3A1WA

Crystal structue of the g domain of t. maritima feob iron iransporter
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
159
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 47
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1wA00
2A9KA 1A7JA 5E3HA 5A5GA 3GLFA 3CUEF 2YOFA 1CKEA 3K0FB 5LBIA 4GOKA 3VR6A 4DBLC 1CF4A 1IY2A 3A1WA 1CJKC 4LJ6A 3EPHA 1W0JD 3EX7C 2EFEB 1E69A 1HUQA 1HT1E 2PLFA 3GLGA 2RCNA 2W6JA 2IUSA 4EAQA 4QKQA 5JI2E 1HE1C 4JVLA 3PEVA 5L3SB 1VHTA 2LWIA 2G0TA 1KI6B 1P5ZB 1ZD1A 3W6NA 3WHLA 2FDCA 3G82C 3JVUA 3ZH9B 3CPJB 1BH2A 1OIWA 1Q20A 2PEZA 3QE0A 5BQ5A 3H0KA 2AR7A 4PHHA 2QUZA 2J0UA 4BRWA 3SJBA 3GLGB 2GAAA 4I4LA 4AG6A 1S0UA 3MUFA 3DOFA 5E4FA 2QTVB 4RSGA 4BLQA 2NG1A 1ZNWA 4V03A 4Q9KA 4DKXA 1T0JB 3DZDA 2IS1A 5C46F 2ZI4A 2REOA 2VP4A 3ADBA 1EWQA 2EVWX 2HXSA 5CDFE 2V6IA 1VECA 2B7CA 2WHXA 4EPYA 3U4QA 3SFZA 4B48A 4BFTA 621PA 1KI3A 4YONB 2KJQA 1Z28A 4JKYA 3BOSA 1E2EA 1E79D 4PR0A 5GJBA 2CE7A 3FMIA 3N2EA 3QF7A 1V5WA 1XP8A 3AVVA 1E9DA 2HT6A 1E1QA 2F1RA 3L0OA 2HJVA 3KUDA 4F4IA 2W6JD 5CIQA 1E2HA 1IXZA 2OCAA 2YZ2A 4O25A 2JJ8A 5E7IA 4NL4H 3O8DA 2C2HA 4N0EA 4TTQA 4US1R 3B7GA 1UKZA 2NZ8A 2O8FA 2JDID 3NDBB 1G4AE 1IXRC 1W4CA 1E98A 3F0TA 3QXJA 3RAPR 5H68A 4TLDA 1Q0UA 2ATXA 4KSCA 3K70B 2JLYA 1D9XA 3QEJA 4OHZA 4NP6A 1G20E 3W5IA 3AVXA 1S1CA 1D6JA 1NG1A 4M1WA 5FPTA 2VSOA 4V0OA 4L8GA 1Q1EA 5DLQC 1II0A 5DI9A 3OEEA 2BCGY 1FNNA 2VRWA 3Q3JB 5B30A 4ZPXA 4MGKR 1JECA 2RH5A 1G5TA 4RD6A 4UNSA 1WE2A 1XWIA 2HF8A 4RVCA 4S35A 1TUIA 1RYHA 3VAAA 4JLMA 3CLVA 3BWDD 2F1IA 2XOKD 2R6GA 1ZM2A 3MJHA 4Q9HA 2AHOA 1ZUHA 1T91A 1TQDA 3SYLA 5AJZA 1E4VA 1G5RA 3U3JA 3EIEA 5KU1A 3BE4A 3I72A 4XD7D 2FF7A 3BFKA 1KNQA 1RJ9A 4I81A 1D9ZA 3AKYA 1KMHB 3LD9A 2Q9CA 2OEPA 2VSXA 1Z29A 1E9CA 1D2EA 4OL0A 2J0UB 4CRWB 1CR2A 2XEXA 2IS4A 2VBCA 4ACBA 4B44A 2JLVA 4ZIRB 2B92A 1S8FA 3NVAA 2D62A 1ZD8A 4DUGD 3CNNA 1Z6GA 1E1RD 2QMHA 1JPJA 3DDCA 4UQOA 3RRZA 3NEYA 2CK3D 2WTUA 1VCNA 1ZYUA 2Q3MA 3BH7A 1ONBA 2RHMA 2F3TA 3EPKA 1Z07A 2C8VA 2AKAB 4JKIA 1UEJA 2W0MA 1ZM7A 4H1VA 1PLKA 1QHHB 1R7RA 5EZ5A 3D7MA 2UKDA 5M04A 1YZTA 1GZSA 1S1MA 2J0QA 3P4YA 1TF5A 1E9RA 1ODFA 3PUZA 1CR1A 4HUQB 5DSZA 5AUOB 3TAUA 4C7OA 1KTVA 4GL2A 4KI0A 4TSFD 1E2IA 1DVRA 2R8RA 2ZRDA 5AJWA 2ZE8A 3RLFA 2BM1A 1XJCA 4OK3A 5FTJA 3SQWA 1NG9A 4XVRA 4DRZA 3FGNA 1W7AA 1NMYA 1E9FA 4B6EA 1AGRA 5JBQA 2DCUA 2G77B 5LD2B 5AR1A 2ZRLA 1M74A 4BECA 1VG0B 2AFIE 4ASUA 1VHLA 2UZIR 2IHBA 2IYVA 2MMGA 4UNPA 5G53C 1NIPA 1SVLA 1X1RA 2JJ2A 1YZUA 3ZIAA 1XD2B 1XD8A 2DR3A 3GLIB 3MWLA 1CR0A 3U61B 2NO9A 4B2LA 3QPVA 1XRJA 3BB1A 4TL7A 4GMXA 1G7RA 4Q9LA 4DT1A 1UAAA 3B1XA 3P32A 2OM2A 2QEQA 2YC4C 4AURA 2EYUA 1KNXA 5DI3B 3CPHA 4MKHA 3Q7PA 3NBXX 221PA 1HQCA 1SVSA 1GSIA 3L8YA 3CNLA 3VHXA 3LFUA 4URYR 2Q0HA 3TSWA 2IA5A 4F38A 4KU4A 5E7JA 5HKKA 5DHFA 1YZNA 3RC8A 3NH9A 3SU8A 1U99A 1RC8A 3W5JA 5H70A 5DI3A 3X2SA 3FFBA 4GSYA 4LPSA 4B6FA 3LQQA 3FKSA 1XEWX 5KOYA 2OAQ1 2VP0A 1OHHD 4G1UC 5DN6A 4Q4JB 1YJ5A 1VCIA 4FCTA 2ZM5A 4W7SA 4IVPA 1KK0A 4YMTA 2C77A 3PENA 3TSZA 3VQTA 4ARZA 2WSSD 2ZAOA 1E2MA 3WNCA 2OCBA 3QPWA 5LB4A 1Z83A 2O0HA 4BZQA 4L4UA 4GT1A 2DBYA 4MYUA 2H17A 2D3WA 2GK7A 4QGGA 5D3MB 5KNCA 4WOPA 5FR1A 3LA6A 1CEEA 1ZBDA 4A9AA 4Q7KA 4EPVA 2QAJA 4E5UA 5E7MA 3SFVA 3A4NA 3A58B 1D5CA 4PQRA 5JHHB 1HH4A 3ETLA 1ZM4A 3B1YA 2VQSA 2ODWA 1E4YA 3PFIA 3UMRA 1NKSA 1A1VA 3VU9B 2ANCA 2JLWA 5L3VA 2YYZA 4XJXA 3QOFA 1TEXA 1FMJA 2FV8A 3H86A 3KQUA 3AP2A 3K0EA 4BFWA 3K09A 1N6LA 2Y8EA 2WVJA 4GOXA 5G41A 2ZUDA 2A5FA 2IYZA 1OE0A 3GJ5A 3EA0A 3K9HA 3WBKA 5KHOC 1JI0A 3AF2A 1US8A 1ANKA 4PSKA 2D7DA 2XSZA 4M22A 1IN4A 1GG2A 1E96A 4KFUA 3I92A 4D80A 2IK8A 2GZHA 2ZJ5A 1N5IA 2P3SA 2KBFA 2F9LA 4NCKA 3GLIA 4LWZA 4HAVA 2GKSA 5CYOA 3TIFA 5CIWA 2FG5A 2R65A 1IJEA 2ODEA 1P72A 4TMVA 3Q85A 3E70C 1MOZA 3ZZUA 4H1UA 4JYCA 2CL7X 4PQYA 4BZXA 4JYBA 3PXGA 2XB2A 1W2GA 1XCGB 5GVRA 1Q3HA 2GVDC 2QAGC 2ATVA 4FW9A 4LCBA 3AKDA 1N6NA 4TN1A 4LHXA 1TQ6A 4CYMA 4XTRA 3VX4A 3THOA 1J8MF 5AUQA 1DADA 5JSZB 3B1ZA 1OHHA 1S3SA 1E2FA 2J5XA 5L3QA 2RGCA 5CK5A 3KQNA 4IVQA 3CZQA 4HLDA 1RFLA 1I4LD 2LCFA 4RFVA 4GDFA 1L4YA 1MRNA 2FE4A 4FMCF 2OCPA 1DAEA 4EFMA 3GEHA 1NN5A 3EZ9A 1IAQA 2JLQA 4IXMA 4DEXA 1OFIA 4B32A 1Z2CA 4YC7A 4DZZA 4D2IA 4JMPA 3CNOA 3LAWA 2C99A 4M9ZA 3GCGA 4C2UA 2JLZA 4K81B 5BW8A 4P4SA 4HZUB 4CT4B 5FI1B 2JIZD 5D3MA 4MYTA 2FSIA 1W5SA 2YV5A 3AVWA 1U2RA 4Q4AB 1EFTA 3W3ZB 4R71A 4IFEA 1KI8A 1P6XA 2RGGA 2VA8A 4GRAA 2CL0X 3H84A 2ZRCA 1DOAA 3EASA 4TQAA 1GUAA 1Z08A 1LV7A 2G1KA 2IEYA 5FOXA 3ZIAD 1Z0FA 2FH5B 4JL5A 1XXHA 2GILA 3PIRA 2HYDA 3QUSA 1EG7A 5BN5A 3QXXA 4B71A 1MO6A 4RKFA 3BH0A 1NJGA 4L9WA 3BD9A 3QKSB 1TF2A 3VU9A 3SYKA 3GLGE 5JFGA 3FWYA 2FGJA 3PG5A 3SE0A 4YMVA 3C15C 3AP1A 1N5KA 3DHWC 3T06B 2ZRKA 2BV3A 2WWFA 1Z6XA 4N0DA 4Q1BA 1DO2A 1JAHA 1G291 4DDWA 2Z0MA 2FA9A 3FE2A 1BYUA 1MT0A 4LJ8A 1FW6A 4X8MA 1R10A 4NH0A 3LLUA 1G1MA 5FUVA 4AC9A 4POAA 1SXJD 2OHFA 3U3RA 4QC2A 4QL3A 2XTNA 1ZVQA 2GJ8A 3DMNA 2ZS8A 4KODA 4M1MA 2Q3FA 1Z6YA 4CEHB 4P0TA 4QGHA 1DE0A 1OYWA 2WJGA 3CRVA 3DL0A 2IC5A 4FN5A 2DFTA 2G1JA 2X77A 3UMFA 