3A1FA

The crystal structure of nadph binding domain of gp91(phox)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
163
Chain Sequence
IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-245 heavy chain
publication title Crystal Structure of NADPH binding domain of gp91(phox)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 163
sequence length 186
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08030 NAD_binding_6 Ferric reductase NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3a1fA00
2XNJA 4K1XA 2RC6A 2BGIA 3VO1A 4F7DA 3ES9A 1J9ZA 2PIAA 1GO2A 4AF6A 5H5JA 1QX4A 1B2RA 2B5OA 1QFZA 4Y7CA 3W5UA 4U9UA 3OJWA 4YAUA 1FNCA 1CNFA 1AMOA 1FDRA 1H85A 1I7PA 1JA1A 4Y9RA 4G1BA 3A1FA 3QFTA 1FNBA 3W2IA 3CRZA 1E62A 2XNCA 4YAFA 1GVHA 1GAWA 3OZUA 3ZBUA 2OK8A 4AF7A 1JB9A 1QGYA 5GV8A 5THXA 4YAWA 1GAQA 3W5VA 3JQRA 1EP2B 1BX1A 2BPOA 3W2FA 2BSAA 3OJXA 1QGZA 4WQMA 3OZWA 2EIXA 2VZLA 3W2HA 2VYQA 3QFCA 4YHBA 1W34A 2GPJA 2VNKA 1DDGA 1UMKA 3JQPA 3ZBTA 3QFRA 3W2GA 2QTLA 1F20A 1IB0A 4DQKA 4BPRA 3ZC3A 1W35A 4G1VA 1TVCA 1W87A 2RC5A 4C43A 2BF4A 3LVBA 2VNIA 3OZVA 5GV7A 4FK8A 4Y9UA 1QUFA 3MHPA 3QFSA 2QDXA 1QUEA 1BJKA 4UAJA 1H42A 3W5HA 1GR1A 2X3UA 3FPKA 1EWYA 4B4DA 1E64A 2R6HA 1FNDA 5H59A 1KRHA 1QFYA 4EH1A 1QGAA 5KSWB 1QH0A 3JQQA 1A8PA 1EP3B 4YAOA 1BQEA 1CNEA 1OGIA 1TLLA 2QTZA 3LO8A 4P6VF 1CQXA 1FRQA 4YALA 2BGJA 2BMWA 1JA0A 5EMNA 1OGJA 2CNDA 3FJOA 1GJRA 4DQLA 5FA6A 1E63A 3QE2A 1FRNA 2VNJA 3W2EA 3VO2A 1QFJA 2BN4A 1BX0A 3LYUA 3LRXA 1EP1B 1SM4A 5TR9A 1DDIA 1NDHA 1QG0A 2OK7A 2VNHA
chains in the Genus database with same CATH superfamily
3U37A 3ICOA 1XYGA 3WGJA 3RRBA 1TQ2A 1XCBA 1Q7RA 2WPDA 3PG5A 2YCLA 3HB4X 2IXDA 1K7YA 4IFTA 3AV0B 1YD7A 2H1SA 3HO1A 5TGDA 1W59A 1KP9A 2RHOA 3FTPA 3OQPA 3AY0A 4MVXA 1AVTA 1H66A 1NURA 1X7XB 1YGPA 1UL1X 4JLAA 1JHMA 2GHTA 3GRFA 3JZDA 5K45A 1EXVA 1OB2A 1QF9A 3RC3A 1TAUA 2CJXA 3Q3JB 4ENRA 3DFUA 2B1IA 3AP1A 3JX9A 3W3AA 3RSHA 3OLCX 3OZXA 3WBKA 2PUDA 6REQA 5DW3A 4MRPA 1FDWA 1TL7C 5F4ZA 2O7QA 1O3YA 1RQPA 2IHJA 2O7VA 3IIMA 5LWHA 4QOIA 2PBLA 3O92A 3OQVA 4RLSA 2NNLD 3LUFA 3VGPA 4Y2YA 5IK2D 2A9FA 4DZRA 4N82A 3QFHA 5HWSA 4H1VA 5M29A 2J6HA 3BGVA 3AHEA 2FQXA 2FMXA 1A27A 5EC8A 5DN9A 5C51B 2XQFA 3RVRA 1WR8A 4BN0A 5CT5A 4UEJA 1N5DA 1QGZA 1KY2A 3ZG6A 1GIAA 2R1VB 3I01M 4KRYA 3RV4A 3WNQA 1V0JA 3EH2A 2HXGA 4EI9A 1BFDA 1IEVA 2EX0A 3EZ7A 1CQPA 3KOMA 4D45A 4RQBA 3Q8WA 3P9NA 4ZD6A 1IZ0A 1SBHA 2E4XA 1M8KA 3VPBA 3WBFA 4MAFA 5DTIA 4ATNA 3CX7A 1EDEA 4MKRA 2GUGA 1G63A 1E69A 2EF1A 2FZ4A 3TG8A 1TKCA 4B31A 2CNLA 2RH8A 1ZSYA 1JNYA 3PDUA 4PW0A 1GTVA 2BMDA 3REFA 3V8QA 1SKYE 2WIGA 3CGGA 3V4VB 4LDPA 4AZ3A 2R8ZA 1DQSA 1ZXLA 3CZAA 5AO9A 2E4YA 3SLGA 1Z08A 3ZHXA 1Q1BA 1M1XB 1SRQA 3ENWA 3MILA 4FLEA 4MR8B 1SO8A 1N2EA 1Y8CA 1F0KA 3C7DB 4FI3C 5DTMA 3OEHA 4BTLA 3E8MA 4YXFA 1JDUA 1GUFA 1UWVA 4CMGA 1LVGA 1B0ZA 3FAKA 5EEHA 4NU0A 2QSYA 2QLFA 2WIDA 3K2IA 5E9AA 2HYDA 3PYXA 5LZ2A 4J49A 1KAGA 4P7JA 3BXXA 4PC2A 2J0UA 2HWYA 2NV6A 2Q3BA 3EHEA 4YT2A 1NQOA 1KIMA 1CY0A 1EUDB 4N3AA 1LBTA 3J81k 4QEKA 2GZ3A 2YWGA 4GEKA 4QD3A 4RYLA 2ZUFA 2WYWA 1YR3A 4LZPA 3TQQA 1YFLA 1NJFA 1YL6A 2OXRA 4ZKEA 3L0IB 1G5PA 5A02A 3H65A 4RCZA 1P6QA 3GFOA 4KQHA 4RORA 1GTJ1 1TEXA 3GAAA 3HEAA 5DNWA 5FTWA 3KQYA 2R60A 1KZ7B 3I0NA 3A4TA 3O90A 1KZ1A 3PF9A 4AJEA 3ZCVA 1NA5A 2Q1TA 1CEQA 1P1BA 2BHSA 1XNGA 4OQFA 4XA8A 1Z5ZA 3UJ8A 1RIFA 5EZ5A 4QL3A 4ETMA 1T2DA 1G9XA 4XRGA 5K3EA 4TZKA 1MB3A 5IT4A 4TXLA 4PYQA 1P73A 2QORA 3W5CA 4LN1A 5DYIA 3AGPA 1JRLA 4G41A 3WK6A 2HV9A 3UMFA 4AB1A 3W1EA 2Y4OA 5CCEA 2C59A 1QTRA 1NXOA 3KHKA 3R7AA 4B79A 2O1WA 3HRHA 3I1JA 4K05A 3TWOA 4D9HA 2EC5A 1N2CA 1PCXA 1RRFA 1LSJA 2Y1EA 2Q8NA 1PT6A 2B4YA 2AMFA 4RMHA 2D62A 3BXEA 4OAQA 1T4BA 4BNVA 2YKGA 4WZBE 1YJ8A 4OLBA 3T4XA 1HXHA 3V46A 1CUWA 4CVNA 3D81A 1QIFA 1ONSA 1S2OA 1ZH6A 2GYWA 3LKBA 4O33A 3C7TA 3JWJA 3ASVA 3Q2IA 4GM0A 5KQMA 5M3BA 1VL8A 1KQFA 1FOEB 3FVWA 4X8LA 2DSNA 1XHLA 2Y4NA 4FJ2A 1CT9A 1CQWA 2NVBA 3NRJA 4G4GA 2VJLA 3NALA 1V1JA 3OIGA 5GADl 5BVGA 3G9XA 4EZEA 5AR1A 3R5KA 3HTXA 2GF9A 5ALLA 1PZXA 3ZD6A 4YMSA 1O0BA 3AJEA 1OLXA 1GGFA 2AKYA 3WRXA 4MUKA 4UAVA 5CEJA 2BFNA 2R97A 3FYUA 1SEVA 2GEVA 1YRQA 3HJNA 3GPIA 1BRTA 2GK3A 3QF4B 4M9CA 3KUXA 2JFVA 1RHJA 1US8A 3UC9A 3ZLUA 4RY2A 3CUSA 2Q3EA 5HJ7A 2HHCA 2CXOA 3M4XA 3NHWA 2NVUA 1J2EA 2A0FA 1M8GA 2RHRA 3IH5A 4L9SA 4XDZA 1BX1A 2P6NA 3YASA 3UGQA 4XARA 2RGCA 2AI1A 4TKLA 2PFSA 1ULZA 1YS4A 2C2MA 1Z0KA 1OCEA 2FKNA 4HUTA 5CB6A 3CLUD 4DCMA 2HWKA 2VN8A 4FD2A 4L85A 5GAJA 5IAEA 1PBTA 5U4XA 5GINE 3ULKA 1MH9A 3K9QO 2H9IA 4RGBA 3KT8A 4DBVO 3HKBA 2VBFA 4DNOA 3CVXA 4D0NA 1WXDA 1E7QA 1PGQA 3GRRA 4P3NA 2QN2A 4RJIA 4GMFA 2BGTA 2EVWX 2G4LA 3GD5A 5G0TA 1MOSA 3Q6MA 3TQHA 4EENA 3VZBA 1F8GA 2IIVA 2ZJ4A 4A0GA 3R8XA 4BNDA 3KQMA 2L19A 1X1EA 1G8GA 5HFNA 2QUHA 3DDCA 3JARB 1F8FA 3E35A 4IO1A 3GG2A 1SOMA 2IXTA 4C4ZA 1QIEA 1KJWA 3SIRA 5KNCD 3REGA 2HCTA 1RYFA 2VQSA 3K3PA 4RM3A 1BYIA 4RX1A 1L1RA 2VBIA 1FDOA 1OTHA 2JAOA 3IAXA 3IQHX 2J67A 4BY9E 4LHEA 3VU1A 2P6PA 2R9VA 3LQKA 4DLKA 3OPNA 1U31A 2G36A 3TJZA 5KTYA 1TJ3A 2FFJA 3MF4A 4GL4A 1OVMA 2DMRA 