3A1WA

Crystal structue of the g domain of t. maritima feob iron iransporter
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
159
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 47
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1wA00
1R0ZA 1WDTA 1F2UB 2QN6A 4LI0A 4B74A 4JSTA 4LJ4A 5DI9A 3WY9A 4M8NE 1FFHA 1MABA 3K9GA 4TMXA 4HUTA 1TTTA 3LX5A 1Z6XA 3LNCA 1UBFA 2F3TA 3LXRA 2OV2A 5DE3A 4US2R 4G3XA 4BFTA 3FGNA 3MRSA 4NE2A 1JI0A 5FUYA 4EQ6A 5E7JA 4F92B 1W4RA 1ZD8A 2BCJQ 2EFCB 2VF7A 4JT2A 4LPKA 4MDEA 5FBWB 3RSOA 4NCNA 1E2FA 4FMDF 5LD2B 1E79D 3B5JA 4GOXA 2QM7A 5KDDA 1E94E 4LV5B 1KIMA 1J70A 1ZW6A 4S2EA 2ZU0C 4CIDA 4Q66C 4RZUA 3EZ9A 4Q1DA 4ESVA 1XD9A 2JCSA 2MSEB 4Q7JB 4XIGS 5FPYA 4LYJA 1NN3A 2WWFA 3I72A 2OE2A 2VP2A 4MRVA 4NHOA 4PHTA 4CRWB 4JVMA 4XVRA 3A1SA 2G77B 1GOTA 4RD1A 4DSUA 2TMKA 3W8RA 1HA3A 1FMJA 3PITA 2AX4A 3W6OA 1QRAA 4Z1MA 2OHFA 2ZR0A 3DOFA 1SKYE 1SZPA 2ZANA 3ADKA 3L0PA 1KMHB 4I1UA 2QENA 2XJ9A 2YV5A 5KYKA 4DCSA 4BWYA 1VTKA 4M21A 2QI9C 2JEOA 5IF9A 1IXZA 1RIFA 4CVNA 1M34E 1OHHA 2FFBA 3W5JA 2QAGB 3BJIC 3L2OB 2GJSA 4LYFA 4BECA 4F4CA 5HCNA 3UANA 4Q9HA 3I92A 1NY5A 2HEIA 5H70A 2O8BA 4D0NA 2CL0X 3SYKA 5HCIA 1VDZA 4Z1MD 1KO5A 2AFIE 2RCNA 2XEXA 3H86A 4BFZA 4D4LA 1TUIA 4RFSA 4D4MA 1PUJA 2HF9A 4IFEA 1XCGB 3KFXA 2OILA 4HB4A 2XB4A 1E96A 1O87A 2KBEA 3M1IA 3LDAA 2OFXA 1Z07A 2X77A 1N6KA 4C0KA 3ADCA 3A4LA 1OFHA 1X8KA 4M1KA 5TDHA 4IDHA 3ZS8A 4P32A 1U81A 3C5CA 3A8TA 2ECKA 3BFVA 4U02A 1PV4A 3WBKA 4LBYA 4A92A 3PCRB 2FSFA 3AF4A 4V0KA 3NC1C 4PPQA 5C4MA 2I1QA 3VNUA 1Z47A 4M9XA 1NSFA 2GAOA 2CEAA 4A6PA 3HPRA 2N46A 2QTFA 3BE4A 3WXMA 4BGDA 1R5BA 5BQ5A 4B3CA 1FP7A 3DPUA 1CP2A 1OFUX 2ZETA 3SN6A 1RPZA 3GLIA 3QKRB 4R2IA 1VHLA 1Z0KA 1SQ5A 1US8B 4NYIQ 4P4SA 3WRYC 3QEJA 1NBME 4HAXA 1SKQA 1IN5A 3T5DA 4LJ8A 2DPXA 2QRZA 1JEDA 4KLZA 4LRWA 3RABA 3SU8A 1ESNA 1OYWA 2P5SA 1ZUNB 1FTNA 4GPTA 4JLAA 4HLCA 4EUNA 2O5VA 3OIWA 1LNZA 1P7CA 4PC6A 4ZDJA 1Z8FA 1SVMA 1L8QA 5JEDA 2XZOA 3TSOA 1RC8A 2XSZA 4FWIB 3LVRE 3FWYA 4WW0A 1NLZA 1TQ4A 5JHGB 1FUUA 4D0LB 1AS2A 2GILA 3PEUA 5AUPB 4RKFA 3ZLJA 4Q48A 1YZNA 1VG0B 2VIIA 6Q21A 2C99A 1DAFA 2PX0A 3TBKA 4GP7A 1EGAA 1M7BA 4UJ5A 3B82A 3GFTA 3GLHB 1VPLA 3K9LA 3RS4A 3THWB 3JZMA 4D2IA 5E95A 4DUGA 2OLJA 2XSZD 1VCIA 4DB2A 5JI3E 5EZ6B 2C78A 4TTQA 1DAMA 2ZJ2A 1N6HA 4DCTA 5JEEA 2RAPA 1OXUA 1ZRHA 4BLPA 2CBZA 3DVLA 3VKGA 1U0LA 4HAVA 4XWAA 3PUVA 1SXJB 5J5CA 3K70B 4NCHA 3IO5A 3RAPR 1G3UA 4B44A 1ZMXA 1M7HA 1N0VC 3FPAA 2FSGA 4NYJR 5DLQC 4ZCLA 5JWRA 2F43B 4PXAA 3LO5A 2ZXUA 2ZYUX 2AWOA 2J0VA 1ZIOA 2Q21A 4DUGD 4B34A 1LVGA 2GVZC 5EXXA 1F6BA 3TNFA 3DZDA 1E2EA 4EFMA 1ZAKA 3P1JA 3P4XA 3NG1A 3BAFA 4OBEA 3PR1A 5JCPA 5FPHA 2GF0A 3VNVA 2ZRIA 2OSBA 2Q3MA 3PXGA 1LW7A 3NBFA 3Q7QA 1CBUA 4HLUC 1LFDB 4HB2A 1TUEA 3IGFA 5E7MA 4TMKA 3KZ1E 4G01B 2QPTA 1MO6A 4B47A 1SVKA 4DLXA 1Z0IA 1Z6YA 3ZZ0A 2OLKA 2ERYA 2Q6TA 3WMEA 4UNRA 5JJKA 4L9WA 4IVRA 1UADA 1P9WA 2GBLA 1K6MA 4BEJA 3N2IA 2ZYTX 3TMKA 4LC1A 4H9GA 2R6DA 3FB4A 4CYMA 1QHHA 4TYWA 3K53A 4Q1AA 4PANA 2YKGA 3DO6A 4F38A 5K8LA 3TAUA 4AG5A 2QEQA 2D62A 3CX8A 2BM0A 2VBCA 4LHZA 1Z6TA 5CM8B 3SJZA 3PJRA 5KTYA 2D2FA 2EU8A 2F3RA 4BLSA 2DCUA 5EXTA 3BB1A 2VHCA 4WOPA 2GCOA 1E2MA 4RD2A 3EPHA 3P4YA 2BDTA 3QKSB 2JGNA 3ZVRA 4E5UA 2QMUA 1XDBA 3CF6R 2FPLA 1IY0A 4MRNA 4QGHA 1XXHE 3GPLA 1G16A 5FUVA 4I4LA 1MABB 3TUZC 3FKQA 3QE0A 3V00A 3AB3A 4F4JA 2F1RA 1G3MA 3X1ZA 2NO9A 1JNYA 2WOOA 4XTRA 4EQ6B 2C8VA 5G3ZA 4OKSA 1GDDA 3LH5A 3BERA 4LBZA 2YHSA 4N0EA 2BIFA 3BGWA 3FHCB 1XNJA 3U5ZB 1AGPA 3F8TA 4C0SA 2ZAMA 4PO1A 1E2GA 2C9OA 3UMFA 1ZBDA 3ZH9B 5SZIA 3NH6A 4EFNA 3BBPA 2W58A 3HR7A 2FF7A 2NTYC 3JVUA 4A0GA 2A5FA 1ZIPA 2H17A 4KJZA 3VTKA 2GXSA 2PT5A 2YOFA 5BXQC 1E1RA 3E70C 4YXWD 4NCKA 3U7GA 3I62A 4O2LA 3AVPA 4TLEA 2IHBA 4TL8A 5JECA 1TQDA 1TMKA 2WWGA 2WMOB 4IVQA 4WVFA 2IEZA 1CIPA 3UWKA 2NGRA 3LY5A 1H65A 2P5TB 5AJVB 4D6PA 3NDBB 1XTSA 4LBVA 4I99A 4HAWA 2DB3A 1GL7A 4HLUA 2J46A 3CRVA 5IHPA 1OB5A 1S2MA 1SVSA 2DWQA 3SNHA 3NC0C 5DH9A 1E1RD 1GL6A 121PA 1Q3TA 2B7BA 2GXUA 4GFDA 2O8BB 2JLYA 3OAAA 3R9XA 4LV8B 5KNCA 1E2QA 2JJ1D 4D81A 2XTZA 3AEZA 4ACAA 4JLVA 2GK6A 5SZKB 1W0KA 1YZQA 1G41A 2WOJA 2C77A 2ZRAA 4A15A 5J40A 3X1YA 3MG9A 4RFSB 2DFKB 1XTJA 1QG4A 2QTHA 2WJYA 3I8XA 2CLDX 3NXSA 5D3MA 5GJVC 2QQ0A 2GRJA 3N5CA 1X6VA 3FHOA 3T61A 4OHZA 4NYJQ 3C15C 1NVWQ 1CR4A 3BORA 2OG2A 4GT1A 1AA9A 2F7SA 1A82A 2J7PA 3QVVA 1W0KD 2RMKA 4HB3A 3SBDA 4MYCA 1E9BA 3QNUA 1VG8A 4B3FX 3GJ6A 1I4LD 2W6JD 2J5XA 3PEVA 4O25A 5DGXA 4XD7D 2FSHA 1W2GA 1X8LA 3PQCA 1R0WA 2O8FA 1NSTA 3GQBA 1ZD9A 4XWOA 1HV8A 1E2HA 3IQWA 2GJ9A 3TJZA 3GLIB 1H8EA 4AKHA 4C7OA 2ZRMA 1RYHA 4P4SB 4PTLA 4UQOA 4YMVA 1VHTA 1F48A 3O8DA 2BJWA 4M1SA 4WBSA 1U8ZA 1CTQA 3HU2A 4LYHA 3A58B 2G1KA 2PEYA 2J7PD 1F3OA 1G5PA 4L8GA 2NO7A 3R7WA 5GADl 5EXSA 1S1CA 2JLRA 1S3SA 1KSFX 4NTZA 1UAAA 4M1YA 4CF7A 2IYUA 4JLDA 3GJ0A 2G3YA 2XZPA 2W2TA 2CE7A 3LX8A 4NYMQ 1L2TA 2IYRA 2C9YA 1KI6A 4JLPA 2DFTA 3I5XA 1GILA 1D2EA 4A1FA 2GJKA 4OI0A 1BIFA 1V43A 2PX3A 1TU3A 2OFOA 4LDJA 4URWR 3Q85A 2ZUCA 1SULA 3L0OA 3UG6A 1QHIA 2WIAA 2ZSAA 