1DAHA 4AYXA 4NTZA 2WKPA 2VF8A 3EZ2A 1FTSA 3UPUA 1OH5A 3RDPA 4FCWA 3OF5A 4URZR 5P21A 4IHQA 2C03A 1TX4B 4C0BA 1NSFA 2QPOA 1OH6A 2GZAA 3R20A 1QDEA 1R8SA 2XX3A 5EE3A 4DDUA 4YQFA 4D4KA 1GNQA 4QJ4A 2RGAA 2OZEA 3KFXA 3RS5A 1J70A 1N6OA 2FN4A 1ZW6A 4JLVA 4QNMA 3SI7A 4Q03A 4ON9A 5L3QB 3O8BA 3SBDA 2JJ2D 3ZGXA 2WWIA 4L9SA 4RFSA 5EE1A 4UKDA 5AWFC 4JL8A 4D0NA 2VL7A 3K70D 2C98A 1LNZA 4LOAA 1ZU4A 2N42A 3FYHA 3UIEA 1NBMA 1TU4A 1GL7A 3ZVMA 2V7QA 4Q00A 1I4DD 3ZVLA 1IONA 4UJ5A 3B1WA 2YWGA 5BYKA 1ZNZA 1AJEA 3KZ1E 3NKVA 4BEJA 1P7CA 3WRXC 3NC1C 1KAGA 2KI5A 2ERXA 3THWA 4KO8A 3ASZA 4LHZA 2ZE7A 5DO9A 1E3MA 5DISB 4QJ3A 3GD7A 3Q8XB 4PO9A 4C0QC 3HU3A 2ZI6A 1JEDA 2ODNA 4B3CA 2QI9C 2HEIA 2PT7A 4B76A 3SOPA 2P0EA 4LV5B 5F9HA 3SJAA 1QHGA 1R5BA 3ND8A 5LDDC 5EXPA 3THWB 1Z0KA 2J0SA 3ICEA 4ABYA 3TLXA 1R0YA 2GCOB 5EP4A 2AXPA 3EW9A 2ASEA 3U3MA 4HB3A 1E1RA 1FUUA 2GZDA 2NO0A 4LV6A 4D0LB 3C5CA 2EFCB 2PMDA 4IRUB 3TQFA 4GPTA 1AIPA 5FPKA 3K0AA 3QY0A 1W1WA 2YVUA 1U8AA 3MD0A 4JS0A 2VEDA 3DPUA 4WBSA 5EXXA 5K8LA 2FPLA 4CIDA 3C41J 3LDAA 4WZ6A 3WXMA 3MRSA 5HR5A 1C9KA 3B60A 2ZJZA 3SHFA 1KY3A 1XCMA 3BBPA 3EWAA 4C0AC 5BN4A 3NC0C 2P6RA 1IN6A 1NLFA 3SQXA 2V4ZA 4R9UC 2JGNA 2NQ2C 1G7TA 3N70A 2GXAA 2RAPA 3LXRA 2FOLA 3IUYA 1G6HA 3HU2A 5FOUA 3QI2A 2WJVA 4WW0A 3WP0A 4AY2A 5FUWA 1OXXK 2J7PD 1II8B 3P26A 5JWRA 1XTQA 1GL9B 5B2ZA 1XJQA 3H4MA 3CWZA 3CRW1 4TWZA 1DAIA 4E03A 2IF0A 3OEED 2GWHA 1IOZA 1UF9A 2FU5C 3KJGA 4PX9A 3EC2A 5HTKA 4LC1A 4KITB 4TYWA 2G83A 2DPXA 2QPAA 1JNYA 3GPLA 1HTWA 1Z0IA 5JLJA 1OFHA 2OV2A 5JRJA 5HPYB 1ZRHA 2BDTA 4RFSB 5JZVA 4Q66C 1U90A 2IYQA 3WNBA 4BASA 1D8TA 4B73A 2WV9A 4A0RA 2EQBA 3O8CA 3WYAA 4AG5A 1A2KC 1D2MA 4JSTA 4Z51A 1U9IC 4TMKA 1BO6A 4MH0R 4YXWD 4LYAA 4A15A 1KOFA 2P65A 2EYQA 5J5CA 4CVNA 2C96A 3P27A 2W0SA 3UATA 2BBOA 3GFOA 4M1KA 2R6CA 4KV9A 2ZYUX 3RNLA 3SHWA 1OH7A 3RANA 1EFUA 4TYPA 3AVUA 1VPLA 1XU4A 1Z0DA 1GRQA 2DB3A 3VHLB 5AJXA 4AIIA 2OAP1 4NDZA 1CRPA 2WSSA 1K5DA 2ZRFA 2GJ9A 2PH1A 1O3YA 2WKRA 1W49A 4CW7A 2FNAA 2ZS9A 4PQFA 1VIYA 1Z6TA 2A78A 2WPDA 3THYB 1UDWA 1F48A 1E2JA 5C4GB 1S2MA 1W36D 2V6JA 3VNVA 3T5GA 3WRYC 2Q9BA 1EFRA 3NDPA 5CYPA 1R0WA 1JXOA 2A30A 2QGNA 4LUCA 4Y0VA 3WY9A 2IYRA 2EW1A 5BN3A 4EQ6B 3U6BA 1UKYA 1OFUX 3AB3A 3D8BA 2ZRIA 1SHZA 3GFPA 2PEYA 1BYIA 2ZU0C 3EZFA 3LW8A 1S3GA 1OV4A 5CJ2A 1KZGB 1KDRA 3G0HA 4KFRA 1MO5A 1KMHA 2CXXA 3QBTA 3QF4A 5SZHB 1BIFA 4OI4A 3ADCA 3HYRA 1YKSA 3OAAA 4Q21A 3S1AA 3L0PA 4LRWA 3ZDQA 1JBKA 4C7OB 3U4QB 1IQPA 4IEEA 4B47A 2ECKA 2CLCX 1ZU5A 3EA5A 1AZSC 2HXYA 3KB1A 1B0UA 4LBWA 4Q7LA 2R6AA 2RGBA 2WSMA 4QHSA 3R7WA 3SN6A 1OB5A 2GXQA 4PZYA 2ZJ8A 3IQWA 5CITA 3FHTA 2G9NA 3LH5A 2X1VA 1KO8A 1QHHA 4OBEA 3R7WB 1TUEA 2ANBA 5BWMA 5DNYB 4IJMA 5SZJA 3B85A 1GWNA 1ZD9A 1XD2A 4NYIQ 2WOOA 4IDOA 3CRMA 5JI3E 1E99A 4QBFA 2RKOA 4KYUA 2NPIA 4C0SA 2WWGA 4Z1MA 3I8SA 2ZRGA 3EWSA 1GAJA 4JLNA 3GJXC 2OBMA 3H1TA 2ZSEA 3VNUA 3OE7D 1G17A 4Y0AA 3KJHA 4HATA 2NO7A 3KKPA 1YRAA 1EGAA 2R9VA 3U2QA 3U7EB 2AL7A 4M9QA 3KJIA 2DY1A 3U44B 3V4FA 3A8TA 2FSFA 3QKUA 1G4UR 2ORVA 4ITRC 2YOHA 3LBHA 1TU3A 4DJTA 4WZBE 5EZ6B 2IL1A 1XCPA 2WWWA 1QHNA 3QSYA 2ODBA 4LYJA 5UKDA 2ZUBA 2ZXUA 1KI1A 3A4LA 1ZUNB 4JLDA 3A36A 1QRAA 1MH1A 3J81k 4AKGA 1R8QA 1W47A 4A0GA 1T3SA 3SZRA 3EPLA 3QBVA 1J7KA 5FOVA 3PCRB 1RRGA 3LBNA 4Q7JB 3K0CC 2IX3A 4NZYA 2E1RA 2OT3B 3BFVA 5L8VA 2FGKA 3IHLA 2WPDD 2F55A 5JECA 2BIFA 2XITA 3V9PA 1NBME 4ZIRA 3VFDA 4M1SA 4DHEA 3KUCA 1VG8A 2PLRA 2WJYA 1AZTA 4LBVA 4NYJQ 2J7PA 2ZR7A 1KI7A 1NRJB 1HEIA 3BXZA 2GEVA 2GESA 2B21A 3CF6R 3DEFA 4MRPA 1GNPA 1Y63A 1IN7A 2ZANA 2DFKB 1ZM3A 3MWYW 2HYIC 3I8XA 4P33A 5TDHA 1T8TA 1H8ED 5B64A 2GBLC 1M7BA 2ZI3A 3L2OB 1W0KD 2R6FA 2O8CA 1KJZA 3OIVA 3IO3A 5LD2C 1GL6A 2BJVA 3V00A 3NXSA 3OIWA 3OEHA 2YHSA 4BE7B 4IDHA 1G3UA 3NTUA 2KE5A 2V8OA 1CULC 2A5GA 2HT1A 4LJ9A 4DB2A 5JJKA 1VCMA 2W6IA 4PC1A 3IDQA 2O8CB 1YZLA 4EJSB 4KLNA 2HF9A 2K5UA 2QG6A 4LJAA 1WBDA 2QAGB 2IW3A 4MDFA 1GIAA 1U9IA 4FIDA 5KNBA 4OK5A 3Q9LA 2J1LA 2CJWB 2VF7A 3K0SA 3CONA 2ZE5A 1AKEA 3UXMA 5FPSA 1H65A 3QXCA 2I1QA 4MRRA 1CTQA 2WIBA 3VTKA 4B35A 4H9GA 3KKOA 3CPEA 3M1IA 4U00A 4ZCLA 2IWRA 1GKYA 1HA3A 1UJ2A 1DARA 5KNDA 1OW3B 3BRWD 5KPJA 2DFNA 4LDJA 4ZKEA 3WMEA 4MYHA 4OYHA 1PUIA 5KTYA 5FTMA 1XNJA 3RHFA 5FBQB 5KPDA 1C4OA 1G8GA 4DLXA 3BB3A 2HLDA 1E0JA 3GMTA 1ZUIA 3R8FA 1F2TB 1N0UA 2ZPTX 4M8NE 4NHOA 3C4JA 4OKSA 5ANRB 1KIMA 5G40A 3AVYA 4PPNA 5A4JA 2XAUA 8OHMA 2ZS7A 3U7HB 1F2UA 1JQLB 2ZSDA 2V7QD 4PHGA 4ZDKA 2CLSA 2QPTA 4EPTA 3PVSA 1Q12A 4TL9A 3UANA 3RSLA 3UKDA 4DDTA 4XWOA 3W8RA 3HDTA 3ZD6A 3A1UA 2GJKA 2QE7D 5KUTA 2EWWA 1E0AA 1E0KA 2KSQA 3RS2A 4B3XA 2BBWA 2HCJB 2REXB 2GHIA 5KSZA 1G8FA 1DO0A 3K09C 4W5WA 4JLJA 3BERA 1GOTA 3B1VA 4V0MA 2VP9A 2WOJA 2BMFA 5IK2D 2QA5A 1GKIA 4QRHA 4ZCMA 1YHNA 1WB9A 2L0XA 3HR8A 3VR4A 2X19A 1AN0A 4JVMA 2BEJA 5TV2A 3KQLA 2PJRA 2IYYA 4DCSA 1P2TA 3M6AA 4G3XA 3P1JA 3T1QA 1I2DA 4B3BA 4BFXA 4LX0A 3FHOA 3ZD7A 3VR3A 3CM0A 1GTVA 2YWEA 4E09A 2JLRA 4TLBA 5FOTA 4P4SB 2QQEA 4A2QA 1F5NA 2QORA 2XJ4A 2RGEA 1AQUA 2IHYA 4GNKA 4OQNA 3DKPA 5KYKA 1X8KA 3KTAA 2PX3A 4D81A 3AF3A 3AF1A 2ZJBA 