3A1WA

Crystal structue of the g domain of t. maritima feob iron iransporter
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
159
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 47
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1wA00
4B32A 1R8QA 3LAWA 4PPNA 2GEDA 2ATVA 3QKTA 1L7VC 4UXHA 5EXSA 2HJGA 2PJRA 1T0JB 5LPNA 4TSFD 4B6FA 5EE5B 4KYIB 4EPVA 4LYJA 2BBSA 3ONWA 2IUSA 2I1QA 1XTIA 4JYCA 4WXPA 4D4JA 2HLDA 3RLFA 3QF4B 2JATA 4CZ2A 2YWHA 3PFIA 4US2R 4XIGS 1YZNA 1G41A 2UZIR 1FNNA 1SKQA 2CHGA 4NYMR 3OE7A 3FPAA 4C2UA 2GCOA 2Q3HA 3CNOA 4EDHA 1IONA 3R20A 3L8YA 2BM0A 2VP4A 1FP6A 4EJSA 1KY2A 3L0SA 2G0TA 3UWKA 1UDXA 2QAGB 4QGGA 2FJUA 4JVMA 1IXRC 4TLAA 2MSCB 2I1VB 4PSVA 5K8LA 2GESA 1O3YA 1OFTA 5DHFA 4DSOA 4WVFA 2QA5A 1W7AA 1ZBDA 2QP9X 4AKGA 3IILA 1HT2E 1GM5A 1X6VA 4M9XA 3CB4A 1VECA 3K8YA 4PZYA 3EPHA 3SU8A 3ADCA 4AYXA 3B7GA 3HU2A 4A0FA 2GF0A 1KDPA 2OSBA 3K0EA 4RFVA 1COWA 4XVRA 1YZGA 5EUMA 3K9GA 3GEHA 3KB2A 3AVTA 4M1OA 2QGNA 2BBOA 4B3XA 4HUQA 5KNCA 3C7KA 3WYGA 1CJVC 1CJTC 2EFGA 3DZDA 1W2HA 1Z6XA 2VF8A 3K53A 1HV8A 4LK2A 4DSTA 1XWIA 4AK9A 1XJCA 4A6PA 2H92A 2ZI3A 4L16A 3ASYA 4DDWA 4CEHB 2XX3A 3DHWC 4M1YA 1A4RA 2IYSA 2R9VA 3UKDA 4TSFA 4GL2A 3RRNA 5SZHB 2F1RA 3RNLA 2ZEJA 3LQQA 5SZKB 1DOAA 1KK2A 2C9YA 4HATA 3TSWA 1EESA 2P65A 5EP2A 3EG5A 4NYIR 1IJFA 1LTQA 5SZIA 3CW2A 3W6PA 5LDDC 3LD9A 3SC3A 1W36C 1XDBA 2QPOA 3ICQB 2RGAA 1OFIA 1Z2AA 3FGNA 3REGA 1JAHA 2WWHA 1N5IA 3ZGXA 3OHMA 1IN7A 4JT2A 4AG6A 1OFHA 2WKQA 2R6CA 3U3JA 1FUUA 2VRWA 4IDHA 2RKOA 1FX0B 3GEEA 3IPXA 1E2JA 1F6BA 3T1TA 2QE7D 3ZZ0A 4J0QA 4W5WA 5CDFA 1R0YA 4R2HA 621PA 1QF9A 1WP9A 4OJKA 2CL7X 4LOAA 2QTFA 5DHAA 4AKHA 3FE2A 1G3IA 1W48A 4NYJR 4QBHA 4G0NA 2G1KA 3BB3A 4RZ3A 2IYUA 1Q12A 1BIFA 2W6JD 3QY0A 4KBFA 1K5DA 2BWJA 1SXJB 2W2TA 4LGMA 3E5HA 1ZMXA 1ZUIA 1D2NA 4NCNA 1NN3A 2ZVQX 1Z83A 3ZLJA 2KE5A 2ODWA 2VBCA 4LI0A 2ODBA 2DYKA 3MJRA 3KKOA 5F9HA 1YQTA 4EQ6B 3CNNA 2KJQA 3LFUA 1AKEA 2ZRJA 4TYPA 1T3SA 5FOUA 4D25A 1CXZA 4W5JA 1Z22A 4A2QA 4M1MA 1QHXA 3SOPA 5JCPA 3OEEA 3RWMB 5FOXA 2O8CB 2JDIA 1CF4A 4G5SA 4LRWA 1ELOA 1KI2A 2ONJA 3Q7QA 4N3NA 1RFLA 3GLFB 5IK2D 4QBFA 4TWZA 1FP7A 3U60B 3EIHA 5GVRA 4BLSA 3OZXA 3L8ZA 4CVNA 4O2LA 4AYTA 4MRVA 4XSGA 5IT5A 4ACAA 1SULA 1S3GA 3G5UA 3U7GA 3FMFA 3MWYW 5BYJA 4QGFA 2OILA 4JVLA 4NL4H 2Q3MA 4TN1A 3KXIA 3DZ8A 2ZE6A 2GVDC 2E1RA 1NSFA 2J7KA 4JBYA 2YKGA 4CEIA 4NH0A 3C5CA 2H18A 2R6DA 1W1WA 1XD8A 3U44B 3AVOA 2IYZA 1G4UR 2YZ2A 3QPUA 2FZ4A 4NE2A 4OYHA 4CYMA 4II7A 1G7TA 2ZUDA 5G53C 1H65A 2Q9AA 5JJIA 1CRPA 1JJ7A 3AP2A 3THXB 2R8RA 4KSCA 1JR3E 4KLNA 4LJ4A 4OHWA 1E2EA 3T35A 5FBWB 1SVMA 1T5IA 3X1WA 2XTNA 4IJMA 5HE8A 4F4IA 3A58B 1G1MA 3H84A 4JLJA 2O8FB 1IY0A 2VF7A 2QG6A 3G0HA 1R2QA 3OEHA 1E0AA 1OKKD 2YV5A 4B73A 4YQFA 1JAIA 3HYTA 3F8TA 2BC9A 4A2WA 5KUTA 2BM1A 1UPTA 1ZVQA 4F4CA 4C0LA 1P3JA 5KDLA 2PBRA 5KDOA 2RHMA 2G83A 2P67A 5FFMA 5KSPA 1F5NA 1M7BA 2V7QA 2FPKA 5P21A 3TRFA 1E99A 5KSOA 3B1WA 1I4LD 2QT1A 4RJLA 1I2MA 1I2DA 1VYTA 1X86B 3RABA 2JJ1A 4TLCA 5FTLA 4ZPXA 3W3AA 2AFHE 2RGNA 4HLUA 4QJ5A 2GXAA 4Q01A 4QRHA 1KSGA 1NMYA 4BPBA 1GRQA 4AWXA 4M1SA 3TMKA 4MGIR 1KK1A 1N6NA 2F3TA 3JZAA 3NEJA 3AF4A 2VH5R 1AGRA 1RJ9B 4NCIA 4KCGA 4B3DA 4BE7B 3QKRA 1W46A 3RRZA 1SVKA 2A5JA 4QNMA 2G77B 1Z08A 2XZPA 4ZDJA 5FBVB 4PR0A 3SQWA 2C96A 5FBLB 1UM8A 4DLRA 2QP4A 1LY1A 3R7WB 2PLFA 3MRSA 5GADl 4M8NE 4EFNA 1M2OB 2GK6A 2LCFA 1XRJA 5FTJA 3BAFA 3FHOA 4AD8A 4C0KA 2GK7A 1G19A 4F7WA 1SKYB 2ZUCA 4HZUA 1E4VA 2O0JA 5EZ5A 2RGCA 3AM1A 4DB4A 4UNQA 2HT1A 4TQ9A 2FGKA 1P4SA 3DEFA 2JJ1D 2P6NA 3U4QB 2YYZA 4TLBA 2AFIE 4BLRA 3KQNA 1BH2A 4JLBA 2V7QD 2ZJAA 2IYQA 3W8NA 2ZPTX 1ZRHA 2GETA 5GJCA 2FFHA 4LHYA 1RRFA 2OCAA 2FFBA 4DLSA 4KVGA 3K0CC 1G7RA 1GITA 4LPKA 4BLTA 1CU1A 4U02A 1N5LA 3X1DA 1BYIA 2FEMA 3MD0A 2O5VA 1OKKA 4NBSA 4XVUA 4BGDA 4H1UA 1BO6A 1N2CE 2CEAA 3C5HA 2CK3D 3SJAA 4TYNA 2WJJA 1II8B 2KB0A 5TDHA 3CH5A 4RD0A 3NKVA 1JEDA 1WXQA 1COWD 1VCOA 5KNBA 1GG2A 2OFWA 2HXYA 3CRRA 3NIBA 3PUXA 2IUUA 5HR5A 2Z4RA 1IHUA 1NMZA 2BKUA 3VX3A 2GXUA 2ZJ8A 2QBYB 1RPZA 3HPQA 4PAQA 2LKCA 4BEJA 3T5DA 1AZTA 4TQUS 1KI7A 2YNMA 3P20A 2J3EA 3T12A 1T91A 1E9AA 5JRJA 4KO8A 2XXAA 1S0UA 1Z0DA 3AVVA 3I62A 3H2YA 4O0MA 4JJKA 2W2XA 4QG7A 3TE6A 1CRQA 1VYVA 3THWB 1A2BA 3QQ5A 2G1JA 2Z0MA 2FH5B 1GAJA 5F2EA 4UNRA 3GLFE 2ATXA 3PIRA 1VKJA 5FUWA 1QDEA 4Q1BA 2VP6A 2B8WA 3VR1A 1TU4A 4X8HA 5KTYA 3THYB 1UBGA 3IEVA 4IXMA 1G6OA 2ZRKA 4N0DA 4QHSA 3ZIAD 1T0HB 4MH0R 4DLYA 4B3GA 2AWNA 4L4UA 3ZZUA 4QM6A 2BKEA 1I4DD 2J87A 3BFXA 3S1AB 1YR7A 2ZE8A 3DOFA 3W5JA 2FN4A 1TPZA 2W0SA 5JZVA 4MA4A 3LNCA 1NMXA 1P7CA 1E2DA 2QZ4A 2PZFA 3PXGA 2EU8A 3P32A 3UPUA 4JLOA 1R4AA 1YZKA 2GJ8A 2WWFA 3L0OA 4OI2A 1AK2A 4PANA 2N1BA 3R9IA 2IK8A 1F2TA 4PQYA 5KU1A 1GL7A 4DKXA 3EX7C 1VCIA 4G5RA 2HYDA 1NLFA 4DDUA 1NVUQ 4KXFB 4UNNA 5AUOB 4Z8XA 4DSNA 4D81A 1R10A 2OT3B 2QMHA 5E7JA 5DI3B 5EZ6B 1DAIA 1GSIA 1MABB 2D2EA 2JCSA 2JLZA 1CEEA 2WIAA 1KMHB 1OW3B 3VHLB 1VHLA 1AIPA 1KNXA 2G3YA 5JI2E 4PHTA 4XOIA 4EPXA 5EE9A 4TMTA 3LV8A 1SHKA 2GXQA 1Q44A 4LX0A 3ZZTA 1VHTA 3ZVMA 4BFVA 5G40A 4TTPA 