4N8EA 4UHHA 1GL9B 3CUUA 5K0NA 2IGTA 1JMVA 4E7OA 1X9HA 2PAAA 5D01A 4UNPA 4NH4A 4E03A 5JYDA 5DK6A 2IIPA 2JD1A 3WK9A 3HSKA 2AR0A 3EIHA 5DVZA 2IJGX 3RHZA 4JJGA 4MQUA 1TZBA 3MGCA 1E9AA 4MYDA 2KE5A 4NONA 5DRTA 5TT1A 5KJCA 1BVHA 4G67A 3QVLA 4A6PA 1VL2A 1PLJA 1YB1A 4J2TA 4W82A 5FWXA 4C7OA 2VO1A 3TQOA 2IT1A 3O1JC 4QO8A 3NHPA 1N0IA 1FP7A 1K08A 2P5TB 1TU3A 3LBAA 3Q9SA 4I50F 1AK9A 4XVHA 4QKQA 3KSAC 2ES4A 2BZSA 3A9VA 3COJA 2W8BB 3FSEA 3KALA 3LUBA 1PFGA 3GLKA 4RTKA 5IFKA 1W7AA 1Z6GA 2BKXA 4M7WA 3S8EA 1GILA 1DWPA 1V5IA 1UFQA 3L1KA 4BX9A 3FI0A 5DXAA 1JLSA 1UM9A 1ZFNA 2HSZA 3K8ZA 3URKA 5IM4F 2HXYA 4F2HA 2QZPA 3IYLW 1M1YE 2C92A 2G8NA 2JEZA 3H2IA 3KQPA 1SUSA 2EEPA 1AF4A 5KOJB 5JATA 4GXNA 3FMPB 1TVKA 1DAMA 3G7SA 3OC6A 4ZI7B 4DLWA 2JI6A 3WRXC 4PR0A 5KNBH 2R6GA 5AHWA 3FYUC 2PUTA 3KQHA 2JB9A 2LVBA 3ONEA 3AERB 1Y7TA 2QKYA 2FZCA 3D1LA 1T4MA 4QICA 4TVSA 3D6JA 3WHIA 4WXEA 3JYHA 3OIFA 4IMRA 3TM5A 4BP8A 1I24A 3MBKA 3P45A 2E9SA 3T5AA 5H9VA 1ZRMA 3ZE8A 5FPKA 1OH7A 1NF3A 3MD9A 3CRZA 1SB9A 4FGLA 1R9GA 1Z4IA 3AESA 4K1LA 1Z8NA 4K3VA 1JSZA 4X7RA 4P3YA 2A1IA 3FLBA 1I3OA 1YACA 5J4LA 3GLGB 2H8GA 2EBUA 2JCVA 3PUWA 1E2IA 2AEEA 4AJ4A 4B5LA 1EVJA 2G7ZA 3RVMA 3ONVA 3OSZA 2PVPA 4A8TA 4QOGA 1DC4A 2Z3VA 1NVMB 3ZNOA 4EYGA 4YQFA 2QV0A 2YXEA 4FHEA 2CXXA 4O1HA 3KQNA 3VR3A 3G85A 4ZCIA 4N48A 3OJXA 1V7ZA 4PE5B 3SC2A 1QWOA 3I6IA 1SEPA 2HT6A 4QC2A 1N1DA 3WGOA 4G37A 3RJMA 2Q2VA 1TYZA 3OTHA 2A1UA 3BIJA 2TMDA 1GCOA 1UKZA 1R4AA 2A0UA 3IHTA 1KEVA 2ZBUA 3RHFA 1C3OB 1AB6A 4KQIA 4GZMA 2Q1SA 4I9UA 4Y2TA 3UXMA 3IEMA 2VUSA 1XVLA 1IPEA 4JLWA 5D6NA 5DXJA 5CURA 2XB4A 3QFSA 1Y34E 4HX2A 5AM0A 3C3XA 2PJUA 1TXGA 2QDXA 3WGQA 5K0GA 5BNFA 1BSVA 1O77A 4W5WA 2XA9A 5I5EA 1VPEA 3W5HA 4QPJC 3VPAA 1NU6A 1I1OA 3OVMA 5E9WA 2A5FA 5K4AA 2EJTA 3IDZA 1AHPA 1E6UA 1SXJE 3BK7A 2HOQA 2H5LA 3HCEA 4NBKA 1A4RA 5DZSA 3QELB 1XVAA 1JSLA 4NQZA 3SYNA 4C0WA 3DE7X 5BNZA 5LU8A 1E7WA 4TVKA 5TF0A 3NHSA 2HPAA 3WMEA 4I3GA 4JB0A 1N57A 1T3GA 3PC4A 3K4PA 4HQFA 5MFPA 1PP4A 2ZS7A 4BATA 2E1PA 1J2TA 1BWQA 3Q9LA 5IPFA 1UXJA 1H8ED 5GJVC 5IN4A 4CT5A 2J7KA 5AKEA 2DQKA 2RKOA 2ARKA 3HXTA 1O08A 1P80A 1SH7A 221PA 2FEMA 2HMYB 2IEZA 4DJEC 1GCGA 1JXAA 1AQJA 3EISA 1SR8A 3IAHA 3QPWA 3SXJA 3SR4A 1E63A 4O8ZA 1RPAA 4Q3OA 4JA0A 2I29A 1BCRB 3NNNA 3TAXA 2JPDA 3PE6A 3PUIA 4RAOA 3SXPA 4OGWA 1KMHB 3DV0B 3CVUA 4OQNA 4I4TB 1SCKA 4RA9B 5KYXA 4XFDA 1YVRA 3KD2A 2JJ2D 4QGAA 5FR2A 4K6OA 3DPIA 1KYVA 2PLWA 1NXQA 2CUKA 3HBAA 3EZ2A 1VCHA 2IW1A 3PPYA 4YJ2F 3LBHA 1MABA 1EQUA 2ORED 4JIGA 3ZJYA 1LEHA 5ADVA 4PYRA 4FMPA 1NZDA 4YIHA 2QXTA 1AQYA 3ZWKA 3ZDQA 4R81A 4CYMA 1ISIA 1DEXA 1Y1RA 2Y0PA 3BHJA 3B9RA 2ZJ7A 3LY9A 1Z8DA 4MUAA 3TYXA 5HIKA 3MAAC 1RZRD 1E1YA 3QXHA 4EAQA 1H1TA 3D0OA 1V5FA 4QBIA 1VC2A 3GCXA 2GAOA 2D5AA 3W8DA 2F67A 3AI3A 2PUFA 13PKA 3OEEA 1XP8A 3OZFA 3JATB 3OZAA 1GUYA 2WM2A 3BILA 1YK1A 3GDHA 1QS0A 3NUQA 5IVKA 1FSPA 1P4AA 2ZJFA 2GAJA 2PLRA 4NPHA 4OYRA 1Q2XA 2OKCA 2B2XA 5EHIA 4BMYA 4EO4A 2DR2A 4IZOA 2R68A 3SZGA 4RV9A 2FG5A 4BJ5A 4ZT6A 4R2HA 4BKOA 4PZYA 4JB3A 3V1MA 1HNXB 1DZ3A 2NTYC 1YKFA 3UOWA 4F3RA 1DCTA 5K8CA 5IS2A 2Q8QA 4REQA 4UBKA 3I58A 3R9IA 3LC1O 4C01A 5C34B 2NU9B 1YCFA 2AKAB 4KZKA 4D1YA 4MGHA 2FMUA 5CBKA 4MIYA 5C5DA 3N2LA 3OJFA 4IG9A 3ZHCA 2HHJA 4E12A 1X1RA 2CZGA 3NBUA 3G1UA 1SPBS 2ZQ5A 3KB8A 1P0IA 3KEMA 4NI5A 4BECA 1ODKA 2FWMX 2H9AA 3UK6A 4PFJA 4B32A 4E2ZA 1NVFA 4Y2GA 2DPYA 1VPLA 3C3AA 3OZWA 4JLDA 1OTYA 4FLFA 5SYMA 1P0QA 3OE7D 4MPDA 2FWNA 3F6YA 3QUTA 1AKYA 3P27A 3SJUA 2O0LA 4EHAA 1HYGA 3KKLA 5LBIA 5CEFA 3EEFA 5DW0A 2ZRAA 1DUIA 1GG9A 1A5ZA 3UAWA 4JL5A 3HJHA 5HE9A 4ZVNA 1T9HA 1O03A 3DWFA 3EZNA 4NH0A 4AWAA 2VBCA 4BLSA 3ACDA 1IVYA 2RC5A 4I6JA 1N9GA 3QXXA 4X7PA 4YEDA 1TTQB 3K15A 2O57A 3NG1A 1U4NA 3AWDA 2DQZA 1IOLA 2B8NA 5CLQA 2OT3B 1GQOA 3I04M 5H80A 5IJWA 1GR1A 4BAZA 5EMHA 2ZIEA 3ASUA 1VJ1A 2D5IA 4GZ3A 4W5QA 2D59A 1W2GA 3TCXB 3DYIA 2ZYVX 1JPJA 5EP2A 1HETA 3M0EA 3CX4A 4XWTA 3RRXA 5ECDA 4RE6A 4FFVA 4ON9A 1W4ZA 2BLLA 1RQXA 1VLLA 4O59O 2P62A 3H87A 5BRJA 2EW1A 1H05A 2CXRA 3TLGB 1FTSA 3B1YA 4AKGA 2JCGA 1JQLB 1NN5A 1NUQA 2O23A 2X41A 3HXPA 4FB4A 1RACA 1LTHR 1KK0A 3I45A 4FYJA 4OJKA 1X2EA 2VQDA 4UBOA 2PSFA 5DLYA 1NMZA 1OZ0A 4M8LA 5EHGA 4HAVA 5EXEA 3L8YA 4Z51A 3F46A 1RAAA 1JEOA 4IX9A 1R3UA 2FUKA 3EVBA 4I50A 4UCXA 1UF9A 4OHPA 2R2AA 1RRGA 2EL9A 4X20A 4Y1FA 3HCNA 3IVXA 3UANA 1AQNA 1MIOB 2C3OA 5EZ6B 2WILA 1ZBQA 4L76A 4PLZA 4TTRA 1FBTA 1NPDA 2X2EA 4PPNA 4RTQA 1KDPA 3RARA 4YUZA 2ZVDA 4ZU3A 4XYLA 1AX9A 1BJRE 1J0CA 3F6RA 4GOJA 4MEAA 5C5EA 4FFMA 1UBNA 1PEAA 4I55B 3WB9A 1JKFA 4Q3KA 1SK9A 1J0AA 3H86A 1PK8A 1XRRA 4YCAA 5CK4A 4R4JA 2AX4A 2NV2B 1ND5A 2CYBA 3SR3A 1AQ6A 2EJBA 3F49S 1C8KA 1C8VB 2YIDA 4WINA 5G3ZA 3UHJA 4KLZA 3CVWA 3A32A 4OV6B 3CUKA 2JLSA 4Y6GB 1NNEA 3PLAE 2VJCA 4LOLA 1ITZA 1KO5A 1WM1A 5IKMA 1AZSC 2G28A 4N4AA 4MB6A 4ZARA 3G8YA 4UPDA 4P3XA 4KQGA 2J48A 5CBPA 3K1TA 1VXRA 2YWDA 4Y0VA 2W2OA 4PZ0A 3V1UA 3EARA 3L49A 1O54A 1H85A 1XRPA 1CS4C 5DLEA 3K5IA 4ZMSA 1WW8A 3IOCA 4KWCA 3OLXA 4CLXA 2EZUA 4IX1A 3COSA 2AMJA 3PU6A 2JGJA 2R2GA 1E9SA 4WNCA 4ZJZA 2V6IA 4XPIA 2HHLA 2IK8A 2YV4A 2UYOA 3U7JA 