4KSCA 3T15A 1WCV1 1XCPA 4EJSC 2P65A 5FOWA 2D4HA 621PA 5DNYB 4QNMA 3AVQA 3X1XA 3LBIA 2FE4A 4R9UC 5J4VA 1E9DA 1U0HC 3FKSA 1NI3A 4QBHA 2XNSA 2F55A 1GG2A 1XEXA 4KFSA 4PPNA 1G6OA 3TVTA 1YZGA 2PLFA 4KYUA 1FUKA 1HTWA 1OIWA 4OQXA 5TMPA 2IYZA 3KKQA 2VTKA 1ZU4A 1YKSA 4P0TA 3FMFA 3ZYCA 1AKYA 4C2UA 4QBGB 2RHDA 4WXRA 5EP3A 1KO1A 2ORWA 1UPTA 3KXLA 5L3QB 4OJQA 5BYKA 1KJYA 2QGNA 2ZE6A 4JLBA 1Z83A 3RSLA 4DWJA 4JBXA 1D5CA 2QMEA 2YJTD 2ZJZA 1YZUA 1MR3F 5AWFC 3OFND 2QP9X 4CDGA 4IEIA 3TK1A 5LB4A 3BXZA 3P26A 4NDZA 5EZ5A 2B8WA 2VQSA 3VQTA 4A8JA 2ZVPX 1AK2A 1G6HA 1ZM4A 3L8YA 3WNCA 4QC2A 5J4KA 1E4VA 2V4ZA 1HQCA 2WIBA 5IRCD 2FNAA 5CK4A 4M1WA 2AXNA 5K8TA 5IDVA 1QHHB 2WMNB 4LOAA 2RGEA 5LBIA 2ZJ8A 1EK0A 2VA8A 4L16A 4YONB 2BKUA 1S0UA 1Q1EA 1KMQA 2GCPA 2CL7X 2B92A 1JR6A 2GCOB 4QBFA 2EW1A 1R5OA 1ZC4A 2I3BA 4DDVA 2QY9A 4LV6A 5EP1A 3WMGA 3SYNA 3EIHA 2YC4C 2ZE7A 3OEHA 2KSQA 1GFIA 2BMEA 1AQYA 5EE0A 1D2MA 1TQ2A 2IYXA 5EJEA 2CVFA 3BIFA 1ONBA 2IXGA 1MO5A 3BH6A 4ZCIA 5JLJA 5DHFA 1FOEB 4DLSA 1YE8A 4GI7A 3SHFA 3ZIAA 3FFBA 4PPFA 5JHHB 2ZRBA 3LLMA 4ZDWA 4C2TA 3BB3A 2RGDA 2X2EA 5CDFE 3A6PC 1W47A 3REGA 1AS0A 4X8OA 1IJEA 2H92A 2BBSA 2JJ8A 2WWWA 3RHFA 3TR5A 3TSWA 4LK2A 3AF3A 3AP2A 3BFXA 4Q9KA 4DT1A 2R44A 4KHZA 1O3YA 1WF3A 3OEHD 4PHGA 5L8VA 2W2XA 1WA5A 1LV7A 1IY1A 3T1TA 4G5QA 1RZ3A 3LVQE 5TXGA 4WXPA 4R71A 3GP8A 5HKKA 2MMGA 1QF9A 2GJ8A 4RVCA 2GETA 1FPMA 1CJKC 4TL7A 1UDWA 1G9XA 2W00A 4MGZR 3AVWA 3E5HA 3LQRA 4XSGA 3ZIAD 3EZFA 2VSOA 4UJ3A 4XTCS 3RRMA 5FR1A 1YQTA 2ZREA 1R7RA 4OQMA 2ORVA 4YMTA 3IDQA 3PVSA 5K8UA 1N0WA 2V6JA 3S1AA 1UFQA 2DYKA 1FTSA 2ZJOA 4HAYA 3CPHA 2BHRA 2QMHA 4K81B 4Z54A 4JT4A 5F2EA 1LF5A 2D3WA 2OESA 2ZSEA 3E2IA 2ZYVX 3MWLA 1OLOA 4GL2A 2Z0MA 1CJMA 5HKKD 1Z0JA 4JLJA 3EG5A 2IS6A 4KLNA 2CJWB 4LUCA 4DDWA 2ONKA 5HPYB 3CR7A 1RJ9A 4P4UA 2IYSA 2DBYA 4HSEA 1NP6A 1WE2A 1VMAA 2CMKA 1SXJA 2HF8A 4KV9A 4MRSA 3HP1A 3SR0A 4C0LA 2ZS8A 5JSZA 4XWKA 4MH0R 5GJWC 4HATA 3EWSA 2F43A 3H1TA 3SZRA 1XB2A 3CRW1 3ZVLA 1P4SA 5DI3A 4BLOA 1DAKA 4GMDA 5D3MB 2FEOA 4ZO4A 3CKLA 1N3BA 3R9IA 3L82B 4EAQA 3WNBA 5DN6A 4DXAA 3CPJB 2OAP1 2QMOA 5ELXA 1X1SA 1AKEA 1T9HA 3TUIC 1OH7A 3A1UA 2CE2X 2WWXA 2ZRFA 4KAXA 2ODEA 4Q1BA 4E07A 1DG1G 3OE7A 4D25A 3UMSA 2R6GA 1DOAA 4Q03A 1SGWA 3GJ5A 1AIPA 4DSTA 2ZRJA 2RGXA 3K0AA 3B2EA 2P3SA 2NQ2C 3RWOA 4FMDB 2G88A 2ZI3A 4ILEA 1G8HA 4AY2A 3GLFE 2O8FB 2LWIA 4KU4A 4AK9A 4FCWA 5AUOB 1J8YF 1PLKA 4M22A 4F91B 2BBTA 2HV8A 2YVUA 3A4NA 3IILA 1QHNA 5IT5A 3AVUA 1FQKA 5H8WA 2WKPA 4XVUA 4C7OB 3MUFA 3BOSA 5DN6D 2AD5A 2Z4RA 4JVSB 1PLLA 4I81A 4OJKA 4BFXA 3ASZA 2PL3A 4W5JA 1AN0A 3NVAA 1CU1A 1G8GA 4AKGA 3B1ZA 2VSXA 4PO9A 1G291 2AD1A 2ODBA 3IKJA 4K46A 4RFVA 4TSFD 3R7WB 1E79A 2WSSD 1U99A 1M6NA 2W0SA 1X86B 1UF9A 1XP8A 2ZUDA 3K0FA 3V4FA 4DLTA 2PJZA 2A5YB 2YNMA 1GP2A 2B6HA 1E1QD 2R6FA 1KI6B 3IUYA 3NHAA 3U3JA 4BZQA 2ZRCA 2HYDA 2IX3A 2PMKA 3KKPA 3U3RA 3Q8XB 3AH8A 2REXB 4IOMA 4QRHA 1CULC 4TQAA 2F1JA 3TSZA 3OHMA 2X2FA 4KVGA 1QDEA 1XXHA 2ZRKA 1HY3A 1I4TD 2VSFA 4TMTA 1DPFA 2A2ZA 5DHAA 1XD2A 3W5IA 4RZ3A 3OESA 4V02A 2FFQA 1HT2E 2PJRA 1UKZA 2J3EA 4IXMA 1E3MA 1C1YA 3CWZA 2OXRA 3SI7A 1G8FA 2IA5A 4TMZA 3CX6A 4XJXA 3AVTA 3EZ2A 1R4AA 2W6ID 3L0IB 3CX7A 1P2SA 4PQYA 3SOPA 2D7CA 4NONA 3MJRA 1G7TA 1N0UA 1NJFA 1J7KA 3BFKA 4PC7A 3QVUA 1E2IA 4HAZA 3QSYA 1MV5A 1XEXB 3KXIA 4TTRA 2BBOA 1ZCAA 4JS0A 4NCJA 2O8DB 1Z0AA 2RGNC 3WP0A 3A36A 1WRBA 2ZU6A 1MO3A 2X19A 1JQLB 1Z0FA 2Z6VA 4D4JA 3IBYA 4YMSA 4TL6A 2WJGA 2IS1A 1KK1A 2WM9B 3D31A 1KDPA 2VP5A 3ZD7A 5FL7A 3U2QA 3OIVA 2GCNA 2A5DA 4G0NA 4OK6A 1SKYB 4DB4A 2LCFA 3QF4A 1OXXK 1VECA 2C5LA 3CB4A 3P32A 1B23P 3K09C 1EESA 3VKHA 2GTPA 5EUMA 3X2SA 2ATXA 3EWAA 4AYWA 4D4KA 1T3LA 2WZQA 1N6OA 3B60A 5FTLA 4A8JB 4F93B 4QJ3A 2DFLA 2G6BA 2BMJA 1R8QA 2YWFA 4ASUA 2CCKA 4WIAA 1T6NA 3IIKA 2ZS9A 4V03A 1QZXA 2IEYA 4I1VA 4BRUA 5FBLB 3IPYA 1KKMA 2NG1A 2ZRDA 4IW3B 4JBWA 5AJXA 2HJGA 5FL7D 3WYAA 2IS2A 5TB5A 2GZDA 4L9SA 1NVXQ 1Q22A 4TYQA 4ESHA 2H18A 2JDIA 2CNWA 4YMUA 1U2RA 1E9AA 5TARA 3C8UA 3KQHA 2QRNA 1TL7C 5JJIA 3NTUA 2UVQA 4PZLA 4C0JA 1LTQA 2FH5B 4OYHA 3VX3A 3CZQA 2FEMA 4RD0A 2XTMA 3I3SR 4WZAE 3W3AA 5J47A 2EFHB 3ECCA 1CS4C 4ASUD 4LBWA 4QM7A 2RGCA 3K9HA 1W4AA 3KX2A 5CYPA 4IJMA 1KSJA 1WQ1R 3EX7C 4KXFB 1I4DD 4QGAA 5FBVB 2JDID 2QP4A 4RY2A 2ZI9A 4JYBA 2CNWD 1Z22A 2ATVA 4P4TA 1BS1A 3R20A 3RNLA 3R8CA 1XRJA 4FWTA 1KI4A 4AYXA 4FN5A 2OXCA 3AP3A 4PR0A 1OE0A 4TYPA 4DT1B 4JLOA 1Z2CA 4TWZA 4DIEA 3ZS9A 2GHIA 4RZ2A 3AV0B 4P3YA 1XBTA 1DTSA 5DO9A 2KB0A 1R6BX 1S8FA 4E03A 2AXPA 3HU1A 1ESMA 1XPRA 5FI1B 3A1WA 3TQCA 5FTNA 1NJGA 5M04A 3SQXA 3IHWA 1F5NA 1VIAA 5DYGA 2FG5A 1DARA 5JRZA 1GSIA 3VR4A 2FFAA 3L43A 2GEUA 2H57A 4Z8YA 3S1AB 4M2LA 2FJUA 1Z6GA 2VF8A 3HJNA 1IN4A 4BLRA 2QT0A 4H1VA 4V0NA 3ZZTA 1WB9A 4A82A 3GLHE 3DEFA 3SQWA 2X8AA 2OAQ1 4LZZA 2BCGY 2C9CA 1NG1A 2XITA 4MRRA 2O0JA 4PAOA 4DC9A 1ZNZA 3NEYA 5JCZA 3U60B 4K8OA 4MKFA 1CJVC 1KI3A 2VLIA 3JVVA 1NN5A 1RJ9B 3DHWC 4IOLA 3I61A 3QBTA 3GLGA 3QJYA 2VYFA 3MFYA 4QGFA 5JSZB 4HLDA 3UXMA 3CNLA 2WWHA 3DMNA 1E0KA 2HUPA 3FYHA 5FH9A 2FZ4A 3U61B 5DI3B 1Z29A 1UEIA 3KDSE 