 4P3XA 1W0KD 1MZVA 3NIGB 1R0LA 1X0XA 3C87A 4QBGB 2WU3A 5EHIA 2FN8A 3KZ1E 4ZVKA 3V00A 3W77A 3P7MA 2V8BA 1R5BA 4MV8A 4XJTA 3T99A 1VMAA 3BWBA 5I9IA 1YE8A 2DUJA 1Z4LA 3MQFA 4LQCA 3W78A 2IX3A 3I2HA 3UCEA 3CVUA 4ZVRA 2FQQA 1KSFX 1OFGA 3PRHA 1E96A 2VPWA 3DHYA 5BYAA 1J8YF 2HB6A 3JVIA 3K09C 1DAEA 2PUTA 1ESNA 2FFBA 3D0OA 4G67A 1A9YA 3WAKA 4DPKA 2C2YA 4D44A 1TCAA 3I23A 3RM3A 1Y81A 3GN2A 1QUFA 2QM7A 4FYHA 3T9CA 4RQAA 4KLRA 1RSZA 1V45E 1BOOA 2O0KA 3QXSA 1CZRA 1EQUA 4XM0A 3V7WA 4Y2JA 2Q1TA 5BVHB 1FFEA 2CB9A 3K8QA 4P53A 2UYQA 3MFQA 4UVGA 4WXPA 3SZRA 2I62A 4PFSA 3TVTA 3GRCA 4PIMA 1J70A 5JYBA 2AUNA 3MJSA 5DSXA 4ED9A 2JIZD 4J4HA 1UWVA 3G2NA 5G1PA 4D3FA 1ONSA 4L5AA 4B17A 2X7HA 2YWGA 2QAIA 4I4TB 4QLOA 3LDHA 1DAOA 4UQOA 3TE7A 3NALA 2PUJA 4L9WA 3DXFA 2H4WA 5K8LA 1L4BA 4QFDA 1HX7A 4M7WA 5INTA 1DOAA 3Q5DA 1OX4A 1I4TD 2BBTA 2ZP1A 3JALB 3T06B 3GA0A 5SYAA 4PFQA 1UP6A 3SNKA 1R5OA 3LX6A 3PQ3A 3JQ7B 2R1VB 2NWQA 1YZKA 1QRAA 4DAEA 1A5BB 3DLPX 5JAPA 3QG1A 3HBJA 1L5FA 2GT1A 4D02A 2POQX 3VKHA 2P8JA 3EIOA 3GBSA 3W5UA 1TZBA 2IZ0A 2YNMD 3KB2A 4LGCA 4RQBA 3PJRA 3GLIB 4UM8B 3BGOS 4KBYA 5AIAA 3HY3A 4Y2YA 1QM5A 4B3TB 4FDMA 4UMFA 5E6SA 4UAUA 2VNJA 3IIJA 5JXJA 1D1TA 1H2BA 4KIFA 2QA5A 1LLUA 5G0UA 1E9FA 4HQRA 2B25A 3MUOA 3MD9A 2I4RA 1QF7A 1ULHA 2YOHA 2BFEB 3PGJA 3EMBA 1JXOA 3G0GA 1TYEB 4MI9A 1F0NA 1E9AA 2Y0PA 3QLVA 4RPJA 3KOZA 4IHQA 5AXAA 3DS8A 3VR4H 1Y9JA 2VK8A 3HGQA 3IOEA 2OFPA 3KWLA 5DULA 4EUNA 1V1RB 3BWCA 3VOSA 1BHO1 3U4HA 1S02A 2ZW9A 4A91A 3P9IA 4P31A 3ZVRA 4AWBA 3GLQA 2WHQA 2BR4A 3HWRA 4QDJA 1H22A 2RCYA 3E2PA 1OV6A 1Z6GA 3KKZA 1CY6A 3BWMA 1E2IA 5CK5A 5CCDA 3F2IA 5CIWA 2E4UA 5BR8B 3LE8A 1NP7A 2VZEA 1GSOA 3I1FA 2XCQA 1J4AA 4DRXA 1EVLA 5CYPA 