3EQ7A 2HJHA 3C15C 3WWEA 5JAMA 3GNTA 3VM6A 3E1KA 3ABIA 3R2JA 4RH1A 5EWMA 2BP7B 4DY4A 2E7ZA 2J08A 1N1EA 3I5UA 3IA7A 4N0QA 3ASYA 2PKCA 2V5UA 4JJAA 2EEZA 4QBTA 1LBHA 1OV6A 2GUWA 4IIJF 4ZAVA 2VJMA 3RF7A 5IDXA 5LLTA 2V3VA 5B57C 4LS3A 4O4IB 2E6UX 4WXMA 2EKBA 5A7HA 1LK5A 2SKDA 4MGZR 4BNUA 5CT8A 2FPPA 5AWFC 3UK0A 1ZOSA 2BI8A 3O8QB 4LYYA 3ZS8A 2B98A 4JA2A 5HJ2A 3T1VA 1VBMA 2HNKA 3VA7A 4BPRA 3C4JA 4PYMA 3U1TA 1DV1A 5U9CA 2CJPA 4K3UA 2WV7A 3R6GA 3BMNA 5EMMA 2O1XA 5FRDA 4N47A 2V6MA 3ADKA 1PJTA 3EMVA 4C03A 3RVKA 4EY3A 4LF4B 4XYGA 3FPHA 4YAJA 4M36A 2YY5A 3W90A 4ABTA 2BIFA 4KYIB 3OFSA 3RAGA 4ZRNA 1RZUA 4YT4A 2RAPA 4M22A 4MS1A 1E7SA 4ZOEA 5JXWA 2AN5A 5C7IO 4LY9A 3O8OB 2FXVA 2ZSIA 4HDSB 3DC7A 2YUIA 4JZKA 4LWZA 1R9JA 4LJ6A 1AKRA 4P4UA 4WN9A 2P4SA 3NTQA 1UCFA 2QTHA 4WK6A 2RGAA 4HEJA 3WISA 5BUSA 4DC9A 3EA4A 4NSNA 5KHLB 4OQPA 2PXHA 2KI5A 1UADA 2IL1A 2RH9B 3H97A 3M49A 3VHXB 5FCDA 1B6GA 4F04A 2HSJA 1SA0A 3G1TA 4WI1A 4LK2A 4RV4A 3GPBA 3DE2X 2N9UA 3FCSB 3H1PA 1CQIB 4R3UC 3L02A 2M2IA 2O2YA 4JU8A 2DTDA 3OCUA 4H4EA 1TM5E 4WIAA 4DR6B 4JGGA 4DV7B 4TSRA 10MHA 3FOBA 3G5MA 1QORA 3GLHB 3KFVA 1YIOA 2WIJA 1KEEB 4WEOA 3B53X 3RS0A 4UD6A 4I81A 3VBCA 3HH8A 3H3FA 4XI9A 3B13B 1SCNE 1ZOPA 1KIAA 3KXIA 4P31A 1NJ2A 2J59A 2XLBA 3LC0A 3BJZA 3OLWA 4H1UA 4ENUA 2PUHA 5CHYA 1AN9A 4LZNA 3K1YA 3C98A 4FFNA 1QMGA 1KJNA 4NNPA 5CXUA 3QFFA 3RYHA 3WAGA 3OUTA 1G2OA 1ZZGA 4ZHQB 1NXSA 1Y5IA 4OGFA 4B43A 1YZYA 4OYHA 5ITSA 3KT0A 1RJEA 3W1VA 5DDIP 1QNFA 1V16B 3WO1A 3R3WA 1T9DA 4XUGB 5JQGF 3VO1A 1D1PA 3V1KA 2ESRA 1V43A 4FFOA 3DXXA 1HEUA 2EP7A 1JJFA 1GFWA 2X9QA 3OIWA 3SR0A 3VR5A 2WUFA 3ROKA 2IZ7A 5FUVA 2CXUA 2KPOA 1EP9A 2HBRA 3RHSA 3KXKA 1N0VC 3PHBE 1Z37A 1X0VA 2J4DA 5DHSA 5BOSA 3ADBA 3W1WA 4O5AA 1ZKMA 4NZYA 1SVUA 1VYHA 2IY8A 4MW6A 1BDIA 1BHJA 1FUYB 1WDKA 2ZETA 3KYJB 3ROGA 1TUIA 4NZOA 4RYDA 2VDWB 3MOSA 3ORQA 3UYKA 3QUAA 1IBMB 5JJKA 1OI3A 1DG9A 3H0CA 1NONA 3QITA 3AZQA 3DVAA 3QPBA 1DEAA 4XD7D 4BKUA 1JU4A 2X58A 3HCBA 1FL9A 1DWOA 2QBYB 4O4HB 4DV6B 2ZJ0A 4P93A 3OO0A 4CGYA 1KFCB 5ALEA 2I7VA 2ZE7A 5E0OA 3FTEA 3B5IA 1T6ZA 1XTBA 2ZK7A 3D2BA 2JLBA 3GIDA 3RRMA 4W5JA 3MCVA 5KKAA 3GGDA 3DEJA 4XEUA 5G4KB 1L1EA 4FHCA 4BGEA 5JTTA 1FSSA 1I94B 3OT5A 5CVDA 3C41J 1P1RA 2GSWA 3GUVA 1M10A 1U0RA 4IXTA 5KOYA 4I8IA 4GP6A 5CGQB 3IX7A 2X0RA 3NHKA 4GKBA 2XOKD 1NMXA 5YASA 4EW2A 4YPVA 2GYUA 3P9SA 8AT1A 2ZQYA 3JASB 2CDNA 3HYLA 4CF3A 4CV2A 3S7ZA 3ZE0B 3R8FA 4HDNA 5CAEB 3B7GA 3TKAA 3QVUA 4L8VA 5JV5A 2XUHA 3OU6A 4C2BA 3OMXA 1MV8A 1SELA 2JW5A 4OH7A 4MARA 2FY8A 1ZG3A 2OLKA 1HL3A 4QXAA 4DLXA 3A05A 2W70A 2F55A 4CKBB 5IW8A 3TTUA 3EZYA 1ULHA 4ZGBA 4HNGA 3IP9A 2BH2A 4L4RA 1WWKA 1SRRA 1RXIA 2QTCA 4UUAA 4QQRA 5CIQA 2ZJYA 1KETA 2WVAA 1DC3A 2GFQA 3BH6A 4W9NA 5GZ6A 4DADA 4EG7A 4V39A 3BIWA 2FSUA 3ILSA 3WGGA 1VCNA 3D0KA 3E9QA 2ZZNA 4ZCQA 4KDEA 4XM1A 2E0IA 2EZ8A 3ZXUB 3WNVA 5BSFA 1DBPA 2B6HA 5FLYA 1CUIA 4QSHA 4EHKA 2O05A 1WG8A 3IPAA 2FSSA 5I7UA 3PDIB 3SDSA 5ELLA 2D5CA 1QR6A 4CM7A 4E88A 2PMBA 4PN3A 1VQ1A 1K5PA 3D8RA 1K7XB 3X1JA 3NFRA 3BFPA 1GGNA 2ZB7A 4N12A 4AFNA 1M54A 3DKVA 1ISFA 1JPVA 3C3DA 4TMYA 3LHKA 2GCOA 1CF4A 2G72A 1Z34A 4YCLA 1QCYA 1QDUA 2J1LA 2NZVG 5CT9A 2Z9CA 5TPWB 4YV0A 1Y1SA 3IURA 1KTVA 4HEQA 4XTCS 2ACVA 5FA5A 1NM5A 2WJJA 5EPUA 5C4GB 4JI5B 3ZW7A 1OY1A 1CLUA 3HYTA 4R71A 4YCBA 4D4GA 4FFBB 2DLDA 4A2CA 6REQB 5LNK1 2BGUA 4TGLA 1CUXA 4K9QA 4NG4A 3RLIA 1SM4A 2ZDHA 4UBMA 4LYAA 2XXBA 3VRHA 1YWGO 3ER9A 1CV2A 3PFCA 1YBAA 1KI6A 1WBDA 2H06A 1RLJA 1E4YA 2XZOA 3HCFA 2PVCA 1XHEA 2WP0A 1F9EA 5EIBC 1AU9A 4D41A 4ENTA 7MHTA 3BWBA 2XUDA 4ZICA 3LLUA 3KUCA 4RY8A 2V3WA 4HMPA 5J2UB 3VU9B 4AG6A 2DZDA 1CIJA 3JY6A 4BNKA 5KDDA 4YASA 4BVGA 1HC7A 1E9RA 5JFOA 2A33A 2VTBB 1XQXA 2Q9AA 2DY0A 3ABOB 3ILHA 3AF6A 2ZZKA 1A9XB 5TV2A 2WG0A 1XPOA 4V0KA 2FW0A 2C95A 1C9JA 4HN2A 3EC2A 1ZN2A 1E79D 3D6FA 1XQVA 3OX3A 4RL4A 1EM6A 3G8DA 2BHTA 1H2BA 2VHVA 2I4IA 2NN3C 3LXMA 4IGAA 4K9LA 4NMWA 3MJSA 5EZYB 3DHEA 5B1HA 3PDWA 3UJ6A 3O2SB 1F60A 4BQFA 4EELA 5A5EA 1W5AA 4W9MC 3VDNB 1QE5A 4IIJA 1GGVA 2FB9A 2FU5C 2AV6A 2QQEA 4DDWA 3QI2A 1M0EA 2VYND 4BFZA 1TRKA 1NOKA 3BTSA 4X3CA 2AZTA 2MHCA 4EGSA 2REQA 5IDYA 4FYXA 5IJ9A 3CE9A 1JT2A 3IUSA 1ZH8A 3LU1A 2SCUA 4K9PA 3W5VA 4UE2A 3EULA 4Z6KA 2ETVA 1OQAA 4HGPA 3T7AA 1KHHA 1XTKA 2RK3A 5IC4A 5IVHA 1I7SB 2AC7A 4KK3A 2IXGA 2EKZA 2V97A 4YAGA 3ADPA 1JLKA 4RVDA 1YMVA 3G2IA 5GJBA 4ZQEA 1EFAA 1WU8A 3U3ZA 4EYKA 4MUYA 2WD7B 1VFNA 3G2LA 4AN4A 4GBMA 1X7DA 5C9ZA 4XIFA 3D3WB 3QF7A 1FMFA 3C5WP 3JQGA 1UMDB 2YS6A 3QX7A 1AURA 3BGSA 3HLYA 5FTKA 1W87A 4Q00A 4X94A 2D4HA 1VFPA 3PHHA 1NBOA 3V2HA 5IWAB 2QOEA 1J0DA 1SC1A 3OTOB 2X42A 3FYTA 2HRBA 4DV3B 3IS3A 2XGJA 1P44A 4HR7A 4BV2A 2QX9A 1PWZA 4L8YA 3ZY4A 1KWKA 1CS0B 2R44A 3G79A 4PSKA 3CPEA 4YLGA 2XADA 5B6PA 1Q21A 4WEQA 2QF7A 1P19A 1WX1A 3CEPB 3QVWA 1U04A 1KOFA 2HR1A 2LKDA 3F67A 4I66A 5TY0A 4ZDWA 1W93A 2CXTA 3LK6A 4BAUA 4AZ0A 2FUG1 4J91A 2VDPB 1D2RA 3BFXA 3JTEA 1EUZA 2XEDA 1OXUA 1T3SA 3VUEA 4PLFA 1ZSVA 3K9FC 1NM5C 3BXHA 5DO9A 3BGDA 1MCZA 1U4SA 2BFFB 2CK3D 5AKJA 4C0XA 3THWB 3L4EA 1XMOB 1O0SA 1MOQA 2EBWA 2ERXA 3N6XA 4J0EA 4TV8A 3ROXA 