3A1JA

Crystal structure of the human rad9-hus1-rad1 complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
266
structure length
265
Chain Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Rad9-Hus1-Rad1 Clamp
pubmed doi rcsb
molecule keywords Cell cycle checkpoint control protein RAD9A
molecule tags Hydrolase/cell cycle
source organism Homo sapiens
total genus 59
structure length 265
sequence length 266
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2009-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04139 Rad9 Rad9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3a1jA00
1UL1A 3A2FB 1CZDA 5HACA 1YYPA 3FDSD 4RJFA 1VYJA 2HIKA 4YHRA 2ZVLA 1U76A 1VYMA 2HIKC 4CS5A 1RXZA 3TBLA 3I2MX 3GPNA 1PLQA 5E0UA 3GGRC 3U60F 2HIIA 2AWAA 5IXAA 3HSLX 2IJXA 2ZVMA 3AIZC 2NTIC 5E0TA 4TR6A 3G65C 3GGRB 3A1JB 1DMLA 5CFKA 3FDSC 3P83A 5IWDA 5AUJA 2NTIB 3GPMA 3P87A 3P91A 3V62B 1AXCA 1B8HA 3G65B 3V60B 1RWZA 1IZ5A 4L6PA 2IZOC 3AIXA 3U5ZF 2HIIC 2HIKB 4D2GA 1IZ4A 5JNED 3F1WA 2ZVWA 3K4XA 1ISQA 2IO4A 1W60A 5B7OA 5IY4A 5E0VA 2IX2A 5A6DA 1UD9A 3LX2A 3A1JA 5DAIA 2IX2C 1T6LA 1SXJF 5H0TA 1U7BA 2ZVKA 1GE8A 1B77A 4HK1A 3V61B 1RXMA 2Z0LA 3U61F 2OD8A 1PLRA 4L60A 2IZOB 2ZVVA 2HIIB 3AIXB 3HI8A 3WGWA 3IFVA 3GGRA 3LX1A 4ZTDA 2AVTA 3A1JC 2IO4B 3AIZA 3VKXA 2NTIA 5DA7A 3G65A 2IX2B
chains in the Genus database with same CATH superfamily
1UL1A 3A2FB 1CZDA 5HACA 1YYPA 3FDSD 4RJFA 1VYJA 2HIKA 4YHRA 2ZVLA 1U76A 1VYMA 2HIKC 4CS5A 1RXZA 3TBLA 3I2MX 3GPNA 1PLQA 5E0UA 3GGRC 3U60F 2HIIA 2AWAA 5IXAA 3HSLX 2IJXA 2ZVMA 3AIZC 2NTIC 5E0TA 4TR6A 3G65C 3GGRB 3A1JB 1DMLA 5CFKA 3FDSC 3P83A 5IWDA 5AUJA 2NTIB 3GPMA 3P87A 3P91A 3V62B 1AXCA 1B8HA 3G65B 3V60B 1RWZA 1IZ5A 4L6PA 2IZOC 3AIXA 3U5ZF 2HIIC 2HIKB 4D2GA 1IZ4A 5JNED 3F1WA 2ZVWA 3K4XA 1ISQA 2IO4A 1W60A 5B7OA 5IY4A 5E0VA 2IX2A 5A6DA 1UD9A 3LX2A 3A1JA 5DAIA 2IX2C 1T6LA 1SXJF 5H0TA 1U7BA 2ZVKA 1GE8A 1B77A 4HK1A 3V61B 1RXMA 2Z0LA 3U61F 2OD8A 1PLRA 4L60A 2IZOB 2ZVVA 2HIIB 3AIXB 3HI8A 3WGWA 3IFVA 3GGRA 3LX1A 4ZTDA 2AVTA 3A1JC 2IO4B 3AIZA 3VKXA 2NTIA 5DA7A 3G65A 2IX2B