3A6FA 2ZR7A 3LBHA 4I81A 4Y7CA 1X1RA 1U6IA 1E63A 4M1MA 5LYJA 1MIOB 4YRMA 1IU9A 2X8JA 1Z6YA 1Q7BA 1P29A 4TT8A 3U37A 4M87A 3GA5A 4FDUA 4QQRA 5BN3B 2RHBA 5A4AA 3RS7A 1FJ2A 2QL9A 1DJMA 4WBNF 3B38A 1YRQA 4ALNA 3SFTA 4DV7B 2GN8A 3DCYA 1COWD 3DMFA 1RI2A 3K1TA 4Q3OA 4LF4B 3S8MA 4QA9A 3OZVA 2ZI9A 5AJVB 4DADA 2G17A 3LC7O 4LQDA 4D25A 1B6TA 2A1IA 3WXMA 4CXMA 1Z0UA 5AK5A 1RZRD 3TUZC 5TPZA 3T5DA 1MO6A 5HJEA 3WJ7A 4EB6B 2PX0A 2QMUA 5K8JB 2WE7A 3AZQA 1WCWA 5IDWA 2QMZA 4OQDA 4GSYA 3QYAA 3H2YA 5KNCA 4Y2GA 4JA2A 2BMFA 1EJ0A 1YKGA 1ECLA 1I4LD 3DDCA 4LYFA 1RFGE 1NDQA 1T5BA 4PWZA 4JI6B 1ODFA 4LDRA 4YA6A 3EUEA 4HFRA 3RFVA 4FONA 2PX6A 5HIJA 3PHIA 1R6DA 4XOUA 1N4AA 4ASUA 4B2YA 3KR1A 4IV0A 1C8LA 1KFBB 1PEAA 3C5VA 2XMGA 2XBUA 2ZJ8A 4HEQA 4KQCA 5T8KA 3R7SA 4OLAA 3SBXA 1XRLA 1C0IA 4QREA 3W5DA 1YJ5A 5AI6A 5ARCA 3H9QA 4UASA 1B3RA 2J46A 3JQQA 2IZOA 2XE7A 2I7VA 1EK2A 1LBEA 4U5XA 1NW4A 5ADVA 3BYZA 3OU7A 1FRFS 3BCUA 3NHRA 2EGUA 4W7HA 3WKEA 4RVCA 4D41A 3UMYA 3MSCA 5TNXA 3ZHSA 2Q1UA 3O4GA 3PSHA 4FKZA 3N8DA 4CKEA 2BI4A 2FNAA 4YT2A 3JQPA 4BAZA 5AMXA 4D7AA 1RHJA 2UUAB 4NCKA 1AQLA 5AVRA 1PV1A 5SY6A 3BMNA 3VTZA 1KZ6A 1PZXA 1QKJA 1LNSA 1FTSA 5D01A 3UKDA 1XDDA 3IKVA 4UCFA 4KNYA 5DEOA 3MGAA 2CBZA 3LPCA 3NIWA 4HDMB 2G5GX 2LR0A 2Q5OA 2O23A 5E6SB 2I1QA 4A8HA 4ZZ3A 1NC1A 2ZRCA 3JARA 1NR5A 3SDZA 2PUGA 1E18A 1PHRA 1WEHA 2B78A 3UKOA 5K45A 3QVOA 2PZLA 3A26A 3PX7A 1IQPA 1MDFA 1Q0LA 1V4NA 2EARA 3CH5A 5FLKA 4ZGWA 4C0HA 2VAXA 3PDHA 4LPSA 1QMGA 1JJBA 3ES9A 4OUKX 4Q7JB 5D2CA 3TBKA 3ASVA 1MABA 1LPPA 4HTFA 4ON9A 3QMPA 1ZBQA 4B7UA 5A9RA 1HDCA 2YMMA 1I4EB 4FHDA 3CIFA 4Q1FA 5JALA 3BILA 1OC4A 3NGMA 1JDBB 2QN3A 1XTIA 4IHKA 4R01A 3V7NA 2BEKA 3NYRA 4UUQA 3K6SA 3ZW8A 5MFPA 