2W83A 4O2RA 4NYJQ 2DWQA 2CDNA 1UFQA 1OPXA 1S3SA 2O8DA 4I1SA 5CLLA 3C16C 2V9PA 3OFNA 5AJWA 4IEIA 2VYFA 1D9XA 1SXJC 2OBLA 3B60A 4LV5B 1Z5ZA 3A8TA 3TSOA 2DWOA 2NO0A 3KL4A 3TAUA 4C0SA 4I81A 4DUGD 2NPFA 5IRCD 4B2IA 4RSGA 2CLSA 2HCBA 2WJHA 4FMCF 4Q18A 4BLQA 4LJ5A 4I99A 2DB3A 3SZRA 3CF2A 3LA6A 5TMPA 4PSKA 1IN4A 4YMVA 2F9LA 4GZLA 4M1KA 3I4LA 1MO4A 3NBZC 1OYYA 4IHQA 3PUYA 3OF5A 1KI6A 2ODEA 2C5LA 5HTKA 3AKEA 2G9NA 1S96A 4DLTA 5JS7A 3NTUA 3LVQE 1UBCA 1S1CA 4IOMA 2VIIA 3I8SA 3SJBA 3N5CA 3EZFA 4OHXA 4JL6A 2BEKA 1EFRD 4ZDWA 3FMOB 4ABYA 3KQUA 1CR1A 3AKYA 1EK0A 2XNDA 5TARA 3AH8A 1C1YA 5C1BA 2HV8A 2ANCA 5EP1A 2H7VA 3CZQA 1SKYE 4RZ2A 1ZP6A 3OAAA 3EC1A 4RFSB 1N6HA 2NOAA 2XZOA 1OIXA 4YC7A 1EFUA 4Q4AB 2IF0A 4G3XA 3RSLA 2ODNA 3T15A 4A36A 3U3OA 4PPGA 3TK1A 4C0JA 1IN6A 3B82A 3GQBA 3SEAA 3U2QA 1YZUA 2D7DA 3WBJA 2BMFA 4EJSC 2ZS9A 2BVNA 1C4OA 3SR0A 5CJPA 2BHRA 2D4HA 3N2EA 4ZCMA 1G3RA 1Q21A 3BBPA 2UKDA 1HQYE 3T34A 4AC9A 1ZM3A 5JWOA 2P6UA 1G21E 2PH1A 4RCZA 5DO9A 2ZJZA 3LRPA 3GLGB 2EFCB 3A1UA 3WYAA 4M21A 3PR1A 2AXNA 1P61B 5B58C 2C9CA 4HDOB 5B30A 1E79A 2QPTA 3KKMA 3OEED 2QUZA 3O8DA 1SGWA 3KFXA 5L3SA 2EFEB 4XH9B 2OBMA 1XEXA 4OK6A 3A1VA 3GFTA 4NYMQ 2B21A 4B2LA 3I32A 4KHZA 1O87A 4PC1A 2XB4A 3VU9A 4P3YA 1W2GA 3QF7A 2AD1A 1W0KA 2R6GA 3QUSA 1EX6A 3ETLA 4RKEA 4URYR 4DUGA 3EZ9A 3O8CA 2Y8EA 3MAAC 4PPQA 5D3MA 1KKLA 2FA9A 1ZCAA 3M6AA 2QTVB 5BQ5A 3IQXA 2PL3A 3RDPA 2QGZA 1DAKA 1VDZA 2A9KA 3IIJA 3PUZA 2IYWA 3KJHA 3DPUA 5HE9A 3CNLA 1SXJD 3SN6A 2F9MA 4BLPA 1JXOA 3PEUA 2J46A 1N0UA 1AZSC 3LX5A 1DAGA 4MRNA 4BUJA 3WNDA 4HB0A 1WBDA 2IS2A 2VHCA 3IIMA 3ICEA 1E3MA 3GMTA 3VMFA 6Q21A 4JL5A 2R6AA 3A36A 5JECA 4TMVA 5HCIA 3GCGA 1DG1G 1SVWA 1P9RA 3CX8A 3OIUA 2PMDA 2FMXA 2QE7A 4ARZB 3PUVA 2GAAA 1G20E 3BE4A 3TKLA 2ZRMA 1GRRA 3NC1C 4D4LA 1R8SA 2XSZA 2GBLA 1XTQA 2ORVA 1VCNA 1GDDA 1II0A 1EWRA 4UXJA 3UWOA 2JIZA 4ESVA 4C3ZA 2BOVA 2JAQA 4B6EA 3ZQ6A 1MT0A 2HF9A 1W36D 5CYPA 1LS1A 1P6XA 1W4CA 1X1SA 4IVQA 5E7IA 1XCPA 1Q1QA 4BFUA 3B13B 4FD2A 1N5KA 2J5XA 4ZCIA 2H1LA 4Q7MB 2OUKA 5M04A 1II9A 4ESHA 1M34E 2AKYA 4OI0A 4ZCLA 4DCTA 3BIFA 4Q4LA 2X2EA 4B43A 1SVIA 1OSNA 3KDSE 3I92A 4NKRA 4E09A 1ONBA 4MRSA 4PC7A 3BORA 1G291 1P62B 5J40A 4XTRA 2CMKA 5FL3A 1FTSA 1D5CA 1JEEA 4DHEA 1SVSA 2CCGA 2VPPA 4G5OA 3BERA 4URWR 5CB8A 1AQUA 4DZZA 2C8VA 2QMOA 1WQ1R 1XX6A 3AF2A 4Z1MA 1W47A 4M9SA 4FMCB 1E2IA 2V6JA 4FWTA 2GZDA 1J2JA 1W49A 3H0KA 1NIPA 2GHIA 4PAMA 1QHNA 2ANBA 5JJLA 1P72A 3CF0A 3GFPA 1G6HA 4HLCA 1TEVA 4IFEA 2AL7A 1CKEA 4AKEA 2ZI5A 2ZS8A 4LV8B 2QI9C 1Q0UA 5BXQC 1KHTA 2D7CA 3LH5A 2XNSA 5FOSA 2DBYA 1GOTA 3U6KA 2I3BA 3QKSA 3T1OA 4CT4B 2MSDB 4DXAA 4QNRA 1ZCBA 3U3KA 3BS4A 1M8PA 3QEJA 4Q1EA 1G8PA 1RKBA 3MG9A 4M53A 4A6XA 4DEYA 4XVQA 1ZW6A 1Z0IA 4JL8A 5J4KA 2ZYTX 1Q57A 3OE7D 1Z06A 4JLKA 5CLQA 4C30A 1NN5A 2B7CA 4CGZA 5F3WB 2VSFA 4OHVA 1CR2A 2P0EA 4UJ5A 4IEEA 4MGKR 4M4SA 3CPHA 3DVLA 4RD4A 1G5TA 3EARA 3QENA 4PHHA 5FPTA 2UVQA 4KFSA 3V4FA 2ZRAA 2DFTA 3AF1A 3GLHB 4Q9JA 3V4RA 1ZJ6A 3Q85A 1E1RD 4NU0A 2KBFA 521PA 2J45A 4Q48A 1AJEA 1ESNA 2V8OA 1TTTA 1F2UA 3EPKA 2YWFA 1SVOA 3VQTA 3O8BA 1FQKA 3SHWA 3FWYA 4OI4A 3KKNA 3FMIA 2NGRA 4GP6A 4LC1A 1N25A 5DLQC 1XMJA 2F1HA 3QIAA 2GVZC 3IQWA 1LF0A 3CONA 1J99A 1JNYA 4A92A 2ZUBA 1UDWA 3BFKA 4C9BA 5B2ZA 4A0HA 3V9PA 4DRZA 1XTRA 2BDTA 2B6HA 3UMFA 1S9HA 4S35A 2C77A 2PMKA 4IDNA 1U90A 1KSJA 3ZYCA 1UAAA 4MUAA 4LHVA 3CUEF 3AVPA 1Q22A 2AX4A 2QPAA 5JHHB 2GXSA 3AVYA 5G3YA 1ODFA 1NLYA 3HJNA 3VAAA 4EFMA 4IVRA 5HKKD 1UEJA 1IBRA 1NJGA 3C15C 1P2UA 2PX3A 4Q9IA 2V1XA 3WMEA 1KK0A 1S4QA 1TF7A 5J5CA 2NO9A 4O25A 1Z0KA 4B2PA 1P9WA 3P4YA 2XOKA 4NHOA 1ZM4A 4POAA 2AXPA 4DCVA 3RS0A 1XTKA 1IN5A 4HLUC 1VG8A 3WMFA 1TL7C 4L9WA 4QGAA 4F4JA 1X8JA 4I4LA 4JIMA 3J81k 2J0UA 4LJ8A 3TVDA 2VP9A 1Z6TA 4EQ6A 1TF5A 1KDRA 2BCGY 3LXXA 5GJVC 1VPLA 2V54A 1E2NA 4N1AA 1U0JA 4LBZA 121PA 2ZJBA 3T61A 1KK3A 4L15A 1PV4A 4WW0A 1E2PA 4C7OA 3OEHD 3TAHA 4JSYA 3UK6A 1KI6B 1A5TA 5TB5A 1SQ5A 2D2FA 2OCBA 4EPRA 4IDPA 3VR5A 3FDIA 3I72A 1MV5A 3WNCA 2ZJOA 3HYRA 2H5EA 3TW8B 2ZM5A 3RYTC 2WZQA 4LBVA 1UADA 4DBLC 5J4YA 4EPTA 3DKPA 1NN1A 1BOFA 2VHTA 3D8BA 2IYTA 3SDZA 2JLUA 2OFOA 3UXMA 2B92A 2C9OA 5KYKA 3U5ZB 4KV9A 1P75A 3SQXA 4Q7KA 1R0WA 2QTHA 4OKSA 3NH9A 4D6PA 4OHZA 3UIEA 5KSYA 3K0FA 1R5OA 1U8AA 2NO1A 4DCNA 1US8A 2P6RA 3L82B 4YXWA 1DEKA 2OO7A 1NRJB 1W0JD 2PJZA 2DHRA 3QXHA 1QVAA 1FQJA 4D0NA 1HQCA 1AKYA 2IUTA 1E9RA 2REXB 3EAQA 3K9LA 1CBUA 4Q03A 1KKMA 3WP1B 2Q3FA 4IDOA 1PZNA 4A2PA 3BXZA 4EUNA 1P73A 2FPLA 3FHTA 2WICA 2OCPA 1J90A 4BQSA 3CRW1 5IK2A 2ZVPX 1SXJE 2IXEA 2IS6A 5HZKA 5FUYA 4KBGA 2O8FA 4US1R 4TLDA 5L3QA 1LNZA 1R0ZA 4UKDA 2JGNA 4QM7A 1VG0B 4W5HA 4Q7JB 4RZXA 4Z8YA 3LO5A 3CWQA 3A4NA 5ANRB 4QFMA 3AP1A 2JJ2D 2ZI9A 2GDJA 4FCWA 4GOKA 3QE0A 1TQ6A 1KAOA 2IXFA 4YLGA 3VR4A 1D9ZA 3H4MA 2QMEA 2GTPA 2X8AA 2FPMA 3ZDQA 3DL0A 4HZIA 2GEUA 2W6ID 2EVWX 1H8ED 4JLPA 3TGPA 2WAXA 3LDAA 1DARA 2XB2A 2ZRPA 4CRWB 2O8BB 4BECA 1KI3A 1GWNA 4C2TA 3EWSA 4AKIA 2VLIA 4JS0A 2W6JA 2GILA 1NY5A 3BD9A 4PQRA 1RYHA 4YDSA 5HZHA 2EYQA 3LBHA 3NHBA 3Q8XB 2V4ZA 1FFHA 1VG9B 2BMDA 3LLMA 