4JKIA 1H8HA 5EP4A 1R0YA 2XXAA 4UNQA 1N25A 4Y0AA 3N2EA 1E0SA 1FMLA 3CIOA 3CBQA 2D74A 5L3QA 2VO1A 1NMYA 1KI8A 1VG9B 2VP0A 2IYWA 1JECA 1E2DA 3ZDQA 1XMVA 1GKIA 1FNNA 2BMFA 3B1XA 4JLKA 4ZV4A 3AF0A 1VCMA 2HDNB 4UNNA 5BWMA 1T5LA 1RFLA 2HYIC 3K0AB 1GTVA 4HAUA 3RC8A 2JLZA 4R7ZA 1OXTA 4LYAA 3VR3A 2ZRPA 2P6RA 3VAAA 2ERXA 2HCJB 3CWQA 3LD9A 1H8HD 4PHFA 4E09A 1YZTA 1NLFA 2JJ2D 5FOTA 4CT4B 2FZLA 2PZEA 4OHYA 1KO4A 2Q3FA 1BKDR 3LLUA 4NPHA 3QF7A 3CRMA 3QXJA 4EPXA 2J7KA 2ZRHA 3VKWA 3B1WA 4MDFA 4ZDKA 4F7WA 5CLQA 3BK7A 4IKEA 4RCZA 5CJPA 1RKBA 3NIBA 2ONJA 4KSBA 2I1VB 3U3OA 4C30A 4B3BA 1E32A 1P6XA 3K0FB 3HPQA 2QBYB 2A3RA 4BUJA 4Q7MB 1UEJA 4KCGA 3RYTC 3EARA 2B21A 3O8RA 1E2PA 1UBEA 4B2PA 2IXFA 3TW8B 1AS3A 1EFCA 4M53A 1PUIA 4MGYR 1NIJA 3RWMB 3FVQA 2GVDC 4YXWA 1TF2A 2G1JA 4FXPA 1XZPA 4HZUA 2KI5A 1OJLA 1OV4A 3ZQJA 1EX7A 5SZHB 1TX4B 4IDNA 4N1AA 1XXHB 4MQBA 5L3SA 4G5GA 1P2UA 2J0UA 3T34A 1DADA 1ZUIA 1KTVA 2GNOA 2P6UA 2IUTA 1BYUA 4URVR 4EPYA 2CLSA 1XD2B 3QKUA 4IVPA 4BE7B 5KNBA 1IM2A 2H8KA 5JFGA 4HUQA 1J8MF 1C4OA 3IIJA 3QXSA 2Q3HA 1MRNA 1VKJA 1ZM2A 4QJ5A 1HT1E 5FOVA 1IN7A 4EIWA 4AD8A 2QA5A 2JJ1A 1KK3A 1N2CE 1W5SA 3AQ4A 4Q7LA 4KFRA 4KO8A 1WP9A 1N6RA 1E2LA 1U8AA 1HUQA 2R2AA 4KBGA 4ACBA 3BS4A 1W5TA 2CK3A 2J9RA 3D6TB 4BZXA 5K8IA 2BMDA 5AUQA 2YC2C 4DEXA 5LDDC 5C1BA 3WP1B 8OHMA 2CJWA 1BOFA 1VG1A 1SVOA 2ZRGA 4POAA 4Q9LA 2J0QA 4AWXA 1E0AA 3AGQA 2A78A 3QIAA 3QF4B 3RC3A 1XTRA 4W5HA 3TLXA 3OEED 4GZMA 1KAGA 2C04A 2X1VA 4MYHA 3I8SA 1U9IC 1JJVA 1KI9A 3RVBA 1JXOA 2W6JA 2FX3A 1RRCA 2ZJ5A 4JJKA 3AVXA 4TLBA 1JJ7A 4XD7A 1R0XA 4B75A 5TV2A 1MO4A 2CK3D 1JQJC 3T12A 3OF5A 5J4YA 4WA7A 3FFAA 1MRSA 5FI0B 4Q18A 2QSYA 3G82C 1W36C 4MUBA 4PFSA 2R6CA 2IBMA 5FTKA 5FPSA 2REOA 1ZYUA 1G3IA 2WWYA 3B13B 1IN8A 1OB2A 1YR6A 1ZINA 3ZD6A 3B7GA 5JS8A 4QGGA 3KB1A 5GJCA 2PMDA 5TY0A 3U4QA 5KPDA 4LJ9A 3D7MA 4B2LA 1PJRA 3SYLA 3U7HB 3WMFA 1IY2A 4MYTA 4RD6A 2IXEA 4KFTA 3RS2A 1G5RA 4ZKDA 5FPKA 1T5IA 3QPUA 3IEVA 1YU9A 1G8YA 3GLIE 1OKKA 1QVRA 4CEHA 1IN6A 2HJVA 2QAGC 4URYR 3C7KA 2YINC 4KI0A 1AZSC 1P73A 2KWIA 2I4IA 4HB0A 3GMTA 2ZS7A 3KJGA 4QKQA 3Q5DA 2Z5FA 3FOZA 1UKVY 1J90A 1QG2A 1P9NA 1YZKA 3RS0A 2OFWA 3QG1A 3W9YA 3PEWA 1EFHA 1Q1BA 2BWJA 4MGIR 3V9PA 4ZKEA 4DHEA 5TVKA 1G21E 3C4JA 3SHWA 4D80A 4XH9B 1OKKD 1D6JA 4MITA 4LHWA 4GZLA 3SFZA 2BJVA 4BLQA 3KKNA 1NIPA 3W8NA 2VHJA 1M74A 3W90A 2V1XA 1IONA 2GXQA 4BZPA 4ITRC 1W49A 1Z5ZA 2XJ4A 3KFVA 2O0HA 3VR5A 1T3SA 5DYIA 3TQFA 4Q1FA 1Y63A 3KKOA 1ZD1A 4G5SA 4LY6A 1T8UA 4CEIB 4LHYA 1KK2A 3DKPA 4ZIRA 3RRYA 3SS8A 4PQFA 4B2IA 4CT5A 3NBYC 4LWZA 3C16C 2K5UA 4BQSA 5CLLA 4KODA 4EFLA 4NKRA 4YDSA 2GA8A 5EE9A 2E1RA 3UKDA 3AVYA 4PSAA 2QZ4A 3K9NA 3GLGB 4GBMA 4C0HA 5FOXA 1GKYA 1T0HB 1U94A 2PH1A 4PZZA 1NVUQ 3OFNA 2GJAA 4OI1A 5AR1A 1N6NA 3MWKA 3G5UA 3RS7A 2GAAA 3U7FB 2O8DA 2W83A 2QU8A 4URZR 3TUJC 4U5XA 4PSVA 5AUNB 3LBHA 2OBMA 2WJVA 1IOZA 2QORA 2DR3A 4X8HA 3U3KA 2XXAB 1BH2A 1A2KC 5F9HA 3QXCA 4Z8XA 2G0TA 2JAQA 1OFIA 5BYJA 2OCBA 5KSYA 2DFNA 2OBLA 5AJWA 2EFEB 4DLVA 1XX6A 1Z0DA 1TNDA 2NPFA 3RANA 2WBLC 2ZVQX 2QT1A 3UATA 1W36D 4O3MA 2P6NA 2UZ3A 1RE0A 3ONWA 1EXMA 4ARZB 3OIUA 3B9PA 4ZPXA 3VHLB 4W9MC 3RRZA 1DAEA 4QM6A 1QVAA 3SE0A 1OT3A 3MWYW 4Y0VA 4B43A 3GJ7A 3LBNA 3MJHA 1KDOA 1E9CA 4LC0A 2WKQA 2CHGA 2C96A 3BB4A 4M1MA 4B71A 2GEDA 1KI7A 3X1DA 1Z06A 3KQKA 1VYUA 1N5IA 3AKEA 5CK5A 2A9KA 3H0KA 1NF3A 3PV0A 2EQBA 3CR8A 1WBBA 2O8EA 4LJ5A 1JR3E 2IYTA 1GM5A 4Q7KA 2GK7A 4URUR 3KQUA 2RH5A 2WICA 1Q3HA 3GJ4A 2JLVA 4UNSA 3NH9A 3V4RA 1GNQA 4XSHA 4R98A 1AZTA 1W1WA 3VR6A 2C95A 1P60A 1XPOA 1RRFA 4S35A 2N1BA 3ZQ6A 1XZQA 4QFMA 3VU9A 4IFBA 4HZUB 4B33A 3ND8A 1CR2A 2RB4A 4Q9JA 5A4JA 5P21A 4JSYA 1W2HA 3T5GA 4EJSA 3A4MA 3LV8A 3BH0A 2BM1A 5L3SB 1TQ6A 2J0UB 4RJLA 2B7CA 3B9QA 1CRPA 1JXMA 1KSHA 3R8FA 1KJZA 2Z83A 4V0ME 1AJEA 1S3GA 2O0KA 1NLYA 2OBNA 4HUQB 4JVNA 1NBMA 3THXB 1L4UA 3ADBA 4Q1CA 1PZNA 4D26A 1GL9B 3WYGA 2AK2A 2HXSA 4XOIA 4BFVA 3I4LA 4O0MA 2DWOA 4PO8A 1MT0A 3HYTA 3A37A 5BN3A 4TYYA 3CONA 1XMJA 1KGDA 5EQTA 3CH4B 4TQUS 3QQ5A 4IDOA 4NH0A 3MD0A 4BFYA 2RHMA 2P0EA 3VHXA 4JZKA 5AJZA 1JPJA 4TT3A 4GSYA 1G8PA 1UBCA 3KL4A 2PBRA 1DEKA 1NBMD 3TIFA 4GMXA 4LHVA 2IYLD 4ZDIA 1AM4D 3CPEA 2IYYA 1S9DA 2GESA 3ETLA 5FBRB 3EW9A 3W6NA 3I5YA 2QE7A 4IXNA 5DISB 3K0CC 4DJTA 3QPWA 1E2JA 4YC7A 4M9SA 1VCNA 4OI4A 5JJLA 2AWNA 2WWIA 3GEEA 1DO2A 2V6IA 4MKIA 3EXAA 1E9RA 3OIYA 2WAXA 3KUDA 4OK3A 4TT3D 2CHQA 2FV8A 1Q0UA 2IK8A 4QNRA 2QQEA 3LW8A 5FBQB 5HR5A 3BC1A 3WHLA 2R6AA 2DHRA 1R10A 2AFHE 4C0AC 4OL0A 4JBYA 5B2ZA 1GAJA 2JATA 3I73A 4IOJA 1KDTA 2QE7D 4DLWA 2VP9A 1IBRA 3LRPA 2Q9AA 4M1OA 1K5GA 1YR9A 1HE8B 3T06B 2JA1A 1KO7A 4AG6A 2H5EA 4YDHB 2VHQA 2F1IA 4TSFA 2ZRNA 2XTNA 3DM5A 4Q4HA 4C4PA 2FDCA 1NKSA 4I1SA 4LJ7A 2WSSA 4Q1EA 2PEZA 1EFRA 3U4QB 1ZNWA 1OYYA 1QHSA 2NZJA 3D3QA 4PQRA 5C46F 2IYVA 1I2DA 2ZAOA 5C4GB 4IHQA 4BASA 1E9EA 1E1QA 2FSIA 3DDCA 3EPKA 1G7SA 1NL3A 1Q1QA 2ORIA 3NDPA 2BKEA 3M0EA 2V3CC 1ZU5A 4CEHB 1NVVR 1EFTA 3GJ8A 2W2VA 4BRWA 3VMFA 1T8TA 4RSGA 5KO2A 3H2YA 1U0JA 4OK5A 2F9MA 1DELA 4C9BA 4DSNA 1X1RA 4PAMA 3QXXA 1M7GA 2ZUBA 2V1UA 