1FPMA 4G01B 4OQXA 1XEXA 2O8BB 1P75A 1NVVQ 3FKQA 4PAMA 1XXHB 2JCSA 2Z4SA 3GLIE 4W5HA 721PA 2QAGA 3FFAA 4G5RA 2OCYC 4GFDA 2ORWA 1FTNA 1KJWA 1ZP6A 1UKEA 1MO3A 1U0HC 3QKSA 5LB2A 3K53A 2KWIA 3RWOA 3SYNA 5EP3A 4A2PA 2QSYA 4XH9B 3LLMA 4RZUA 1UBCA 1X86B 1NY6A 3IILA 3KXKA 5EXSA 4DLRA 1IY1A 2ZU6A 3VKWA 3GQBA 4Q1AA 5EE9A 4R98A 3W9YA 1CXZA 3K9LA 4BFYA 4URWR 4CEIB 1LF5A 1LS1A 4RZXA 3RWMB 5EXTA 5EUQB 4KHZA 3PV0A 1HT2E 4TL6A 4L16A 2QM7A 1FUKA 2B6HA 2FEOA 4MGZR 521PA 4D6PA 2VIIA 5IT5A 2O0JA 4TZ6A 1LB1B 2QNRA 4HAXA 1P2UA 4KBGA 3CO5A 5H1YA 5FUYA 3DM9B 1SVIA 4B33A 2D2EA 1F60A 1PLJA 3SS8A 1HURA 2GEDA 2R2AA 3B2EA 3QKTA 4BLOA 3MFYA 2QBYA 3AF0A 4A6PA 1SHKA 1T0HB 1ZCAA 4OK6A 1WDTA 3K1JA 2A5JA 4QXAA 2QT1A 4II7A 3SEAA 1P61B 5FR2A 1CP2A 4FMDF 4P31A 1JAIA 4QM7A 2WWXA 4OQMA 1FQKA 1DAGA 4OI2A 4P32A 2OLKA 5E95A 5HE8A 3GJ4A 4JLOA 4MUAA 5JRZA 4OQLA 4BFUA 1XZQA 3NHAA 4A4DA 1E1QD 2W00A 3OHMA 3TVTA 1XJ0A 1FMLA 3D3QA 1LW7A 4L5BA 5JJIA 1N2CE 4ERNA 1QF9A 1Z22A 2R6DA 4PC6A 1XMIA 2ZRPA 3REGA 4EKDA 3LO5A 1Q21A 1UM8A 3FMFA 4YDSA 1KO5A 3LQRA 4ZKDA 2BMJA 4BZPA 3MAAC 4A8JC 1EX6A 3H2YA 3PQCA 2MSEB 4JL6A 2ZRNA 3EC1A 4C2TA 4OHYA 4FCVA 2ONKA 4KCGA 5B57C 4PO8A 1M2OB 3R9XA 3X1DA 2QTHA 1BMFA 3LX8A 2WM9B 3THYA 3EG5A 1OKKA 3IIMA 3MG9A 4OHWA 2ZEJA 2IYTA 1M7GA 4PSAA 4UXJA 3W8NA 3ZVNA 4R2HA 1BMFD 1P4SA 1OYYA 2GTPA 3B5JA 1Q22A 1XFAA 4KSBA 1SKQA 4JBWA 2IYXA 4PANA 1T6NA 1K5GA 1YE8A 1N0WA 3TKLA 1Y3AA 1QG4A 1CS4C 1P9NA 4NYIR 2I4IA 4GOJA 4EJSC 3DKVA 2VPPA 3U6KA 2NGRA 1XXHE 4Q1DA 1Z47A 3MLEA 4EQ6A 3HPRA 1EX7A 1S4QA 3CBQA 4HSEA 3EPJA 1IBRA 5K8UA 2F43A 2YINC 4RCYA 2P5SA 1CR4A 4QBGB 3LW7A 1W4RA 3K0AB 1CJUC 4CEIA 4AI6A 2WWHA 1E0SA 3I3SR 1W0KA 4FINA 4TMTA 3RC3A 3X1XA 2G88A 2P2LA 1SVWA 3PITA 3IHWA 1A82A 5C18A 4ASUD 4C4PA 4QM6A 3ECCA 4HEJA 1DBSA 3TR5A 1N6KA 4YMUA 3C14C 2W2TA 1X3SA 4LK2A 2ZRBA 1YR8A 2QP3A 4W9MC 5EJEA 3T12A 2JEOA 2HCBA 1K8RA 2QN6A 1JR3D 1ZAKA 1NVVR 5AUNB 2Z43A 1IY0A 4TMWA 4PZZA 3Q5EA 4C9BA 1PZNA 3B9QA 4Q1CA 3TBKA 1LVGA 4LZZA 3O8RA 4TLCA 1RE0A 3KXIA 1VMAA 1I2MA 4ESHA 1PJRA 4P4UA 5IF9A 3ZS8A 2AX4A 3CF0A 3IO5A 4XVUA 1G21E 3OESA 2QP9X 4DCVA 4ZI2A 2Q21A 5D3QA 1XPOA 2A5DA 2GXSA 1RIFA 1ZIOA 2J3EA 4JIMA 2XB4A 1TF7A 4U7DA 1M6NA 1X6VA 4RKEA 2NOAA 2Q9AA 3VKGA 4LY6A 1JB1A 1U0JA 2IYWA 3DOEA 3X1ZA 4C0KA 3D31A 4V0LA 4F7WA 1G7SA 2IYUA 3K9GA 3FMOB 4GBMA 5AJYA 4Q18A 3QXSA 1UEIA 2FPMA 3CH4B 5FOSA 5DYIA 2J59A 1KO1A 3T34A 1SXJB 2RGNA 5GJVC 1W36C 5FPYA 4NYJR 4GI7A 3T1OA 3X1WA 4DLZA 4HLCA 1P60A 2IXFA 2IT1A 2FPKA 2Q6TA 1U8YA 3SJCA 3JVVA 3TSOA 1AA9A 2X2EA 2ZAMA 2CEAA 4Z8YA 1JJ7A 1G9XA 1G18A 3FKSD 3LNCA 4V0NA 3AV0B 4KBFA 4XIGS 1ZIPA 3RS4A 4I1OA 2XSZD 4Z8XA 4EPWA 5JWHA 2ZJYA 5L3SA 5FBRB 3AKEA 1KI6A 4GP6A 2XNDD 1OH8A 4Q9JA 1VCOA 1Z6AA 2OO7A 3CX8A 3GJ3A 3HR7A 4Q4JA 4DB4A 2FFBA 1FOEB 1LY1A 3Q5DA 1E94E 4PO1A 4A1FA 5KDOA 2ZYTX 1HY3A 1XTSA 2V54A 1J2JA 4FWIB 5JEEA 5IK2A 1I4TD 4U02A 2G0NA 1XDBA 3HU1A 2F1JA 4X8LA 3GJ6A 1KO4A 2D7CA 3DVLA 5TMPA 3SR0A 5J4YA 3OAAD 3K8YA 4OI0A 1FFHA 1II8A 1WF3A 2ZVPX 1TL7C 3QKRB 4PC3A 1IN8A 1XTJA 4PFSA 5IRCD 2FEMA 3SBEA 2PZFA 4ACAA 3TK1A 4XOIA 3F3YA 3PEYA 3NBYC 4LJYA 5AK0A 3S1AB 3Q72A 3MJRA 4JLBA 4TMZA 4WIAA 1SXJC 1TQ2A 3B8HA 4BLRA 1YVDA 2WAXA 2IXEA 2YC2C 5KSOA 2VHJA 5TB5A 1A2BA 2BBTA 2CLDX 1Q1BA 3I32A 4DSTA 2A5YB 3I4LA 1YZKA 5J40A 2O8FB 2A3RA 4EUNA 3L43A 4GZMA 1RPZA 1JJVA 4M53A 5DN6D 3IGFA 4M1TA 3CX6A 1ZM9A 2UZ3A 1OXSC 2CJWA 1R0XA 2IF2A 1D2NA 4Q48A 3TW4A 2VP2A 4NCNA 4B2PA 3FB4A 3QENA 4G5QA 3ZQ6A 5JS7A 1GILA 1E2KA 1G8YA 1FL9A 3IPXA 2ZROA 2H16A 1COWA 1Q1QA 2GRJA 4HLUA 1YZQA 4B75A 2CHVA 4NE2A 2B8TA 2CK3A 2WMOB 4DLYA 4AKIA 4WZAE 2NTYC 3QG5A 4B3FX 4RCZA 3AGQA 1G41A 1RRPA 2DWQA 5FI0B 2W6ID 1N6RA 3L8ZA 4BWYA 1TNDA 2OSBA 2WZQA 2RB4A 2PL3A 3DO6A 1J90A 2ZSFA 4KVGA 1UDXA 2PX0A 2Z6VA 1ESMA 5G3ZA 1XBTA 4HAYA 3BFXA 2VHTA 1NI3A 4BFSA 3LWNA 1Z2AA 2FSHA 3AVTA 4X8HA 4D4LA 4FMDB 3THXB 4AYWA 1X8JA 2O0KA 2QL6A 1S9HA 4HAUA 4PSVA 4IEIA 4FXPA 5L3RA 1G6OA 1NVUQ 2XOKA 3PJRA 4TQ9A 1NMXA 4HAZA 3T1TA 1LF0A 2JAQA 5EE0A 2F7SA 1E79A 3AVOA 4PHFA 1N25A 1NN0A 1NL3A 5F98A 1KDOA 1COWD 2PMKA 2QMUA 5GJCA 2MMCA 4JJZA 1EFRD 4XSGA 3LBIA 1M1YE 5FFMA 3W6OA 4DLUA 1ELOA 4A92A 3GJ0A 2Z83A 5JEDA 4URUR 1G19A 2DYKA 2ZI9A 1SVOA 4ZO4A 2NPFA 3FHCB 4UNQA 4HAWA 4LJ4A 1DPFA 2NZJA 2JATA 1XMSA 2GK6A 1MV5A 2OXCA 3U7GA 4CEJA 1BKDR 4MGIR 1DAKA 1U0LA 4DVGA 3PR1A 3ONWA 4IDPA 2ZITA 3RABA 3IIKA 3NBFA 1CU1A 2AD1A 2C95A 2O8DB 4LV8B 1KJYA 1UBFA 2WICA 1N6IA 2EFGA 3EIQA 4QGAA 1SZPA 3QJYA 2BMDA 1DS6A 1QZXA 1R4AA 2J41A 1W0JA 3OEHD 4PZLA 2PCLA 2D06A 2Z5FA 4XD7A 4BLPA 2G6BA 3OE7A 4YXWA 2J0VA 3OZXA 3CRQA 4HLUC 1YU9A 1BOFA 4D4JA 2GAOA 3GEIA 1E2QA 2GF0A 2PJZA 3P4XA 4E22A 1MR3F 1KK3A 2EWVA 4PC7A 4R2IA 4PPGA 2JJ1D 1Z5ZA 2J46A 4XSHA 5K8TA 4LPKA 3LY5A 4JJKA 2QZ4A 1JPNA 3AUYA 2CHGA 5CM8B 2XXAB 1OIXA 1SXJE 1X1SA 1QHYA 2I3BA 4RJLA 5HCIA 5JSZA 3JZAA 3MWJA 2IUUA 1DAFA 2RGNC 1XEWY 2ZR0A 1CLUA 3HYTA 4IOKA 2XNDA 1GRNA 1G16A 4BFZA 2H1LA 1E9AA 1C1YA 4P4TA 1N5JA 3A1VA 5JJLA 2XXAA 1N6HA 4MQBA 1AS0A 2XZLA 3FDIA 5JCPA 3P20A 2BHRA 1WA5A 2ZI7A 1R2QA 