2XOKD 4NPHA 1GKYA 4PSAA 1E0SA 1G7CA 2WSSD 3F0TA 3TNFA 4FIDA 3BGWA 4A8JC 3LW7A 3VR6A 3VTKA 1KNQA 1NVVQ 1FNMA 1TMKA 1OXXK 5LB2A 1E9EA 1HE1C 1U0HC 2FWRA 4KVAA 2ZE7A 3R7WA 3QF4A 1ZIOA 5JEDA 1JR3A 2JLVA 1KO1A 5CIQA 2PEYA 2MSEB 1AS3A 2NZ8A 3HWSA 3PQCA 4FCVA 2EFDB 3KQKA 1NVWQ 3BRWD 1NLZA 3WMGA 2ZREA 1E9BA 4O3MA 4OQNA 4DDTA 1OE0A 3K9NA 1M74A 1YR8A 1N6OA 3IHWA 3GJ6A 2A30A 1NL3A 1B23P 3LLUA 1FZQA 3KXKA 3NHAA 2DFNA 2WJIA 4KFTA 3PCRB 4Q00A 1XPRA 1VIYA 3E1SA 2OZEA 1QG4A 3GLGE 3GP8A 1GNQA 821PA 3GJ3A 3VKGA 4B35A 3FHCB 2VHQA 1X8LA 2RHDA 1E2QA 4JLVA 3X1ZA 5FOWA 1E0JA 2D62A 2VO1A 3TLXA 1JBKA 2ZYUX 4A0GA 4B3CA 5JBQA 4NMMA 3WBKA 2GWHA 2R62A 5AJVB 2AKAB 3ADDA 1E9SA 4B71A 2IC5A 2A7QA 2YOGA 4LJ7A 4G5QA 5DISB 1R6BX 4TYQA 1ZD9A 4KFRA 1G16A 3GJ8A 4JVSB 3AEZA 2IF2A 2ZSFA 3CH4B 1KSHA 1DE0A 2D06A 3DMNA 3IKJA 1Z0AA 1G5RA 2YVUA 3QG1A 2WBLC 3O47A 3B2EA 3BH0A 2AWOA 2W00A 4MKIA 2EQBA 1OFUX 2H17A 1A1VA 2HYIC 2QBYA 2XGJA 1ZNWA 5DH9A 3RS4A 4DLVA 4LHWA 5H1YA 1MO6A 3I1FA 4LC0A 1FL9A 2CVFA 3QXCA 4HLQB 1DS6A 4QKQA 1NY6A 1DAEA 5FBQB 2C2HA 3N70A 5AR1A 4D0LB 2ZAMA 1R5BA 2ORIA 2XXAB 1N3BA 4B74A 2ZS7A 4X8LA 4P4TA 5JHGB 2QROA 1SZPA 3W5IA 4V0LA 2LWIA 2NIPA 3THWA 2REBA 2WPDA 4A1FA 2F43A 4TTQA 2BBTA 4PAOA 2NPIA 4B44A 1ZC3A 2BIFA 5JS8A 1BMFD 4R9UC 2PLRA 3HU1A 2XJ9A 4IVPA 4HUTA 3R8FA 1FUKA 5CB6A 3HPRA 3DOEA 1PVOA 4HB3A 2X77A 3ZVNA 2FFQA 4DSUA 3RS3A 3D7MA 1D2MA 2OG2A 1T6NA 2R44A 2RB4A 1GUAA 4GP7A 1LF5A 3B9PA 4PC2A 5EJEA 1H8HD 5FUVA 1KDTA 5TY0A 2QNRA 4BRWA 3E70C 1ZM7A 2C03A 2QL6A 4GRAA 4QHYA 5FUXA 1DO0A 2XAUA 2GJAA 3FFBA 4E07A 1TEXA 2DFKB 1GIAA 2WWIA 2NQ2C 4FMDB 4A8JB 2FZLA 2QU8A 3DM5A 3M0EA 4I1VA 2ORWA 4D80A 2IYVA 1C9KA 2WSMA 1KI9A 1E2HA 3MCAA 1E2FA 2OM2A 3K70B 4WA7A 2CBZA 4ASUD 1KI1A 4X8MA 1XEWX 3LQRA 4XTCS 3I73A 5BN4A 4X8OA 3NWJA 4DEXA 1L4YA 2OESA 1E69A 4Y0VA 1FMJA 4I1UA 5AJZA 1J7KA 2AD5A 2RGXA 4QXAA 3UMRA 2QY9A 1WRBA 4QBIA 2XEXA 3IDQA 1G8GA 5SZJA 4WBSA 3AVXA 2FNAA 4XSHA 5FI0B 2IW3A 3IPYA 4NDZA 2O8CA 1GNRA 1T9HA 3R8CA 4US0R 3B78A 4DC9A 2RGEA 4FW9A 2N46A 2LKDA 1T5LA 3QXJA 3ZD7A 1NP6A 4NONA 5KDDA 2EFHB 2HJVA 2YHSA 3EPLA 4W9MC 1Q3HA 1YR9A 3I8XA 4DT1A 4DDVA 1NBMA 2MMCA 2WV9A 1Q3TA 5DE3A 2DCUA 1OXUA 2QAJA 4G5GA 4TQAA 5CM9C 1E9FA 1IOZA 1N0VC 3CR7A 4LDJA 4B34A 2GJKA 3EXAA 5CJ2A 3FKSD 4PPFA 1J8MF 1XPUA 4Q4JA 5JSZA 3EZ2A 2ZYWX 3W34A 4H9GA 3MWKA 4C0QC 4ERNA 5FL7D 4URUR 2WM9B 4JJZA 3P27A 2WKPA 4ZDIA 3FKQA 4RVCA 1F48A 1N5JA 1EXMA 3M1IA 3IBYA 3QJYA 4GNKA 2XTMA 1LFDB 1GTVA 5HCNA 2IHYA 2DY1A 2Q9CA 3ZVRA 5DN6D 3LBNA 3NEYA 3DMDA 4IDQA 4FN5A 2H16A 4YMSA 1Z2CA 2ZTSA 4Q9LA 2QM7A 1Z29A 2IT1A 4WXRA 1UJ2A 1E96A 4PHFA 4EAQA 3I3SR 2PT5A 2IYXA 1N0WA 2K5UA 3AUXA 4B75A 3W6NA 2IWHA 1OXVA 5B57C 3QPVA 1KIMA 1CJMA 1W5TA 2F1IA 4OBEA 3OIYA 2RAPA 4JBXA 4TYYA 2DFLA 1G8FA 1GNPA 1AA9A 1KO7A 2ZR9A 5CDFE 2YWEA 1Q1ZA 1UKEA 1TF2A 4Q19A 4YONB 1WB9A 1WCV1 1JPJA 3CPEA 2OE2A 3BJIC 1QHIA 3SHFA 2ZSBA 3C41J 2BJVA 2ZITA 3ZQJA 4RD3A 4PC6A 5BN5A 4IKEA 2GCOB 4HI0E 3SI7A 3GLGA 2OAQ1 1UBEA 2ZAOA 5DN6A 4F93B 4CW7A 1D6JA 1CP2A 4JLAA 1G4AE 4DCSA 3IO3A 1XB2A 4AY2A 3WHKA 4OL0A 1U9IA 3KJIA 1KO8A 4HDCA 3CRQA 3D31A 1GP2A 1KTVA 1XEFA 1K5GA 3VFDA 3VU9B 1HA3A 1XXHB 3RS7A 2NZJA 4TT3A 4BRUA 1W4AA 3TW4A 5J47A 1VTKA 4B3BA 1AQYA 1D8TA 2VHJA 2W0MA 1R7RA 2VSXA 2QSZA 4WIAA 3B8HA 1XP8A 1GL9B 2IWRA 2Z43A 1TUIA 1VCMA 5CK4A 2O8BA 1XNJA 1OH6A 3MUFA 3R9XA 2CJWA 4WAUA 2P3SA 3B1XA 1G9XA 1TQ2A 2A3RA 2AK3A 2KSQA 3HDTA 4TL7A 3K70C 4GT1A 1W36B 1IXZA 5GVSA 3QBVA 4XD7A 4B76A 3THYA 1ZC4A 4V02A 1RE0A 2QM8A 4Q66C 3OFND 4RZUA 1JR3D 4HAYA 3PENA 5K8IA 1OJLA 3HR7A 4PFSA 2WMOB 1U94A 2WWYA 3UANA 1MO3A 3ZS8A 3K09C 4QJ3A 1IY1A 1U99A 1XZPA 1E1QA 1DG3A 4TZ0A 1OXSC 1M7HA 1OHHD 3QPWA 4GSYA 5BN3A 5HKKA 1T3LA 2QQ0A 1F2TB 4XD7D 5FBRB 4ZI3A 2V3CC 2J41A 2KI5A 1KYIA 3HU3A 4QJ4A 1Q1EA 3BWDD 3L2OB 2OHFA 4BFXA 3GLHE 3Q5DA 5TV2A 1JJVA 1TU3A 4CEJB 221PA 3SJCA 2GJ9A 1RRCA 1E9DA 2OXCA 5AUNB 4EJSB 4ZIRB 1CLUA 1U98A 3MGCA 4TT3D 1SVLA 4HEJA 4BFZA 2ZRDA 2EWWA 2WVJA 2J7PA 3GJ4A 3NC0C 3ADBA 1U81A 2ZJ5A 2ERXA 2X2FA 2ZI6A 2ZSDA 1Z47A 1NG9A 1AM4D 1EFTA 2RMKA 2J9RA 4JZKA 2WOOA 4S2EA 3VHXA 3HR8A 2O8DB 4BZQA 1UBFA 5H68A 1I4TD 1KOFA 3GLIE 3U7FB 3PG5A 4MRRA 2PX0A 3K0AA 3BB1A 1DVRA 4M22A 4TL8A 5B64A 1ZINA 2DR3A 1UKVY 4K81B 2V1UA 3KUDA 3KTAA 2YOFA 4GFDA 4ZO4A 4EKDA 1OH5A 1GKUB 2IL1A 2GJSA 3QEOA 1KI8A 4AIIA 3RANA 1T8TA 2VHUA 3OIVA 2JLRA 4LWZA 1IY2A 3A4LA 4YDHB 4XWKA 3G82C 2MMGA 4V0NA 3KQHA 3QKSB 1XD2A 4CEHA 1MRNA 2FU5C 2QENA 4QGHA 4EPYA 2CHVA 1UKYA 3MLEA 3MSXA 4V0OA 5E3HA 3WHLA 3RSOA 4KODA 5CITA 1TQDA 2FFAA 2IA5A 1Z6YA 5FTNA 1NBME 2HUPA 4MGYR 3RRMA 1MRSA 4DJTA 2JLYA 5KHOC 1A2KC 4JLMA 3KXLA 4D2IA 4XWOA 5L3VA 1QHSA 1Q20A 1MABA 1XMIA 3AKCA 1IN8A 2A5DA 5FL7A 3GLHA 1KMHA 1FX0A 2ZJYA 1OF1A 4Q02A 2FSHA 4HB2A 4W7SA 5FR2A 4EFLA 3C8UA 4CEIB 5FI1B 3B85A 4Q4AA 4TZ6A 1Z6AA 4OK3A 1X8KA 3IGFA 3HP1A 3U44A 2A2ZA 1J8YF 4EPWA 3U3RA 2Z6VA 4TLEA 5DGXA 5FPYA 5GJWC 4AYWA 4JBWA 3PV0A 4OQLA 5KO2A 4FINA 4RCYA 2E9SA 3T5GA 3FMPB 3R9WA 2ZU0C 1K6MA 5CM8B 1YZTA 1ZIPA 1JPNA 1CULC 3BH7A 3I5YA 1EG7A 3SE0A 