4OHXA 1LS1A 1YHNA 2FWRA 1EFRD 1VCOA 2J87A 2OCPA 2RGBA 3CF2A 4IEEA 4UXIA 4E22A 2WJJA 3FMPB 3TR0A 2QBYA 4DKXA 2O8CA 2ZE8A 3E1SA 3EA0A 2OZEA 2XB2A 421PA 2ZJBA 1XTIA 5FUXA 3PG5A 1CF4A 4ZI3A 1OW3B 2G83A 2W6IA 3K8YA 4OQFA 1BO6A 3O47A 4DDUA 2ANBA 2QL6A 1XMSA 2QGZA 4KVAA 5BN5A 3RLFA 2FMXA 4TL9A 2UZIR 3B6EA 1FX0A 1OH5A 1CEEA 3C5HA 2ZIAA 4B73A 1K8RA 2LKDA 2QSZA 1DE0A 1G3RA 4FW9A 3HYRA 3I32A 4NBSA 4W5WA 4DLUA 4ZIRB 2KJQA 2JLWA 4RD4A 3K0CA 3FE2A 2RKOA 2PZFA 1E99A 2W0MA 4FCTA 1A1VA 4OHVA 1P3JA 1YRBA 1ZC3A 2P2LA 5JI2E 2ZTSA 4GP6A 1A7JA 2ZSBA 1FQJA 4PC2A 2ODWA 3TVDA 3FHTA 1XJQA 2XAUA 4AC9A 3CM0A 1GNPA 1X3SA 4U7DA 2YOHA 3BH7A 1G7CA 4LSGA 2HXYA 1E2KA 4Q4JB 2Y8EA 4US0R 5KDLA 1W36B 1OPXA 1D8TA 2EYUA 1RRPA 1HURA 2IL1A 4JLNA 2FPMA 2CLCX 2QM8A 4OHWA 5LPNA 3CRRA 3AGPA 2FGKA 3PENA 4TZ0A 1DO0A 1CKEA 1E9FA 3MMPA 4KBFA 3G0HA 2FA9A 2QP3A 1KSGA 4X8LA 5J4HA 2ZRLA 3LAWA 3CF0A 3AUXA 2GKSA 5C18A 2CCJA 4QHTA 1N5KA 3NHBA 3IPXA 4HDOB 3H4MA 1P2TA 1XF9A 2BBWA 2GZAA 5EE1A 5GVRA 3EZ6A 4HDCA 4ERNA 2EVWX 2XNDA 2WPDA 2F9LA 5A0FA 2Q0HA 4QXAA 4G5RA 4D0GA 4V0LA 2BOVA 1XFAA 4QBIA 1HH4A 3PUYA 4Q21A 3L8ZA 1WMSA 3PUWA 2NO6A 3SFVA 3T1OA 3MAAC 3B85A 3P20A 1II9A 4JJZA 1XTKA 4LJAA 4BPBA 2O8EB 2P67A 1W7AA 5D3QA 3PIRA 4C0QC 2ZI6A 3ZVMA 5GVSA 5EUQB 3A1VA 4M1TA 3QG5A 3T1QA 1JPNA 1IAQA 2ZEJA 1OHHD 2XNDD 2WPDD 4B6FA 1ETUA 2ZR7A 3AVOA 2IHYA 1CLUA 3B78A 4UKDA 2JASA 3SC3A 2FPKA 3VU9B 4NU0A 4EKDA 4FMCB 4A9AA 3QUSA 3CNNA 1XMIA 4EJSB 1EWRA 4GDFA 3ICQB 4U00A 2IF0A 4MRPA 1VYVA 2V8OA 3CZPA 1YRAA 1CXZA 1NVVQ 1M1YE 2FN4A 2J59A 1E6CA 1CJUC 3THYA 1IXRC 1KZ7B 2D06A 2GBLC 2HLDA 2VL7A 2OEPA 5G41A 4OI2A 4BEBA 3AM1A 4WAUA 3TH5A 1LY1A 1W48A 2RGNA 4A2QA 4B3DA 4KITB 1DAGA 3O8CA 1VYTA 3HU3A 3IHLA 4LPSA 1II8A 2CDNA 1SHKA 4DZZA 3NEJA 2JIZA 5CYOA 4BLTA 2HT1A 4BFSA 4CEIA 5JBQA 3KTAA 3TRFA 4DIDA 2JLUA 1XPUA 1P2VA 2HLDD 4Q9IA 4FMCF 3K09A 2JLSA 3P27A 1OFTA 3UK6A 1ZM9A 1GNRA 4A0HA 4A0FA 3GFOA 1JBKA 5KSZA 2YWEA 2CCGA 3REFA 1IJFA 1SXJE 3KJHA 3NBZC 3W34A 2ZJYA 2JIZD 1RVDA 1G17A 2Q9BA 2R65A 4FIDA 1Z08A 3U3MA 2WKRA 3N70A 2GEVA 4TMWA 2PCLA 5JMTA 4A36A 1TPZA 2VP4A 1II0A 2MSDB 3F5FA 1BMFA 4DLYA 4ZI2A 2JJ2A 2F6RA 1TADA 3QXHA 2KBFA 1DVRA 4TQ9A 1XEWX 1NRJB 2IUUA 2O52A 1FZQA 3IIMA 3UG7A 3MGCA 1S1MA 1XWIA 2ZROA 4PSKA 2GXAA 4Q4HB 1COWA 1QHYA 4C3ZA 2PT7A 4TLAA 1Z3IX 1TEVA 4ARZA 1G5TA 2AK3A 1BMFD 5KSPA 4F4IA 3MSXA 1HE1C 1JALA 1ZM3A 3EASA 5FR2A 4WZBE 1U98A 4ZCMA 5J4LA 5G3YA 3U6BA 5HE9A 3TKLA 1W4BA 1D9XA 4JIMA 1G4UR 4NCIA 4Q4AA 5DSZA 4DRZA 1KDRA 4W7SA 4YMWA 4QOSA 4JLMA 4RZXA 4TTPA 4DCNA 1S96A 5KNDA 4US1R 1B0UA 5IK2A 1COWD 3WYFA 2QPOA 3FMIA 3TE6A 4G5OA 3HR8A 3QENA 1NG9A 1F2TB 3ND9A 2O8CB 1AGRA 3SJAA 1MKYA 3QOFA 1KNQA 4M9QA 3WBJA 1V5WA 3MWJA 1OF1A 2J1LA 4R2HA 1E0JA 1FNMA 1P72A 1G19A 2D2EA 1ZNXA 3VR2A 1NNEA 2ODNA 1GUAA 1PVOA 2WTUA 3ZJYA 1N6LA 3ZVNA 1KY3A 3LXXA 1JR3A 2YWHA 4TLDA 1YR8A 4NYMR 3C14C 3LQQA 5G53C 1U8YA 1DAHA 5IK2D 1L4YA 2Q9CA 3Q3JB 1FX0B 1IXSB 4LGMA 1YR7A 1JAHA 3LWNA 4Q5IA 1RW4A 4DCUA 1VIYA 2N42A 1T3HA 3AKYA 3THXA 3MLEA 1NMZA 1KY2A 5L3RA 1Z28A 3UPUA 5CDFA 3IEUA 4HYYA 3NWJA 4CEJA 2HCBA 4QL3A 1R2QA 2QPAA 3IO3A 3F0TA 3BWDD 1EWQA 1JR3D 3GEIA 1NY6A 3QI2A 2ZJAA 5UKDA 3PUZA 4EPVA 3OEEA 2OT3B 1N6PA 3Q72A 1EG7A 1HYQA 4QG7A 4V0MA 1Z63A 3DL0A 1IQPA 1CR0A 3QBVA 1AQUA 2WHXA 1KO8A 2DY1A 4Q4LA 3AVVA 2RGAA 4A2PA 1R5NA 2E87A 4DVGA 2FU5C 2NOAA 3I1FA 1N5LA 3THOA 2EFGA 2PZGA 2XX3A 1ZCBA 3D8BA 2QNRA 2NO0A 2D7DA 1ZVQA 1OH8A 4DBLC 1XTQA 4HI0E 2AN9A 2NIPA 3CW2A 5HTKA 1UBGA 4RCYA 1KHTA 2G9NA 1ZP6A 4P33A 5A5GA 3RS3A 2BC9A 3U6KA 5E3HA 3QPVA 4PC3A 2EWVA 4TYNA 2V55B 5EP2A 1TU4A 2IF2A 1E9SA 3T1VA 2VRWA 3VFDA 3FMOB 1GWNA 2H16A 2REBA 2VPPA 2EFDB 3KB2A 2IUSA 5LD2C 3OZXA 3GCGA 3DMDA 2C03A 4UXHA 4YQFA 3UIEA 1GKUB 4CW7A 1ZJ6A 2GWHA 4PPGA 821PA 1IHUA 4V0OA 4AKIA 1XJ0A 4N3NA 2FFHA 3SEAA 1W46A 2AKYA 5EE5B 1KI2A 1T91A 4NL4H 4IOKA 2J41A 1JEEA 3QEOA 1M2OB 3AUYA 1G1MA 1SVLA 5FFMA 2ANCA 1A5TA 5CIQA 5HZHA 2J0SA 4AYTA 3BD9A 4RD3A 3EAQA 2VH5R 3FTQA 4JVLA 4L15A 3PUXA 1WBDA 1P62B 3WRXC 1QBKC 1WXQA 4HLQB 2YYZA 4EDHA 221PA 4Z51A 1XEWY 3AKCA 3AP1A 3LFUA 3OAAD 4DLRA 4QHYA 2IYQA 1LF0A 3TW4A 4TN1A 4EPTA 2EYQA 1UKEA 4N0DA 3T35A 4IRUB 4GNKA 2WV9A 4TLCA 3GLFA 1P9RA 1G20E 3EPJA 1GVNB 3AF2A 4IDPA 4PZYA 3U44A 4X8MA 2JLXA 3AKDA 1FW6A 1Q57A 2ZI7A 4OQNA 3ADDA 2GZHA 5CIWA 5EXPA 3DM9B 3MCAA 4FMBB 3KKMA 2BEKA 3THYB 4A8JC 1SVIA 4ABYA 1CJTC 2OUKA 3ASYA 2KE5A 5FTJA 2IWHA 4LJ6A 2ZI5A 1TEXA 3GFPA 2YZ2A 4D82A 1G64A 3RDPA 1XU4A 2MMCA 3H84A 2AKAB 1U90A 2BVNA 3WHKA 1D9ZA 4KFUA 1UDXA 1N6IA 4JL5A 5B30A 3B1VA 1II8B 1W4CA 2V54A 2VP6A 4GOJA 5FL3A 4FI3C 5B57C 2LKCA 2QTVB 1F2UA 3KQNA 3BRWD 1GRRA 4LJYA 2HT6A 5FUWA 1LB1B 1R8SA 1H8ED 1ZM7A 3KTAB 1NN1A 2ZI4A 3SJBA 4G1UC 2YWGA 1P5ZB 2IT1A 2GDJA 1W0JA 4YLGA 1T0JB 3EC1A 1U9IA 3J81k 1C9KA 4FCVA 4B3XA 3W6PA 2FOLA 1XJCA 4B35A 2J45A 521PA 4URXR 4WZ6A 3GLGE 3EZ7A 1DBSA 3CLVA 1KI1A 2IC5A 4P31A 2OCYC 3NKVA 3M4YA 4Q4JA 2RGGA 3RRNA 2QAJA 1NN0A 3LW7A 1Q44A 2ZR9A 4DSOA 4H1UA 1G7RA 2EWWA 3FDIA 1Q20A 1DG3A 3EIEA 3X1WA 4TZ6A 1W0JD 4LX0A 5BN4A 