1P9NA 4EX7A 2WE8A 3TVTA 2E87A 1WXQA 1SHLA 3Q10A 5AIBA 4EP1A 1L5SA 2AMLA 2Q9UA 1EFRA 2B8WA 2QB5A 1L9KA 2ASVA 2OVBA 2Q1XA 5LQMA 3V4LA 2AVDA 4QYIA 4PFQA 3DJYA 1VG8A 1WXHA 5CB4B 1IBKB 2I6QA 3F1KA 1YA6A 4RTRA 1W1WA 4FJ0A 1ID1A 1ZUNB 4HFMA 5ITWA 3Q3CA 3QE3A 4EMTA 5L8VA 2WC1A 2EKDA 1W2HA 5HEKA 1P4RA 5IYZB 1LBSA 4UEWA 3SN6A 3TEMA 4BKQA 4CCYA 4IYJA 4UW9A 4EPXA 4IF4A 1KFEB 1TYBE 1O89A 4DBLE 3RC8A 2ATCA 5LR6A 4Q5IA 2PIAA 3T3GA 2C2KA 4S2UA 3HUTA 1I9GA 3LUAA 1EEXB 3TEJA 4NK4A 2WB4A 4PINA 3VC1A 1V41E 2V5VA 2YZKA 3KE8A 3ZY2A 1SWVA 3F5DA 1V4VA 1P4JA 1G2PA 4HVAA 2WSLA 5FFFA 2XRMA 1VRVA 2OFOA 3MRVA 4K7JA 2M6KA 1ML3A 4LY3A 3H42B 1PNTA 2BFBA 5CM8B 4GGMX 4Y9RA 1T5BA 4DKXA 2IDJA 1G291 3DNPA 4OQQA 3TBHA 2OZVA 2GWRA 4FSHA 3WJAA 4HYYA 4QJ4A 5HRUA 3VU0A 1P7YA 3M83A 1Y3BE 2XUQA 2V0NA 3R6TA 4M8NE 2YXDA 3JZIA 2IUYA 3OZUA 4W5RA 1MZVA 1MAUA 4MEJA 3PXAA 2ZBPA 5BSEA 4RIHA 2PX8A 1CK4A 3PC2A 1Z83A 4HXEB 4MQLA 4NJEB 3ZDXB 1BGVA 2VSYA 3ZQ4A 5FI3A 2ZIFA 1U0NA 2XZPA 3OU7A 4RTNA 3UCXA 3A9RA 1DAFA 5A05A 1P6UA 1Q0TA 4W8HA 3MWDA 3N07A 4TVOA 4MDEA 1ZH0A 3AFGA 2WM9B 5IK2A 3I12A 1UBCA 1Y5LA 3LRTA 4G8CA 2ORWA 1KSFX 1KR2A 4JODA 2V7WA 3A31A 2FOXA 4L6CA 4QOHA 3EUFA 3W2GA 1U5CA 2BD0A 2P2DA 5FB3A 3KWLA 3C5HA 3B9QA 2ZBRA 1DWQA 3TCKA 3QX8A 1Q15A 1E0SA 4NG5A 4W99A 4FZRA 2R65A 2HDOA 5BUQA 4QT0A 2IVZA 3A04A 3IPLA 3JAKA 3DMDA 4EWLA 4LMPA 3GK3A 4F1KA 2ATEA 1S9HA 5E6UB 2C04A 3AM4A 5DB4A 1XJQA 1E6EA 4IQ8A 4F0JA 3L0BA 4RWEA 3GLRA 3OLVA 1YS1X 1XK6A 1UJ6A 2HU7A 2PH7A 1FFXA 4LZOA 4N65A 1GU0A 3T95A 4D57A 2CNKA 2OBLA 1QHIA 2OO5A 4FHGA 3ZXIA 2TS1A 2FFAA 1U3VA 2R751 5DLQC 1JHDA 4C21A 3KKMA 4PGAA 4D3ZA 3P4YA 1E2QA 1OC4A 3MWEB 4DSNA 1A8PA 1T36A 3H9UA 4U7HA 4P7GA 2AF4C 3AJDA 1WXIA 5KYNA 1OBHA 1CUSA 3PIIA 5AVYA 1N7HA 4E5PA 4L4SA 1CF2O 3LQQA 3N6VA 3IB6A 4S2EA 3ZVMA 5ESRA 3EFBA 5ILGA 4M4SA 4R2KA 5GONA 1KQ3A 2P41A 1D6MA 1AV7A 4A1FA 1WHTA 4WJKB 1T6BY 3TSCA 2Q5QA 5A4IS 3D9QX 2NSLA 3I9FA 4N6OA 3ZZMA 1LV7A 2IZZA 3A6DA 3E82A 2AHRA 1U0SY 4A6XA 1G4AE 3RU9A 3OCYA 1SZPA 1ZM3A 4YRAA 4PAMA 1ATIA 2PKXA 2EFEB 5DI9A 2P9FA 3GNLA 4DYDA 2FLWA 4KV7A 3SAJA 3GQBA 1MVNA 4EHHA 5FUBA 2IVFA 1K4YA 5AXBA 1LPPA 1MEJA 1G3MA 3WLSA 4BX3A 2I76A 1UWKA 3LYAA 1JPNA 3T5DA 4XFKA 2WAOA 2ZTVA 3RIXA 1H2YA 4MTLA 2Q1WA 4MYHA 1QK4A 4UQPA 5IBCA 3KOXA 4GHWA 1T15A 5K6AA 4FGUA 3WOHA 5I7HA 4KRXA 2P79A 4S04A 2VPQA 3RSZA 2PZFA 5KJ6A 1YFKA 4WHMA 2I1VB 4Y6LA 1GEEA 4ZAGA 1GU1A 2BOVA 5A9RA 1Z2DA 1R8YA 3WLNA 5JNTA 4CMBA 5LQAA 4HDRA 5K2MA 2QN7A 1WDLA 4L2IB 4W7IA 4DRXB 3BTUA 4C4YA 4F56A 3HWWA 5EFZA 3OBBA 3D02A 1VPTA 2R3SA 3E48A 5AHOA 3T5BA 4I8XA 4WZBA 3V8PA 4ASUA 4EKIA 5IEJA 2A4KA 3LT5A 3NYQA 5JS7A 3NETA 1Q7GA 1SU8A 2H1RA 2IHYA 4XQ9A 2A0XA 1QZXA 5I9IA 2GBFA 3CT4A 4J4HA 5TJ9A 1XI2A 2JRCA 1R0ZA 4GOKA 3GVXA 3I4CA 3TZBA 2IYXA 3EAQA 3LWBA 3UFBA 5MF6A 3ZVLA 4C7KA 1DMSA 4NK5A 1J23A 4G1CA 2AQHA 1LC0A 4QNNA 2ZJ3A 1HDCA 1F4VA 3SMVA 4V0QA 2FW8A 3RWMB 3CXRA 4IKPA 3FPFA 2W5UA 3I9NA 3MINB 2J32A 3G5LA 3G0CA 3JYNA 1E6MA 1ZK3A 3K9BA 2D1FA 2HFKA 2Y1DA 4LXHA 1RWVA 1DSSG 3K30A 4Y2SA 2OO5C 2ONCA 3A1CA 2DQ4A 3PEVA 2OZEA 5ALKA 4RPCA 5HRAA 3DHVA 2YZGA 3I39X 4JGIA 4K6KA 1ULBA 5EQFA 5IVIA 1JE0A 3SEZA 1AC5A 2IBSA 1CJCA 3M3PA 4LDRA 4NJMB 4UKDA 5I7FA 4L8FA 2C61A 3AF1A 3WWYA 1HKUA 2Y1LA 4CJXA 4ZYVA 5JNRA 1EJ2A 2R6HA 1E3WB 1NN3A 3QKRB 1XIVA 1XXLA 3LOQA 4F86A 3OJ0A 3E9EA 3GUUA 2GM5A 4QNMA 1CDDA 2YRXA 4L4ZA 5EYPB 1V3QE 2C0PA 5EP4A 5JXJA 5AM3A 4UBIA 1UBLS 3EVGA 1K8XB 3BFVA 5LVAA 1CQXA 2JI9A 2LR0A 4YAIA 1CHDA 1U3DA 1T5SA 3T34A 5L4NA 2AR7A 1C14A 2QN8A 2JA1A 2UYHA 5BQ5A 4KR3A 5JNVA 4D3SA 2ZCUA 2Z8XA 4CQMB 2QZJA 1ZNYA 4EY8A 2P7IA 5E8JA 1CJBA 3PFGA 4II7A 1SUCA 5JAUA 3EGDA 3L01A 2RAUA 2PFGA 3JW8A 3REQB 1GGHA 1GZ7A 3QVMA 3VO2A 3JPYA 4E5DA 2QMZA 2Y1KA 1LF5A 4HLCA 4TLCA 1D4AA 4MI6A 5AMXA 4RVGA 3EIWA 1FVXA 3WWOA 4JEHA 5COAA 5B36A 2QIPA 3P0JA 4R1LA 3LNTA 3IQXA 1BWRA 2C3UA 3L6BA 4HUQB 4UM9B 2QAGB 1IY8A 1KO8A 1S7CA 2F3RA 3JQEA 3FH0A 5K6AC 4D9IA 3GLIB 2DQYA 1L5FA 4LCBA 5EE1A 3UT5B 1XZ8A 2PBRA 3UMGA 4ZFNA 5A0FA 1BD4A 1Y3IA 2Q0HA 3ES9A 4Y0AA 3TXAA 4YB8A 3GLFA 3IPXA 3BQNB 4MS3A 1NI4B 2FR0A 3SVTA 4P38A 4DCUA 3ITDA 4UJ5A 2IYUA 3LC7O 1CDZA 2G63A 2V54A 4AJOA 3TSYA 1XG5A 1LVUA 3DAPA 3DEZA 3EVAA 5L7WA 2BZ1A 4N54A 1RBYA 2HUNA 5ALXA 4KIJA 2VPZA 3KQVA 1N5IA 3GJ0A 3PFBA 5C1DA 3AL2A 3H9GA 5EP1A 1KYYA 1QVAA 3ETHA 3ZCRA 2O2CA 2QRMA 3LPCA 2HUPA 1PG0A 1L3IA 2IPXA 1KC1A 2P4EA 3ORSA 2NLOA 4M6WA 1JQKA 1A8QA 1MUUA 3GEPA 4O0LA 4MCHA 1O4VA 3OT1A 3UIEA 1HYEA 2L18A 1CJVC 3MYYA 4OL0A 3ZTYA 3U7QB 4XOIA 3OKCA 2RH5A 3DCIA 4UEQA 5JSUA 1A72A 4TKVA 1OLSB 1KERA 2RBKA 1GAXA 4B5KA 5KNDD 2HO5A 3DL2A 1Z2AA 1FUUA 4D8YA 3E81A 3Q3VA 3ZEIA 4QQNA 1M1YA 3ESZA 3IB3A 3I8SA 1ZAKA 2BDUA 2O50A 5AK4A 1QZZA 2OQRA 2J7PD 3EEIA 5GOTA 4M0EA 1TK2A 4F12A 2XDAA 4MI1A 4QDZA 4HZUA 1Y8QB 2XMGA 1WKCA 2ILTA 3DB1A 5AW7A 3GF4A 2YDYA 4JUDX 4Q7MB 1W34A 1AKTA 1WPRA 1Z0AA 2ZRKA 3HNOA 3JQPA 3PGKA 5DBIA 4DT1B 3IQDB 4CFYA 1WNFA 2B6NA 1IBLB 1GKLA 3QZUA 2IYEA 4ITRC 3WYGA 3LCMA 3A3KA 3TPZA 1GT6A 2H2WA 4J2OA 2YN4A 3EW7A 2B9VA 2BEWB 2H1CA 4YNBA 4B3XA 3AI2A 4I99A 4EHFA 2PMKA 5L3SB 