4D4MA 4RD1A 3GLIA 3EWAA 2IYLD 1M1YE 2BJWA 2CNWA 3T1VA 3Q7PA 4DLXA 1HT1E 1P2VA 4P33A 3VKHA 1IQPA 3F3YA 3QBTA 5L3SB 3BH6A 4P4SA 1G8HA 1L4UA 1DAMA 4RD2A 8OHMA 1P2TA 2O52A 1PUJA 4MQBA 1NKTA 1X1RA 3CO5A 4A82A 4Z54A 5IHPA 1QG2A 3PEYA 2FX3A 2ZRGA 3AUYA 4DLUA 2FF7A 4CT5A 1NNEA 2ZRLA 5J4VA 5D3MB 3GLFA 2IS4A 3O8RA 4OQXA 4MDFA 1YZLA 1HH4A 1JI0A 1DAFA 1GZSA 1OIVA 1XD9A 3MJHA 4KFUA 3PVSA 4LCBA 3ECCA 3KX2A 3SYLA 2J0UB 4P0TA 2W2VA 3TBKA 1KMQA 3KQLA 3U3MA 4F91B 2R2AA 2NO7A 2YJTD 5C18A 2FDCA 3CBQA 2CLCX 1H8HA 1NI3A 2QAGC 3OIWA 1W0KD 2EYUA 4IOKA 3TUJC 3A6PC 5G3ZA 1YRBA 3RS5A 3EW9A 4DIEA 3QNUA 4FMBB 2JASA 2JJ8A 3L0IB 5AWFC 4OI1A 5HPYB 2REOA 1MR3F 1DTSA 3H1TA 4LJ9A 3BK7A 4E22A 1XCMA 5LD2B 3CR8A 1FMLA 2CL6X 3PEVA 2RH5A 2GEVA 3DM9B 4HZUB 4K8OA 4JMPA 4K46A 1TUEA 4FI3C 1P9NA 2CE7A 3TR0A 3W6OA 2JLWA 721PA 1U0LA 4QL3A 1EFCA 1VMAA 2V6IA 1HTWA 4WOPA 1GKIA 2OEPA 4GMXA 5FPHA 1ZUHA 5LB4A 4HAVA 3TIFA 1S8FA 1ZM9A 3MWLA 1XJ0A 1ZNZA 3WXMA 2YOHA 2ZR7A 1TX4B 5FPKA 1PLJA 4LYAA 3RRYA 1W0JA 2R65A 4NCHA 4NCJA 3EASA 1ZNXA 4LJAA 4Q9KA 3K0SA 2PCJA 4JYBA 2FSFA 1KY3A 4R2IA 5E4FA 2J0QA 3B9QA 1U9IC 4MYCA 4TYWA 1L8QA 4GOJA 4YMUA 1QVRA 4DIDA 3SFVA 2FOLA 1U2RA 2EW1A 3QVVA 1G7SA 3OAAD 3ASZA 4TMWA 3V00A 1ETUA 1GFIA 1LVGA 3Q3JB 2WKRA 2P5SA 1KSFX 1NJFA 2F55A 2BV3A 4KSBA 4HUQB 4ZV4A 1D2EA 1T8UA 3B1YA 5JFGA 3LY5A 3K9HA 2A5FA 1DPFA 1YR6A 1QBKC 2QQEA 1ZUNB 1G3MA 2ZSEA 5FOVA 1RJ9A 4OQFA 4AG5A 3QKRB 2ZIAA 1NN0A 3CF6R 4LPSA 4E03A 1OLOA 2C78A 2FE4A 2J7PD 2TMKA 4LYHA 2JDID 4DVGA 5J4HA 4M9ZA 2IHBA 3SS8A 1RYFA 4FXPA 4LY6A 3E2IA 4LBYA 3A1WA 3F5FA 3FKSA 4JVNA 1OXTA 2FG5A 2F6RA 5EP4A 5IF9A 1OB2A 2NTYC 2D74A 4C0BA 1RRPA 3VNVA 1KAGA 3IO5A 5A4JA 4C4PA 2GKSA 2A5GA 3BFVA 4QBGB 2OV2A 2VEDA 4JT4A 3QSYA 1AN0A 1QHHB 1WE2A 3M4YA 1EX7A 2Q21A 1DO2A 1A7JA 2HXSA 2B8TA 3EA0A 2ZU6A 3GD7A 5C4GB 3KZ1E 2J1LA 2ZANA 2V55B 3QVUA 2XSZD 1UKZA 3AV0B 3ND8A 1E1QD 4AI6A 3WYFA 3S1AA 1EFHA 5FPSA 4NP6A 1DAHA 4F92B 5K8TA 2GBLC 1Z28A 5KSZA 3OESA 1F2UB 4B48A 4JLNA 4KLZA 2J0VA 1WA5A 2IBMA 4U7DA 2NG1A 4Q4HA 4KYUA 1WDTA 3CRMA 3CRVA 4NYIQ 4R71A 3KKPA 5EXXA 1II8A 3WP0A 5KNDA 1TAGA 1NVVR 1SXJA 2HF8A 4YMTA 1XTSA 4PX9A 4GMDA 4B3FX 3TQCA 4DB2A 4P31A 1JECA 1ZD8A 2ZYVX 2A78A 3GJ7A 1E94E 5GJBA 4KI0A 2QRNA 1RRGA 3U7EB 1CJKC 1ZYUA 3K1JA 4ZIRA 4KAXA 4EIWA 1Y3AA 2PZGA 1XCGB 4YMWA 1OH8A 3L43A 4UQOA 2FV8A 2AHOA 5A5GA 2Q6TA 4D82A 1P60A 1Z6GA 4L9SA 1ZD1A 2OLKA 3D6TB 2N42A 1E79D 5IDVA 4Y0AA 1G3QA 3EZ7A 4CIDA 2WIBA 3WRXC 1XXHE 2J59A 5JJKA 2HT6A 3SJZA 1G5PA 4XJXA 3ZIAA 2ZRNA 3B6EA 4URZR 3EZ6A 2GCNA 3K0AB 5EE1A 3PUWA 1PUIA 1BMFA 4IW3B 2FSIA 4M0LA 1CS4C 4OQMA 2QRZA 1FW6A 1G64A 2QORA 1VIAA 2WPDD 3CLVA 4U5XA 3VNUA 3FTQA 1JQJC 1E4YA 1N6KA 5FH9A 4Q1CA 3GJXC 1Z8FA 4MRPA 2VA8A 2VQSA 3GEIA 2O0HA 5E95A 3TVTA 1XD2B 2GNOA 4MUBA 3A1TA 1AS0A 4HB4A 4MYUA 4OK5A 1Q1BA 2ZRIA 4C7OB 4WZAE 5G41A 4Q9HA 3TUIC 2CXXA 4LHZA 5FTKA 2WWXA 4H1VA 4A15A 4M9QA 4URXR 4BFYA 2G88A 1W5SA 3ND9A 1CR0A 1W44A 2OLJA 4JKIA 1XEWY 4V0MA 2WTUA 1NIJA 1MO5A 2XNDD 2F1JA 2IEZA 3JZMA 4R98A 2Z5FA 3NDBB 1Z0FA 3UMSA 1DBSA 1GILA 3AP3A 4D0GA 2UZ3A 2ZI4A 3K0FB 3IEUA 3C4JA 3FVQA 3KFVA 1WBBA 3T1QA 3AGQA 3BC1A 1US8B 3LX8A 4BFWA 2ZXUA 3A37A 3GJ5A 4ZKDA 2CHQA 3NH6A 1YRAA 1KZGB 2HLDD 4Q1AA 1SHZA 4L8GA 1G17A 2IX3A 4G01B 4A8JA 1NBMD 4HYYA 5JRZA 2VSOA 2WWGA 1HUQA 2NO6A 2WJVA 3KJGA 2ZSAA 4LBWA 3FYHA 2GAOA 2XJ4A 5JWHA 2CVHA 4Q21A 3VX4A 3CPJB 5AJXA 3RHFA 2IYYA 1FPMA 4GOXA 5KPJA 2FSGA 1CR4A 2AK2A 2X1VA 1U8YA 3QXXA 2BMEA 1Z63A 2JLQA 5EP3A 1RC8A 1DADA 2RGDA 1XMSA 3C14C 3GLIB 4D26A 1JR6A 5F98A 2QN6A 3X1XA 2XITA 3W8RA 4ON9A 1RVDA 1W4BA 2CL0X 4A4DA 1LW7A 3NVAA 4M2LA 3EA5A 2O8EA 4CDGA 3MMPA 1OV4A 1VYUA 4HSEA 4KITB 2OXRA 3ZJYA 3UG7A 1JXMA 2CNWD 3UG6A 1QHYA 2KBEA 3BB4A 5BYKA 1E9CA 1QHGA 1KO5A 5EE3A 5JI3E 2WSSA 3CWZA 4PC3A 3X1YA 4ASUA 4IFBA 4CF7A 3K70D 1XFAA 1V5WA 3CM0A 3DO6A 1XPOA 3NBXX 2CE2X 1M7GA 2HDNB 1DELA 1AGPA 1S2MA 4IOLA 2JA1A 4HLDA 5JLJA 5JMTA 5KOYA 1K8RA 1XBTA 2WMNB 5FTMA 1QZXA 3TJZA 1GRNA 1CTQA 4V0ME 4DT1B 5EUQB 4JLDA 1BYUA 1XTJA 1E2GA 1TADA 1E2LA 4P4UA 4HAXA 3I61A 1H8EA 4PO9A 2E87A 4LYFA 2WHXA 1Z0JA 4FCTA 4MKHA 1G8YA 2W6IA 4M1TA 2Q9BA 1Z07A 5FR1A 3P1JA 1E0KA 3MFYA 4ARZA 2QT0A 3CX7A 3TQFA 2OAP1 2VP0A 2R6FA 5JSZB 1RW4A 4BWYA 4C0AC 2DWPA 2QEQA 4ILEA 5F9FA 1P2SA 4GI7A 3SBEA 2VTKA 1MKYA 1MH1A 4PZZA 1OIWA 5H8WA 4JSTA 1HYQA 2ECKA 4WZ6A 2RGGA 1RZ3A 2FEOA 3DKVA 1IAQA 3T06B 4E5UA 4RY2A 2GF9A 1VG1A 2CCKA 4LZZA 2PT7A 5CYOA 1E2KA 4IXNA 1ZM2A 1U8ZA 3KJEA 5L3QB 1N6IA 2VP5A 5CIWA 3D3QA 3TSZA 1IJEA 4KU4A 3CZPA 4QC2A 1S1MA 2QAGA 1FTNA 1XEXB 1ZAKA 4MYTA 4TL6A 1V43A 4HAWA 4B47A 1PLLA 2AR7A 1KO4A 4TTRA 5J4LA 1TNDA 3PEWA 3JVVA 5A0FA 4YXWD 3W90A 4HDQB 4R7ZA 4D4KA 4IOJA 1HEIA 2HCJB 3ZD6A 1E6CA 3CIOA 2F3RA 4QHTA 1YHNA 4TMZA 5EE0A 4DLWA 3EIEA 2P5TB 1AS2A 3AF3A 1CJUC 3H86A 4IRUB 4ITRC 4Q1FA 4Q47A 5DYGA 2OCYC 3X2SA 3ZH9B 4BFTA 2BCJQ 2WOJA 2WAYA 5K8UA 2RGBA 1NF3A 1YZQA 3AVUA 5DSZA 1TQ4A 1OH7A 4A0RA 2CK3A 4M1WA 3AVQA 2YWGA 2IXGA 2CCJA 1EFRA 4P32A 3THOA 2ASEA 3DDCA 3KKQA 3UATA 4RKFA 2ZI7A 4LJYA 1F3OA 2O8EB 1KJWA 