1E2NA 5HZKA 5FTMA 4MYUA 1XD8A 2CVHA 4Q47A 2AHOA 1MH1A 1E69A 1G18A 1G3QA 3VR1A 2V7QA 4MKHA 4OQLA 1BYIA 4BFWA 4B3GA 2FGJA 1KMHA 3GEHA 1S9HA 5ANRB 5B58C 5C2JB 721PA 4MUAA 2E9SA 3CRQA 2OO7A 1GRQA 1SVWA 5KSOA 2C2HA 2BEJA 5CJ2A 1CR1A 1ODFA 1YVDA 4MA4A 4CZ2A 1LS6A 2QAGA 2H1LA 1TF7A 3IQXA 4FINA 4B32A 2YOGA 2C98A 3FKSD 3EPLA 2JLQA 4NZYA 2QG6A 2XGJA 4Q4AB 3KJIA 5SZJA 4AIIA 1EX6A 1K5DA 3NBXX 2V7QD 3B1YA 1KNXA 1PLJA 1QHGA 2ZE5A 4UXJA 1GZSA 1SXJC 4J0QA 3K70C 2ZITA 4JL6A 5KOYA 2VHTA 4CGZA 3PEYA 3SBEA 1Q12A 5G40A 3KQLA 2NPIA 1XEFA 1JB1A 2CL6X 2ZSDA 4L5BA 3ZGXA 2ZQ5A 4JMPA 2XZLA 3UMRA 3O8BA 4PHHA 1Q21A 3QKTA 4L4UA 3DOEA 5CB6A 2B8TA 4B48A 2IW3A 4I1OA 1E4YA 5EE3A 5AJYA 3M6AA 5KU1A 3HWSA 4M9ZA 2R9VA 3Q5EA 2OCAA 1KYIA 3L0SA 3EC2A 1N5JA 2L0XA 3EA5A 3GJ3A 1NKTA 4XVQA 2ZSFA 2WVJA 4DDTA 1KKLA 1RYFA 2G0NA 3JZAA 2CHVA 3Q7PA 4LHXA 1Z2AA 5FOUA 2ZM5A 1ZUHA 5GJBA 3QKRA 1M8PA 3W3ZB 1US8A 4RKEA 1TAGA 1OSNA 5CITA 4CEJB 2A30A 1FP6A 2NO1A 4AI6A 2PCJA 2WJIA 2F1HA 3CNOA 2NMVA 2VHUA 5L3VA 4IDQA 5B64A 1HQYE 1SHZA 2XOKA 4B76A 4KYIB 4MKGA 2A7QA 1GITA 1GIAA 1KOFA 3A1TA 3GJXC 2AR7A 3IBGA 5CM9C 5F9FA 1CRQA 4EPWA 5E4FA 1ZNYA 4ON9A 2OM2A 1L7VC 4II7A 4GOKA 3AF1A 1NMXA 1YJ5A 5AK0A 2R62A 1J99A 1P75A 3K0SA 4LCBA 4QJ4A 3CO5A 2WAYA 3WNDA 4DEYA 3K1JA 4PC1A 1DAIA 1GRNA 2XOKD 5CB8A 2VEDA 3GLHA 4GRAA 5JRJA 3C41J 3THWA 2WSMA 2PLRA 5FOSA 5H68A 3UWOA 4A6XA 2QROA 5JS7A 1Z6AA 3KXKA 4Q00A 3HDTA 4QHSA 2MSCB 4Q01A 4BFUA 3RS5A 2NZ8A 1UJ2A 2A5GA 1P61B 1ANKA 2H7VA 4HEJA 1S4QA 1Q1ZA 4HZIA 2IS4A 4NMMA 3TGPA 2ZPTX 5KPJA 4AKEA 4JKYA 2Z43A 2GF9A 4EPRA 4AURA 3F3YA 3CH5A 1TF5A 5JWOA 1Y3AA 3QY0A 5JWHA 2WJHA 5FPTA 1UM8A 4A4DA 1D2NA 2UKDA 3GD7A 1OXVA 2CXXA 3K0EA 1KZGB 5JZVA 4B6EA 1G4AE 4FD2A 2SHKA 3DKVA 5KUTA 4M0LA 4TMVA 3SDZA 5DIFA 2V9PA 4A2WA 2AL7A 4PAQA 2R8RA 1A2BA 2ZYWX 4O2RA 3ICEA 4JL8A 3EIQA 4DLZA 3Q9LA 3R9WA 3U7EB 1JAIA 1SXJD 5BW8A 3K70D 3VX4A 2QUZA 5KHOC 2DWPA 4NP6A 4NYIR 5H1YA 1QHXA 1UKYA 3GLFB 1HEIA 3SJCA 3CUEF 4MGKR 1FL9A 3U44B 1OIXA 2ASEA 4A0RA 3B8HA 3KUCA 5HE8A 4C0BA 1F2TA 2IWRA 1MOZA 1DS6A 4Q19A 1ELOA 1W44A 1EFUA 3PFIA 1KAOA 1E98A 1RRGA 1KK0A 5KDOA 4JYCA 4PX9A 1I2MA 3ZZUA 1KJWA 1X8JA 2Z4SA 1F60A 4DCVA 5F98A 4HDQB 3OE7D 5F3WB 4M4SA 5LB2A 1OIVA 3DZ8A 5E7IA 1XCMA 3TAHA 1J2JA 1T4GA 4Q02A 1OH6A 3LA6A 3QKSA 1A4RA 1YZLA 2BV3A 1OXSC 2A5JA 3KJEA 4UNPA
chains in the Genus database with same CATH superfamily
1FS4A 1KEEB 4B74A 4JAVC 1Y8RA 4UM5A 1T2AA 2H48A 2XKBA 1O9GA 1FFHA 1MABA 3NDRA 4TMXA 1TTTA 1IUKA 1B43A 4GDMA 3LX5A 3Q11A 1Z6XA 2BF4A 4HVAA 2E5WA 2OV2A 4W4TA 4FC6A 1HFEL 4X0EA 3VJMA 3FGNA 1FSSA 4NE2A 3MA0A 5FUYA 5J9FA 3KS9A 3MCTA 3PFFA 5E7JA 4DRXB 2CGEA 1ZD8A 1PK9A 1NW4A 3UUWA 1TA0A 4KR3A 2XHEA 2HNKA 3T3IA 2Z2ZA 4KK3A 4LC9A 3O91A 2X86A 4FMDF 4IUCS 2BHTA 1E79D 2HRCA 4GOXA 5EWJA 3L6EA 4RA9A 1KIMA 3OPYI 3PE4A 2GX6A 1NXTA 1R8JA 1U5BB 3UO8B 1ZW6A 3IHKA 2ZU0C 2JCSA 4XIGS 1JAYA 1LVHA 4MNTA 5J2UF 1JIVA 5BURA 4LYJA 3HXKA 1TT5B 4M98A 5G0WA 3E27A 4PHTA 3TQOA 4XVRA 1UK6A 3OSZA 2G77B 1F8YA 1GOTA 2W8BA 4WACA 3DE4X 2VBGA 1COZA 5EIWA 4DSUA 4ER3A 2O7SA 4N3AA 4BLVA 1O2DA 1Z37A 4DNFA 1RTTA 1FVFA 3PWTA 4PG4A 4MQUA 2XAAA 4ZZ0A 2O2ZA 3H6GA 1UBNA 1VJ1A 1YBVA 2OTCA 3L1HA 4YP5A 1VM6A 2XGGA 5F35A 3UMJA 4DNPA 1U3TA 1SKYE 3FA2A 3NYWA 2FWMX 5F2NA 3IULA 1HYEA 3RV3A 2XJ9A 4F2WA 4MA5A 1N4AA 5KYKA 3IAS1 1LTKA 5DNAA 1VTKA 2QI9C 3I0MA 4P58A 2E1PA 4CVNA 1RIFA 2FX5A 2V7GA 3W5JA 3KPJA 3BJIC 3INTA 3L2OB 3MNFA 3HCWA 1X7WA 4D43A 4NZ9A 5HXAA 1NQTA 1R0RE 4Q9HA 4P7BA 3TIIA 2BFDB 4N7MA 1NVFA 2DSNA 4WT7A 4EUSA 5CXUA 4DUZB 4YJ2A 2GHQA 3FCEA 1PL7A 1M0WA 4TXLA 4QZVA 1JH8A 4BY9E 4C04A 2CNDA 3K94A 1H2EA 4LZLA 3V1UA 4CQNA 1B8PA 2HMSA 1U0OC 2Z9BA 2F59A 4KN5A 4GC5A 5LP6C 4BUCA 1HQKA 4D4LA 4JI7B 4D4MA 4J8PA 1PUJA 3EZYA 5H7XA 5JD6A 1H9CA 6YASA 4TUYB 2VWHA 3HJTA 4HB4A 2QN7A 4YBRA 1WMBA 2ZPUA 3DD5A 1O87A 1RM0A 3QFRA 3PVZA 4R8RA 3LDAA 1BDHA 2OFXA 2P2GA 1X8XA 2X77A 2PVPA 4BAZA 1LZLA 3K6RA 3RG2A 1OFHA 3ZWYA 2XR1A 5DZSA 2NTEA 4IDHA 6LDHA 3I9JA 1U81A 3C5CA 3A8TA 1T6YA 3OWHA 3P2JA 4U02A 5K4AA 4AY6A 3OCUA 1Q2XA 1WO8A 4V0KA 5C4MA 1N2SA 2I1QA 1T5TA 3VI3B 5CT8A 1KJJA 1XU9A 3T4PA 3BA1A 3CF4G 4Y9UA 4ZOAA 4AMYA 2ZAIA 1R5JA 3L0DA 4IDDA 5EQJB 4A2CA 3PJEA 2UDPA 4KQMA 2X7XA 4Q15A 1SCUB 1Y3FE 1CP2A 5C5EA 1RPZA 4C7BA 2YWCA 3GLIA 1VHJA 1W5FA 2I5PO 2NZ2A 3MOIA 3QKRB 4FYXA 1E66A 4R2IA 5D3KA 5DGDA 5K0TA 1SQ5A 1YL5A 1P3DA 4IQGA 4EW2A 3ND5A 3Q40A 4HAXA 4HNTA 2C2GA 1U3WA 3D2BA 5IAOA 1FMCA 1IAVA 1SKQA 3UK0A 1EDBA 2G9ZA 2A1IA 2DPXA 4LJ8A 3BJEA 4Y2RA 3UHJA 1JEDA 2BFPA 1B3RA 5I3CA 1AQNA 1FFDA 4TM8A 4CQMD 2IPXA 4MVJP 3NMUF 4ND8B 4AZSA 5L40A 5EEHA 3HFRA 4JLAA 4CMIB 1XQ9A 2O5VA 4Z7QB 1Z8FA 3ZHOA 2ADMA 1OVGA 1L8QA 1GPMA 2A0XA 3OC6A 2CVOA 2IYOA 4N9QA 4RH3A 1WNTA 1UP7A 2ECQA 4FWIB 1UZUA 3BXXA 3FWYA 3LVRE 4PNZA 1V25A 1UPUA 2XKKA 4E5NA 1O5OA 1AS2A 4IIGA 4BIMA 2ZJ7A 3PEUA 4MP8A 2VJDA 4XZ3A 5BNIA 4DADA 4I1RA 4Q48A 4D99A 4XEHA 2JFVA 4HDNB 3TQQA 6Q21A 2C99A 5B12A 1DAFA 2HIMA 3TBKA 2D1TA 3FNFA 5JS2A 3MB5A 5KOIA 2QXTA 3B82A 5IN4A 2YXDA 3MFQA 3OPQA 4Z2AA 3K9LA 3L06A 