4MGYR 5KSYA 4NCHA 3TGPA 3VR2A 1KDTA 1NN3A 4IOJA 3WMFA 1OXUA 4F4CA 3CH5A 4XVQA 4TLAA 3VX3A 1XTKA 4LJ5A 1P9WA 2QU8A 1YR6A 2QE7A 4BLSA 2J45A 1RRCA 2CCGA 4NYMQ 3ND9A 2QGZA 4QFMA 2JLXA 2AD5A 5J4HA 2VP5A 4XWAA 1GVNB 4Z54A 4QBHA 1GP2A 1SULA 4BUJA 2VHCA 1T8UA 4WXPA 2ZIAA 4Q47A 5JMTA 4OJQA 4K8OA 4EFNA 2GCPA 2OE2A 4G5OA 3GEEA 4Q1FA 3T61A 3T1VA 4X8OA 3UMSA 1T4GA 2O8BA 1G64A 1G3RA 2LKDA 4DXAA 4N3NA 4A82A 3QQ5A 3T5DA 2A2ZA 2CNWD 5HZHA 4TTRA 3CF2A 2I1VB 4M21A 2H7VA 1W4AA 4OI1A 4TL8A 2BC9A 5SZIA 3HPQA 3E5HA 4IVRA 1M7HA 1VIAA 3K0FA 2ONJA 2CNWA 1JQJC 4BEBA 2G3YA 3TQCA 3C7KA 4M1OA 4N1AA 3LVQE 4PAQA 1GITA 1WCV1 2C5LA 1WBBA 2GNOA 4EJSA 2ORIA 1KK1A 1TEVA 1WQ1R 1UPTA 1EESA 1N0VC 4DIEA 2AKYA 4RD2A 2ZJ2A 3KTAB 4O2RA 4B3DA 2WIAA 4HYYA 1OSNA 2PT5A 4IKEA 4FWTA 4JVSB 2IEZA 4FMBB 3T35A 1FX0B 1T5IA 2VLIA 4MITA 1KKLA 3KQKA 3QG1A 3TMKA 5JS8A 1U94A 3A6PC 2O52A 3PUXA 4G5SA 2OFXA 2F9MA 5KO2A 1ZC3A 1S96A 3NBZC 1E2LA 4DDVA 2IS6A 5FBWB 2VTKA 4F92B 1OPXA 1FX0A 3TW8B 3CB4A 4PXAA 3NH6A 4MRVA 4QOSA 4ESVA 3RVBA 2BKEA 3DZ8A 1UBGA 4QJ5A 1DELA 1E9BA 4EIWA 5IHPA 4JT4A 3MWKA 3SDZA 1R0ZA 2CCKA 5FUXA 3K0CA 4M9SA 5FBLB 5KDDA 1L7VC 2QRZA 1KSHA 1E2PA 1FP6A 5GADl 3AVPA 3GFTA 4LBYA 4QBIA 4S2EA 4JLKA 4WA7A 1VTKA 2NO6A 1IM2A 1A5TA 3ZQJA 4JLAA 3C16C 1XZPA 2FMXA 2CDNA 2CHQA 1CJMA 2YJTD 1UADA 1EXMA 1L2TA 1XF9A 3NIBA 2GBLA 1GKUB 4IOLA 3QIAA 1Z0JA 4C0HA 3Q7QA 2YWFA 2EFHB 3FTQA 4V0KA 2REBA 4BPBA 1DG1G 2XGJA 2MSCB 2VP6A 3E1SA 4MRNA 3GP8A 1G3IA 4US0R 4BQSA 1AM4D 2ZE6A 1HV8A 1PUJA 2RHDA 3KFVA 2FX3A 1UFQA 4RD1A 1VYTA 5IDVA 5C4MA 2AWOA 5KDLA 1CJVC 3IBGA 2BJWA 4DLTA 3KQHA 1QG2A 1P2SA 2CCJA 3KKNA 1JALA 2ZJAA 4EDHA 3L82B 2QROA 1J99A 2EFDB 4GP7A 4KAXA 4NCJA 4AD8A 2AFHE 2GETA 2W2XA 4O2LA 4DCUA 3EZ6A 1AS2A 1KHTA 3RRYA 4C30A 3EZ7A 1P2VA 4UNRA 3EXAA 4FI3C 2C78A 2ZRHA 3BAFA 3K9NA 1R6BX 2WJHA 1VYVA 3CZPA 4AKEA 2DWPA 2ZSAA 5EP1A 4O0MA 4JLPA 1Q44A 2QSZA 2VSFA 3GLFB 4ZDJA 1ETUA 2OG2A 3BGWA 5HZKA 121PA 1WXQA 1F3OA 1MABB 1RJ9B 1SKYB 1XX6A 3RS3A 5FL3A 1R5OA 4L15A 3F8TA 1KO7A 3EARA 4QHTA 2ZREA 3MCAA 1LS6A 1YR7A 4O3MA 2BWJA 4QG7A 4A2WA 3KKQA 5CK4A 1KI2A 2W83A 2YOGA 3B82A 3PUWA 1MO4A 2P6UA 2ZRAA 4NKRA 1KMQA 1N3BA 2GCNA 3NEJA 4GZLA 5CLQA 4DLVA 2HV8A 2VO1A 3TUJC 2H18A 3I5XA 1E2NA 3CIOA 4PC2A 4RD4A 2BM0A 4JVNA 4B34A 2VHQA 1A4RA 1NMZA 5DYGA 2GF9A 1H8HD 2QRNA 5SZKB 1R5NA 4C0JA 2C9CA 4QHYA 3I1FA 3KL4A 1OXTA 4CZ2A 1LTQA 2WJIA 4TT3A 2IS2A 3KKMA 5J4LA 4LHWA 1B23P 4U5XA 1UBEA 2ZRJA 4LSGA 2NMVA 2IYSA 2OILA 3CRRA 4NMMA 2ERYA 3CR7A 3D6TB 2XJ9A 4B43A 1VKJA 4LHVA 4HDCA 1G8HA 3RS0A 2V9PA 1CIPA 3AUXA 4IXNA 3U5ZB 1G3QA 2P5TB 2J7KA 4ZV4A 3RRMA 4I1UA 3I5YA 5H8WA 2AK2A 2E9SA 3FPAA 1E9SA 1FZQA 4JBXA 4BFVA 5HKKD 2WWYA 3VKHA 4MKIA 1XEFA 2OFOA 5GVSA 2V1UA 1SXJA 2JA1A 3NWJA 3BB4A 2D2FA 2QTFA 5LPNA 1RRFA 4OQFA 3KJEA 1EFCA 2V1XA 4LJ7A 3BJIC 1YRBA 1FP7A 3AP3A 2GVZC 2B7BA 2BKUA 2EU8A 2XZPA 4QNRA 4I1SA 3ICQB 4WAUA 3SNHA 3TE6A 3ZLJA 1KSFX 1HYQA 1MKYA 4DSUA 3ADDA 2CL6X 5FBVB 3PUYA 5FL7A 3LVRE 1OLOA 1ZMXA 3BC1A 2YWHA 3E2IA 4ZDWA 4FMCB 1LFDB 1KI4A 3WMGA 5J4VA 4LI0A 2V3CC 4I99A 4TQUS 2RMKA 1ESNA 4LYFA 4KXFB 2CVHA 1NVWQ 2AN9A 2GJAA 3CW2A 3B6EA 4AWXA 3MMPA 5DHAA 1SVMA 1BS1A 3R9IA 4BLTA 5FL7D 2J87A 3U7FB 4RZ2A 4DCTA 4G0NA 3ADKA 1G5PA 1VG1A 4FD2A 1O87A 2ZJOA 3QF4B 4QGFA 2D4HA 3KXLA 4TSFA 1AGPA 2OBLA 1XD9A 3PUVA 4EFLA 4YMSA 4YDHB 5FOWA 4Q01A 4AK9A 4F91B 3MGCA 5J4KA 2N46A 4F93B 3QKRA 3KX2A 4A0FA 4E07A 1WRBA 3ZVRA 4K46A 4XTCS 1S9DA 5EQTA 4AYTA 5FPHA 2TMKA 3HWSA 5F3WB 1OKKD 3C8UA 4P3YA 3R8CA 5JWOA 2ZUCA 4JBYA 4DLWA 1OXVA 1W2HA 1ZJ6A 2IYLD 1CBUA 3OIYA 1Z06A 3RRNA 4DUGA 3QXHA 3UWKA 1W4BA 4TTPA 5JHGB 1IJFA 3DMDA 4Q4HB 3IEVA 3M0EA 4NPHA 1Z63A 2HDNB 4PHTA 2PBRA 4LBZA 4LYHA 1XMJA 2H92A 4RD0A 3EAQA 3TJZA 3I61A 4A8JA 1JR3E 3TR0A 1E2DA 2P6NA 1PVOA 1NVXQ 2YKGA 3TRFA 2ZSBA 3W6PA 5C2JB 1K6MA 2JLSA 1CJTC 4HUQA 3T15A 2NO1A 1P9RA 2O5VA 4C0LA 4D82A 3LXXA 1OFTA 4Q4LA 1E9EA 2ZQ5A 3CR8A 4NCIA 4TZ0A 4WXRA 5CB8A 2HUPA 4B2IA 4MUBA 3A1TA 3IIJA 1QVAA 3CX7A 1AS3A 2JLUA 5CDFA 4UNNA 1Q1ZA 2H5EA 2QMOA 2ZI5A 3WBJA 2JIZA 2OUKA 2QY9A 4HDOB 2E87A 4IFBA 3UK6A 5DGXA 3SC3A 1IHUA 3TNFA 1IXSB 2FWRA 2J9RA 4D25A 1XPUA 1GFIA 2CMKA 3EIHA 3ZS9A 1V43A 4ZDIA 1G3MA 2FJUA 2C9YA 4B74A 4IOMA 3U44A 1F6BA 3FMPB 2FSGA 4UJ3A 4M1YA 1JR3A 1U8ZA 1G8PA 4ILEA 4C3ZA 1XMVA 3B78A 4HDQB 2AXNA 2F6RA 4HZIA 3F5FA 4RD3A 4UXHA 4CDGA 4HUTA 2X2FA 4PAOA 2H57A 4Q1EA 4NU0A 4M4SA 5DH9A 3DM5A 1NF3A 4YLGA 4TMXA 3WNDA 1QBKC 4IW3B 3I62A 3LRPA 4BGDA 4JT2A 2BVNA 3QEOA 4V0ME 4F4JA 4US2R 4I1VA 2PZGA 1VG9B 1QVRA 1NLZA 3UWOA 1L8QA 5CM9C 2BBSA 4URVR 3THXA 1P62B 2W2VA 1ZCBA 2V55B 1N5LA 1KK2A 4M9XA 4OJKA 2GEUA 4TYQA 3WP1B 4HI0E 2R44A 3UG6A 5BXQC 1JR6A 4EPRA 3GLFE 1KZ7B 3L0SA 1G7CA 4B3GA 1FQJA 4KJZA 1TADA 2JASA 1FNMA 1KI9A 2NIPA 4Q4AA 2GA8A 4ARZB 5FTLA 4NBSA 1YZGA 3AKCA 1AQYA 1RKBA 2LKCA 1RW4A 2H8KA 4G5GA 4M0LA 3RYTC 1Z0AA 5F2EA 3RSOA 1EWRA 1KAOA 2ZR9A 1SGWA 1MRSA 1NP6A 1U98A 1KSGA 3U3OA 3WHKA 3AEZA 2XNSA 3OFNA 4Q4HA 1SKYE 3VMFA 4PPFA 2W58A 4KFTA 5HE9A 3M4YA 2QMEA 4AKHA 3QVUA 1DG3A 4MRSA 1X8LA 2OLJA 3X1YA 