2GD6A 2I71A 4H6WA 5AVWA 1V39A 4JD5A 1KWGA 1HH4A 3M6XA 3PC7A 4W4TA 3V1LA 1N8TA 1RYBA 4IWXA 2R6AA 2XR1A 1NBAA 3PNSA 4G5HA 2X5JO 3P0JA 5KYYB 2BFOA 4O3MA 3OA2A 4K9PA 3PEEA 3EGIA 3PUZA 1G41A 3UB4A 3CLSC 2FH5B 4DC0A 3W4IA 2WSSA 6CHYA 1NUSA 2D5BA 3K92A 3EG9B 3QRWA 5C35A 1JI0A 5D00A 5IANA 3EPHA 1Z06A 2ACKA 3L05A 4RQUA 2NN3C 4LF8B 1NZJA 2L18A 3D3QA 4AZVA 1RWPA 3EIEA 4XJVA 1R6UA 4BNDA 4Z53A 1GNVA 1AQJA 1Q1NA 5AOAA 5K99A 2BHTA 2TS1A 3H19A 1WUKS 3VO9A 2ERCA 4UDYX 5EE1A 4ZYTA 3QE9Y 1N5DA 1FCJA 1SOAA 3ROXA 4HNTA 4LXYA 3KZCA 5FPTA 2V7GA 3UENA 2OTCA 2P9FA 4YRGA 4INJA 5BUSA 2GERA 3P0EA 4N03A 3HACA 5F78A 3TGWA 1HQYE 2UUCB 3C6KA 4N39A 3EYWA 2A33A 1SCAA 3AIIA 4ILEA 3E22A 3D3WA 1JTVA 3L8YA 4E1VA 3KXKA 4IKEA 3GPLA 4KBGA 4QSHA 1UC9A 4ND8A 1N2EA 4UARA 1GNSA 3RRMA 4DSZA 2DUMA 4BJ5A 4XEHA 1JQBA 2BPOA 1D1SA 4O4HA 4U7JA 3C5CA 1NJ5A 1X94A 1P3JA 2Z8YM 4P83A 5K3CA 3T7SA 4Q3LA 4BKMA 4C6TA 2DPLA 2A0YA 1VJ5A 1DUIA 2PX2A 3OZFA 4YRZA 5KYUA 1L3IA 3CLRD 3NEAA 1ZAKA 1QP7A 3QV2A 1B3BA 3IPLA 2IZ7A 2OBMA 3B1KA 4Q3DA 3OEHA 4MVJF 3OU2A 2WTUA 1XF9A 2VNKA 6YASA 4I19A 2FEMA 4TRJA 4B87A 3UGQA 3K2BA 3U7QA 2P1DA 4AZ3A 5G02A 1AH2A 1X7XB 4X3OA 3DTYA 4HBZA 4BX0A 3FDZA 3HYCA 2GBLA 3TQHA 4KGZA 3SMQA 3WBKA 3ZJ5A 1SHUX 4LJSA 1JIUA 3AU8A 1Z34A 3DGEC 5EI5A 1Q0TA 2OO5C 4ALLA 3KAQA 5BNFA 3UOAB 1SK9A 1NQXA 2ZSDA 5A03A 2ZIVB 3U6KA 1SUCA 4CKYA 4K3VA 3OLZA 2QW1A 1VB3A 4L4RA 3CVYA 3AVXA 4LMBA 1W46A 3BMOA 8GPBA 1U2DA 4YPFA 1G7RA 4JP5A 4QEZA 3DJFA 2Q5IA 3AB3A 4OJQA 2X3UA 4FUQA 1P77A 4ZQEA 5IJ9B 4I4TA 1NKSA 2XWBF 5K0CA 4OX9Y 4I4NA 1PNVA 1Z6XA 1E0JA 1LPSA 4IP0A 4NK4A 5LB4A 2VNAA 2O07A 3LSTA 3V8MA 2IS1A 5K3OA 3SY8A 3AR7A 3VJRA 3VA7A 4NFHA 3TQRA 4JX8A 4CEJA 2IH5A 1E8NA 4TSRA