3RS4A 3THWB 4KW7A 1JTVA 5CDTA 2Q3CA 3EC7A 3JZMA 2IHVA 4D2IA 1SQSA 1M2KA 3P0RA 4JC0A 4PSUA 3A0UA 5E95A 4D46A 5EZ6B 5JI3E 3INNA 3OX2A 4O2AB 4IG9A 1N6HA 4JGGA 2HPHA 5B1IA 3HA3A 5TNXA 2QRUA 4ENTA 3KOOA 5JEEA 2RAPA 4HOYA 4BYMA 4RESA 1ZRHA 2WTEA 2CBZA 3DVLA 4KFCA 1BCSA 1U0LA 4G9EA 2J67A 3FRIA 1X1CA 3UAGA 1YL7A 2X0NA 3WQRA 1U63A 1ZOLA 2VAPA 4XWAA 3ZW9A 1ZITA 2H2WA 1MMFB 1ZISA 2VT3A 4EO9A 3HJRA 3K70B 2FPGA 4MIYA 3RSZA 3GD5A 2BFBB 3QHPA 3LCMA 5DLQC 1M7HA 9LDTA 1CF9A 2H2IA 2FUEA 3RIEA 4QXRA 4PXAA 1F12A 1HSOA 1TVCA 2VJPA 3L6DA 1INLA 2Q21A 4PAWA 1CRLA 2PGDA 4BQOA 3KCNA 4B34A 1LVGA 1ISRA 3S6JA 3DZDA 4PZAA 1ZAKA 4FB5A 5I5EA 5ALHA 1HG0A 3BAFA 4RNDB 5JCPA 2V7PA 4H4DA 2ZRIA 4MW9A 4RW0A 2C1ZA 4ZHSA 4FZ3A 4JB2A 1W87A 2ZTVA 5AI6A 1O6ZA 8MHTA 4INPA 2XMQA 5HF5A 4HB2A 1TUEA 4B3GA 3ELBA 4DV0B 4TMKA 2VHEA 3KZ1E 3Q9SA 4FW8A 1EGMB 1WBJB 2BEWB 1T2NA 2QPTA 3AERA 3MYRA 4HC4A 4XYMA 4B47A 2FHSA 4MO9A 2QXUA 3RAGA 4DLXA 4RO0A 4XLZA 4Y2PA 3AG5A 2ERYA 3CN9A 4XQCA 1CUHA 5F3RA 1MQ8B 1QB8A 3G8YA 4IH1A 5AH0A 3KVOA 3U4CA 2GBLA 1QGUB 4B3RB 1K6MA 2OD7A 3OQ1A 1QSGA 4Z4CA 4LC1A 1QONA 5CVCA 3FB4A 2H4ZA 3WFZA 4CYMA 4TYWA 1P4JA 4YRMA 3CG0A 4PANA 4WZZA 1CUAA 5K8LA 4AG5A 3SEFA 3ILXA 3T5BA 3CX8A 3MIZA 1U4NA 2BM0A 5J2TB 5JU6A 4EI8A 4KQXA 2P4QA 5CA1A 5ICCA 2D2FA 3BGIA 1OAAA 2VDNB 3DOOA 3WGNA 1E2MA 3EWNA 4ZCPA 3EPHA 3P4YA 1R8XA 1USVA 1BQ4A 1W88A 2QMUA 3AFMA 3WLKX 2C42A 5IJ0A 2OZKA 5I3ZA 2FPLA 4HRVA 1NUHA 4KAAA 4D3DA 1XXHE 3GPLA 2R97A 1KKUA 1G16A 2O20A 1DJQA 3BDAA 3EBLA 4EVQA 1H5NA 3TUZC 1NSYA 1NRWA 4U3JB 3V00A 3AFHA 1QZTA 1RBQA 4LY0A 4X00A 3LY7A 3H75A 3LIIA 4AQYB 5HM6A 1N2HA 1WAMA 1JNYA 2NU6B 4IGIA 4XTRA 4EQ6B 4PCUA 5G3ZA 3TL2A 3HUTA 3MZ0A 4RIIA 5JTUA 3TKAA 2UYYA 2JCYA 3LH5A 3PXEA 4LBZA 1RWQA 2GGSA 2IDZA 2PBZA 2PH3A 2W2KB 1VJ0A 1M1NA 1B1CA 1S4MA 1LWOA 3WK4A 3WLSA 2PBFA 1WB5A 2RG1A 1ZRSA 3H2GA 2Y0DA 5FLYA 1NYRA 5E8JA 1TJ4A 3NYQA 1MAVA 1M2GA 1PQYA 2B98A 2EWMA 3Q0EA 3L7AA 3PNPA 4AZVA 2XT9A 4GMGA 3BBPA 2W58A 5FHRA 3SAJA 4P3KA 1QDUA 2A5FA 1DFHA 2Z2KA 5J2TF 2HDHA 1ZIPA 3GLSA 3HVHA 3T5AA 4NEQA 4WL0A 5DRYA 5TMBA 1N36B 1E1RA 2GD6A 4O33A 3UKOA 4D0RA 3LF1A 1ZN8A 3U7GA 5HZGA 2UXCB 2ZKIA 3AVPA 4ZK6A 3HR4A 3CE9A 2HWKA 4K1LA 1K0UA 4TRMA 2QU7A 1FU7A 4LAFA 4ALNA 1QIKA 4ALMA 5JECA 4OHBA 2F3SA 4GXQA 5EPOA 1PZMA 4XB2A 4K8RB 1PJCA 1VI2A 4EDFA 3UWKA 2I99A 1C9JA 1XQVA 3O2SB 5AJVB 5FX2A 2QUBA 1YIAA 5KTSA 2R5NA 1XTSA 4ZN6A 5CYGA 4PPYA 4LBVA 3WLIA 4HAWA 3T1HB 5JNUA 2OC9A 5LSAA 4MMYB 1E1DA 1DBWA 2XLBA 1TMOA 2AI1A 1JV2B 1KVQA 1XQ6A 1Y33E 3EQ7A 3PHIA 2CLFB 4JWTA 4BWFB 1CQJA 3AJ9A 2G40A 3UPTA 2RC5A 2GXUA 1HFWA 2YHIA 3IUNA 4GFDA 4MLDA 1DIAA 3KZMA 4LV8B 2APJA 1QQ5A 1DPGA 5AVKA 4C1NA 3AEZA 4ACAA 5KNCA 1CNEA 4G89A 5BOSA 4P53A 1NI5A 5SZKB 3NDIA 1KRWA 3LYLA 4B4DA 2W2OA 2ZRAA 3F2IA 4OSPA 2DFKB 1CUEA 4DCGA 1XTJA 3DV2A 5IX8A 1FSZA 3J7AC 2WJYA 3I8XA 2CLDX 2DUWA 2KQUA 4UEOA 1MPTA 5A3JA 4KR6A 3NXSA 2N9UA 1M54A 3MXTA 4JI2B 1FRFS 4UVHA 3LUFA 2GRJA 4R1PA 3TLKA 1JFFA 3N5CA 1X6VA 4UULA 4LWPA 4NYJQ 4JEIA 2B3TA 4MEAA 4XGQA 5TS3A 3ISVA 5C7YA 5FWYB 1M83A 1X80A 1ZONA 2W71A 1PG0A 3WTBA 3UB2A 2X0DA 4E2XA 5L3ZA 1AA9A 1T3TA 3ITEA 5LWQA 1Q6ZA 5K03A 1W0KD 2RMKA 4HB3A 4CQMB 2WA1A 4MYCA 3RI3A 1EVYA 1VG8A 4GECA 4UFNA 3Q3EA 3AM4A 4EMTA 1M8GA 4H08A 3PEVA 4XD7D 2RONA 1X8LA 5AW6A 5BUQA 4Q4DA 1OASA 2UVPA 3GVXA 4A7PA 4EYSA 2WYUA 3IE1A 3O3NB 2O8FA 1JKMA 2O2IA 5FTWA 4RZHA 2R8EA 1RABA 1E2HA 1RHKA 4PYNA 3CLSD 4AKHA 1E18A 1LLFA 2ZRMA 5ECGC 3SG0A 2X40A 4W9NA 2ZWMA 2XHZA 3DE3X 3UJ8A 1VHTA 4M1SA 4Q6BA 4WBSA 1Y5RA 3GDFA 1RQLA 4LYHA 3A58B 3CUKA 2QVBA 2G1KA 2UUPA 3EH2A 4MMZB 4D3XA 1UP4A 2FN9A 3R7WA 5JH7F 4WD3A 3NU1A 5L6LB 5GADl 2VJNA 2Z1MA 3CLKA 2QE6A 1T0UA 4QLOA 4E1BA 4M1YA 4CKEB 2NU9B 5TQJA 1U6KA 4JLDA 3A32A 1NI4B 3H5LA 3NX4A 5CAEB 2VRCA 1LW6E 2W2TA 3ZXYA 4ICIA 2P79A 2DFTA 3OKFA 3QZUA 4JENA 3TZQA 4A1FA 3GFSA 2GJKA 2XUHA 5JD4A 2X3UA 4PQEA 2C88A 1DDIA 4URWR 5EKUA 1CZOA 3Q85A 5CTAA 5AI8A 5IEBA 2JJMA 4WK2B 2JFXA 5D6NA 3UUGA 2B36A 3OZGA 2ZZNA 2WIAA 4KSCA 1WCV1 5A04A 3G9ZA 3SE7A 3ZD8A 1VGQA 2FMIA 4NCAA 2BR3A 3CRZA 1Y1RA 4H6WA 4K7JA 3AU9A 4DLAA 3BSYA 1Z2PX 4JHXA 4B81A 4XDHA 3RADC 1Z6QA 3VPCA 1UOQA 4ZMBA 4JDUA 3J81A 1CUVA 3EVCA 2R1TA 5J4VA 1Q83A 1E4OA 1YAHA 1XTZA 5EKSA 3LQFA 3GRFA 3VPSA 4C4YA 1JSCA 1MIOB 2JBAB 1B00A 1JRLA 1USIA 4I50B 1AN9A 3NORA 1PFWA 1GG2A 1XEXA 1Y1TA 3VTAA 3DQPA 4PE5B 4R41A 1IH8A 1U6JA 2BW0A 3H9UA 3TVTA 3WYEA 3WRXA 3ZC3A 3W9SA 5AVUA 1A9RA 2GNPA 4BVGA 4OGGA 4Q3LA 4RA6A 3LPAA 4JI4B 2QN1A 4OQXA 4YRJA 2C94A 4DVJA 1ABBA 2VTKA 3DQZA 1ZU4A 2JFBA 2YUIA 1Y4AE 5WRFA 2PUAA 1JLLA 2UXDB 3GI1A 4LXQA 4QBGB 1BU8A 1QP8A 2DPLA 3C6YA 3KXLA 4D74A 1Y3HA 4YRDA 5IC6A 3T9CA 3PX3A 4B3TB 1KJYA 2QGNA 2ZE6A 3IBSA 1Z83A 2Q62A 2R96A 5HQ3A 3QM1A 2E55A 5AKJA 3HA2A 1YZUA 5AWFC 1MF7A 2QP9X 3S2YA 1KPIA 2O3RA 4FEGA 1A9OA 3QKWA 1TC1A 4RTJA 3BXZA 2IZZA 3AR8A 3I3OA 9GPBA 1C0EA 2V5UA 3LY8A 4JJEA 2HZBA 3M6VA 5KQLA 3OMLA 1HQCA 5ICFA 2FNAA 4Y2JA 4DWWA 3ZIDA 2AXNA 1QX4A 2WPNA 3AHCA 1QHHB 3CUTA 4P35A 3G2JA 1E5DA 4G9BA 1E60A 4OATA 3EWIA 4PG6A 2XQJA 2ISQA 