4DLSA 4RY2A 1HQYE 2FFAA 4A8JB 4HB0A 3TVDA 2IWHA 2IUTA 1ZNYA 1Q3TA 2BEKA 5FTNA 3AQ4A 2C9OA 3BK7A 3BH6A 1JEEA 4TT3D 2GXUA 4CEJB 3WYGA 4V02A 4MKGA 2OFWA 4Q7MB 1RYFA 4DC9A 3KB2A 3PEWA 2AK3A 1E6CA 3O47A 4URXR 5FH9A 5JCZA 3K70C 421PA 1II9A 1NKTA 5CB6A 2O8DA 1W5TA 1SQ5A 5CJPA 3U3KA 5HCNA 2VHUA 1JXMA 2F3RA 3W34A 2UVQA 3IPYA 3IBYA 1H8EA 2CE2X 2XTZA 1M8PA 3TUZC 2ZYVX 3GJ8A 5CLLA 3U60B 4MDEA 4CEHA 1W46A 3ZYCA 4MKFA 2RGXA 1F2UB 3OIUA 1P73A 4DT1B 4PPQA 1EFHA 1AKYA 3FVQA 1PLLA 4W5JA 3CWQA 3RS7A 1CRQA 3HP1A 5TARA 3AM1A 4UXIA 3CKLA 5B58C 1TTTA 1Z3IX 3QNUA 2HLDD 1TAGA 4XWKA 2QT0A 5TVKA 2WKQA 4CGZA 1W48A 1WMSA 4DIDA 3JZMA 1XPRA 4A6XA 3N5CA 1OB2A 1OT3A 1XTRA 3MSXA 1AK2A 2FZ4A 2HJGA 5EUMA 1F2TA 4Q19A 5AJVB 1DEKA 4OHVA 3W90A 2CVFA 5K8IA 1PV4A 3R9WA 1U81A 1YR9A 5G3YA 2VH5R 3OFND 4DSNA 4LC0A 5C1BA 1EK0A 5A0FA 2OBNA 5EP2A 4DCNA 4CT5A 3AH8A 1KKMA 1ZNXA 2AWNA 1QHIA 3GLHA 2VYFA 1ZINA 2XZOA 6Q21A 3L0IB 5KSPA 4ZCIA 3NHBA 4EPXA 2C04A 2WAYA 3AF4A 4GMDA 1ZC4A 2FFHA 2FZLA 1KY2A 1RVDA 4BRUA 2ZETA 2X8AA 4DWJA 4RZ3A 1H8HA 2Z4RA 2KBEA 1NNEA 2QM8A 3FOZA 4KFSA 3ZJYA 1NY5A 3ZZ0A 4TLEA 3A4MA 1XEXB 4HLQB 3BORA 4OHXA 2F1HA 1XTIA 2Q3HA 4HZUA 2ZRMA 2PZEA 2DWOA 3C5HA 1T5LA 1GNRA 2YNMA 3GLHE 3LV8A 4M2LA 5TY0A 4R7ZA 4DEYA 2CBZA 2IXGA 1WP9A 2BOVA 1KGDA 5EE5B 2PCJA 2N1BA 3VR5A 4D4MA 1DAMA 2WMNB 4Q9IA 4KVAA 5ELXA 4IDNA 2ZVQX 1SVKA 3V4RA 1MABA 2DFLA 5FTKA 1TMKA 3AVQA 1Z8FA 1KDPA 1US8B 4LGMA 2WBLC 2A7QA 4JSYA 2FFQA 4NONA 5J47A 3QVVA 1M34E 1Q57A 4A0HA 4TYYA 4PTLA 1NIJA 1KSJA 1VDZA 2F43B 1KYIA 2ZYWX 3B9PA 4MA4A 3AGPA 5BYJA 3GJ7A 4YMWA 1GRRA 1IN5A 2MSDB 1QHXA 3IKJA 3IQXA 2D74A 3QPUA 2JDIA 4HB2A 4D0GA 1W36B 1GDDA 5F9FA 2P67A 4HB4A 2DHRA 3PEUA 4Q02A 1QHSA 2OESA 5DIFA 1T3LA 5AUPB 1NSTA 3BIFA 3TUIC 2SHKA 2OXRA 3BS4A 3HJNA 4IDQA 5GJWC 4LHYA 3VR1A 3IEUA 4WVFA 1DTSA 2B8WA 1XB2A 3N2IA 4A36A 3WYFA 1L4UA 2KB0A 4ZI3A 2O8EB 1UKVY 4J0QA 1P3JA 1J8YF 3NG1A 3A1SA 4Q5IA 2QQ0A 4Z1MD 1E32A 1OF1A 2XTMA 4KYIB 1YQTA 3REFA 1T9HA 3ZZTA 1VYUA 3ASYA 1OJLA 1NN1A 2IBMA 2QENA 2QP4A 1E2GA 2QBYB 4JZKA 3UG7A 3GLHB 3W3AA 2GDJA 1T3HA 821PA 1HE8B 4MYCA 2O8EA 4DSOA 2RGDA 3KDSE 3A37A 1TQ4A 2WJJA 4CF7A 1RZ3A 2BMEA 3TH5A 4D26A 5TXGA 1OIVA 4TYNA 3LX5A 1N6PA 3SJZA 3B13B 2GJSA 1W44A 1NLYA 2JJ1A 2ZTSA 4NYMR 2GCOA 2BCJQ 3G5UA 4KLZA 1NJFA 1NBMD 3TAHA 3I73A 1TPZA 5DE3A 1GM5A 2R62A
chains in the Genus database with same CATH superfamily
1A7JA 3OBBA 1UMDA 2P9CA 1XTPA 1CKEA 4LRUA 1C4WA 3GLVA 2BGJA 2RAUA 5LBIA 2CFTA 2OGUA 3JAWA 3VR6A 1CF4A 2HBRA 2O7SA 2ECOA 1E1MA 5THXA 3A1WA 2Q2WA 3PT9A 1GEGA 4MI3A 3WK5A 4C5BA 2EFEB 3QLEA 1E69A 3V4VB 1E7WA 4MUKA 3NVMB 4MDYA 2W6JA 3NMUF 2VH1A 3SNKA 2CHFA 4ES6A 3DBVO 1Z4IA 5IAAA 2RK4A 1KI6B 1H2XA 1XVIA 3L01A 3JVUA 3ZH9B 2H00A 2OHXA 2PEZA 4YDRA 2FK7A 4AMVA 2AR7A 3MCVA 4PHHA 3GCZA 4BRWA 1JJIA 1M3SA 1SVNA 3SJBA 3W5HA 3RARA 2VYVA 3ACCA 4NESA 5CYGA 4PYLA 4AP9A 1MB9A 2YASA 2XT0A 2Q50A 1EK6A 5L4LA 1WSWA 3GF4A 1LQ2A 2AE1A 3G2LA 4QYIB 4WXMA 4FOLA 3LF1A 2YFQA 4BLQA 2W93A 2YICA 1ZNWA 2NSYA 2P4HX 5IXYA 1T0JB 1DOHA 3P71T 2XCTB 4TROA 4D9EA 1RXIA 1XKXA 1LGYA 1ZJ5A 2FPGB 1KEKA 4IDBA 1X0VA 2HA2A 2WHXA 4WZAA 1CEXA 4IMPA 3U4QA 1QCYA 1J6UA 4K26A 4YONB 4BFTA 2I3ZA 4RADA 3RYIA 2QTGA 3NETA 4BO2A 4ER5A 3ZDRA 4RSRA 4DPMA 3BOSA 1WULS 2PPLA 3OJWA 2BGUA 1PS8A 2CE7A 4MS3B 1V5WA 4QXMA 4XSVA 4PYNA 1ZHHA 2EJCA 4P22A 2BFFB 2HJVA 3JALA 4EUHA 4EGJA 3HYCA 2W6JD 1HO3A 5IAEA 1EFVB 5A4DA 1R4MB 5DTMA 1CCWA 2Z58A 3O8DA 1TECE 4H3VA 4RH3A 4FYKA 4I55B 3DTVD 4EB6A 1UKZA 5FA6A 4MPPA 3QHQA 1FXWF 3ZXXA 5EESA 4FX5A 1G4AE 1IXRC 3WIBA 3F0TA 5BR4A 3DL2A 1GHTA 4J16C 4TLDA 2EP8A 1TD1A 1Q0UA 1W75A 1GCUA 2J3HA 4QTTB 3QEJA 5C37A 3TRIA 4MHSA 5E8JA 1PZFA 1P0MA 4Y2GA 1BS9A 5B1SA 3A9WA 1B0AA 2D0IA 2WU8A 4NPCA 1L5HB 4TS9A 5LFAA 4G07A 4MWGA 2V96A 2HU8A 4RIEA 4YRGA 3DE3X 3JASA 5I4BA 4UUQA 3A6KA 3HVHA 2HJ9A 1U1CA 3NR2A 3RT1A 2BCGY 2VRWA 2WW8A 3M34A 3GDGA 5B30A 3ZCUA 4MGKR 1SY7A 3Q10A 1CG6A 2RH5A 4HBGA 5BUQA 1G5TA 1UC5B 3O1HB 1JIKA 1WE2A 1XWIA 4JITA 4RVCA 4JLMA 3BWDD 3B8EA 2R7MA 3CLUD 2R8ZA 4EHAA 4JBIA 1C50A 3K1ZA 2ZM6B 4PGGA 5LOVB 2Q8NA 2D1TA 3E15A 3FXAA 1VBFA 1U9JA 3ACDA 3QWAA 4PBTA 4XUCA 3EIEA 4ZOLF 1P5FA 3HI6A 3U3JA 1DGQA 2EL9A 2WKSA 1M72A 2WRZA 3JYOA 1XRRA 5I9MA 2G7ZA 2W11A 2Z2JA 5ICSA 4DEVA 5D86A 5KQGA 1JFSA 1RJ9A 1EIZA 3WISA 1D9ZA 1YCDA 2LUOA 1GUBA 1KMHB 1W35A 2W6MA 1GZ7A 1L5SA 4MK4A 4NH4A 3LKZA 2OEPA 2JFQA 2VSXA 3VXKA 4ONEA 5CJJA 4CRWB 1JDZA 4MUIA 2PKXA 5KJ6A 4DE5A 1B4DA 1EPUA 1RMYA 1INLA 3HVIA 4ACBA 2CVQA 1L5FA 1Z0UA 2C97A 4NU6A 3NVAA 4C20A 1ZD8A 1J49A 1JZQA 2WKWA 2Y68A 3CNNA 3ZBTA 3ZWYA 4D3DA 5JIBA 4P8RA 1WX1A 2EERA 2GZRA 2IJGX 5AKKA 1BHO1 4EG5A 3IT3A 4FS3A 1W25A 4LSWA 3OZAA 1U2GC 5SV2A 4DJEC 4ESVA 4XJVA 2HU2A 2Z30A 1EEHA 3BTOA 1U0OC 1X7HA 3FUWA 3JW8A 3A4VA 2AKAB 4WJZA 1KH1A 3M6WA 3QKWA 4KPUA 5EZ5A 5ALIA 1RHRA 3D7MA 1WAMA 2VUHB 5FWYB 2C7PA 2YW2A 4O59O 5ALZA 3NUGA 3WO1A 1RAHA 1E9RA 3OMLA 3DAGA 3NHLA 3R7LA 2NUBA 3PUZA 4QO8A 4UEWA 4G1EB 4HUQB 2F48A 1LTKA 3JV7A 1TZKA 5EMJA 3P2MA 5JTUA 4TSFD 1E2IA 3D2BA 3OLWA 5AJWA 2BM1A 4S0ZA 