1XXHA 3IIKA 1L2TA 3RC3A 3GJ0A 5KPDA 5AJYA 3VR2A 2YC2C 4V0KA 4MKGA 1KJZA 2X19A 2RGNC 1W4RA 2H57A 4BZPA 5EXTA 1FOEB 4MKFA 2ZETA 4I1OA 3RAPR 2F43B 3ADKA 3SNHA 1QHHA 2OFXA 4AURA 2GZHA 3IUYA 5DI3A 1ZU5A 3TUZC 2ERYA 2C99A 3FOZA 5JWRA 1NVXQ 3SFZA 3Q9LA 4GPTA 1OHHA 421PA 1KDOA 4UXIA 2JLXA 3LBIA 4A9AA 1F60A 1BS1A 2IYRA 3QG5A 4PO8A 5LBIA 1N6PA 1HY3A 1MOZA 3AKDA 4QOSA 2JEOA 3VKWA 3TH5A 3ZVLA 2QMUA 4TL9A 3KB1A 4UNPA 3SBDA 2ZRCA 2ZQ5A 4BZXA 2Z4SA 5EXPA 3MWJA 4PZLA 3AGPA 5EQTA 3NXSA 3PITA 2Z83A 1A82A 2ZRFA 2CLDX 2GRJA 4Q4HB 3TR5A 3N2IA 2ONKA 5AUPB 1S9DA 1NSTA 1YE8A 1IXSB 1B0UA 4Q7LA 1YJ5A 2J0SA 2VL7A 4N0EA 4TMKA 4XWAA 4CEJA 3SYKA 3WY9A 3PJRA 2PEZA 4WZBE 3RS2A 1XF9A 2GZAA 4UJ3A 4KJZA 4Z51A 3KUCA 1X3SA 4MGZR 2F7SA 4LHXA 3QXSA 5C2JB 3ZS9A 5FOTA 1XMVA 2GA8A 4Q5IA 4RD6A 3P26A 4V03A 4ACBA 3NBFA 2JJ2A 3K0CA 2YC4C 1XZQA 3CX6A 4U00A 3RVBA 3P4XA 3JVUA 3BOSA 1Y63A 1N6LA 2ZR0A 4OJQA 1UF9A 4DWJA 5E7MA 1R5NA 3W9YA 3W3ZB 2IS1A 1E1RA 2C95A 3A1SA 3L0PA 4F38A 4MYHA 2P2LA 1CIPA 1NKSA 4LJ6A 5LD2C 2BMJA 2BBWA 1UEIA 1EWQA 1JB1A 4G1UC 3U7HB 1P5ZB 4PXAA 2OBNA 3AF0A 4LV6A 1KI4A 4RFSA 1HURA 3LVRE 3EPJA 3KTAB 3EC2A 1LB1B 4HAUA 2NMVA 1LS6A 2O0KA 3WRYC 4GZMA 5ELXA 1T3HA 3IBGA 1GL6A 1G3UA 1Z3IX 2GCPA 2IEYA 2ZJ2A 3Q72A 4BLOA 2YINC 5BWMA 2W58A 2PZEA 1EGAA 3IHLA 4GDFA 3THXA 4PQFA 2FGJA 3LWNA 2JLSA 5L3RA 3QKUA 5TVKA 5C4MA 2L0XA 3AQ4A 5DYIA 5DIFA 1KGDA 4LSGA 3SYNA 3AB3A 5JCZA 1E98A 2SHKA 5CK5A 3AVWA 1WF3A 2WJYA 4DLZA 1GVNB 1KZ7B 2WWWA 4PHGA 1LV7A 4Q1DA 2WJGA 5L8VA 2G6BA 2QP3A 2A5YB 4HAZA 1ZNYA 1R0XA 2HEIA 5D3QA 4Z1MD 5H70A 1JALA 3FB4A 1E2MA 4B33A 3B1ZA 4C0HA 1PLKA 4UNSA 3LXRA 4ZI2A 2XTZA 5DI9A 5JEEA 2H8KA 1E32A 2G0NA 1ANKA 2I4IA 4NCKA 4JKYA 2VP2A 4URVR 2AN9A 4BFSA 2ZE5A 4BASA 4ZKEA 2DPXA 5TXGA 5UKDA 5C46F 4ZDKA 4LUCA 2RCNA 1M6NA 2Q0HA 1YVDA 1N6RA 4TMXA 2ZRHA 3A4MA 3I5XA 5BW8A 1RIFA 1BKDR 3NDPA 1OB5A 1QRAA 2KWIA 3QI2A 2C04A 4MDEA 3U6BA 5AUQA 4DCUA 1HE8B 2JIZD 4FMDF 2EWVA 4P4SB 4FWIB 3VR3A 1T4GA 3EIQA 3Q5EA 2C98A 4L5BA 3NBYC 1OT3A 4NTZA 3NG1A 4PO1A 1G18A 4Q4JB 1OYWA 3RC8A 3LW8A 1JQLB 3K09A 4OHYA 2ZROA 1ZU4A 1PJRA 1NG1A 4BEBA 2QSYA 1KJYA 1XJQA 2B7BA 4PTLA 3REFA 4NZYA 1J70A 1WMSA 3B1VA 1IM2A 3GFOA 2ZRBA 4GBMA 3WNBA 3U61B 3FFAA 3B5JA 2PCLA 2CJWB 3QOFA 1ESMA 3GPLA 5AK0A 1YKSA 3RWOA 2XZLA 1XU4A 1YU9A 2BEJA 4MITA 2D3WA 3CKLA 5DNYB 3U4QA
chains in the Genus database with same CATH superfamily
1Q1NA 1R8QA 5JFOA 2FZGA 2ECOA 4YALA 1NMEA 1E8NA 4AJ9A 4CUJA 3KEOA 1GGNA 2R68A 2PJRA 1E8DA 1VBMA 2H8GA 5ICSA 1QH8A 2M1XA 4M1EA 4KYIB 5T6MA 2HJHA 3DMGA 1RRMA 2R7KA 2I1QA 3F8WA 1XTIA 5FPPA 1QB7A 2BGIA 4LJKA 4JYCA 2BFFA 2HLDA 3QF4B 1SUPA 3IB3A 4Z9XA 1PEKE 1IVSA 5K0SA 2DXIA 2DWUA 3CLRC 2XLCA 4WBXC 4B85A 3AT1A 3DH0A 2RHWA 4EEKA 2O1WA 2Y9PB 3BSFA 3KSAC 3OOYA 1DINA 1U7TA 4PFQA 4UUQA 5D5QA 1G41A 2EEPA 2PS9A 2CHGA 1QP8A 1SKQA 3L7MA 3LYUA 4LVCA 4NBKA 3FPAA 4L02A 1J21A 2X6RA 2Z5VA 4NARA 4G2NA 1DAPA 1CLEA 4DZTA 3GT3A 2FWMX 5A9SB 3P71T 4WZBB 4B83A 4XR9A 3BWXA 3CMMA 3FHJA 3FWNA 1D1PA 4MKRA 5B4UA 1NBEA 1LBTA 4P38A 4TT8A 4R3UC 4MPDA 2MSCB 1SWWA 3ROPA 1PBTA 2AN3A 3LF2A 4NK5A 5I7OA 3Q8KA 2Q5CA 2GN0A 3N0WA 4WVFA 2QA5A 1D4AA 3N2KB 3V8MA 3CA8A 4AX4A 5DNCA 2Z2YA 5I9NA 4AKGA 4M9XA 3CB4A 1VIDA 4NRDA 4BUCA 1DUSA 1O6BA 3FMVA 2HWXA 1CRWG 3GCZA 2Q2VA 1TQ8A 1U0RA 5EIWA 4BP3A 4A0FA 1W25A 3FYCA 1KDPA 1T24A 1MQSA 4RY8A 4W5QA 3QPCA 2I76A 1O77A 4TKMA 1YZGA 4HCJA 4A73A 3E1KA 3K9GA 4PNHA 2PFSA 3KB2A 1GO2A 1TVKB 1ILWA 4YRNA 2QGNA 2H3HA 4E5SA 4B4OA 1FJGB 4E08A 1G0OA 1ESDA 3NU1A 3S5UA 1NJ1A 1CUGA 3DZDA 3K53A 4JJ4A 1Z6XA 2QY6A 4LK2A 5D00A 3O3CA 2ESRA 1XWIA 2GTHA 2PYDA 4AK9A 3I1YA 2Y93A 4HRVA 5HJ7A 4GXQA 1G5IA 2WHPB 2UU9B 2CDAA 2H92A 4MP8A 3M6VA 2EJUA 2YCLA 3GT0A 2VJQA 4YDRA 3ZX4A 4F3TA 2SCUA 3ASYA 3HVIA 3DHWC 1L8AA 2IYSA 4CHGA 5KVCA 1J0BA 1L8XA 5A7HA 2FX5A 4TWBA 3PNBA 3STUA 5D01A 3L7LA 1IHYA 3L49A 2JD2A 4ZA2A 3WKAA 3RYIB 1P29A 3LQQA 5BN3B 1DOAA 2ZWPA 5JY1A 2AFRA 5CDGA 4J7UA 2DY0A 5SZIA 1MJGA 3D0QA 3EG5A 2HU2A 3W6PA 1MB4A 3CW2A 1W36C 3SC3A 3RB8A 5A6SA 2B83A 2QPOA 3PGA1 5TPZA 4E1BA 1P0QA 3F1KA 1CQJB 1OFIA 1Z2AA 2GZ2A 1JAHA 3KWJA 4NMHA 4OGKA 2Y1LA 4K6CA 2FR0A 2HFJA 3O8QB 4MWCA 2WJAA 4GX1A 2VUIB 3SMVA 2WKQA 5A5DA 2IHVA 3BBLA 3JR3A 4MDHA 2RKOA 4U63A 1FX0B 3UJ3X 4ZOBA 2XB8A 4PLTA 1EB8A 4ZGWA 5CB4B 1NU8A 1IXYA 4B7AA 1JKIA 2QE7D 3A6HA 4GMKA 1RLUA 1XDDA 4J0QA 1SXHA 2BFDA 1QPZA 1J1ZA 3UJ8A 3MTDA 2HU5A 3IQIX 2WWRA 3NDRA 5BORA 4K28A 4OJKA 1X70A 4HQLA 3TSYA 3NLLA 4AKHA 1ZN9A 1G3IA 4HHEA 3KJFA 4G0NA 3BREA 1WP4A 3M6LA 2G1KA 4O5OA 3RG8A 2QVZX 4QPNA 4BV9A 3QU4A 2IYUA 4OX9Y 1BIFA 3QX8A 2B1JA 4GPIB 1UDCA 3MMXA 5CCEA 2CL5A 1N8SA 4LGMA 1RTTA 1WMDA 4WINA 4ZQFA 2JD0A 1ZMXA 4KLRA 1D2NA 1MJNA 1E5DA 1JR2A 4NCNA 3CG4A 5ARCA 4NULA 3ZLJA 2KE5A 2I8AA 3GPDG 4QBKA 2ODBA 5EHNA 4M6WA 5HIJA 2PLAA 1W9HA 4F6RA 3CNNA 3ODGA 4TWRA 1X19A 2IU0A 1AKEA 5DMXA 1CUEA 4DE5A 3HYCA 1JV2B 2GFHA 2Z57A 4OV6B 4YRDA 5JYBA 1EUQA 5FOUA 1QDUA 4B6RA 2VBGA 4W5JA 1Z22A 4JQOA 2C0CA 4BMZA 1SXGA 3KT3A 2DJ5A 3KVRA 2X6QA 3SOPA 3NM4A 3KQWA 1EFAA 1T15A 3RWMB 1S02A 4NIMA 