chains in the Genus database with same CATH topology
1UL1A 3A2FB 1CZDA 5HACA 1YYPA 3FDSD 4RJFA 1VYJA 2HIKA 4YHRA 2ZVLA 1U76A 1VYMA 2HIKC 4CS5A 1RXZA 3TBLA 3I2MX 3GPNA 1PLQA 5E0UA 3GGRC 3U60F 2HIIA 2AWAA 5IXAA 3HSLX 2IJXA 2ZVMA 3AIZC 2NTIC 5E0TA 4TR6A 3G65C 3GGRB 3A1JB 1DMLA 5CFKA 3FDSC 3P83A 5IWDA 5AUJA 2NTIB 3GPMA 3P87A 3P91A 3V62B 1AXCA 1B8HA 3G65B 3V60B 1RWZA 1IZ5A 4L6PA 2IZOC 3AIXA 3U5ZF 2HIIC 2HIKB 4D2GA 1IZ4A 5JNED 3F1WA 2ZVWA 3K4XA 1ISQA 2IO4A 1W60A 5B7OA 5IY4A 5E0VA 2IX2A 5A6DA 1UD9A 3LX2A 3A1JA 5DAIA 2IX2C 1T6LA 1SXJF 5H0TA 1U7BA 2ZVKA 1GE8A 1B77A 4HK1A 3V61B 1RXMA 2Z0LA 3U61F 2OD8A 1PLRA 4L60A 2IZOB 2ZVVA 2HIIB 3AIXB 3HI8A 3WGWA 3IFVA 3GGRA 3LX1A 4ZTDA 2AVTA 3A1JC 2IO4B 3AIZA 3VKXA 2NTIA 5DA7A 3G65A 2IX2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UL1 A;  3A2F B;  1CZD A;  5HAC A;  1YYP A;  3FDS D;  4RJF A;  1VYJ A;  2HIK A;  4YHR A;  2ZVL A;  1U76 A;  1VYM A;  2HIK C;  4CS5 A;  1RXZ A;  3TBL A;  3I2M X;  3GPN A;  1PLQ A;  5E0U A;  3GGR C;  3U60 F;  2HII A;  2AWA A;  5IXA A;  3HSL X;  2IJX A;  2ZVM A;  3AIZ C;  2NTI C;  5E0T A;  4TR6 A;  3G65 C;  3GGR B;  3A1J B;  1DML A;  5CFK A;  3FDS C;  3P83 A;  5IWD A;  5AUJ A;  2NTI B;  3GPM A;  3P87 A;  3P91 A;  3V62 B;  1AXC A;  1B8H A;  3G65 B;  3V60 B;  1RWZ A;  1IZ5 A;  4L6P A;  2IZO C;  3AIX A;  3U5Z F;  2HII C;  2HIK B;  4D2G A;  1IZ4 A;  5JNE D;  3F1W A;  2ZVW A;  3K4X A;  1ISQ A;  2IO4 A;  1W60 A;  5B7O A;  5IY4 A;  5E0V A;  2IX2 A;  5A6D A;  1UD9 A;  3LX2 A;  3A1J A;  5DAI A;  2IX2 C;  1T6L A;  1SXJ F;  5H0T A;  1U7B A;  2ZVK A;  1GE8 A;  1B77 A;  4HK1 A;  3V61 B;  1RXM A;  2Z0L A;  3U61 F;  2OD8 A;  1PLR A;  4L60 A;  2IZO B;  2ZVV A;  2HII B;  3AIX B;  3HI8 A;  3WGW A;  3IFV A;  3GGR A;  3LX1 A;  4ZTD A;  2AVT A;  3A1J C;  2IO4 B;  3AIZ A;  3VKX A;  2NTI A;  5DA7 A;  3G65 A;  2IX2 B; 
#chains in the Genus database with same CATH topology