5DEOA 3RU2A 3WXBA 2FWPA 4RMNA 4LF8B 2EEZA 4DRZA 3PNKA 1KEUA 1UMCA 2QHXA 5SY9A 3ZU5A 1O0SA 2QTTA 1V25A 3KLBA 4IBOA 5JBQA 2NVWA 3F74A 3F47A 1QYIA 3OZEA 4MV8A 4BECA 1VG0B 3KHTA 5KTMA 1VHLA 1KH3A 4N39A 4DKJA 3C7DB 4ZXPA 1Q0QA 5F2KA 3JY6A 1NIPA 2PVPA 2IW1A 2P5YA 4WECA 4H59A 1ABBA 4YRDA 2F3UA 3IOBA 2JJ2A 1YZUA 3KPUA 3P9PA 2YJ6A 1XD2B 1XD8A 4KQFA 3T9FA 5FJJA 3A31A 2H29A 1ZVVA 1YCFA 5F2OA 4KI7A 1QIGA 3B6IA 4NHEA 2WHYA 3QPVA 2R1UA 3P9QA 1KOJA 4GMXA 4EG7A 1ULBA 4NBUA 4Q9LA 4FSDA 2HSZA 1SRRA 3B1XA 3P32A 1UAAA 2YBDA 2QEQA 1WB6A 3GA7A 2EYUA 3ZDDA 1U1GA 2EGUA 2HTEA 3D59A 1XYVA 4IIGA 3Q7PA 1V9LA 3FVRA 1KYTA 1NW7A 1J56A 1HQCA 5JVDB 1X0XA 1SVSA 3U9LA 3TSWA 4KU4A 4CR6A 3CJRA 4GPD1 2AI2A 1YZNA 4BAGA 3RC8A 4J9UE 5EL0A 3EULA 2DY0A 5J23A 1PU2A 4EJ2A 4B46A 1Z2PX 4KE8A 2BY4A 1DRVA 4PZAA 4C6SA 5BSEA 1U28C 3MYYA 2Y1FA 3ZWVA 1ISFA 1X1TA 1VI6A 1NLMA 1Z7EA 3OZ7A 3OTOB 1E4OA 2DERA 4YCJA 5JVDA 3HXTA 1XEWX 2HRCA 3PTLA 3VO2A 4AJ2A 4J76A 1SCBA 3G49A 4G1UC 4DQXA 5F7XA 2JD2A 2A4MA 1ZI6A 1SELA 2DFPA 3LECA 1PDOA 3FX2A 4MLCA 4IVPA 1O95D 4L4ZA 1CHDA 2BM8A 3ANMA 3PENA 3PQ2A 5KINB 4A8PA 5LUAA 3ZVNA 1KP2A 2ZAOA 1UOEA 5LJLA 4NR0A 4RPGA 2OCBA 2G5GX 3IUEA 3FMGA 3KR9A 3BMXA 3QPWA 3SVLA 3GVCA 2QW8A 4GT1A 1EVJA 4KEAA 3BCRA 2DBYA 3BL5A 4G63A 4CMIA 2H17A 2D3WA 1CQXA 1Z4OA 3KR0A 3MTBA 1XR3A 3V8BA 2OCIA 2FOXA 3HDJA 4UBKA 5E9QA 4A9AA 1OI7A 3K2IA 1UFKA 4FYXA 3F5SA 3QEKA 4RO0A 1A9PA 1DKMA 4E5UA 5AVYA 1P17A 4JUIA 3SFVA 2JANA 1Y5RA 4BTEA 1JRLA 1T2UA 4CMIB 3A58B 2C1EA 3OIFA 1JHQA 4EG6A 1WDMA 4B40A 4N3BA 3UHPA 3UB4A 3VH2A 3RVOA 2QJFA 4Z3DA 4C5CA 1XDUA 5COBA 3ITDA 1GPLA 3PFIA 4JYAB 3E23A 4GMFA 1A1VA 1AHHA 4WK4B 4V1CI 4W4TA 3IPRA 1TEXA 1YGYA 2GEJA 1EP2B 1FMJA 3H86A 1TJYA 2E6KA 3BMCB 4JJIA 3K0EA 2D5AA 1GPKA 3VVBA 2MSLA 4BFWA 2QX7A 4H17A 1UWLA 2VLBA 1FVFA 3E9QA 4JBGA 3ZW7A 1EP9A 3GJ5A 5ADHA 2Q1TA 3ODGA 1ZKMA 2E2WA 5FEUA 3AF2A 4BNKA 4DTCA 4TQGA 1QGED 2RB5A 3J7TA 2D59A 3L84A 5DLPA 1IN4A 2K4MA 3T3DA 2Q5JA 4CQNA 4NCAA 4LA4A 4X41A 2ZJ5A 1M2GA 1MC5A 2P3SA 2KBFA 1WHTB 1PJSA 1RQ7A 2BDUA 1L8XA 1Q50A 3IBFA 4D3ZA 1ISIA 4AX8A 3TIFA 2R68A 5CIWA 2WI8A 2R65A 4IUCS 2WD7A 3TNDA 2ODEA 3W6ZA 1QCZA 1P72A 3Q85A 4UNIA 3ZZUA 4G8BA 3D4OA 5CU7A 4JYCA 3OTIA 4PQYA 2YQ4A 2XA2A 5E1MA 3W2TA 4LQCA 1B1AA 3CFYA 4LCBA 4KK3A 1A27A 1J25A 4KXXA 2HMAA 3PRYA 3EXIB 2B83A 4M8SA 1N6NA 3M49A 4P7BA 5GV8A 3L1VA 4LXGA 1P29A 3C3EA 1CEYA 1K7YA 3MT7A 2C2GA 2JHFA 3ZE9A 1J8MF 1ZA1A 2JHAA 1OHHA 4Q3EA 1S3SA 4PS1A 4HD8A 3AYXB 4UZFA 3ZWOA 2J5XA 3BX1A 5CFNA 2RGCA 5EYPB 2HCTA 3L8CA 1FMFA 3O82A 1YUMA 3ORFA 4HLDA 4OXNA 5AMXA 4GDFA 1I4LD 2LCFA 3F6PA 3GL9A 5KS2A 3ZJUA 3G7NA 4FNAA 2PSJA 4PSDA 4X45A 5LIPA 4FMCF 3WAJA 4RNDB 4WZZA 3EZ9A 4FQ8A 4NBVA 4DEXA 4ENQA 2WEKA 2BFBA 4M8LA 4ZA2A 5KQLA 1KZ6A 4XM1A 3DP7A 2QUKA 3O8QB 3CNOA 1E7SA 2C99A 4U7TB 1RI3A 1QO0A 2B4YA 3H9JA 5HDBB 4K81B 4P34A 3OY2A 3WVNA 4BLUA 2NXCA 3CCCA 3UTCA 2VCEA 3NDRA 5LNK1 3AVWA 5BRAA 1U2RA 3H4IA 3PBKA 1EFTA 3PT5A 4OHOA 3UMGA 3W3ZB 4BO3A 1S6YA 2BKVA 2VA8A 2RGYA 1QONA 3JZDA 3IE1A 3H84A 2OHJA 1KA9H 1QGUA 1GUAA 1W76A 1Z08A 3C3PA 3EASA 3HM2A 4LE1A 1Z0FA 4OYYA 5FOXA 1S7GA 1XXHA 4INZA 2GILA 2QE6A 3EEQA 1VJ0A 1GQYA 2MINB 1UINA 3BIJA 3ODPA 1J09A 4UU1A 3VZCA 1MJHA 3MXTA 4KVFA 4UU7A 1O77A 1A9YA 1MO6A 1U3WA 2JAXA 2ZSIA 1NJGA 3I1JA 4OM7A 4L9WA 4RKFA 2V65A 2XUAA 1UJ6A 2B8EA 3VU9A 1HZJA 5DBFA 3L4JA 2D1QA 1EUZA 3FWYA 4P4GA 1FU8A 3STXA 1WZ2A 2M6RA 1KE2A 3C15C 5HWSA 4ZO9A 3FDJA 4MW4A 1QH1B 1JW9B 2VQDA 2BV3A 1EGMB 2ZRKA 5ICCA 1CUSA 2VK2A 3K6SB 1C41A 1DO2A 2OWDA 2V4MA 4IIYA 4YT4A 1HG1A 1SIOA 3K32A 5ILOA 1L4MA 1TYDE 2O8NA 4ZP1A 2DPMA 1PNTA 3FE2A 5A0VA 1PTJA 3I2FA 1SXPA 1L3IA 1YB7A 3C8HA 4LJ8A 4DIMA 4DA4A 1FW6A 1H9AA 4YCBA 2AF4C 1XJWA 1RLJA 1G1MA 5BUCA 3TEMA 3PWSA 3KZCA 2YN0A 1LA2A 3MMXA 4NG5A 3UT5B 1Y8QA 3UAYA 2ZS8A 4RMGA 5BQFA 4Y6OA 1J4AA 4P0TA 1DE0A 1OYWA 1YDGA 3MCTA 3DL0A 3IQHX 4QU9A 4EY8A 1T5HX 3CT6A 1D1TA 2DFTA 2JB9A 2VYVD 2X77A 1DAHA 1KEZA 1T0PA 3HJCA 2IZ1A 4XQCA 3WLRA 1E3QA 1WDKA 4UEQA 3NT2A 2EZ9A 3FJYA 2FZGA 1F17A 1FTSA 2IPNA 4FDTA 3WK7A 4IHQA 2C03A 2QZ9A 3RG8A 4C0BA 1NSFA 2WT8A 3WGNA 1GT6A 1R8SA 2ID9A 1QV6A 5EHNA 4YQFA 3SDBA 2F8TA 1HDRA 2MJLA 3EXFB 1FDWA 1JHVA 1O9GA 3KFXA 5EMMA 4Y9TA 1E3JA 1GPAA 4JLVA 1K8YB 2JGDA 3UWMA 1NT2A 2UZ1A 3H9BA 3QJ5A 4QNMA 4RJ2A 3RTEA 4DMKA 5L3QB 3O8BA 3D5QA 3CE6A 5F1OA 2XWSA 2ZUVA 3BXHA 3PRKE 5EHQA 2A9OA 3AUAA 4JL8A 2C2YA 4MO9A 5HVNA 3G0DA 5HXAA 4D3XA 3F78A 1CVLA 2N42A 1CIVA 3AL3A 5TS2A 3S0JA 2WG1A 3I0NA 3ZVMA 4IO0A 2V7QA 1I4DD 1QX4A 4R1QA 2WHEA 1KJ8A 3ZVLA 3OUUA 2K6GA 4P2GA 5JXIA 3FSEA 2ZQZA 3GEGA 3IVRA 2I2DA 4HVAA 1ZNZA 5BYKA 3VAYA 1WHSA 3NKVA 4QDUA 1GRVA 4KN8A 3UICA 3OZFA 2Y1KA 2Z95A 1WVGA 3T7DA 3U7RA 4UMVA 4CE6A 2VVTA 3H11B 4BQQA 3GROA 1UM9A 3M4NA 1OX5A 4UPDA 2VR1A 4LVOA 4K6KA 4EO7A 4QJ3A 4B7AA 1ILEA 3Q8XB 1WCIB 2IHUA 4N5DA 3AHEA 3HU3A 2FR8A 2ODNA 3DLBA 2GH1A 2PT7A 4F85A 2XB8A 1WTAA 5FHQA 3TTTA 4BKMA 2P0EA 2MCFA 1XL0A 4LV5B 1R8XA 2ZTLA 2COUA 2EEPA 1BA2A 1I80A 3FCCA 3H11A 4KP7A 4D0SA 2J0SA 2HSWA 1NP7A 2G71A 2PZKA 3VNQA 3ICEA 1AC5A 1FK8A 