3A1WA

Crystal structue of the g domain of t. maritima feob iron iransporter
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
159
Chain Sequence
b'HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 47
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1wA00
2P6NA 4QHTA 3IDQA 2O52A 3IO3A 1LNZA 4F4JA 4JSTA 4JT2A 4D80A 2FWRA 3LH5A 4Q1BA 1UDXA 2BDTA 4G5RA 5EXSA 2BMDA 4Q4AB 5BN3A 2ATXA 2O8EB 2ORIA 4P4SA 3GPLA 1G3MA 1JXMA 1UEIA 2ZJ8A 3HU1A 1RJ9B 4DLXA 4CF7A 2YV5A 2ZE8A 1TADA 3KZ1E 2RH5A 3D31A 2G1KA 3KJEA 5EUQB 5JSZB 4GBMA 5KU1A 2X2EA 1N6KA 2G0NA 1D9ZA 1G3UA 4KFRA 4Z1MA 4AG5A 2G3YA 3NBZC 1XD9A 4PPFA 4Q1FA 4QXAA 4CW7A 2D2EA 1TF5A 4HZUB 4Q18A 1P9WA 4EDHA 5CDFE 1KDTA 1IY2A 3EXAA 4KCGA 421PA 1E9EA 1MV5A 2W58A 1G5RA 1KI4A 3WXMA 2IEYA 1NBMD 2IYVA 1VHLA 2UZ3A 3GJ0A 3KKPA 4GP6A 4XVRA 4DCVA 5JJLA 4AKGA 3KQKA 5G3ZA 2D06A 1II9A 3OIYA 4HAYA 4P3YA 3V4FA 1KSGA 3BH0A 5CB8A 1FL9A 2F43A 1S1CA 4O3MA 2Q0HA 1NBME 4I99A 2IXEA 4OI1A 2QAGA 4V0ME 2A5FA 5FPHA 3IEUA 1LB1B 5KDLA 3SS8A 1UKVY 4DCSA 2XB4A 5FOTA 2QE7A 1ZM9A 3FMPB 3HYTA 4JLAA 3J81k 2WSSA 3MGCA 2O8FA 4DLZA 1W4AA 4Q5IA 4YMUA 3OE7A 5ELXA 2DYKA 4C0HA 1KYIA 1N6PA 1K5DA 1KY3A 4ACBA 4RD3A 1CR0A 4I1SA 2ANBA 1YZKA 4DHEA 2EFGA 1WBBA 3RC8A 1U8YA 3QKSA 2V1UA 1DE0A 3SFVA 2GVZC 4BLQA 4CGZA 2N42A 3AKDA 1RYHA 4B35A 1KIMA 1E2FA 1HH4A 2BEJA 4M9ZA 1E9SA 2WVJA 3TR5A 2YZ2A 1EX7A 2J7PD 2KI5A 1IJFA 5B64A 1KDRA 3T12A 2C8VA 5GJBA 3MSXA 1U0LA 3NHAA 4JS0A 4PO8A 3QXSA 4EFNA 3FE2A 2AWNA 4HAWA 1E2LA 4B3CA 1KMHA 1ZIPA 1NLYA 4DXAA 4A2WA 1ZW6A 3SJAA 1JPJA 5EQTA 1NVXQ 3A1UA 1GG2A 1UKYA 3REGA 1W1WA 2IA5A 4UJ3A 4TL7A 1H8EA 3GJ4A 2VH5R 4GL2A 4PSAA 2DB3A 1Z0IA 4DSUA 2I1VB 4HDQB 5EZ5A 1XBTA 2UKDA 1ZRHA 1NRJB 2FPKA 2QM7A 4M53A 4OK6A 2IYWA 3K1JA 4B6EA 4CEHB 5JWRA 1AKYA 5JECA 3QXXA 1U94A 3L0PA 5CIQA 3W34A 1NY5A 2Q9AA 3OFND 3B5JA 3ECCA 2GHIA 5EE9A 3RNLA 1B23P 2AN9A 5KHOC 3TRFA 3AKCA 4Q48A 2G83A 4EQ6B 1AJEA 2D4HA 4O0MA 4TQAA 1F48A 2VHTA 4M4SA 4YLGA 5H70A 5GJCA 2JASA 3EZ2A 3PUVA 1ZD9A 1VIAA 5IF9A 2HCBA 4P4TA 2J3EA 2IBMA 1FOEB 1W5TA 1A82A 4XIGS 1IBRA 4BFSA 1GUAA 1LF0A 2YWGA 5AJZA 3ZZTA 1KI1A 3B8HA 1T3LA 3DMNA 3PXGA 3GEIA 4IFBA 2ZSFA 3B9PA 4MYUA 2JGNA 2VIIA 1ZCBA 2P0EA 3CONA 3OEHA 4LBWA 4QBFA 2FG5A 1NIJA 2IXFA 3SYKA 1QVRA 4EPRA 4HLUA 