1T4CA 1XU7A 4D46A 1N2EA 1WHTA 3SGLA 1CF4A 2ONJA 3SXUB 1ELOA 1KI2A 5IAOA 4IGIA 2A1TR 3R40A 3GLFB 5ADUS 3TXAA 3LA8A 3CUUA 4FT4A 2GRAA 1WZEA 4AF6A 2ACWA 3U60B 2CXNA 2WB4A 2HB6A 4PLGA 3AI7A 1PX2A 2PMWB 3I8OA 3VVMA 3TPZA 3L5KA 1Y3IA 4O2LA 4XSGA 4ACAA 5E8RA 1SULA 2CWDA 1TW3A 4DQLA 1NNLA 3G5LA 5BYJA 3UWOA 2OILA 3SIRA 3KXIA 5TGZA 5IMSA 2RGYA 3LCJA 4L78A 1SOMA 1NSFA 2E1RA 3FI0A 5K3SA 1FCJA 1H85A 4NH0A 3VM6A 5EHZA 4J75A 1Q7BA 1KETA 5J2TF 4U6SA 1XD8A 4R1OA 1T0BA 5B6PA 4WT7A 4L7QA 1DBVO 3QPUA 4OAQA 2O2IA 1YDGA 1LQUA 4CYMA 4CM1A 2ZUDA 5JAUA 3VC7A 4QGSA 3VJRA 2GNAA 3DV0A 1M6HA 3AP2A 3WL7A 3KZMA 2RI1A 4RK6A 1JR3E 4KLNA 4LJ4A 1ZVJA 3T35A 2YZNA 2R6ZA 4D9IA 4ED9A 5EJ4A 1SVMA 3JW8A 4KREA 5LWQA 5HFJA 3MOGA 3O74A 2P79A 3IDFA 5DM2A 3LUPA 4EGSA 4O4HB 1XQ6A 4LF5B 3HC7A 3FAZA 5DHRA 4JVOA 3HDGA 2HNAA 4J6FA 5C35A 3AUKA 4JEHA 1EJBA 3WYBA 1NUAA 4LX8A 4RMNA 4PS0A 2YJ5A 3CNBA 1OKKD 1U3FA 4YQFA 4KQGA 3D2LA 1L5NA 4X93A 2CWWA 2ISCA 4A2WA 1ODJA 2BM1A 4WI1A 3Q7SA 3NNSA 4NOJA 4F04A 1QU2A 5ETJA 1YR2A 2WFLA 3CHYA 2AFVA 4PCAA 4TXHA 2RAFA 3KHKA 3INGA 2XMQA 2Y1FA 2XUIA 4C07A 2D0PB 2PBRA 3ZWYA 1P19A 1G8JA 4HWSA 3GEBA 5AXDA 4H3HB 4M0EA 3C1OA 4NEHB 3R8XA 4LDNA 1VRWA 2WKSA 3RKUA 2QJWA 4Q3KA 1XHEA 1TAQA 5LIPA 1VYTA 2GBIA 2W9XA 4EY8A 1X86B 2OGTA 4RZQA 2JJ1A 1HWYA 4TLCA 2O19A 2QSUA 1CE8B 2X0NA 2ZKLA 3SX4A 3OPYA 2PR2A 4BAGA 3BGSA 5F78A 1YUMA 3MTAA 3OZFA 3GEPA 1YR3A 3GUCA 4FW8A 2HIGA 4IQ4A 4L50A 4OLFA 1OX4B 4Q01A 1GRQA 1OBFO 4QRHA 3CVXA 3FOFC 1FLVA 4ZT3A 4MGIR 3ETEA 4P3KA 4LZLA 1L6IA 3S29A 1QP4A 1AGRA 1RWOA 1N9ZA 1YNSA 4MLDA 2A9RA 4NCIA 3LFTA 3QWAA 4JX8A 4XYBA 1SVKA 4IS3A 2G77B 1NVEA 2XQFA 5HS6A 5LDGA 3SYRA 3ZQKA 3SQWA 3DDWA 2C96A 2Z5GA 1W59A 2P8SA 2QP4A 3VOSA 4F56A 2VT7A 2JIMA 4X6XA 3WIOA 2ZXEA 2PLFA 4JOCA 2X5OA 1JQEA 4M8NE 2PWZA 3CZ5A 1GZHB 4TMYA 1V2GA 5B55A 3M33A 5IWCA 1NYRA 2C8KA 3ZU4A 5FTJA 3FHOA 2NZVG 1GCOA 5G02A 3RGGA 4AD8A 4E32A 4RTQA 2EC5A 2QLMA 3PDUA 4R2MA 2ZUCA 2O0JA 5EZ5A 2RGCA 1KRXA 4UNQA 1WULS 1MEOA 2CLMB 2NU9A 1GCAA 3FZEA 2FGKA 3HRKA 3HYSA 2JJ1D 1T2AA 3B52X 4B0OA 4PSUA 3PQFA 3L6DA 4MVCA 4MR8A 1Q95A 4DMCA 3BN3A 3KQNA 2ABWA 1DT5A 3TF5A 4JLBA 2I54A 2ZJAA 2WB2A 4KW7A 2IYQA 1N2BA 3W8NA 3M5PA 2GETA 2V4UA 1U2EA 4LHYA 1DIRA 1KMCA 2OCAA 4DLSA 4CKXA 5I6DA 4DQKA 3K0CC 4YS6A 4FS3A 4LPKA 4FYIA 4P1ZA 4AP5A 5C7LO 1N5LA 3X1DA 5FXMA 1OKKA 4NBSA 1FSSA 3HFRA 3T7EA 1BO6A 2PYIA 1RMYA 2CEAA 2PH7A 1WUHS 2A86A 1MJ5A 1II8B 2ZAIA 1QZ3A 3ELUA 3MCWA 3M7IA 1UT8A 3KD2A 2KB0A 3H3JA 3CH5A 5TDHA 3ZE6A 4FFVA 1T43A 3OQJA 1JEDA 1RYNA 2BGGA 4A8TA 4LE0A 2PWPA 1VCOA 3GN2A 5IAGA 1Y0BA 1XP5A 3ACDA 5DM70 2HXYA 1V3QE 1QKJA 4LOLA 5E9WA 3RGWS 3CRRA 1ZN8A 1M2JA 2G8NA 2MU1A 1P2GA 2X8WA 3F8SA 4H2DA 2Z4RA 4Q3NA 2IUUA 3UYKA 1U8FO 5AW7A 1CCWA 5EA2A 1MA0A 3LCVB 3T41A 5M34A 1XKLA 3VZSA 1O1YA 3PIIA 2G4CA 5A0VA 2EZUA 1F3LA 3ETHA 3WYNA 4F4HA 1KGSA 2VI5A 3ZXYA 4PAQA 3P9PA 2YV1A 4FFPA 4BEJA 2Q7XA 1N2OA 4F06A 3RAEC 1VBNA 4KEAA 1EU1A 2W4MA 4IMRA 5G1PA 4BYGA 4JT8A 2YFYA 3BIJA 1DOHA 4KMRA 1U4OA 4PFJA 3WGZA 1S0UA 3Q6IA 4K26A 4ND4A 5JQWA 3N2GB 1HDRA 5HKAA 2BFMA 1FJ2A 1YDEA 2AOXA 3EVGA 4PGHA 4UU8A 4UTXA 4N47A 3TPFA 4HWKA 3TS1A 5LQMA 1VHQA 2BFPA 1ML3A 2Z0MA 2FH5B 3HZRA 4NE7A 3FUTA 4PRLA 3VPDA 3O82A 4HRXA 2EIHA 1VKJA 3PIRA 1KC3A 3PC7A 1CHNA 2ILVA 2B8WA 4X8HA 3THYB 5LQCA 1PJQA 1PYOA 4IXMA 1RI4A 3RIEA 1PNQA 4LI3X 1E89A 3FBGA 4MH0R 4B8WA 3A7EA 5EIXA 2AWNA 3ZZUA 1V3VA 2WHPA 3B2QA 2RD2A 1I4DD 3BFXA 3SQOA 4HADA 2QX7A 2H5IA 3CEPB 3WGVA 1JJFA 2W0SA 1T9BA 1SR8A 3K05A 8AT1A 3NKFA 3QJ5A 2HRCA 3O38A 3O9VA 4R2WA 1P7CA 3DEKA 3P96A 3S1LA 3P32A 1TUGA 3UPUA 2PKYX 3DF7A 3IIIA 3L0OA 3LVFO 2PH5A 4NBLA 3WNCA 5AI9A 3U7RA 1GL7A 3WAKA 3ADPA 1VCIA 4G5RA 2GBGA 2HYDA 1X8XA 2YYSA 1PZXA 5B4VA 2H11A 3O3MB 1FTYA 2QD4A 1YHYA 1JDPA 2J9GA 3O2NA 4D81A 2OT3B 1BH6A 5M2QA 1YCDA 5HMLA 4WJLA 5JROA 3W5VA 3I2JA 2PN1A 2D2EA 5JAOA 4INAA 2JLZA 1QRDA 2WIAA 2C82A 2ZULA 3I0NA 4HDSA 4NFSA 4OQEA 4WNCA 1AIPA 1KNXA 4MW1A 3FJ1A 1JLMA 4XOIA 2WFAA 5EE9A 1F2DA 2CMGA 1NI4A 3B3QA 3LV8A 2PBZA 2GXQA 4UC0A 5KX5B 3ZVMA 3IUQA 4BFVA 2ONCA 5G40A 4I08A 1CJBA 3KSZO 4YCJA 5JU6A 1W96A 4IQFA 5FADA 4BNWA 2B4KA 5A4KA 1AUPA 1CQIA 1PSWA 1XDUA 2X7JA 4LMRA 4OD0A 4OQQA 4F8JA 3HABA 5C5EA 1QQAA 2O8DA 3WV4A 3PNMA 4MIKA 4K6OA 5CM2Z 1ZSVA 4OAOA 3OFNA 3GRZA 3WL6A 5A3JA 2ZWOA 1SXJC 4YAEA 2OBLA 3EK2A 5LYJA 4YAUA 1Z5ZA 2GH1A 3PA8A 3UXHA 2X5XA 3ONNA 2DWOA 1DKOA 2GGSA 2ZIGA 3D4BA 4J94A 5EKDA 5GMOA 4C0SA 2IP1A 2NPFA 1GPUA 4P82A 4B2IA 3EDRA 2HCBA 2DQ4A 2WJHA 3IR7A 3LL4A 4UVDA 4I99A 3RTDA 5IU6A 3CF2A 5IVIA 1E3IA 1M2NA 4KPUB 1GPLA 2PSHA 1CNFA 2K6GA 4E2FA 1RYZA 3QV2A 3X43A 4YMVA 5JDIC 4GZLA 1QLWA 3OCJA 4M1KA 4ND3A 1MW8X 2YY7A 3LDGA 3ZI4A 3I4LA 3MT8A 3R77A 4RIGA 1OU4A 1OYYA 2VK4A 3NM6B 1YTUA 3MFQA 5HTKA 3W1WA 1EA7A 1BJKA 2AVNA 2K2QB 3LECA 4I5EA 5AIAA 3VJMA 1ODKA 1DBQA 1VRCA 2QRGA 3KOUA 3RS8A 3RU7A 3ZWMA 4Q4DA 3TEMA 4NBUA 1DU4A 4MVJM 4XR4A 4JL6A 2BEKA 3SCZA 4LWOA 3ISTA 3PA6A 1GQYA 4KQ2A 4EKYA 4AJHA 1SOVA 3IOEA 1EK0A 5TARA 4R8SA 1Z4NA 1GPBA 1M1UA 1TGVA 2H7VA 2WU8A 1BXGB 3CZQA 3QVGA 4LOHA 