1D5WA 4LZLA 2J3QA 4G0MA 3O3OB 2HQOA 2PCJA 1QYRA 3Q88A 2LCIA 4G1EB 4RF3A 5E7JA 3RLFA 3UKOA 5FX2A 5KIAA 1RXVA 4AJKA 5BV0A 2YQ5A 1CCWA 1ENOA 3C7KA 3GXBA 5CLGA 4AMBA 2ZM5A 1YQGA 4KR0A 3T7DA 2GJ9A 4QJ5A 4NABA 3DL7A 4EG6A 3L4SO 1Z4NA 1D2HA 2IHUA 4G6ZA 3DTVB 2NUTA 4DWJA 1OA0A 4E5NA 1BGWA 3FWYA 1R74A 3LY5A 2YHIB 2ADOA 2CWDA 2V7EA 4PF1A 4RA6A 1F5NA 4RD1A 3ZGXA 4URHA 5FNZA 2XYVA 4OU4A 4MVJE 1X7ZB 2OBXA 2R6DA 3C6KA 3Q41A 4OKIA 2WB2A 3RYCB 5F52A 2EKPA 3I4LA 3SF8A 4TUYF 4Y3UA 4G97A 2OORA 5AJUA 2C7VA 1ZD4A 4FBMA 2AFIA 3AHJA 1XLWA 1VJGA 5AVKA 4DQVA 1L8OA 4EF4A 721PA 4EI8A 1GTRA 3L3BA 5EQTA 4G2TA 4G89A 3DCNA 3R77A 3LM8A 4OI4A 1JIQA 4Z4FA 2ORVA 5DCYA 3MN1A 4JVNA 4F93B 4F11A 2BYTA 2PU7A 4ZEVA 2GI4A 2VT3A 4QAJA 1LFAA 4G0VA 2TECE 5CCBA 1SXJA 1IQPA 5DN6D 3MPOA 3J81A 4WA7A 3DPUA 4MJXA 4MLDA 2NQTA 2NZUG 4JQYA 3K0KA 3NJRA 4BVAA 1G20E 1D2EA 4UMEA 1Q19A 3UFXB 2R6R1 2GFHA 4LX0A 2ZUSA 3F5QA 5FR1A 3ORYA 3VYSB 4CEHA 3CCCA 2JJ2A 4ZXFA 5I7VA 1MN6A 2ZI3A 1ZMXA 2WEKA 1PSWA 3GJYA 2ZUDA 4JR0A 1PSDA 2QP3A 5AW4A 2ZRIA 3A2MA 2RI1A 5IN5A 1C0KA 1Z33A 3T1TA 1L5YA 1YIDA 2BTEA 1QRSA 1IJBA 2DJ5A 3H5OA 3IPYA 5AKKA 1UDXA 3O7MA 5I4KA 4N5NA 3EEOA 3MQ4A 2WSSD 4L5AA 1XRNA 2XIQA 4KSCA 5IJAA 3MW8A 4MYCA 4QGGA 3SS9X 3FBWA 3IOMA 4Q34A 4X1OA 3UH1A 2ZIXA 3FDFA 3S2GA 5H83A 1JFVA 4Z0TA 1I2AA 1BU8A 3JYLA 4A8JA 3HP1A 4DA9A 1OX4A 5EI5A 2JDID 3UMBA 2PGJA 3GMTA 5JW6A 3KU1A 2M1ZA 1LCIA 2HAEA 1P7WA 1PQWA 4LJLA 1L4NA 4XVRA 5BN4B 1D8TA 3HU3A 1W76A 5ALUA 1AKEA 4Z9FA 2Q21A 3R24A 4D9NA 1V25A 3MLAA 4DJJA 2FH5B 2NU8A 2H1OA 1KY4A 3HUEA 2YIVX 1USGA 3AR7A 1LDEA 4G9GA 1Z2EA 3KHTA 4PYJA 3IKTA 1L7VC 3AQ4A 3NJ4A 1QHHB 1AMNA 1WCV1 3R0QA 3PDJA 1HFEL 2CZQA 3ZOZA 3P2EA 4MGEA 4IUDS 4C3VA 3L7CA 5FPTA 5IAAA 3AHIA 4B3BA 4CDGA 2QG6A 1A71A 2VDQB 2ANCA 1THTA 2XI4A 2QTVA 1IBRA 4N7BA 4IXMA 4RCYA 3SJZA 3FVVA 4OKNA 3OE7A 1ZDMA 3E9ZA 4UMDA 1JXMA 3W6UA 4DA7A 2HJRA 5EESA 2VYVD 3AIKA 4M9ZA 5TQJA 4KU4A 3CLVA 4RDXA 4KBYA 1GN8A 5BSVA 2G04A 3HJFA 4EG0A 2FQ1A 5JDIA 3KJZA 5JSHA 1J5XA 4G5QA 2Q5IA 3QVKA 3W8NA 4LNUB 4X91A 1E5TA 1E7MA 5K0BA 5DM0A 3SQDA 3NOOA 2OORC 3MHTA 2IHKA 3UUEA 4EHBA 1I1HA 2G9ZA 3S2FA 3WNZA 1P5FA 4FE4A 2GSDA 4K9MA 3LZ6A 3UTDA 4EL0A 1FDUA 1IMOA 1WL8A 1AHNA 3KLOA 4AQDA 4E2WA 4O3FA 1Y3CE 1DLJA 2O59A 4E2YA 2I2CA 3QUBA 1XU7A 1Z68A 3DMTA 4O2RA 3NZEA 3KEQA 1FMCA 3PJFA 1KDRA 4JJ7A 3OWXA 4QUDA 5ETJA 3R0XA 1SXJC 2QMOA 3W8FA 2CMDA 1AN0A 2H2DA 4KH1A 1O8BA 1N2SA 3GJ5A 1SK8A 3L1HA 4ZYLA 5JFTA 2EDCA 2H9YA 4FNAA 3TAHA 1UOOA 2P9GA 4HTFA 4IJ5A 1BRMA 4AN1A 4HFRA 1SBYA 1P3Y1 3KPUA 1LF0A 3D8NA 3DMRA 3EEQA 5DHFA 1KJJA 2BHRA 4JL8A 4Z99A 2JGFA 4F5DA 3MCWA 3VNUA 1ZZEA 3AKEA 3U4CA 2XWJI 3Q8MA 1ECJA 2AJCA 1WD5A 4TLDA 4UXHA 4BRWA 3FPCA 1JECA 3F7MA 2W2LD 4QOJA 3OQMA 1R0YA 1OWPA 1RJ9B 3D7SA 3GL9A 2HMWA 3KUDA 4GPAA 4NEQA 3RSQA 1P18A 3RFTA 2SKEA 4FCTA 2XXAB 1J25A 1B2LA 1DQPA 3NYRA 4PEVA 4Q1EA 4A8JC 2I87A 2R6AA 3DOHA 1WD7A 5E4JA 1KOJA 2CVZA 2IDMA 3GEEA 1BMFA 4GOOD 1OZAA 3OETA 2QTWB 3W5UA 4RVHA 1YASA 1O5IA 2DFTA 3EE6A 3EBPA 3X1YA 4LF6B 1VDMA 4W1PA 3TL3A 3O9MA 1NQ5A 4LJ5A 4XDYA 2VWPA 2XT0A 3TBKA 1FLNA 4J7UA 1R16A 2PD6A 3A1TA 3ZWBA 4AUEA 3PWSA 2CFIA 4JUFA 2O9JA 3P9XA 4J29A 1C5KA 1Q6ZA 2IYPA 3PC7A 1HT1E 4X60A 4RACA 3S1AB 4ZN6A 1HDEA 4P33A 1GKYA 1NSFA 4B3GA 3T0IA 3BWXA 3WLOA 1SIOA 2C8JA 5I4IA 1NZFA 4XR4A 1EBUA 3IFSA 3L8ZA 2HN9A 1U9IA 3O4FA 3PNBA 3V5NA 4CEIA 1TUGA 3NTVA 8ABPA 5K8TA 3TECE 2GYVA 3AU8A 5HS4A 2DERA 3HMQA 5AJTA 3ZJ4A 1IN1A 2ZJAA 2JD2A 1Z17A 4Y2RA 4C04A 5G1PA 1HG0A 3LZDA 4HRXA 2VF4X 1E8NA 4JP8A 3QU9A 3X1MA 4FCVA 1LXCA 5IDWA 4PLYA 1IOVA 1AKNA 5JDIC 3F96A 5JVDF 2Q9CA 1E77A 2FP4B 3UCFA 4E7PA 3TGLA 4QRHA 4S1NA 4EA8A 1GGEA 3EPPA 1WF3A 4J43A 3NBKA 4Q3NA 4KR7A 2PKQP 2PNJA 5EXTA 3CR8A 3K8OE 3KLBA 4TUYA 3KQKA 4KPEC 1V1RA 1Y8RB 1YJ5A 1PVVA 1BS2A 1EBFA 2O3TA 2UYGA 3DMTC 4LRXA 4J9VA 4L95C 1JTFA 1MPXA 3ANSA 5KQPA 3W5IA 3VKWA 4GMXA 3TS1A 2BFWA 4G65A 1EFTA 1M6VA 1TW3A 3X2SA 3CX6A 4GPEA 2ZWIA 4HXYA 5EOVA 3GVHA 3R3SA 1YRBA 4I4NA 4J03A 1R6BX 4RUKA 3WMXA 4PHTA 2ONZA 2V59A 2XUKA 4L16A 4L3WA 4U7GA 4H7IA 4EY4A 1AO0A 3FUWA 2AX3A 1D1TA 1MG5A 2FMIA 1P3JA 2WVGA 4DPKA 4DR4B 3JSAA 3PKJA 5BYJA 3RQIA 1V4NA 5ILQA 4AY4A 2AOUB 1T0PA 2JFOA 2X9NA 3EGXB 4U2BA 5D1HA 2BR3A 5J3JA 2BUBA 4E14A 1LFDB 4M1KA 4YIKA 4R7ZA 2WKSA 2IOFK 1DIHA 1Y3AA 3D8UA 3BMQB 1XOIA 2EJCA 2OCPA 3O47A 4QWWA 3UJHA 4C2TA 1XFAA 3LW8A 4RJKA 2A3NA 2YMMA 1DX4A 4HRYA 4LSMA 2OOKA 4REMA 3IUBA 3PFFA 2ID4A 2JCYA 1N4DA 4RZ3A 3QOFA 4ER3A 3SPXA 4RZIA 4C0AC 3U4GA 5IDQA 1NI3A 3ZBPA 4KPUB 2FWPA 3ZIAD 3U60B 1EXDA 3RVPA 1LQ2A 2ZI5A 4Q21A 5GY7A 2N75A 3ILVA 2X19A 1JAYA 5A3VA 3BREA 3GB9A 4YJHB 3WLEA 3KX2A 2E5LB 3ETDA 1I2ZA 1GPH1 1KI9A 2UUPA 3E9CA 1C4WA 1OYOA 1X39A 3FFTA 1REQA 4NZMA 3TR0A 2DPHA 1O94D 3O75A 3QYAA 4EI2A 2L0XA 1SCQA 4FDVA 4G07A 4PO8A 3FWNA 3QUSA 2C98A 3KRTA 1YO6A 4PZAA 4EDHA 4CEJB 3HKCA 1O95C 2J8ZA 1QG4A 2GZSA 3GFFA 2F59A 3OKFA 2HBZA 3EK2A 4W7HA 2BGLA 4QTYA 1FRVA 2BW0A 3O2JA 3M6IA 4LHYA 1N0WA 4MQEB 3VZDA 2EV9A 3WGNA 6PFKA 1ZCBA 4EQ6B 1RP7A 5LD2C 2JBAA 4LE1A 3GJRA 1AIPA 5FBQB 4GC5A 1PFWA 1II8A 4ND7A 1U9IC 5I7WA 2UZ3A 1NJ8A 