3C98A 1R0YA 4N8SA 2XYQA 3UQZA 1WCIA 4TN5A 3WWDA 1XZNA 4LC9A 4AKTA 4ECEA 5A5VA 4XR9A 2AXPA 2ASEA 3U3MA 1ZMBA 1PI3A 3AILA 4HB3A 2GZDA 2JAHA 2NO0A 4FU0A 1WPQA 4LV6A 2G1PA 4D0LB 3V1TC 3X44A 3HTXA 1PL6A 4NFHA 2JFWA 3TQFA 4FE3A 3UVEA 1AIPA 5AI6A 4LSZA 2WZDA 3C2QA 3K0AA 1F4VA 1SZJG 2FW0A 4KL8S 1GTRA 1W1WA 2J48A 2QTVA 4NJEB 1U8AA 3HCWA 5E6SB 4JS0A 3DPUA 1C9JA 5E4JA 1T3GA 1VSQA 1YR1A 3SIWA 3SKYA 3TOVA 3LDAA 2QWXA 3BPSA 4GX1A 2FG6C 4KNVA 4WZ6A 4P3KA 3KRTA 4D99A 3RCBA 1C9KA 3D54D 1XMPA 1KY3A 2B99A 4PLPA 2I8AA 3DXYA 4E15A 5AM3A 3EWAA 4C0AC 2GGSA 3CVOA 5IAKA 3AJ9A 1WCYA 2E3JA 5E6SA 4IQ4A 2WYOA 2V4ZA 1H1LB 2JGNA 3FPSA 2IPMA 1RWPA 1OUMA 2RAPA 1G6HA 4YIHA 4WCFA 5FOUA 1W59A 2WJVA 1VPVA 4AMBA 5FUWA 4E51A 2H0RA 4PFQA 1FJXA 5JWRA 1WOYA 5DHSA 4O1MA 5B2ZA 3RJMA 4W1SA 5BP7A 5KNDH 4TWZA 1BEEA 3W5UA 1C8KA 2IF0A 3IMGA 3OEED 4FOTA 5F21A 5FLXA 3VPHA 1HGXA 2Q7XA 1E8MA 1Z4JA 2FJPA 3B20A 3EPRA 3KLOA 1ZX1A 3NKLA 3K92A 2UZ1B 2QTWB 3CG4A 3PC3A 3GPLA 5JLJA 1FDIA 2EBWA 2R00A 4FGSA 4MCAA 3LT0A 4QOFA 2BDTA 3KOZA 1A7UA 4P84A 1PNVA 2IYQA 3AJAA 2O20A 5CMLA 3WNBA 5JZVA 4F2HA 1JAYA 5C1IA 1EJ2A 2EQBA 2M6LA 3WWCA 4MS3A 4LYAA 3C97A 4FHGA 4Q3OA 5BOSB 1I7NA 1I5OA 4I66A 5CCDA 4U2GA 1G20B 1FMTA 1H69A 5CTAA 4JI3B 1HX7A 2WFZA 1Y5MA 3UFXB 3CXRA 2I8CA 4K2AA 4MUHA 3RNLA 3NHWA 3DBHA 1NPTO 2IEBA 4GXRA 3VDNB 2Q1XA 3GAMA 4JSRA 3SDSA 1JEQA 4ZMSA 1T5SA 2PZMA 1TK2A 3OM1A 4HG2A 3OFJA 3DUFA 2C2OA 3N8HA 3TX6A 4CMGA 5ELLA 5EZYF 1NPDA 3ID6C 5JMPA 1LDGA 3OU6A 1NE2A 3V5NA 1SWWA 5AW0A 1SIWA 2WSSA 4YH1A 2ZRFA 1KVTA 4B6GA 2C4UA 1OBFO 3I04M 2FXIA 2XMGA 4MVJA 1O3YA 2WKRA 2IU6A 1W49A 4OQEA 1EZ4A 3BJZA 3HDQA 4G0UA 3UJAA 2AJLI 2ZS9A 4PQFA 2A78A 2JVIA 3PHIA 3U4GA 5F77A 1PF7E 1L5KA 5IJ0B 1C9YA 4OATA 4RGVA 4J2TA 2FFJA 2JIPA 2ACVA 5B4UA 2V6JA 3AONB 4NBLA 3VNVA 1I13A 4QUGA 4I50A 3M33A 3T5GA 2HK6A 1G5HA 1XLTA 2P9QA 2ZBGA 5CYPA 3PIIA 2I67A 2AN3A 2Q5IA 4NZPA 1Q2XA 1QIHA 1RWQA 2O3RA 3DT6A 3B1KA 3RUFA 1RLUA 3U6BA 1YI1A 4RBNA 3AUUA 4CLRB 3QU2A 3VYUB 3GFPA 3JQRA 1ZK3A 2HRBA 2RIPA 3ELYA 4FFBA 2PYZA 5B2FA 5TGTA 1ZVKA 4M0FA 1V95A 1UZLA 1XQ9A 4NU5A 1Z3CA 2F4VB 4XD2A 4DDHA 4GLLA 1NF2A 1OR8A 3FZEA 5A62A 5ER9A 3WGQA 3EVGA 2OO5C 1DHTA 2A5LA 3F4KA 1KMHA 4Q1VA 2BF4A 1BIFA 1BE6A 3IAXA 3IHTA 2HWXA 5JISA 2IH2A 3L0PA 4QLBA 4JIGA 4LRWA 3ZDQA 2C0QA 3GLUA 4DQLA 2PT6A 4K9SA 2NV6A 4CCAA 1IQPA 4IEEA 3U62A 3CUYA 2VG8A 4RLFA 3H5LA 1RQ2A 1ZU5A 1KMIY 3H1BA 3OG9A 1AZSC 3RSSA 3B89A 3KB1A 3VC2A 4Q7LA 3R7WA 2MU1A 3GJRA 3PXBA 1NVGA 3ZDAA 1U8TA 2OYSA 3U0BA 1A04A 3QVXA 2A9FA 2WTEA 3FHTA 5KTKA 3MS4A 1AKRA 3H3FA 5ALUA 4RS4A 4YHHB 3QOWA 4N03A 2XNKA 3HL0A 2IU0A 3ZWMA 2HM7A 4FDAA 1KDYA 2Z6UA 3HRKA 1LI4A 3PWZA 1YRWA 3IBTA 4KAAA 3R7WB 3G1UA 1IHXA 2TYSB 1JTFA 5LWHA 5U4XA 5L7WA 4DYDA 5EJ2A 4GE3A 4O4JB 3TZQA 3WI7A 2WOOA 1SMKA 4QUKA 2QR5A 5JI3E 2BFMA 1IC6A 1EP1B 1HL3A 1EBUA 4K87A 3EUFA 3HJHA 2I6SA 1O7JA 2ZJ1A 1VA4A 3WBFA 4PX5A 3CO0S 1UPUA 3H1TA 5L40A 5LMCA 3VNUA 3OE7D 5FNVA 4LXYA 3KJHA 3TXAA 4ZK6A 1KKUA 4BVEA 2FMFA 1R88A 3U2QA 5I7EA 4IGEA 2Y1LA 4B84A 4F4HA 4F8JA 5JJCA 4BNWA 3U44B 4BKUA 2J31A 4OY3A 3BD7A 3SXPA 3H2KA 4BQEA 1BXGB 1TCVA 2VDRB 4LOKA 5F3RA 2Z9BA 1NDHA 4EHKA 4R54A 1O96B 1R9JA 2C20A 2FETA 3UMJA 2EDAA 3FTDA 2FLVA 3Q3GE 5EKSA 2IPAB 5JH7B 4Z4FA 4DS3A 2J4FA 1XCPA 1NMEA 4H7DA 3OE4A 3FWHA 4HFRA 2ODBA 4TV8F 3V4ZA 4ENRA 1NXSA 2ZXUA 4GI5A 4C4SA 1N2JA 2JJMA 4JLDA 3HWRA 4UAUA 2NUAB 4DXHA 4FEEA 3WA7A 1EHIA 1YB1A 2UYOA 3A36A 4HGPA 4YP5A 1BCRB 1CUXA 1CQWA 3HWWA 3HKCB 5C8XA 3B5EA 3DH0A 1WM1A 4EEXA 1C14A 3UF0A 2ZIGA 3D4PA 5C35A 3PCRB 3LBNA 3WKDA 2D2IA 3CZCA 1U1EA 5JQGF 2IX3A 1WO8A 3FJOA 2E1RA 1O57A 1OTYA 3PNYA 2XMBA 4FFBB 1NTRA 2FGKA 3EGDB 3IHLA 3T7JA 5CHYA 1GPMA 2BIFA 2XITA 3GRKA 2Y1OA 3OTGA 3VFDA 3ET5A 4X1IA 2HJWA 3GXOA 4LRYA 3AI7A 4ETIA 1LPNA 4LBVA 4ZVRA 3ZYZA 2TMYA 1KI7A 1ZH6A 3NB0A 3BXZA 4QUDA 4AJNA 3CLRD 2ZBRA 1Y1KE 1QYXA 3K6KA 1USGA 1QGDA 2B21A 3NBAA 3DEFA 4MRPA 2GN2A 5HQJA 5IC6A 1LKZA 4D6YA 5LXTB 2ZANA 3I9FA 1IXYA 3WLMA 3TIVA 1JKIA 4P33A 5TDHA 4A1OA 1C0LA 4I8XA 1QV7A 3G13A 2HSGA 5B64A 1VLZA 3IAHA 3E6AA 3HVUA 5IJZA 4W5QA 5JQGB 3QVLA 4A27A 4DMGA 4WT7A 4EFKA 1GL6A 3ESDA 3LPNA 1G5QA 1Z35A 3P96A 1RC0A 4GLOA 2JAUA 4RVSA 1M8JA 2JGLA 1S02A 2LVBA 3FCOA 3NXSA 1YTUA 4BE7B 2VCYA 3Q9SA 2B3DA 4G4GA 4U63A 1QFZA 4LF7B 1R37A 2FLKA 3C8DA 3EFEA 4PCAA 2P9ZA 2WM3A 4DNFA 5JJKA 1VZ2A 1BX0A 1H23A 2GD1O 3H2HA 4JHXA 5DP1A 3BIOA 1YZLA 5B3JA 3IXLA 4DMFA 4EJSB 2HF9A 2K5UA 4YO7A 3CZRA 2QAGB 3KT8A 2J0EA 2I5PO 2ZYDA 4MDFA 1QFSA 2JI7A 2IFTA 4NF2A 3Q9LA 4C89A 1EEXB 4RXTA 1C80A 1V16B 3K0SA 3CONA 3ESRA 1AKEA 3UXMA 2EHJA 1H65A 4AVYA 4OQQA 1W94A 1ZL2A 3VISA 4MOWA 3JYQA 2AOVA 2CXOA 1EA5A 4G5XA 1UJ2A 5BORA 1DARA 4B45A 1OW3B 4FSXA 5BQ3A 4GEKA 4RLSA 4C3UA 1KPIA 1SURA 1NJ8A 3NKFA 3I9NA 4HNQA 4OYHA 4MB2A 4L3WA 3EVEA 1AXEA 2PWBA 3NM4A 3DBRA 5FBQB 5FOQA 5KPDA 4H1WA 3B7PA 4U7WA 4DLXA 2O7NA 1E0JA 3ABIA 3LCMA 3PJDA 3FMVA 1ZUIA 3C39A 5G40A 3WGGA 4RZHA 2G9QA 3RRJA 3USCS 3KJZA 2XAUA 4EW3A 1Q6YA 2ZS7A 4L6IA 2MSNA 5HOQA 5IANA 5LP6A 3DEJA 4PHGA 4EPTA 1TPYA 2CVOA 3UANA 2C1XA 4U2EA 