1SOWA 2A4KA 3OAAA 2I2XB 2CSUA 3CR3C 4KP7A 5DNAA 1N6HA 4ZTUB 1ISHA 2XZOA 4FJ0A 4MI9A 2XQKA 3V2UA 2ST1A 4FP9A 4DNQA 1E3WB 1SQSA 2A59A 3ABSB 4Q4AB 2XXJA 2C4UA 3FBTA 4G3XA 5FFFA 4XJTA 3T15A 2Q2OA 4MTCA 3U3OA 3TK1A 1YQDA 3FYDA 4ZRNA 1KWGA 5E1MA 5AVJA 4C0JA 3B82A 3GQBA 2NN3C 4DMRA 3U2QA 3P9RA 3ODPA 16PKA 2DPHA 1C3XA 1UCFA 2I62A 2IPOA 4D9HA 4NZMA 4MAMA 1Q21A 1RC0A 2UKDA 4CF5A 4MVYA 3TTXA 3VAYA 2HQBA 4R1PA 2B1QA 3BXFA 3PFCA 5COQA 3T6KA 4CT0A 5J5VA 3Q0EA 1RAGA 1G21E 2PH1A 3GRKA 2OL4A 1B14A 3L6OO 1QZTA 3GLGB 3IV9A 2EFCB 3N58A 3WYAA 2BZ0A 4BC1A 3GJYA 2DMRA 2AT1A 4CTMA 1CSEE 1E79A 1QMPA 1F0KA 2GNPA 3PICA 3KKMA 4GI1A 5AM2A 2W22A 3GUYA 3KFXA 3TCXB 5L3SA 2P6PA 3AJAA 5HRUA 4HWGA 3WGYA 5HDBB 3W7VA 4XPZA 2OBMA 2HADA 3T4XA 3VR4H 3F6YA 1TIKA 2P1ZA 3GFTA 1RQRA 3NORA 4O4JB 4YH1A 4D9KA 4O4HF 5CHEA 4PC1A 2XB4A 1XZMA 2WQZA 4P3YA 4D4IA 2ZFUA 4Q3AA 2WF6A 4P80A 2R6GA 1N0IA 1JFTA 1GA1A 1V7PC 1Z4LA 2LD4A 4URYR 5IKMA 1J09A 2Y8EA 3A31A 4F5YA 5D3MA 3BJZA 4I19A 4ZVVA 1KKLA 3V1NA 5B7GA 4QPJC 3H3FA 2CLLB 1WLYA 2PL3A 2QGZA 2G4LA 1DAKA 1NQ5A 4I4NA 4MKXA 3OTGA 4Y7CA 1QTQA 2IIQA 2A6PA 1SXJD 4HTAA 3S55A 2A0UA 3OPYB 1X14A 2YJ4A 3B7PA 3ILSA 3PEUA 1TYAE 3LQ2A 1ISIA 4B9AA 5ALKA 3NEAA 2QX8A 3QMWA 2IIPA 3ZWBA 2IS2A 3IIMA 1QX3A 4C06A 3VDXA 3B6JA 4TXMA 3VMFA 5JYDA 1MHTA 4DR4B 2R6AA 2R97A 2EZ4A 2DTEA 4DSZA 4GG1A 1RXWA 2QS9A 1XA4A 4TMVA 3GCGA 1SVWA 1JYEA 3T99A 2PMDA 1KFBB 2QE7A 3DL4A 2VZ8A 3PUVA 1N33B 2GAAA 1G20E 3NW9A 3BE4A 2OO3A 2XOXA 5LZ5A 5BSFA 3QIVA 1JDTA 3JCZA 2XSZA 1FS5A 1AT1A 1C0EA 1I5OA 1GG8A 3PNLA 1EWRA 3IP8A 1C7QA 1W5AA 4RE5A 1B6RA 1U0GA 4N5DA 1MT0A 3I58A 5CYPA 1LS1A 1W4CA 4X65B 4HL6A 1ZPDA 3M6FA 1X1SA 4U7GA 4FKZA 4UCXA 2C7RA 3FUCA 3SPXA 4MW2A 1G1AA 3ETNA 4XSVA 1N5KA 2H1LA 1DXHA 3OECA 4Q7MB 1PU2A 1AUQA 2QHXA 3C87A 4F1JA 1DJQA 2REQA 5M3BA 3CB2A 1CFZA 4NICA 1WY7A 3M3HA 4OI0A 2EFYA 4PW0A 2EKDA 2X2EA 4DCJA 2PLNA 1EHIA 1SVIA 4DTCA 2V58A 1ULBA 4RL6A 4NKRA 4E09A 4B7ZA 1EDEA 1YGPA 5IBCA 1DT3A 4A10A 5J40A 1G291 1P62B 2VDRB 3RC1A 4CODB 3SBXA 5AVKA 4QLBA 1D5CA 5AM1A 1Z25A 5AO9A 1SVSA 4URWR 3HGTA 4G5OA 2OSVA 2ZCUA 4DZZA 1OBCA 3WXBA 1B73A 2QMOA 3AF2A 2HHHB 1O9GA 1XRMA 3OCYA 4RXMA 3OSUA 4Z1MA 4KMSA 3COZA 4RNDB 2GZDA 2N0SA 3DE3X 3H0KA 3O92A 1PZFA 3T4EA 1N2IA 3HP4A 1Y4DE 4N7MA 3VKVA 3BHMA 4HLCA 4MJ7A 3FJYA 1NNI1 1VCHA 1Q92A 2AL7A 4KN5A 3VNRA 4B3HA 1CKEA 4ZYVA 5LMCA 2O06A 4AKEA 1HF3A 2ZI5A 4BZZA 2BFWA 3L4EA 2LXNA 2Q99A 3IOCA 1DTWA 1JEAA 4Q3LA 1Q0UA 1FFEA 4WCDA 4F97A 5BXQC 3LH5A 2XNSA 5I7FA 1M1YA 2DBYA 3Q2OA 2I3BA 1QIEA 4LCEA 4REMA 1Q74A 1T5TA 1IHPA 1HOXA 3P5SA 2CYAA 4GGPA 5CAEA 1OYVA 3ZDAA 3DE5X 3NI2A 4DXAA 4OA8A 3DXZA 3WS7A 3WGLA 3BS4A 2H00A 3T7JA 3KLNA 4P84A 4GMGA 4RH1A 3DDZX 2JHAA 4Y6SA 4BV3A 2M98A 3FXAA 2CUZA 1DC4A 3A2LA 3EDCA 4IJWA 1BHSA 1T5OA 1XRSB 1Z0IA 1U8UA 1YKFA 4GYKA 4BN4A 2F3QA 2R47A 4K9DA 2QMYA 5CLQA 5LKRA 1NN5A 4HN9A 3VZQA 4CGZA 3HKDA 2P0EA 4JI7B 4J4BA 5F1KA 1UC8A 2P9JA 4G81A 1W94A 4M4SA 1Z4JA 1Q7RA 1N1MA 2PX5A 2UVQA 3RFUA 4QLAA 5JH7B 1NZJA 1T3GA 3N76A 4NEGA 1NYQA 1SMKA 2G76A 4OFWA 2ZIXB 5KYYA 3FFTA 5E1DA 4RPIA 2N75A 2XRZA 3L93A 3IHKA 3AWDA 3LUAA 4Q48A 1YZ3A 1ISRA 4R9NA 2OGWA 1ESNA 3GGGA 1GN9A 5GZ6A 2YWFA 1KXZA 1K08A 3V5NA 1ST3A 4HXYA 4BMSA 4ZZ3A 4I14A 5JD4A 2NGRA 5JTUA 2XUGA 4Z6KA 2G5TA 4XZ3A 4CM9D 2VVTA 1BCRB 3DDOA 1IAVA 2PA0A 3L6UA 3OQOA 1LF0A 2FQYA 1UJMA 3RVNA 1QR2A 2Y1WA 1ZW1A 3EY4A 4C9BA 4ENWA 5B2ZA 4DRZA 1GUFA 5EXEA 1DLJA 5IBRA 1Y5IA 1RZRA 3PGJA 3L07A 5CBPB 4E14A 4M0KA 2IBSA 4PN3A 4DUYB 4BWVA 3ZLTA 2B4AA 2FN9A 3PC2A 1H5NA 3B3AA 3AVPA 3CUEF 4L08A 3RC2A 2PBFA 4WERA 1A9XB 2O2HA 3A6KA 3EEFA 3OIFA 5JHHB 5HKKD 1NLYA 1I13A 3L8FA 3AVYA 5KVSA 2C2YA 3TJMA 4TVOA 1IB0A 4LVUA 3E4CA 3U56A 3K16A 4Q1VA 5DTEA 1Z6PA 2CJXA 4GZ6A 2PX3A 4WH0A 1YS7A 3DBHB 4HGYA 5PNTA 2QQ5A 2AZDA 2V1XA 4GYYA 5CPFA 1J8QA 4EEXA 1KK0A 1TF7A 2P9QA 4CCWA 1CUAA 1HFWA 3EW7A 4B2PA 4QFCA 4TVKA 2XOKA 3ELWA 2AQ8A 2G09A 4GKVA 1XTKA 1EA5A 4EKEA 1ZAYA 3BG5A 4HLUC 3AC0A 4RIEA 4DIOA 4L9WA 1REQA 1XTUA 1PHPA 4EJ6A 1Z6TA 4KGXA 4NHEA 4QUAA 3VUEA 1TF5A 1KDRA 3D7RA 4MWTA 2V54A 1F2VA 1VKZA 2ZT5A 4FOOA 4FFWA 4G1EB 3I5MA 4N1AA 4X3OA 1X80A 2EDAA 3DYVA 5DMHA 1U0JA 4B84A 4D9GA 3C3WA 1VI2A 1TRHA 1E6KA 4A8HA 3T8YA 4C7OA 1YQUA 3TAHA 1D5WA 3Q88A 4JSYA 1T35A 1KI6B 2RHRA 3LG2A 1MB2A 1L4HA 1SQ5A 4UEJA 1DCKA 4RHTA 4W8GA 4IDPA 3WB9A 1IRXA 1UK8A 3INRA 1NXXA 2Z56A 5CXSA 2ZJOA 3HYRA 1V11B 2D7JA 1T8PA 1PQUA 2I34A 3LSYA 4DBLC 5J4YA 2E89A 1GRVA 4UUBA 4DV1B 2BELA 3OLCX 4JT9A 3UFXA 1C8VB 3GHHA 3GPIA 3D8BA 2IYTA 4I9GA 4FLFA 1PIWA 2B92A 4KR2A 1QGED 1CUBA 5CVVA 3ZU2A 2ZJ0A 3HBLA 3U5ZB 1R1DA 2PX2A 3JAWB 4J76A 2P5UA 1Z33A 2QTHA 5K03A 1GLNA 5KNDH 3CWCA 3MINA 2EGHA 1FS4A 2FXIA 4M54A 5LA6B 3VISA 3TGLA 2J3DA 4IZ6A 3FCUB 3OE1A 4MVJI 2VCHA 4C2AA 2G70A 5I48A 3MJ4A 1E58A 4DCNA 2ZP1A 1US8A 2FPIB 2DPMA 5DTMA 4YXWA 3HDVA 3AY7A 1NRJB 4GPEA 1Y6QA 4JB8A 2PJZA 1N9KA 5DVZA 1PQPA 2DHRA 3DLIA 1V8ZA 2I3ZA 3N5KA 2AN5A 2ID8A 4WNAA 3LC0A 4E13A 1HQCA 4FTWA 2REXB 3RJ9A 1D2AA 1W76A 2QRUA 3K9LA 2G40A 2PD6A 2FW9A 2Q3FA 2YIJA 3VPHA 4EB3A 5AW3A 2ZLBA 