4PBRA 3NCTA 2FGKA 4NEGA 1OFUA 2Z3ZA 5MFZA 5AP9A 1SCJA 1C1DB 4YUWA 4V0LA 4BQPA 3CO5A 3D0QA 3C87A 1J9EA 2X8WA 4IHQA 4XD7A 4YP5A 5AOBA 2WUWE 4XJTA 4S05A 3HCDA 2FN9A 1T1GA 4Q1VA 1N5JA 1NX6A 3DQPA 2BJWA 1E3MA 4IOLA 2FYTA 2VRCD 5ICEA 1D1QA 1R18A 5KDLA 4DPLA 4LV6A 4UVEA 1ZQ1A 2WTBA 2Q3HA 2HWUA 3NHYA 3ZV3A 4I5IA 5E3HA 1I4WA 1I7LA 2C3YA 4UDXX 1EE9A 1FS4A 3D1JA 4EG1A 4RD4A 4CM4A 3D7NA 2N42A 2CYCA 2GMWA 4TKUB 3FPGA 4RKRA 4P3OA 1P3DA 2XE6A 2C54A 1TTTA 2O8FB 5I7EA 1U8EA 4WUVA 3LUDA 3RVOA 1RQ7A 3V32A 4MLPA 2XNSA 3H1BA 1QK3A 2ONKA 4PG4A 1N3YA 3RBVA 4CDNA 1PUXA 2QU7A 2VF7A 2M6SA 2XKJE 2Y2UA 5FI5A 2ZLBA 5JCOA 4EDFA 3FPKA 1UH5A 4XQCA 3W7AA 1UKCA 5JS2A 2OB2A 2CHQA 3DDWA 2QVLA 3RRJA 3BXFA 4INJA 3O94A 4W4TA 3HBNA 2FGJA 1T10A 3RJ5A 4PHGA 4RU1A 3I6YA 4Q15A 4BVHA 4BQQA 3RFVA 1NW6A 5AW5A 3CB4A 2I80A 2CJWA 1EIZA 3IT1A 3LVRE 3OZBA 4DCGA 5KX5A 2CNOA 4FBLA 5BNWA 4PPFA 3AO0B 6LDHA 4GE0A 1UK6A 2GEBA 1RWNA 4X54A 4ARZA 1DZIA 2WU0A 4HWKA 2VOEA 3CC8A 4FT4A 2WWIA 4HZIA 5E7QA 5BW5A 4ND6A 2R8XA 3THYB 1YE8A 3PQ2A 2QRNA 5GIPE 3PI6A 3B2EA 3H1GA 5JQGB 3IULA 1AB5A 2H2AA 1Y5RA 1BMTA 1ZH2A 2E1RA 4JYPA 4WCFB 5DYGA 3DDSA 4CG2A 2O8BB 3LOUA 3QMVA 4MYRA 3V48A 2RJOA 1K8YB 4NU5A 2A86A 2GNOA 2CDAA 4QUAA 4NXNB 4LVCA 4B3JA 1PS9A 2BGMA 2P27A 2XKAA 5BORA 3L07A 1E6WA 4H2DA 3T5TA 4DM3A 5L40A 4BO1A 1O1YA 2XNJA 1G21B 3ANTA 3G82C 4P5EA 2XBLA 4MW4A 1PX0A 4BRZA 4DNXA 4RK4A 1D6JA 2RJ3A 3EXG2 3IILA 4FMDF 2E5WA 1ENZA 2YN2A 1CUGA 1OE0A 4XRRA 4Y8VA 5D3ZA 5KWIA 2Y99A 4LWQA 3AEXA 1XKLA 3GJZA 3V4ZA 1EX9A 4JJ6A 1JR3D 1TQ4A 3E84A 3GG9A 3GZNA 2QL6A 3N9IA 3ZI0A 3KPVA 3PT9A 4IDQA 3A6JA 4K6FA 4P2BA 1V8BA 4XCVA 3A6LA 1ZUHA 3HPQA 3Q0TA 2ID7A 3DTNA 1SFRA 4MK4A 1XNJA 4TMWA 3ANNA 1JZQA 1QHSA 3ZDZB 1P0CA 3ZXXA 2PX0A 3LUKA 4MV6A 5L3RA 1EFDN 5J47A 4OEHA 4RXTA 3T1NA 3K70D 2DR0A 4WXYB 2UYQA 4KOEC 4FHZA 3IQFA 1GNRA 3TIVA 4Q4AB 4ZOCA 1SUPA 1U2SA 3SDZA 1YMUA 4BE7B 1K27A 3Q40A 1KPHA 1YB2A 1PU2A 2VJPA 1O5TA 1UPXA 3M5WA 4C3UA 4DANA 1UFRA 4RZXA 5KYVA 1UQTA 1ZI9A 2BPOA 2Z8YM 4AJJA 5HQJA 1KI1A 1JVNA 3COYA 3KJNA 1E60A 2VLIA 4MV5A 3RYFB 3ED5A 3SLKA 1B0PA 2XA1A 2VYNA 2HO4A 3RVNA 3WBJA 1TMKA 4XZ3A 4O4JB 5I45A 1EXMA 4EVQA 3GEGA 2ZDQA 4ZGWA 4A0RA 4Q9JA 1HFJA 1H2XA 4JKOA 1GRVA 4HZGA 5DNAA 4C7XA 4OP3A 1A2OA 5KMGB 3K0BA 1B1AA 4ZPXA 2XOXA 1DU4A 5G41A 4BNXA 1JH8A 5JCOC 1RXWA 1GUAA 5E0KB 3IR6A 3WK7A 3G2PA 3PFWO 4XKJA 3QTLA 3X1DA 5JIBA 2RCNA 3UG7A 4ECEA 2CLFB 3LVQE 5AI0A 5LDDC 3AUAA 3VHLB 1R4MA 3KT6A 1QYIA 4CQLA 1XZHA 3ICPA 4HYQA 3B8EA 1PD1A 2IEAA 4R5HA 4H6PA 1M7BA 2AQIA 4P32A 4KX3A 3QPUA 2IU3A 4I9GA 1RBMA 4HPXB 2RSLA 3B12A 1AZWA 4JB8A 3G17A 5BN3A 5JT1A 2C2HA 4F4DA 2WJAA 1XO1A 521PA 2AMVA 1W49A 4HAYA 3ELDA 1Q1QA 4FGKA 4LCEA 3HWRA 3KZ1E 4YRSA 5JMOA 4AJIA 4RTMA 1PI3A 1SVMA 1V11B 2DETA 3ZOKA 1ZEJA 4KQJA 5KSYA 2YOFA 4S0ZA 4JC8A 4P7BA 1DKMA 1J21A 1KH2A 3FG9A 4PCUA 5AQEA 4BMXA 2XDYA 2FDRA 4I3HA 2RGRA 3MFQA 4I4LA 4DQLA 2J9FA 2DFLA 2R6FA 4BOYA 2ZT5A 1LX6A 4YY3B 3L40A 2QD4A 1E2BA 2X6RA 2YCBA 3HGQA 1N32B 1Z6ZA 1QIGA 4K5QA 1E1KA 2CK3A 2ZVPX 4IBOA 1V45E 4KNWA 3BULA 1DC6A 1W44A 1UPAA 3VKFA 4XDGA 1COZA 3Q1LA 3AHDA 4LJ9A 1M1UA 4YJKA 4BBZA 3JQ9C 1TAGA 2YZ7A 1NTRA 4CFZA 3HKEA 1N1GA 1GPKA 4ZI2A 3FNBA 4BLPA 6AT1A 5IHPA 2GEDA 1JHOA 1RJGA 3W77A 3CRW1 1AV6A 4NCIA 5D8DA 1B42A 4L22A 3HCAA 4M54A 1P2BA 4JI8B 1DKLA 1ZD2P 2D3WA 3NS7A 3LFUA 3EZXA 4IVRA 2ZTSA 1N3IA 4MRMB 3VPSA 1XD2A 1Z35A 3OAAA 4CXMA 3MGKA 4JP1A 1OLOA 1Q1ZA 1GZ3A 5H5JA 2W4MA 1U98A 3QSGA 1WEHA 5KDOA 3O8BA 2HPZA 2V1XA 2BT4A 4HRAA 1XTTA 3LQYA 5KSPA 3KTDA 1FNCA 4BYGA 3EG9A 1EE1A 1YZVA 4PG8A 2PDAA 3M89A 2C99A 5FWYB 2DBVO 3V9PA 1NRXA 5BNIA 2FEAA 3L7DA 1H0SA 1P2VA 5SY6A 2P9HA 5LXTF 5FYDA 3FIUA 1L5LA 3TSAA 5EUCA 5AKHA 5DBOA 4GOMD 5EPEA 2DE0X 4ENWA 4RLQA 2QEQA 2AZXA 4N8DA 3ZDBA 3I64A 1Q57A 1Z74A 1E9FA 3MTBA 4HPJB 1G16A 4AP5A 1IY9A 2DUNA 2R7MA 3CN7A 3ET5A 3R7WB 4X84A 1DV2A 1KPIA 3JTMA 2C5AA 4CI9A 1A76A 4RH0A 4CMIA 5EZSA 4A03A 4F2GA 3FHLA 4WX2B 2GPJA 1SCAA 3SYLA 1SBCA 5F7OA 3EHDA 1C4KA 4WOJA 4TTVA 3U49A 1K97A 1ORVA 1LDNA 1VKZA 1CFZA 1ZX1A 4IXWA 4QULA 2UVPA 3AJAA 3A3OA 3VMFA 2QJRA 4FVTA 5B3JC 1U0BB 3V34A 2WAXA 1PJZA 3U80A 5ICGA 2XGGA 2HCRA 3KR2A 4P0QB 1O5OA 3LWZA 1L7NA 5C5IA 4TZ6A 3EDQA 1U7TA 5BSHA 5CCXA 3KBOA 1OAKA 1A1SA 4JP5A 1W8DA 1GPLA 1TZJA 4P80A 1CIVA 2RGDA 2JRLA 5HNKA 4IJWA 1YR2A 4JVMA 3TTSA 4AZWA 5JECA 1CETA 1T43A 3FM9A 4R16A 1QYVA 3M6AA 5A9SA 2QR3A 4ARAA 5IZ4A 1GCIA 4P4LA 4X71A 2HCBA 1BQ4A 3JVUA 3QSYA 3G7NA 3IAAA 1J39A 3ETJA 1KU6A 3A8TA 1P77A 4KO8A 4R2LA 4P6VF 3B60A 5CLHA 1M8JA 3IHWA 4WVLA 5EKSA 3S7TA 5HZGA 3EXIA 5ALPA 2VJKA 3FDXA 1LB1B 1R0XA 4KHPB 4GBJA 4TPKA 5B1SA 4HGZA 1BCSB 4OBEA 2EG5A 2I2AA 4AYTA 3A3YA 2PSDA 1W48A 2Y05A 2PR7A 3CLRD 2GD2A 3O38A 2GKSA 1DMRA 3ORHA 3I62A 3PHGA 4P5DA 2WHXA 3TSZA 2MYTA 3W5AA 3PXEA 3FCXA 3H84A 5TVGA 3DBLA 4BFYA 4ZT7A 1OXBB 1R50A 1NRJB 4H0NA 2E4ZA 2G5CA 2CXNA 4BWFB 1FTNA 4J9UE 1Y6QA 1AKQA 3K1AA 3HYCA 2CDBA 3GWZA 3KR9A 2O8CA 2CXPA 3TFOA 1Z6XA 3IGFA 1E7YA 3NIFB 3OUZA 2NO4A 2N47A 5SYAA 3GDGA 2P2YA 4G09A 4P0TA 3SGLA 3TOCA 1ZIOA 3K0AA 3A1EA 3HCOA 1AHIA 4R40A 1J2UA 4ALMA 4GI7A 