4I50F 5FFFA 3R7DA 2ZUWA 4CN9A 1EBFA 2NW6A 2ROQA 2BKUA 3RODA 3FN4A 4N7JA 5I47A 1KH2A 4YAWA 3M3HA 2CL7X 4HN9A 1JR6A 3WL8A 2YJNA 1GPH1 1JPUA 2M1ZA 4PHCA 4D5EA 2B5WA 4LV6A 1NVAA 1MCZA 2I6TA 4WY8A 3EIHA 5I7RA 2YC4C 4O8ZA 4K88A 1GFIA 5BW4A 3F5MA 3PPYA 1DUIA 2OOSA 2QM0A 2YXNA 3KVYA 2CVFA 3LPCA 4AZ3A 2CMHA 4WXHA 2NUTA 3IODA 4XD2A 1ZH6A 5HOEA 2PAAA 3GPIA 3H99A 3VYRB 4DMUB 4ZVVA 4DLSA 1NF8A 1QK3A 1U7XA 1QANA 3EUAA 3JWGA 2IPLA 4GI7A 3SHFA 3WE7A 3LLMA 1TCAA 3BB3A 3JV7A 1CEXA 2X2EA 3GEMA 4OREX 2PGLA 1X1EA 3H4IA 4PSCA 3GRAA 1SHLA 4JQZA 4ZODA 1BGXT 2DFPA 3ZDQA 1AS0A 2V7UA 4Z5XA 4YHHB 1VJCA 2H92A 2ZOSA 2BBSA 3AEUA 1T6ZA 2JJ8A 3L8CA 3IPCA 4G1MB 4PVCA 3RU7A 3RTAA 3BFXA 4Q9KA 4LYYA 2AG0A 1GYQA 2R44A 3GDOA 3OEHD 1R6UA 3G9TA 1NUTA 3VPGA 1W59A 4Y2QA 1LV7A 4PLWA 1M6VB 1U8EA 3PQFA 1EWVA 1LV8A 2E0IA 1MJGA 2Y67A 2HF2A 2IZ1A 3LVQE 5EHIA 4EB0A 4R40A 5JFTA 1A9ZA 2MMGA 3HJHA 1QIGA 2GETA 1CJKC 1G9XA 1NMSA 1MENA 3E5HA 1VA5A 3LQRA 2WVGA 3ZIAD 3RRMA 4XTCS 4EJ6A 1ZIDA 1YQTA 2ZREA 1GEEA 3JQFC 4JK3A 5ALSA 4J7CA 4UZEA 4O3FA 3I0ZA 4BJHB 3PPIA 3I58A 3KU4A 2V6JA 4L7VA 2DYKA 2ZJOA 1FTSA 3ME5A 5B2EA 2QMHA 1OZFA 4K81B 3PPXA 3O8QA 4XPIA 4J0IA 2YWJA 1LF5A 1MVLA 1GR1A 1KPGA 2WVAA 2ZSEA 2ZYVX 2PZLA 3MWLA 1OLOA 2FDCA 3VH1A 5FWXB 4M87A 4KR9A 3OZTA 2ONKA 4ILKA 3GJQA 3ZWWA 3ZJ4A 3CBGA 3WXBA 5JAIA 3H6HA 3HKBA 1RJ9A 1Z2DA 2RCYA 2IYSA 4P4UA 5I8WA 3M6IA 4HSEA 1IE3A 1L5FA 1S5PA 3R6GA 3TMYA 4B83A 5CFNA 3TTXA 2CMKA 1SXJA 3R9XB 3UCEA 5KJ6A 3JWHA 5JSZA 2FSVA 4MH0R 2JGMA 5GJWC 1ICIA 3DB2A 4O2BF 3SIWA 3TL3A 3W04A 4BNXA 2X1MA 3A9SA 4QPPA 4JZYA 3QFCA 2P5YA 1GQOA 5DI3A 3GUYA 4BLOA 4A0QA 4DZRA 2O2CA 4QTUB 3H83A 2NZXA 2X2PA 3OPXA 4ZO4A 1KMMA 5FULA 2Y93A 5LZ9A 2N75A 2QIPA 1WP4A 2QRGA 3H3JA 5FO0A 4KAFA 3T7KA 1O96B 4TV8B 3SJ7A 1SUAA 4FZJA 3H9JA 3DVAA 4G0ZA 5DMHA 1I3CA 3AIIA 3DAOA 1T9HA 2I9PA 3PFBA 3A1UA 1OH7A 5JSQA 1JDBC 2WWXA 2ODEA 2RHTA 3E7PA 1F7UA 2XNJA 2PUEA 4KLCA 5GTDA 4D25A 2O3SA 4H0FA 3ROXA 1O54A 1C7EA 1OILA 2H9YA 2V0NA 3K0AA 1CY2A 2RGXA 1PQPA 3B2EA 3ZZMA 2P3SA 3EQ8A 3K72B 3RWOA 4ILEA 3OX4A 1Z88A 5TF0A 1W6RA 5K0EA 4F12A 3ZDCA 2J6HA 4F91B 4FCWA 4UQPA 5E9JA 1PLKA 4HL6A 4DM4A 2Z2IA 2BBTA 3QMVA 1P45A 4YV7A 1QKIA 5ENZA 1XK7A 1EXWA 3DP7A 1E8MA 9LDBA 5IT5A 3AVUA 4C7OB 1Y9JA 1M76A 5I8ZA 3TOSA 3RO7A 3PFCA 3K71B 3QWFA 4P3PA 1PLLA 4QFCA 4R68A 5LOVA 1YBAA 1NXQA 3ASZA 4LXXA 3A1DA 4IQ0A 3DDSA 4FFBB 4S1NA 3OD1A 1EUCA 1WIWA 2FK7A 4B6JA 3RJ5A 1H0SA 1KAHA 1Y3CE 2EL7A 1JWAB 1I5EA 2EZUA 1P1HA 5C7OO 3ZY2A 2VCHA 2JGFA 2ZUDA 1XP8A 3K0FA 4KPYA 5FJJA 1BVUA 5KTKA 1UK8A 3MGKA 4LE0A 2CZCA 3W1EA 4WK6A 1GP2A 1GQYA 3KWMA 4W9RA 1WULS 3NHAA 2ZRCA 2V74B 2ZTLA 3AB7A 3CEJA 3IXLA 3JQEA 4NSNA 1GL3A 3Q8XB 3CC8A 4QRHA 1CULC 3Q9UA 5A0VA 1DWOA 2QIOA 2ZWOA 3UJDA 2H51A 3P9SA 4L6IA 4ZMSA 1T1EA 2ZB7A 4H1TA 4FKZA 2BFEB 4LDNA 4EL5A 5H9WA 3RBZA 4BMDA 4ZGWA 1HY3A 1R1DA 4GSKA 4ZOLB 1TIBA 2RGWA 2A2ZA 2VDUE 4RH0A 1RKUA 4EHBA 3W5IA 1I30A 1KS9A 1XKQA 3LZDA 4P2BA 3DL2A 4J1SA 4V02A 5FADA 9MHTA 4N5IX 3DEHA 4UPEA 1T1GA 1LDEA 2VYND 5LXTB 1QIMA 5IXYA 3CWZA 5AI9A 2FX2A 1G8FA 4TMZA 1XAGA 3AVTA 1DEHA 1R4AA 3KELA 1NF2A 4ZAVA 1P2SA 3C74A 2EW2A 4KQIA 4PQYA 4YPFA 1QPZA 3RSGA 3GC6A 3NM5A 2CT8A 3PD1A 5DDIP 4HAZA 5LKAA 4IGKA 4RTRA 1MV5A 3CXUA 3IP1A 4KE7A 4TTRA 3E5NA 3EFOA 1YNOA 4Q7QA 4G81A 4LFAB 1Z0AA 2PU7A 3MSCA 1BRTA 2HA2A 3HWRA 1DJPA 5ESWA 1JQLB 1Z0FA 5DWDA 1V8OA 4YRLA 3DQQA 2YMMA 2GRAA 1MDBA 2WJGA 3ED1A 1ILWA 1UJCA 2FPOA 3N59A 3VHRA 1LBIA 4M8SA 5T8KC 5FL7A 4IZOA 3WWEA 3OIVA 4ARSA 2GCNA 4G0NA 2CLEB 4KGZA 3F98A 3EFBA 4KN9S 3VU8A 5JASA 3SSMA 4B6OA 5DX8A 4ZOLF 1J8DA 1O77A 1FS6A 2IPMA 1VLMA 4FOPA 2YW2A 4QJBA 3LGAA 4R3UC 2ZBGA 1T3LA 3NUQA 1N6OA 2ZZKA 3BUSA 1UXKA 2FR8C 3T7EA 4A8JB 3ZWBA 2ZUSA 1FFCA 4CMEC 1ORDA 3SX4A 3IIKA 2EJCA 2CVPA 2RHJA 2ZS9A 4I1VA 4U5QA 3F46A 4ME6A 5FBLB 1E89A 3H5NA 1TTQB 1EJ0A 2AEJA 5LYJA 1CNMA 3S1LA 2NG1A 2V59A 2Z3ZA 3O4IA 4LOIA 5AK6A 2PSSA 2SECE 2FZ5A 1Q16A 3OG9A 3T4UA 4M1ZA 3HUFA 1OU4A 2I4RA 2ZWPA 3W6UA 3JPWA 2E5FA 2CNWA 4RORA 4NS4A 3V7WA 3C8UA 4CDNA 3EA4A 3NIWA 3G2PA 3A10A 3KEGA 2Y1CA 2FRXA 4C0JA 3VX3A 4RD0A 4J2TA 2RD2A 3FZEA 1H1DA 4LOHA 3OPNA 4RTPA 4G0WA 3OEYA 1JIQA 4CG2A 1AVTA 2EFHB 2G1AA 1CS4C 3ECCA 4JEHA 3KP1A 4UVIA 1E2BA 3F7OA 1YE3A 3K9HA 1E61A 2Q2OA 3RAEC 1RT9A 5CA0A 2HXGA 2I7XA 4POOA 4RKWA 4KXFB 4QGAA 1WXGA 1YRWA 2JDID 4X6LA 2VKQA 3HRHA 4P4TA 4JU9A 4GLLA 4WE3A 2BTOA 4F85A 1BWQA 1UFOA 4FFRA 4IFTA 2PR2A 2BF7A 1AOXA 1TIKA 1PSDA 2JW5A 3AP3A 4DT1B 1OE0A 4TYPA 1SPXA 4O2BB 1Z7EA 3O8OB 3V1LA 4CCSA 3G17A 2XNCA 3ZS9A 2GHIA 3CMMA 1AK1A 4HV4A 3AV0B 4P3YA 1JDTA 5REQB 2KB0A 1QHEA 3IOCA 3C3MA 4YP9A 3VGPA 1B16A 3K1YA 2AXPA 3HU1A 4Y7CA 3OECA 4NECA 5FI1B 3TTWA 2WEKA 1OLUA 3KLMX 3MELA 1NWHA 2GEJA 2OKGA 3R0ZA 4LXGA 3IR6A 4LOLA 4PLCA 1U3FA 3TOVA 5GOZA 4EI2A 2HB6A 1CUFA 2ZBQA 3IQFA 4XR9A 5EMKA 3HNOA 1XZGA 2P27A 1KA9H 2BZ1A 3DR3A 3T7RA 5AKKA 1JA1A 1P9LA 2FFAA 2HPAA 4RHTA 3L43A 3STXA 3VR4A 2H57A 1B93A 2ZWIA 1IFXA 1RXSA 3HJNA 4M2LA 3HCDA 1LNSA 4H3SA 3BMXA 1N33B 2NV2B 3WVNA 1T6XA 2IOYA 4HWKA 4RPGA 2WJAA 2Y3IA 4HDSB 2OAQ1 1L5LA 