3BXZA 4PLYA 4X95A 5TR9A 2NYUA 5DLEA 2LE0A 4EHDA 4YJ2A 3CRW1 4JYPA 1RAEA 3QGMA 2VAXA 2ZVPX 1ZRMA 2RBGA 3S44A 5JD5A 1SXJE 2IXEA 3B5IA 2G04A 1KZ1A 1NXQA 1P1JA 1TT5A 3D54D 3FHLA 5FUYA 4BKMA 3LCUA 4YMHA 2WEKA 1YVEI 3DEJA 4US1R 5IBQA 5L3QA 5EYPA 4FZVA 4QM7A 1RP7A 3U4HA 4Q7JB 4Z8YA 1ZUNA 1PS8A 3CWQA 4TQGA 4Z7JA 2AJDA 1Z12A 2R8PA 2W42A 2GD2A 4NZOA 3VDRA 4MEBA 1C4XA 4O4JA 4GLBA 3CO0S 1VC2A 1A8UA 1D9ZA 3H4MA 1Z2PX 2QMEA 4KIUA 1GUZA 2NZXA 3FPCA 3DL0A 1GG5A 2GEUA 3ZY4A 1GLGA 1OLXB 2EVWX 1SD1A 1NVTA 3VYWA 3QJGA 1CF9A 3TGPA 2WAXA 1ZZGA 3ZCQA 3U4AA 3F49S 3TZQA 4BMYA 1NY5A 1O7JA 1CE8A 4ITUA 3W5HA 4YDSA 3EHDA 3LBHA 2SNIE 2DLNA 1FFHA 2EARA 4GOLD 4Y2RA 4AT1A 4DYDA 2PSSA 2BMDA 3LLMA 2J8ZA 4FOPA 1OXBB 2XOKD 1RAIA 2EFJA 4LDAA 2AEMA 4F72A 4G9EA 3VPCA 4PSAA 1L5MA 1G7CA 2O50A 3NYQA 4O33A 2J08A 3WLSA 3C74A 4A8JC 4BO4A 5HOEA 3GF4A 3LW7A 1F1BA 1U28A 1TMKA 1XV5A 2OZPA 3OZEA 1W73A 3NTXA 3QF4A 4L8YA 2WU4A 1U0TA 4IXDA 2X5KO 4II2A 3WL8A 2JLVA 3HWSA 4UQPA 2E3JA 1V5IA 3CE9A 3ZQUA 3DLCA 4E5VA 5K3OA 1XAJA 1ZCFA 1XFDA 2N3ZA 3AFMA 4MIOA 1EWVA 4KAJA 1RXIA 4O3MA 1Z5PA 4OQNA 1JJBA 4DDTA 2DF8A 3JRXA 1IWPB 2BGKA 2NZYA 1LXCA 4I66A 1ABFA 1ECBA 1AKTA 3IHWA 5GONA 4WNYA 1KE1A 7AT1A 1NL3A 1RZRD 4MR8B 3LLUA 4J9UE 2DFNA 4KFTA 1BJTA 1PGNA 4Q00A 4YRSA 1E6WA 1OLSB 2ONZA 3AETA 2GCEA 2OZEA 3KAKA 3LPMA 3M5WA 3QLTA 821PA 2D1FA 5SV2A 1PT8A 2P91A 1RLJA 1QH9A 4J07A 2W6CX 4C08A 2XRMA 1UQRA 4JLVA 1U7XA 3EBLA 3WIDA 1TFUA 2CLEB 3X1ZA 1TC2A 3TLXA 1JBKA 4NC9A 4NMMA 3HVRA 5I7VA 2GWHA 1LBEA 4AU1A 3EISA 4O5AA 4NQRA 4AO6A 1E9SA 1K5PA 1UPAA 1B93A 4B71A 5IM4A 1GUYA 5D1HA 2A7QA 3O73A 4JMLA 2DPYA 4LJ7A 5DISB 5CEFA 1R6BX 4FX5A 2CHUA 2HJSA 1E61A 4KAFA 2OOSA 4MW4A 3JAKA 3IUMA 4JVSB 2AJBA 4ZREA 1XMXA 3AEZA 1IK6A 3CH4B 4G4SO 2Q3DA 4WK0B 4EG6A 4AY6A 3PHBE 3SVZA 1RBYA 1XK7A 2ONYA 3D6VA 1F38A 3F6CA 1Z0AA 2W71A 1EEXB 1G5RA 4IM7A 2WBLC 1PW5A 2W00A 1OFUX 2BGUA 4OHFA 3DFKA 3T9CA 1IWOA 2QBYA 4GPAA 4B80A 4LHWA 2CNDA 1CS0A 2VRCD 5DEOA 5H1YA 5KMGA 2SCUB 4NX2A 1FL9A 4DFDA 1J0DA 2CVFA 3QXCA 3N9IA 3EXIB 1DAEA 2AW3A 1U7ZA 1WB4A 2XMDA 1GFZA 4G2TA 5B3AA 3HB1A 4D0LB 1R5BA 1XTBA 5REQA 5KJ1A 1JWBB 2JL1A 5THKA 1E5TA 2XXAB 3ABOB 4X8LA 4E21A 1SZPA 1P3DA 3AFIA 4FX2A 3TQRA 3W5IA 1CZNA 2REBA 4LOJA 4CNQA 4ZVMA 2VQFB 3ANXA 4NU6A 1KQPA 4PAOA 2H1RA 2D1SA 4XIYA 1S7GA 4YT2A 4R9UC 3HU1A 2AH5A 1NUPA 4BQPA 1ZVVA 3LX4A 5F2KA 3V4OA 3BCSA 4QUJA 1PEAA 4A1OA 4DGQA 4FEGA 2PO7A 4KXVA 3IT2A 2FFQA 2VRNA 4JBLA 1ESZA 4C89A 3D7MA 3PHIA 1V96A 3KVYA 2OGSA 2GRUA 2R44A 1NI5A 2RB4A 1JXAA 2GN9A 4RETA 3T3MB 1H8HD 3IT3A 5EJEA 3OQIA 2QNRA 2IY7A 3IXQA 5FO0A 5DM0A 5IX8A 4M7WA 1P2DA 1ZM7A 1Z15A 4GRAA 4E4RA 2PSDA 1DO0A 1U5BB 1PS9A 2GJAA 3FFBA 3OSZA 1V6CA 2DFKB 1CF2O 3ZQ4A 4FFDA 3VSBA 5LYJF 1I24A 4I8DA 3DM5A 2QU8A 3M0EA 3M9WA 4LMPA 5J63A 1E62A 4FKMA 4AICA 4D80A 4OVKA 3W06A 3LRTA 2AXQA 2WSMA 3AM3A 3IAAA 4C1BA 3HJCA 1F0YA 1PFVA 3ISJA 2C4TA 3N8HA 1R0RE 3LIIA 1U8TA 3T3IA 1DFIA 4BJ3A 3NHYA 4QATA 2Q3LA 3UMMA 1LPOA 4P3NA 4QDXA 4S0ZA 1BEUB 3UBTA 1IK4A 4DQ0A 5JASA 5BYAA 2ARKA 3LQRA 5CDTA 2QTZA 3NWJA 1WU7A 4IIFA 1L1RA 1SBCA 4Y0VA 1TJ4A 4FYXA 1OVGA 4AG3A 3FZYA 2JI8A 3WX0A 3UMRA 4I1YA 3LK6A 4O2BF 1TAHA 4KQEA 2GYVA 4CFYA 1G8GA 3NYIA 1DBRA 1IEXA 1MJFA 3W79A 1BG6A 2ENWA 4EO7A 2MYNA 1RYYA 2P35A 3IPYA 2ZIFA 5E6SA 1FNDA 4CE6A 5BSWA 3UB2A 3DZIA 1PV1A 3EMVA 3R8CA 1D0VA 1F9AA 5BNZA 1C0KA 1QUEA 3DE0X 4FW9A 3RVOA 3I1JA 5H9VA 3UWMA 3IPRA 3QXJA 1AD2A 1NP6A 2QQFA 4NONA 4L0DA 1Y1TA 4TYMA 4NFLA 1QPGA 3DBVO 2HJVA 4ER3A 4FZ5A 1R8YA 1NWHA 2XCIA 5DASA 4G56A 1BD4A 2OQRA 3RYCB 1OREA 4WDRA 4BPRA 3PRHA 4NOMA 3MEQA 1KPHA 1Y5MA 1UT6A 2PS1A 5JVDB 5ICMA 5DE3A 3GK3A 2G72A 4ICIA 2QAJA 4M3NA 1E9FA 1IOZA 3JU3A 1NASA 2RHLA 3CR7A 4OP2A 2YH2A 4N4AA 4RNCA 4AS1A 3EXAA 2EWMA 2QR2A 2ZB8A 3DT6A 3FKSD 4PPFA 4R7TA 3BXHA 3ESDA 5DM4A 5J1TB 2Q1WA 1I32A 4P6VF 5JSZA 2ZYWX 1KXJA 3L6EA 4ENRA 4H9GA 4C0QC 5AHWA 2MT9A 5BOVA 1BTOA 1CNEA 2CZQA 2XZTA 4W7IA 4WJZA 3H19A 3HXTA 3N7AA 3Q3VA 4JJZA 4BAUA 2QL5A 4I2NA 3T3GA 3GIDA 4HX5A 4RVCA 4K05A 4IF6A 3SZLA 4ZPJA 3V80A 1E3SA 4GNKA 1GTVA 4IGFA 2DY1A 2VT6A 1VXOA 1O94A 1U3DA 4FN5A 3ROXA 5C9ZA 1JU9A 5I47A 2H16A 3L84A 1M8KA 1Z2CA 2O7QA 3KEQA 2QM7A 2W8BA 1GZDA 2JZOA 4E33A 1YXMA 3NIFB 4BVKA 5HUQA 4I50F 2BEUA 4UARA 5AI0A 4H4EA 4HNAA 1U3UA 5DLDA 1N0WA 1KAEA 1QRTA 2ADMA 1K4YA 2JCGA 3HMKA 5H83A 1SC1A 2F1IA 4OBEA 5C7YA 2WI8A 3DNPA 2F4VB 1PJ3A 4WY2A 3JASA 4DR7B 1GNPA 5DGCA 4EVSA 1HYGA 1KO7A 1XQXA 4X92A 1XR3A 3BSSA 1LJLA 4D45A 5LNK1 2RB5A 3ZIUA 1WB9A 2X0IA 3CSSA 1JPJA 3N86A 3CPEA 1CQWA 2OE2A 3BJIC 4N40A 5ALPA 4YO7A 2ZSBA 3SHFA 1N4DA 2QTWB 5BW6B 4PNPA 2V7GA 2QTRA 1QFSA 4RD3A 2PUAA 4NZZA 4DIBA 2E4VA 1A98A 3SLGA 2HAEA 3I9V6 1Y3BE 1SPXA 5AI8A 1SOAA 1UUFA 1WM1A 4D56A 2WW8A 2ZAOA 4F93B 4MPJA 5KI6A 2E6KA 1I2AA 2WR8A 4JLAA 1UIMA 3OLZA 4WZBA 1H1LA 1XB2A 3KR2A 4AY2A 4PXYA 4TTTS 4BQQA 1MTOA 1S4MA 1MOSA 1XA3A 3HDQA 3GFRA 1RBZA 2DQSA 4XGRA 1WPQA 1VB5A 1AB5A 3H5VA 1MQ9A 3NASA 3L7DA 4BQRA 5KCZA 1W2WB 1HA3A 1XXHB 3RS7A 2NZJA 4WOBA 3QNMA 1W4AA 4B3BA 2DKFA 2P2NA 3R3UA 1EVIA 2C59A 1GZ4A