1U7OA 1M6YA 1R15A 1TM4E 2W2MA 4DHEA 1U94A 2YXBA 4UFOA 5JCXA 3OLQA 1ICEA 2L69A 2QUJA 2YYAA 3P5SA 4KBGA 1PT5A 4DXAA 2E18A 4NBUA 1C29B 4MVJF 1MT0A 4ER0A 1IG3A 3TW6A 1UJ4A 3BSSA 4Q4JA 5E1MA 2XCLA 5L3QA 4PQGA 1WV0A 2OPBA 4IV8A 1WIWA 4KVAA 1AZLA 3THOA 5KVSA 2HK6A 1YJXA 2KB0A 4TLAA 4LV5B 1E1CB 1N9ZA 2I3BA 4F6LA 2X5JO 3AVPA 2B25A 3FCOA 1IUPA 1PR0A 5CNJA 3C6QA 2QRJA 5JE8A 1WXWA 4PZDA 4DBLC 2DT5A 4H4DA 1ZBDA 4H08A 4ND8A 3UHPA 1Z63A 3GXOA 5ALNA 4KKVA 1GVHA 5BSMA 1SUBA 1MB4A 4HV4A 1YR6A 4E22A 1DAPA 2NQ8A 4IUBS 1DBSA 2OR3A 1GYRA 4M8IA 4RHCA 4MUBA 1CKEA 3AVWA 1HDYA 2BFCB 4WNAA 2XVAA 4UOZA 3SQLA 1U99A 1CE8B 1HE3A 4AKEA 4CQJA 5CU7A 1YOBA 1U7WA 1M66A 4O2AF 1L4HA 3M9LA 2LCFA 4CETA 3OZTA 1NW4A 2HKIA 2Z08A 4PLTA 4GI2A 1FFCA 4C07A 1RWQA 1R0KA 1UQUA 4QGFA 3W2HA 4XE5A 3W3AH 1GUZA 2HA0A 1R0BA 4YMTA 1A96A 5HX7A 2IEYA 4FWIB 1SN7A 2FQWA 3R4CA 2FMKA 3N87A 4L51A 3STUA 1VKRA 2NIPA 3J7TA 2QTLA 1SHTX 2QT9A 3H9JA 3DMYA 3KAQA 2DRIA 3L04A 2C5LA 2H4JA 3R3UA 4NULA 4QNRA 4CKYA 3CLTD 2HBYA 4TXNA 3V00A 3IHLA 2HH9A 3MJCA 2XYPA 3TFQA 3WRYA 1ORRA 4C43A 5FTLA 2UUBB 1Z5OA 3BFJA 4HDKA 4LRWA 3HA7A 1WDWB 2GCEA 1E96A 2HZ7A 3QG5A 1F2UB 1ESMA 4NYIQ 3HADA 3KPWA 4FONA 4MUHA 3W3ZB 2PKRA 2IPMA 2VP9A 4DILA 4M0LA 5EIAA 4CLOA 4YN3A 2G67A 3EXAA 2VP4A 5A5VA 2DSTA 2K6GA 2MSLA 1MR3F 4LC1A 2WKWA 1V39A 2XUPA 1U1CA 4US0R 3C48A 4RC9A 1QQ7A 3JYPA 4WASA 3E5HA 5HFAA 2ZYAA 4DSOA 5JMTA 1JDSA 1WKBA 1A8IA 1QHYA 1VLHA 4FZJA 1C3XA 1SIBE 2BMEA 3SFVA 4F60A 5C1IA 3M4NA 1FRQA 3CEAA 1WZCA 4Z7NB 1QNLA 1KZ4A 2FETA 2GXQA 4XOUA 1S3GA 5B30A 5JBIA 5DASA 1UC5B 2QVZX 3IPRA 5CIYA 3L2OB 4MI9A 3WBBA 1VJDA 1JSXA 2NUAA 4H18A 1YOVA 1DHTA 3DWEX 1T5IA 3NH6A 4FZ5A 4JBNA 3WWPA 3MYRA 4FR0A 3V8BA 4F4JA 1UMCB 2QU8A 1WMAA 4JIMA 1OT5A 2OCGA 4DVGA 3WK5A 3FA2A 3QVXA 1WDTA 3H99A 4LOIA 3N0WA 5K0LA 3RJTA 1CUVA 2OY0A 1EP1B 2ZR0A 3NWBA 4KWIA 1UJBA 3MBOA 4N7RA 1YH3A 2NPOA 3RREA 2X14A 3OQOA 4ID9A 3TTVA 1OASA 1HRDA 1QHFA 2HQRA 3QV1A 4QUBA 2NU7B 3RRNA 2FPIA 3PXUA 4GAEA 2RKBA 1QIKA 4KXLA 4Y0NA 3X2FA 4CKXA 5HS6A 4S24A 1HK7A 4DR7B 3G2HA 5LYJB 3OFJA 4H17A 1QM5A 1OGYA 2DPGA 3FCEA 3R6DA 4R1PA 1P72A 1X86B 1Z6YA 3GJQA 1JKIA 4COOA 5KQRA 1QHGA 2JARA 4MS4B 4Q9DA 3E2MA 5HCNA 3OP1A 2NZWA 4AKHA 4ZU6X 1RTTA 5LXTA 3VYRB 4Y1RB 1SZDA 2DYKA 3C4QA 4KXWA 3WL8A 1KGSA 4REOA 2W2PA 5CPBA 4NBLA 1XF1A 2B92A 3LHSA 2AOTB 1II0A 1QRAA 4ZXPA 1QFXA 4E13A 3PHLA 2QUZA 4Q4CA 4Q9NA 4AG3A 4L5JA 3E53A 3N28A 1L7MA 3EDYA 4R84A 4TL7A 3E3LA 2AFHE 2QMUA 4TN5A 2F8TA 2W0SA 1SIUA 2PPVA 4FDUA 1FF9A 4XEHA 1GAQA 2JI4A 4PQFA 4QTZA 1C7JA 1JAZA 4KE6A 3DP9A 2F8MA 4OQDA 5DYNA 5EXDA 1I7NA 4AF8A 3R9XA 1XVUA 1TYEB 5L7YA 2W6ID 3H6HA 4YJFA 4V0ME 3WRYC 1AUOA 1PWXA 3KYDA 1E1LA 1SZJG 3BERA 3L7IA 1GSHA 1K8ZB 1SBQA 2DVMA 4B34A 1QQTA 4IS3A 4Z8XA 3HYNA 3G9QA 5FNVA 2IU6A 5KNDA 4JQOA 4RESA 4JLVA 4M7RA 1RC8A 1JG7A 5TQ0B 4EB6B 3N58A 2F1RA 2XH8A 4RL6A 2OSVA 3VVCA 1E2GA 2XYHA 4JI6B 2VYFA 4CM6A 1ABFA 5EJ6A 5CYOA 4PQEA 3FX2A 1IJEA 4R2IA 5EN4A 2LZ0A 2PRSA 1EB9A 3OZVA 2IQIA 2RI0A 3KR1A 5J9FA 1YI1A 1X1QA 3ML1A 4PS1A 3T99A 2RMKA 3QHAA 4CV3A 3VC3A 3ER8A 4QGBA 3WL3A 2IEDA 3KC2A 1Y9EA 2D06A 3MEQA 5CJPA 3ZHTA 1QCCA 3B78A 4MIKA 4DV1B 4G0YA 1L5QA 1TCCA 2C9YA 1IIRA 3BMOB 2POCA 4WECA 5A2GA 1HH4A 5H16A 3BCHA 1QGAA 4KFUA 1Y9AA 4LKRA 4F7WA 3UJBA 4MROA 2JZCA 3HO6A 1C0LA 1WVGA 1PV2A 1G8PA 2W6JD 2H18A 2PL5A 1QK5A 1MXHA 1JLMA 5GPBA 2P2ZA 2COEA 4D4MA 3ZDDA 2AKEA 1ODIA 1V3VA 2ZR9A 3PQFA 5KHAA 1P2UA 1KJIA 1FU7A 3BL8A 3U6BA 1J4AA 3BB3A 3NTRA 2G06A 4IJKA 1GPUA 2RB5A 3NNDA 4JEMA 4NYJQ 4Y6RA 5E9JA 2UXDB 5FULA 3TLMA 2VUUA 4A2QA 3IP7A 5FFNA 1FRNA 1ZESA 3W2EA 1MTOA 1UXIA 1E94E 2AG0A 2Z0MA 4ARIA 4J75A 5JZSA 3H0KA 4IRMA 4EMBA 4U5XA 1NATA 1JQ5A 1OJ7A 1UEXC 2LXNA 2ZTUA 4KLAA 2NADA 1E2DA 5ES3A 4BO4A 4CV1A 4JSYA 4DJDC 4CLHA 2I4NA 1M7HA 2P3QA 4IKOA 3F90A 2YWCA 4IIYA 5DI3A 2VSFA 3O2QB 4O02B 4J4TA 1T0HB 4GMGA 4MVJA 3COVA 3RT7A 4BO5A 4AY2A 4U6SA 4U39A 3BWMA 5M34A 3JD4A 2VAXA 5DN6A 1X1AA 3X2EA 2GN6A 4MP6A 3WQSB 2GQ0A 3M8KA 2YW9A 3BFKA 2PZAA 1Z75A 5BXYA 4BO0A 1JHUA 5JZVA 1JIKA 1B2RA 3PCTA 2PS3A 1S8OA 3RANA 1U02A 5FF9A 3SE0A 4ZIRA 2WYUA 2VCEA 3GA7A 2IHNA 4TLMB 4J0HA 4URYR 3RTGA 2WY2D 1MLDA 3T38A 4B7UA 3USES 3SYKA 1IZYA 1GKUB 1LV8A 4ZT5A 2QRZA 4DY6A 3IBSA 3K0CA 4IUYA 5B7GA 1HNZB 2WIAA 1PQ4A 1CUJA 3K20A 1C50A 1ZJ5A 3OE5A 5G3YA 1VRWA 2XB6A 4KXNA 1G20A 2QTRA 4LFAB 1JFFA 3HLKA 2ZP1A 2C31A 3VC7A 3P9YA 4RJ2A 3UPTA 2QN3A 1ADFA 1P8AA 4PRYA 4UUNA 4ZOLF 5T8KA 1MO6A 1C2TA 2QW8A 2I6FA 2P9QA 5ESWA 1KE2A 3DPSA 3T3MB 3F97A 2HDNB 2JDIA 4W1SA 2WD8A 3MJFA 1IXRC 3ZU6A 4NCBA 5DHRA 2EIXA 3LQ2A 3RVQA 2I4MA 2GKOA 3ZDFA 3W5JA 5KU7A 2VTVA 2FUNB 3BEDA 2I1WA 2QE7A 2XWBF 3C3EA 3NEJA 1Z0UA 3R0IA 1NUAA 4KDFA 3H3XA 1HZJA 4N9QA 4X61A 5AXAA 2RAFA 2Y1OA 5CT6A 2IEIA 1V95A 1U8AA 4UM5A 7YASA 2GETA 5JEEA 2I03A 1YRAA 3A1NA 4Z4HA 4Z54A 5LLSA 3D2LA 3OQBA 2JF0A 3A58B 4JELA 1TLTA 2MWMA 3UWMA 1LLDA 1O2DA 5SYNA 3WGKA 3RRYA 2W0MA 1KEUA 4PAOA 4BUZA 1UEIA 4B82A 3DVRX 3RCBA 2ODAA 1N2JA 3GGJA 1FX0A 2XMQA 3OEYA 1EUCA 1FUKA 2I7CA 2BL4A 2X1HA 4NICA 5BVGB 5C4MA 3FOFC 2VYVA 5J40A 1ST3A 4MLZA 3D6MA 2B20A 2HSDA 