3RYIB 4F1KA 2C9CA 2ADOA 2OUIA 1QGED 1AV7A 2WHPA 4XVCA 2DJIA 3MC1A 1PNTA 3HFSA 4K8OA 4QBTA 3KTFA 1SPBS 2VLIA 3RAJA 4UOZA 4ESEA 3ZY5A 1K6XA 3NATA 2G7ZA 3CKKA 4LKOA 1C8VB 3REFA 5LP6A 3QPDA 1YCDA 3IUJA 3DKIA 3E61A 2CLIB 1A50B 4FEYA 5K7SA 3QJYA 2VYFA 3C8HA 4JBNA 3CNHA 2IQ5A 5ALTA 3HEBA 3DMNA 1E0KA 2BLLA 3FYHA 2YXLA 4W8HA 5FH9A 3G2OA 3MW8A 1OFUA 3QPBA 3DT9A 2FZ4A 2G67A 5I4BA 4V24A 2EC5A 4FLEA 1RS0A 3QE2A 2CXOA 4JYPA 3V7FA 2B4RO 5EP4A 4DKJA 1MU0A 4UAGA 4G1BA 4Y0AA 1AD2A 3N2EA 5KS2A 5ALNA 1Y3BE 3CIOA 1IEVA 3KBBA 1O6BA 3RUIA 1Z7YA 2QZJA 3QU2A 2IYWA 2XIJA 2XCIA 2PFSA 3S2ZA 4ZV4A 1FNNA 5LZ7A 3UT6A 3AF0A 1VCMA 3JSXA 2XQFA 3ZCXA 3EPPA 4MTCA 4AAYA 1D0VA 3N2GA 2YY7A 1LLQA 2ZQYA 1F3LA 1YNSA 2CUTA 4Q9AA 4IWXA 4LYAA 3FR8A 4KPFC 2I55A 4BDTA 1CW2B 4C4XA 2ERXA 2E18A 3CWQA 2AQHA 1UWKA 1XDGA 1XJ5A 3HBAA 4WFIA 3DMRA 4I4TB 4EY8A 3RYCB 2FZLA 5ADUS 4M46A 2PZEA 3E4CA 1GUFA 5ITZA 1KO4A 1KYQA 1ZJWA 2Q3FA 2VF4X 2F1OA 1TT7A 1K1EA 5CPBA 4IH4A 3QF7A 3AI1A 1UZMA 1TM2A 3OOEA 1FUYB 4FKMA 4QODA 1MVOA 2JGKA 2HX1A 2Z08A 1YVRA 2ZBUA 3AI2A 3ETJA 4MDFA 4CUZA 3B6IA 1HDZA 2PGOA 3BK7A 4IKEA 3Q2OA 3IKTA 5DNEA 1XF1A 2VS1A 3NIBA 4YALA 2P35A 4CKBB 1H4QA 5KNDH 1IQUA 1E32A 3VR3D 3HPQA 3GVPA 4BNHA 4OKNA 1KTIA 4LF9B 2WF7A 4NBNA 4MAAA 4B2PA 1E1NA 1G9TA 1WUIS 1Y6RA 2IXFA 3TW8B 2WUVA 1EFCA 1MEEA 1TI7A 2F8LA 3LS2A 1C9EA 3LPDA 4MGYR 1AZWA 3RWMB 1T0IA 2FN7A 3OJOA 2BGUA 4GZ6A 3UGQA 1ZL0A 5G0UA 3OT1A 1XCJA 3Q1LA 5BV2P 1O5TA 1Z8HA 4IJKA 2X23A 1HRKA 2EHDA 2VPTA 3MOGA 1HE5A 4RM3A 5DT2A 3GFFA 4IDNA 5BSVA 1Y5NA 3C5EA 3UBMA 3T7SA 2G04A 2XVAA 1KE2A 3PYXA 3IBCA 1P2UA 3CV3A 3H3FA 3T3MB 1E1KA 1Z0UA 3BWYA 5TPWB 3TL6A 1BYUA 1YMUA 4QQKA 2CLSA 2X9VA 5CG1A 1IM2A 3O4HA 2J9ZB 1BMQA 1DRUA 2CFTA 3ENVA 3RF6A 1J8MF 1HBJA 4C14A 1QZ3A 3DWGA 2I0FA 4DQKA 4MKZA 3HM2A 5HG0A 2H0AA 1AB6A 1FBTA 5K8VA 3CB2A 4QJ5A 2FEXA 2BI7A 1WDWB 2OCXA 2VSNA 4AD8A 2I54A 5DSXA 1TZMA 4HUJA 3UWMA 2FWBA 1JJIA 4XAQA 4W82A 1N2CE 2O2HA 2Y4NA 3A25A 4Z53A 4KFRA 4HTFB 3Q9NA 2HA5A 2OGZA 4AJOA 1QFZA 4S12A 2FLVA 4E94A 3DZBA 2E49A 3EIWA 1HUQA 1JLKA 1NW7A 2F4VB 3BS4A 1YCGA 4PLGA 4BQFA 1XHLA 2G1PA 2J9RA 3AUUA 3EXG1 5EMMA 4GR5A 7MDHA 2NUBA 1PTKA 1VL1A 3L8HA 4Y1RB 5K8IA 2BMDA 1HDCA 3CSSA 2Q1UA 4LDPA 1VKRA 1VG1A 2YL2A 3JYPA 3O7WA 4FGZA 4ND2A 4OQZA 4UHHA 4ZVSA 1Z0SA 3T3NA 3W77A 1PJTA 3NUZA 3RC3A 4XFJA 4QLBA 3K6SA 4IDFA 3TLXA 4GZMA 4LZNA 4RTSA 4CCWA 1U9IC 4HAIA 2EP7A 4MDHA 1T8PA 4N6OA 4PTZA 4JJKA 1PK7A 2MYTA 1E3JA 3O94A 1R0XA 3AVXA 2VDWA 5E9WA 1MO4A 4WGFA 5KB3A 4BQPA 2JIMA 1JQJC 4PFJA 3T12A 4DC1A 1F7VA 2EJTA 2KX7A 4JUAA 4XASA 4DMGA 2HL6A 1W36C 4MUBA 3GFGA 1SOUA 3K2EA 1RXYA 4L76A 1H05A 2RI0A 5FPSA 1W85B 1T29A 1JZQA 3R0XA 5E9AA 3GFVA 1G3IA 4HDKA 1WPRA 1LJ8A 1O5IA 3B13B 5ADHA 3LCJA 2CB0A 3W5SA 1ZW1A 1OB2A 2A14A 4ZGBA 1ZINA 3H1GA 1BDBA 2VR1A 3ZD6A 1QC5B 4ZQGA 4XGNA 2QR3A 5TY0A 4MQ6A 2GB4A 3U4QA 1NKVA 3HUEA 5KPDA 3D7MA 4DQLA 2QRQA 3M89A 2AOUB 2V6BA 1S89A 3WR5A 1TM7E 1IY2A 1QHFA 2IYEA 4MYTA 4EHIA 2IXEA 1UEXC 3RS2A 4N48A 5KYWB 4GM1A 4DW8A 3GLIE 2C82A 3T0IA 1HSZA 2ZDQA 3ZHCA 1H2HA 1J1IA 4LRTB 5KKAA 5FWDA 1FLAA 3OWXA 1I51A 1G20B 1PE0A 2FWJA 1H2ZA 1DV2A 4IHJB 4KI0A 4P7GA 3CLTD 4M0DA 3DG9A 2WFMA 4QKQA 1GTG1 2C2WA 2Z5FA 1J1UA 1NP7A 4FR0A 3OE1A 3AZPA 4RVSA 1KWGA 3PKIA 4D45A 3L93A 2PWBA 5AVSA 3GDGA 3QG1A 4J9VA 4X91A 1EFHA 2BWJA 4MGIR 5AJTA 4FFSA 3ZW7A 3LT1A 1L4MA 4J7XA 4BTVA 4DHEA 1UMBB 3PE6A 1LUAA 3U4AA 5JTTA 5L95A 4UW9A 4XH9B 1T8RA 4IDGA 4GX2A 2BAGA 3OCVA 1D6JA 4IXTA 4GLJA 4LHWA 3F9RA 2B20A 2JFWA 5LJIA 5FBZA 2VHJA 1M74A 4JI8B 1U2QA 1PL0A 1SCQA 3DC2A 3TJMA 4BZPA 1TCBA 3IAUA 1W49A 3WL6A 1U1DA 1KJ9A 4ZAXA 1RI1A 1Y4ZA 3TQFA 4PGAA 3UWSA 5F77A 4ENUA 5B5SA 5GM1A 4C7MA 3KKOA 1ZD1A 2Y6UA 1NBIA 5HA5A 3O74A 3VVBA 2EFYA 4P86A 5FEMA 1CETA 1MN6A 1LLUA 1WSDA 4MAFA 3FUVA 4ZIRA 1WUYA 3RRYA 3ZI4A 4B2IA 4PQFA 2QDKA 5FLXA 4EGJA 4R0NA 4OBXA 1BWSA 3E3AA 1ADGA 2A9PA 3LA8A 2BZGA 3IKVA 4FYMA 3UT5B 1HNWB 3RT7A 4YRSA 4KODA 2A57A 4B4UA 2A9FA 3TIXB 3PR2B 1WL8A 3UKDA 5HKBA 5T5QA 5LNK6 5ICEA 2DULA 2X5XA 4HX9A 3IDZA 3D4IA 4PZZA 4TN5A 5AR1A 4C4OA 2C2KA 3GB9A 1AK9A 2W83A 1V1RA 2QU8A 3L4JA 1C9DB 1QVZA 3ONEA 1IIBA 1ADCA 1QO0A 5JZSA 2CZQA 3QUCA 1BN6A 2Q5OA 3EOAI 2I2AA 3OZEA 2PN1A 3LBHA 4PSVA 2OBMA 1GCOA 2W6MA 4WUVA 4CN8A 1V2HE 4X8HA 2A88A 2XE4A 3U3KA 4AULA 2J5QA 1A2KC 1QIIA 2YBEA 2XA9A 3FOCA 2VDVE 3JQAB 3IE0A 5L3VA 1T0PA 3QXCA 1L5ZA 2G0TA 5I7OA 2ZIXB 3IXMA 3TTTA 1ZQ9A 1X92A 2MU1A 2AFVA 5KSYA 2DFNA 3PYLA 3VO8A 1HETA 2OBLA 1XP5A 3GQVA 5JNLA 1FFSA 1MNAA 1CZNA 3NWEA 3R76A 3ZLTA 4QOGA 1JIXA 1QDLB 3H9BA 3OOJA 5EN4A 4P4LA 4YLYA 1TNDA 3IKLA 3P9YA 4J2OA 1XFDA 4OQPA 1JUDA 3ZPXA 1IQ0A 1GO2A 2GFHA 2ZVQX 3LUKA 4U39A 3UATA 3SQDA 3WZMA 4QDKA 1MTOA 3ZY3A 3I2KA 1NYLA 2OD2A 4ZPXA 3EE6A 5B7GA 2IEBA 5KINB 3U7FB 1NVTA 3RRZA 2QN3A 4BV8A 1GG9A 5DHQA 2XCUA 1W19A 3RTCA 3SE0A 1MB2A 2V3WA 1K66A 1DKPA 3NONA 2VYCA 1C7JA 4J76A 4R8MA 4B43A 2G72A 2WM8A 3LFHA 3JTMA 3IMCA 3TG2A 2C96A 2J6IA 3PIDA 4M1MA 4R1QA 5DK4A 1KI7A 3KQKA 1U7WA 1VYUA 1JDJA 3AKEA 3DBLB 4L6AA 2A9KA 5KOHA 3PV0A 5CX1B 3IAHA 3USZA 4LJ5A