 1UL1 A;  3A2F B;  1CZD A;  5HAC A;  1YYP A;  3FDS D;  4RJF A;  1VYJ A;  2HIK A;  4YHR A;  2ZVL A;  1U76 A;  1VYM A;  2HIK C;  4CS5 A;  1RXZ A;  3TBL A;  3I2M X;  3GPN A;  1PLQ A;  5E0U A;  3GGR C;  3U60 F;  2HII A;  2AWA A;  5IXA A;  3HSL X;  2IJX A;  2ZVM A;  3AIZ C;  2NTI C;  5E0T A;  4TR6 A;  3G65 C;  3GGR B;  3A1J B;  1DML A;  5CFK A;  3FDS C;  3P83 A;  5IWD A;  5AUJ A;  2NTI B;  3GPM A;  3P87 A;  3P91 A;  3V62 B;  1AXC A;  1B8H A;  3G65 B;  3V60 B;  1RWZ A;  1IZ5 A;  4L6P A;  2IZO C;  3AIX A;  3U5Z F;  2HII C;  2HIK B;  4D2G A;  1IZ4 A;  5JNE D;  3F1W A;  2ZVW A;  3K4X A;  1ISQ A;  2IO4 A;  1W60 A;  5B7O A;  5IY4 A;  5E0V A;  2IX2 A;  5A6D A;  1UD9 A;  3LX2 A;  3A1J A;  5DAI A;  2IX2 C;  1T6L A;  1SXJ F;  5H0T A;  1U7B A;  2ZVK A;  1GE8 A;  1B77 A;  4HK1 A;  3V61 B;  1RXM A;  2Z0L A;  3U61 F;  2OD8 A;  1PLR A;  4L60 A;  2IZO B;  2ZVV A;  2HII B;  3AIX B;  3HI8 A;  3WGW A;  3IFV A;  3GGR A;  3LX1 A;  4ZTD A;  2AVT A;  3A1J C;  2IO4 B;  3AIZ A;  3VKX A;  2NTI A;  5DA7 A;  3G65 A;  2IX2 B; 
#chains in the Genus database with same CATH homology
 1UL1 A;  3A2F B;  1CZD A;  5HAC A;  1YYP A;  3FDS D;  4RJF A;  1VYJ A;  2HIK A;  4YHR A;  2ZVL A;  1U76 A;  1VYM A;  2HIK C;  4CS5 A;  1RXZ A;  3TBL A;  3I2M X;  3GPN A;  1PLQ A;  5E0U A;  3GGR C;  3U60 F;  2HII A;  2AWA A;  5IXA A;  3HSL X;  2IJX A;  2ZVM A;  3AIZ C;  2NTI C;  5E0T A;  4TR6 A;  3G65 C;  3GGR B;  3A1J B;  1DML A;  5CFK A;  3FDS C;  3P83 A;  5IWD A;  5AUJ A;  2NTI B;  3GPM A;  3P87 A;  3P91 A;  3V62 B;  1AXC A;  1B8H A;  3G65 B;  3V60 B;  1RWZ A;  1IZ5 A;  4L6P A;  2IZO C;  3AIX A;  3U5Z F;  2HII C;  2HIK B;  4D2G A;  1IZ4 A;  5JNE D;  3F1W A;  2ZVW A;  3K4X A;  1ISQ A;  2IO4 A;  1W60 A;  5B7O A;  5IY4 A;  5E0V A;  2IX2 A;  5A6D A;  1UD9 A;  3LX2 A;  3A1J A;  5DAI A;  2IX2 C;  1T6L A;  1SXJ F;  5H0T A;  1U7B A;  2ZVK A;  1GE8 A;  1B77 A;  4HK1 A;  3V61 B;  1RXM A;  2Z0L A;  3U61 F;  2OD8 A;  1PLR A;  4L60 A;  2IZO B;  2ZVV A;  2HII B;  3AIX B;  3HI8 A;  3WGW A;  3IFV A;  3GGR A;  3LX1 A;  4ZTD A;  2AVT A;  3A1J C;  2IO4 B;  3AIZ A;  3VKX A;  2NTI A;  5DA7 A;  3G65 A;  2IX2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...