1TLLA 2W2NA 3VNAA 1LPAB 3VPFA 1B00A 1I6WA 3FWKA 3TOXA 1PDVA 2WM3A 3KPYA 1ZQ9A 4N7MA 3O4VA 4Q01A 2XCOA 2IH4A 1DOZA 3M7IA 3COZA 1M3SA 4IH1A 2QMYA 4POAA 1RC0A 1SVOA 3ISJA 4YFYA 2NVUB 2PWYA 4LI0A 3VFDA 3RSCA 4MWZA 1GRRA 2Q9BA 1N8SA 4LY0A 4ZALA 1G5IA 3UY4A 4QQKA 4YCMA 3OFKA 3AVUA 4O2BB 2L2QA 3W9SA 2XJ4A 3N74A 4UASA 4I9FA 3WGTA 4RTOA 3JAMA 2K7FA 4DDTA 3GP8A 3SD7A 3K9NA 2BV3A 5AVJA 3H5IA 1P1KA 3GHHA 5LQSA 3WFJA 2QN6A 4ZK6A 5HKBA 4EUSA 4HUJA 3TPCA 5F5XA 3S5JA 4X64B 1XMXA 1S2LA 2CFTA 3FNQA 2A9VA 2KHZA 1TYAE 3HKBB 1JAIA 1ELOA 5HBGA 1V37A 3JU3A 1XWFA 4BNLA 4D98A 1OR8A 2HRZA 1DEHA 2F3SA 3DONA 3PUJA 4UVHA 5A3SA 2J5RA 5KVVA 1R0SA 1YB4A 1Z5UA 2BGKA 2QD1A 4TQAA 3KPJA 3U3MA 3IVGA 4BNDB 2OBFA 3BTVA 4X62B 3ZWMA 3NRBA 3K0CC 3SOZA 1H3NA 2OCAA 4EF6A 3QU7A 4MKZA 5F5LA 3SJBA 1IBCA 1FVHA 2WA1A 4B47A 2XA2A 2W2LA 1JLLA 1WVIA 2HMSA 3R0VA 4BQRA 4L4XA 1ZYUA 1FNSA 4H0CA 2B1GA 4UC0A 5DK4A 3OJWA 1ECPA 1P1IA 4NZNA 4OUDB 3VVLA 1ZCFA 3D5TA 4R1NA 5EG5A 2PSJA 1X7YB 2PS0A 5T8KC 1F2TB 4LJ8A 4CM3A 2BRUC 2ACEA 4MHSA 4OXYA 4UE6A 3KKEA 2GPWA 3SJAA 3J7AC 3D8SA 4HBGA 1SOWA 2BDTA 1DAOA 2D2VA 3HS3A 4KQKA 5IDVA 2VFAA 5IF9A 2EWVA 1D7AA 3IVAA 3T35A 3HKDA 3U48A 2RE8A 3CW2A 4M49A 1F8XA 3GLHE 3SKVA 3KOZA 1R6DA 3TZQA 2DGDA 2YYYA 4CUKA 4G0PA 1RI5A 2EDAA 3UTCA 5ALMA 1EP2B 1YR7A 1Y7HA 4LE0A 3VR6D 5IKOA 3G5AA 5FWXB 4D26A 3EUWA 3U19A 3T7KA 4C7OB 3SIXA 1PZMA 3IO3A 1LSUA 4AP9A 1MD9A 4GYYA 1Y7IA 2DWPA 3LDUA 4B6OA 4YBZA 3TTYA 1M0TA 5I48A 4G63A 1FCJA 5LZ9A 1B93A 1LSSA 1LJLA 2C82A 3RFCA 2JI7A 3MRTA 4YRNA 4HNVA 1W35A 5LQCA 5SICE 3WWZA 1J56A 1TTPB 4IP0A 4OMCA 2ZFUA 5C0OE 3ZWXA 3DEYX 3GYBA 4IRUB 3U3XA 4D9FA 1O8CA 2GM9A 1RYYA 4NHEA 3LT2A 3HJCA 4YJ3F 1D4OA 4KSYA 4BO3A 3VPGA 1T8PA 3G0OA 3V4SA 2AEFA 4BV3A 5IX8A 1DIBA 3NM4A 1ICIA 4MITA 1NLZA 3PNYA 2YINC 2BBWA 4RADA 4BC0A 3ROFA 2JK1A 3FDZA 2I8AA 4IFBA 4YRZA 1WMBA 2QNBA 2RIPA 4RFSB 1GTL1 3HWSA 1E7RA 2G09A 3FB4A 2DKFA 4EH1A 3WNBA 1EM8A 4AN0A 4KCGA 1L2TA 1WMSA 1OILA 2P4QA 1SD5A 2QJFA 4OY3A 1W9HA 5AI5A 5NULA 3PEFA 2CDCA 2Q0XA 2DHEA 4X3PA 3VZQA 1WV1A 1BG6A 3VR4A 2PV7A 3JQAA 1NYTA 4BZWA 4C3OB 4D2IA 4ZMRA 1UDAA 2YYZA 3HSSA 3V1NA 3C16C 1Z36A 5TX7A 1GADO 4MQMA 3WFZA 1CY6A 3ZU4A 2Z4RA 5HIMA 1Q7EA 4HSEA 2GILA 4J0FA 2IPLA 2LP4Y 3AKCA 2GB4A 2J3IA 2K87A 1S6YA 4NYIR 3PXBA 2H4FA 3CZ9A 3P96A 5ALRA 2CEKA 4CBVA 4JUBA 1QQ5A 3F78A 3ND9A 5JPDA 1U7XA 4PHFA 4PYLA 3KXDA 4C1BA 1G3RA 3MCZA 1GG5A 2JFPA 4JAVC 8GPBA 4BLOA 4RTSA 2WMDA 3GARA 4ZQGA 3L0YA 1OMOA 4YPOA 4YRTA 4LTMA 5ALVA 5LJIA 1HE4A 3AFOA 1QFSA 2V3CC 3E0QA 3NYIA 2ZIAA 2JAXA 4FLMA 1LTKA 2O6HA 4Z5XA 2JJ1A 1EQAA 3GFPA 4IEIA 2XQGA 1BS9A 2QAJA 3INYA 3PXCX 4AULA 3VYWA 2PZMA 3L8GA 2R48A 3JRXA 5EWLA 5EVJA 1EK5A 5ITZA 2P9TA 3E9NA 3ZIAA 1QR2A 2WMOB 3D64A 1R4NB 1TM7E 3N76A 4B8WA 4NAUA 4F9EA 2BZGA 2FPSA 2LWIA 3MC1A 4ND1A 4EARA 1NIJA 3LXXA 5EE5B 1N75A 4OP2A 5FAKA 1O94A 4Y2HA 1QO0D 3WLAA 3ANYB 5LYYA 2FZKA 5DBGA 2VG8A 4OK6A 1QX3A 4EX6A 1LGYA 3JSXA 1RSZA 2JFGA 4EPTA 3ZQUA 2FRXA 4OHXA 4Y6OA 5AKIA 2ZB8A 2QM3A 2X9GA 1ULAA 2D5LA 2R4TA 4N03A 5A1JA 5BYBA 5KYTA 1PFQA 4W63A 2QIOA 1L5RA 4FIZA 2YHUA 2GEJA 1QQBA 4KMSA 4JN6B 2PSHA 3KQTA 5E1OA 4WOBA 1WSDA 2I6TA 1IM2A 1BAPA 2VWHA 3IJPA 5K0JA 2OFFA 1UXOA 4AJ2A 3PD1A 2FMHA 4MX8A 4MWGA 5JJBA 4BMDA 1FP1D 1CRQA 3IUPA 2OFPA 1MABB 5E1BA 2VJBA 4KVGA 4MVCA 4NIMA 2JJQA 1B26A 3CKYA 4ZO4A 3OP4A 3WL7A 3ZU3A 3R5FA 3ZHBA 4B6SA 4DQKA 1L7BA 5BSUA 4G1VA 5F76A 3KXLA 1QH8A 5B2EA 1W6RA 1VKNA 4U9IS 4GZ5A 4UNRA 1SVWA 5DFAA 2GTPA 2VRCA 4L0CA 1I30A 4GXTA 1LZLA 4BMSA 1NVTA 2PKWA 2PJRA 4IL5A 3UMMA 1T5TA 1V48A 2SNIE 4AJLA 2IITA 4CCSA 1Q77A 3TRDA 1EWYA 1NLFA 4Z7JA 4LZAA 3B82A 5E2BA 5TQ2A 2Z2KA 1CUAA 3TTWA 5L3QB 2P30A 4IOJA 1F48A 1FFGA 1SU4A 1VJ0A 3UK1A 1P4HA 3FMVA 5THKA 3KZCA 4BFTA 4C4TA 2NXCA 3EOBI 3LUJA 3M5DA 3GGCA 1E6CA 3G1WA 1BQEA 1C7ZA 2F43B 2OKGA 2YFKA 2Q0SA 1FP4A 2QYSA 3EF3A 2VF5X 1IOZA 3PI7A 1SBZA 3V8RA 2MOKA 3WRWA 3I28A 3PUZA 3IP5A 2PA3A 1QIDA 2YV5A 1C2YA 2IW3A 2P9JA 3U62A 3ZBQA 5KTRA 2PUCA 2P67A 1I3MA 3OJOA 4RXUA 5IVDA 1JTVA 1I3LA 2R7KA 1GAEO 2W11A 4QDTA 5ARBA 1CEEA 5CFRA 4R7GA 3GPLA 3BS4A 2X40A 4FXOA 1VHTA 4UEKA 1NQAO 2E3JA 3E58A 4BP3A 4C6SA 2Y67A 4OL9A 4NZPA 3ZVRA 4OHBA 1UBGA 2J5XA 1G4UR 1QGOA 1VE6A 4KQ6A 1G55A 4E2FA 1MO5A 1NQWA 1C1XA 4CM9D 1MAAA 2XCIA 3R7SA 2IPAB 1IN6A 2AH5A 3BE5A 3MJRA 3NKVA 8MHTA 3MS2A 4FEYA 1VL0A 5IP5A 3MSCA 5DKFA 3RO7A 5LQJA 2NZ2A 3CWQA 2NZ8A 4E1AA 1QGUB 4HGOA 3OOWA 2C2YA 4KRFA 3DUWA 4GI1A 1CR4A 5FLXA 1I6KA 2GK7A 3JWPA 4DV2B 1O94C 3RR2A 1OAAA 3M6XA 4V2IA 3TLBA 2R6ZA 1NLYA 4U4AA 2ZUBA 1GTSA 1VMIA 1ZGHA 2QWXA 121PA 1NP3A 4ZQHA 4NYJR 2VTKA 1A9QA 1KOLA 4ARSA 5IRCD 2WU8A 3UGTA 3PD7A 2G7MC 2Z9BA 4XIIA 3I09A 3RG8A 1EVEA 3GFSA 2Q5LA 2FMFA 3SQNA 3OEHD 2Z4TA 4R9VA 3FYSA 2F9LA 4BLWA 6YASA 4FS8A 1G8AA 1Y98A 4GLFA 2LCQA 1VBKA 1E62A 4WNIA 4XPZA 1HFWA 4GD3Q 2JLQA 2GXUA 2B0CA 3ETNA 4OJNA 2RARA 1SVNA 3A2LA 4BNJA 3I5YA 2IBMA 3VR5H 2A58A 3FKJA 2F00A 1VLVA 1FLDA 1T5LA 3G2JA 3ZI4A 2BEVB 2PX4A 3CJRA 4JH0A 3HM2A 2BTQA 3NATA 3W5DA 3TW8B 1Y7LA 2DCMA 3EZLA 1RC1A 5HOEA 2XMCA 2V74B 1UBSB 4YJ3A 4F3KA 2XUJA 3KP1A 2ZRJA 4WOKA