4DDTA 3D3JA 3W8RA 2HLPA 1QYCA 3CKYA 4DZRA 1QB8A 3D64A 2FUKA 2I55A 2QTNA 3OLYA 3MM4A 3UB3A 5KUTA 1Z16A 3RAEC 4H4EA 3RS2A 1E0AA 2TS1A 4GI3A 3GRZA 4GUDA 2IHVA 3BMOA 1DKNA 2GHIA 2BD0A 4BVAA 3I01A 5KSZA 1N9KA 1GG5A 1DO0A 4QQ8A 4JLJA 3S2YA 3B1VA 4WWHA 2J3MA 3ZI0A 5B5SA 2BMFA 2BDEA 4JDUA 2BE9A 1TYCA 1LJ8A 2JFNA 3HR8A 3VR4A 2VA9A 3CZAA 3GLQA 5K09A 1A9OA 1AN0A 4IM7A 5TV2A 1QM5A 3KQLA 2PJRA 1G59A 2P4UA 4YUAA 1ZGCA 2CXQA 3I01M 3IELA 3M6AA 4QICA 4XW2A 3S29A 1BX3A 3UK1A 4DIUA 4BFXA 1UDCA 2VHZA 1N78A 3H3XA 3FHOA 1FSFA 2HF7A 4MTCA 1D03A 2HBQA 3A0RB 2XT6A 3NOQA 4FHZA 4NQRA 2F1OA 4C22A 4EH1A 3UUWA 3WLIA 2YWEA 4TLBA 4OJNA 5FOTA 3FSJX 2QQEA 1F5NA 4JCCA 5HZMA 2RGEA 3D6FA 4DYHA 3OOJA 2IHYA 3RM3A 1J8QA 1PW5A 3LPMA 5H59A 5KYKA 3NP7A 1XZGA 2BFEB 5BNWA 4D81A 1SEVA 1P6QA 4IFIA 4AF8A 3Q98A 1B1CA 3AEKA 3IUNA 4HQ6A 4O29A 3TCNA 3OECA 1BS2A 1NVVQ 2H2WA 4H31A 4UEKA 4G8CA 2E55A 3GIWA 2Z4SA 3HXKA 4K1LA 4ZQCB 4AUNA 3AHGA 4Y9DA 1ORVA 1RJDA 2AUMA 4G5RA 3BREA 3NRCA 1FTNA 3HXLA 4GFDA 5EMHA 1UKEA 1MO3A 4GX0A 2PUDA 1IM8A 3QNWA 1VKOA 3MLAA 3P8ZA 2KWIA 2OG1A 2BFOA 4A2PA 2GSWA 2H1FA 2LP4Y 4IGFA 5DM60 2BFPA 4RZUA 5GOZA 3IILA 3U9SA 2JGAA 1KBOA 4GEGA 3VKWA 2PZJA 3AT1A 1DQNA 3V1LA 3D0OA 4R98A 1JI3A 1CXZA 4URWR 1LF5A 1LS1A 4HEHA 3QEMB 1TCAA 3DOCA 1BW9A 3KV1A 4TQAA 5EXTA 3RAJA 1TEZA 3JPWA 2WILA 1LFAA 1HT2E 3ETDA 2ZZMA 2P2SA 5JE8A 2WSBA 1FUKA 2RBGA 3SQLA 4E4RA 1T9BA 4WXHA 3D7KA 3AM4A 2VRBA 4PEVA 3PXEA 4I9FA 1LB1B 4HAXA 4MVJI 4ZTUB 3FZGA 1GNLA 5L95A 1Y7HA 4RTNA 1MB0A 3BA1A 5FUYA 1KQNA 1SVIA 4FOSA 2BGIA 2CEKA 4RZSA 3UCFA 2GEDA 4F1WA 1BQ3A 3HBAA 1YBFA 1XTBA 1MU0A 1C3OB 2R2AA 2AQKA 1A8QA 3NBQA 4MUXA 3U1TA 3ZWWA 3MFYA 1VJTA 3V1YA 4H08A 3AF0A 2P6MA 5ESDA 1I94B 3T0GA 2QVBA 3DHNA 2A5JA 1LQUA 2C2BA 2JK1A 4FFMA 4QXAA 3V7YA 1PFKA 4QJBA 4CL8A 5FR2A 1CP2A 2XCQA 3PS9A 4YQYA 1MNQA 4KXWA 4A8TA 1GUZA 1AX9A 4OQMA 2JGDB 1C30A 2Y2UA 3ZHSA 3LK7A 4P32A 1MJNA 2E5WA 3FFWA 1XF1A 4OQLA 2FAXA 1XL1A 4QWMA 5EINA 5H02A 1XJ0A 4KQHA 1PZHA 4LGYA 3OU2A 1ZD4A 1TAUA 1N2CE 5KTSA 6LDHA 4AIRA 2R6DA 1ZESA 2X22A 4OA5A 2DUWA 1Q7EA 3DV9A 3EK2A 2DT5A 1RNLA 1Q21A 2AGVA 3KPJA 5AXDA 4GI2A 1B00A 1KO5A 2B2NA 3KU1A 3O6VA 4BZPA 5BUSA 1EX6A 3DC2A 3PQCA 4JL6A 2GMWA 1JV2B 2MYUA 2B20A 1FRQA 3DMTC 3OX2A 3AYZB 4MRMA 4PNHA 4XX0B 5F51A 1ZK2A 2A0FA 5DXJA 5DEIA 4G6ZA 3ZUPA 2PKQP 2WLSA 3H1EA 3W1VA 3NATA 5IM4F 1JVBA 1P45A 1N4AA 1V7PC 3LX8A 4C4TA 3GUZA 3TINA 3THYA 4GDMA 4KAJA 5GQSA 3FW1A 3GGPA 1OKKA 4BE4A 2ZEJA 3AG6A 4QQRA 5FDFA 4R2HA 3QYFA 1BMFD 4EX6A 4RTPA 3HXQA 3ND6A 1SQ0A 4JLUA 1FC0A 2Y99A 3KOUA 4KSBA 2IYXA 4PANA 2Q6KA 3FSGD 4ETMA 1K5GA 2PY6A 2F17A 1Y3AA 5BV1A 3KSZO 3SWWA 1GL3A 4I3GA 3TEJA 1VE3A 5C5IA 2AOUB 4GQIA 4D9FA 5DV9A 5BY2A 1Z47A 3HPRA 3Q9UA 1PT6A 3DW1X 4Y6GB 3R7DA 2JH8A 4A7PA 4X90A 1XDSA 2Q6LA 1K7CA 3NT5A 6ADHA 1TYZA 5KOJB 2YINC 3R5XA 5IN4A 3NJRA 1DRUA 2GPNA 1U5CA 3LW7A 1W4RA 2GPSA 3DCYA 4AI6A 2WWHA 5C4IA 5GOTA 4TMTA 2RHCA 3RYIB 3X1XA 3RC3A 3VYTB 3DOUA 2Y6UA 1XROA 2QVGA 3PITA 2VKQA 3IHWA 4U8GA 5EHGA 4BRZA 3PFNA 4RPJA 4UUMA 4Z7NB 3H6GA 1TOAA 3KB6A 5ALFA 4TT8A 4FZ3A 4EKYA 4JC8A 1M66A 1TLFA 2QP3A 1LLCA 4W9MC 5EJEA 3N9IA 1H85A 2UUPA 3T12A 2HCBA 3REQA 1JR3D 5IYZF 2ZR8A 5K9ZA 1PWHA 5AUNB 1IY0A 1FNSA 1BU5A 2JA2A 4NE7A 1PZNA 3UY4A 3DGEC 5HYVA 1LVGA 1UDRA 3CT4A 1N8SA 1P5JA 1VXRA 4IPTA 5D3KA 3SCZA 3SGLA 4G56A 4DLAA 3SK0A 4EGQA 4JBNA 3ZUGA 3ZQKA 1G0NA 4P4UA 1P6UA 3CF0A 3IO5A 1FRZA 3SEFA 3JVIA 1ZONA 3E8XA 2AE2A 3BBLA 1NX6A 1LPSA 1CUVA 3DLTA 1SUBA 2Q21A 4PVDA 3QWIA 2A5DA 3MUNA 1Y6QA 1X7YB 2FZEA 4O5OA 3ZU3A 2J3EA 3LQFA 3O31A 2XB4A 3TRJA 4U7DA 4BJHB 3DDWA 1B43A 3NX4A 2IH5A 4NNJA 2HPHA 1YFZA 2BMWA 2AXQA 2Q9AA 3TLKA 3VKGA 4GW3A 3X1ZA 4YALA 1I3KA 2XTJA 2FPPB 1BMQA 1G7SA 3A9UA 3ZWPA 3DE2X 2IYUA 4ZC8A 4HQRA 4RKRA 5A6SA 4AROA 5EHXA 2DXIA 5AJYA 3RNOA 2UUOA 4JI6B 2ZDGA 3KB8A 3NXKA 1HFEL 5FOSA 2FPMA 4G5HA 1WIWA 2BEVB 1C1HA 5K0NA 3RIGA 3U13A 5LDHA 4LQDA 1KO1A 3WGOA 4WESB 4DMRA 3HEBA 4RXMA 3HZRA 3DBOB 1BWPA 4RM3A 2GHTA 2WA1A 4WKCA 3L4SO 4CMJA 4G1VA 4AP6A 3FYTA 4YMIA 2OVFA 2H2HA 3T1OA 4ZN6A 5BVHA 3ER8A 4PCLA 3EVNA 1P60A 1EZ1A 4EBBA 5FXMA 2AG8A 2VHXA 1W5AA 3SJCA 3I4FA 3TSOA 4MW6A 1AA9A 2ZAMA 2ZIZA 2RHRA 3IX7A 3P9CA 1G18A 3LNCA 4H3HB 4LTNA 1VMDA 5J59A 1KYZA 5EZQA 1AQ6A 4XIGS 4CR8A 4NBWA 4Z8XA 5C53B 1A88A 5L3SA 4KFCA 2ZQYA 2BUAA 3EDCA 3GZ4A 4GP6A 3TIGA 1PFWA 3OD5A 3IEIA 5INTA 3CLUC 4N0PA 5GIPE 2PIDA 2WDPA 2WIKA 3H7AA 1O95C 2AIRA 3HR7A 4KQCA 1SM4A 5TQJA 3TBFA 1O4WA 3USES 1JHUA 1NC3A 4KWCA 5LDGA 4BO1A 4A1FA 1MG0A 5KDOA 2JIOA 3C6QA 3RBXA 1IB0A 2ZYTX 3EGIA 5CDSA 1J2JA 1TVEA 1EQAA 4QRIA 2DP4E 2Z6QA 5IK2A 1P1RA 2GBPA 5CG2A 1WXHA 4BNVA 3H8JA 1XDBA 1J0AA 3HU1A 4X8LA 2O2EA 2D7CA 4WACA 1V4VA 3SR0A 4JY7A 1EBBA 5CFOA 2ICAA 1U5BA 2UVPA 5I8PA 3QKRB 4HUJA 3TSAA 2PZFA 3TK1A 1GNVA 3T3PB 3DEKA 3NBYC 4EG0A 4AICA 1VGQA 2X8JA 1YK0A 4JLBA 4UE6A 1PX0A 5HKLA 3CN7A 3LG2A 4JUFA 1J2UA 3A06A 2NQTA 3B8HA 3T5TA 4PLVA 3AMVA 4UDXX 1VE1A 1LNSA 4X63A 2WAXA 4ZRMA 1PT7A 2IXEA 2YC2C 2VJAA 5TB5A 3CKMA 1R3DA 4XVCA 1DT5A 2OHGA 2R5FA 4FZVA 5CP8A 5KKCA 1YZKA 1A8IA