4HAXA 5KSYA 1OH7A 4WXRA 5C46F 4LV6A 3U44A 3DEFA 2J0QA 2H1LA 2EU8A 2ZAOA 2CLSA 3LDAA 2J41A 1EESA 1CJKC 1Z28A 4QKQA 2VP0A 3OF5A 4Q7MB 1J2JA 3HU2A 3ND8A 4B2LA 4B33A 1NVVQ 2FOLA 1R0ZA 5TY0A 3VKGA 1TX4B 1GKYA 3K8YA 3QKRA 4KODA 3K0FA 2CE2X 1T3HA 3KTAB 1HUQA 4S35A 3AVVA 4O2RA 2GKSA 4ZDIA 1GFIA 4G5OA 3SJCA 3BFVA 1YVDA 1PUIA 2FH5B 4JSYA 1I4LD 3CZQA 4LI0A 3M6AA 3BH6A 1XXHA 4A36A 2GWHA 3EIHA 1KTVA 4PO1A 3D8BA 4RFVA 4OYHA 2CNWA 2ZI5A 4US0R 1MOZA 3TUJC 1DADA 1LFDB 3I1FA 5B30A 1Z29A 2IL1A 1JB1A 4UNNA 4KBFA 4RY2A 3OIUA 4PAQA 4TYPA 4JVNA 1IN5A 1S3GA 4YQFA 2ZM5A 2CBZA 3VX4A 2P5SA 2CJWB 1UEJA 2KBEA 3K70C 5EUMA 2ZSEA 3WP1B 1MO6A 4NMMA 4WBSA 4R9UC 4ESVA 2O8BA 2O5VA 3TSZA 1KI6B 3A37A 4XTRA 3TMKA 3RS2A 3NH9A 4W5JA 4LWZA 5E4FA 2VHJA 4TMKA 5DN6D 4E5UA 1F60A 3R9XA 3SYNA 2YWHA 3BOSA 1E9DA 1XEWX 2IWHA 5J4LA 2A5DA 1L4YA 1LVGA 4MRRA 1OE0A 1CJMA 1RRGA 2NO6A 3FOZA 3SU8A 4R71A 1G7SA 3KJHA 4DUGA 1XB2A 4A2PA 1DBSA 2GK6A 4M1WA 2OUKA 3QG1A 3UMRA 1BH2A 1E6CA 4ZDKA 4A6XA 2IYQA 2FV8A 1U8ZA 1U9IA 1E2IA 2QRZA 4XH9B 4PHTA 1KDPA 1OIVA 2ZRIA 3R9IA 5SZIA 1JXOA 2ONKA 1PJRA 2RGAA 1EFCA 1QZXA 1XEXA 1R6BX 2FN4A 4MA4A 3NG1A 1R0YA 4LYAA 3PFIA 1HTWA 2Z5FA 2HCJB 4TSFD 5TXGA 4BFYA 1RKBA 2F1RA 4QJ5A 4QHYA 5HTKA 1ZYUA 1X86B 4ABYA 3U7EB 4NBSA 4M1MA 1G8HA 1BMFA 2IUUA 2WJIA 1UADA 4P32A 4B71A 1JR3A 1FQJA 4Y0VA 1PLJA 4EFLA 5FOUA 2ZREA 1AN0A 1SVOA 3B82A 4TL9A 4IFEA 3O8DA 1FW6A 2FEMA 3LXRA 4Q03A 3UIEA 2YC2C 5DH9A 4RFSB 4ZKDA 3AGQA 1F5NA 1CR2A 3QKUA 4U5XA 4FINA 1OIXA 2J0UB 1XZQA 3BK7A 3MCAA 1W7AA 4JLKA 1ANKA 5L3SB 3K9LA 3W5JA 5SZHB 1ZJ6A 3K9HA 1DAFA 4MYTA 3EG5A 3L2OB 2CL7X 4KFTA 1NSTA 5BN4A 3FHTA 2ZPTX 4W5HA 2Z83A 1UM8A 2ECKA 1H8HA 1T0HB 1GSIA 1LTQA 4Z8XA 2AX4A 5EZ6B 3EC1A 4XVQA 1Q1BA 5KOYA 3VX3A 3EPJA 1CEEA 3QF4B 4HSEA 1Q3HA 3WMFA 3RWMB 2CE7A 4KFUA 3T5GA 1VYTA 2QP4A 3UWOA 2QPAA 4YDSA 5SZKB 1E2JA 5F98A 3U3KA 1KO4A 4OHVA 5HKKD 4DDWA 1R4AA 5IT5A 4TYWA 2XB2A 4X8HA 1RC8A 4E03A 1DG1G 4BFWA 4YMTA 5F2EA 1ZBDA 3EARA 1E3MA 4N1AA 2N46A 1G8YA 4MRNA 2IYLD 3TW4A 1Y63A 4B47A 1T4GA 4RD1A 4J0QA 1YRAA 2A3RA 2GXSA 5DSZA 1GL6A 2GEVA 4LV8B 4AIIA 4C2UA 3KXLA 1KI9A 2XTZA 3AV0B 2VP5A 4JL8A 4Q02A 3GLIE 3WYAA 2B7CA 2RGNC 3AH8A 3NTUA 5JRJA 2OE2A 5C4MA 2BC9A 1J70A 2W6IA 3B1WA 4EJSB 2BCJQ 1V43A 3BJIC 1XJCA 1T0JB 3CF0A 3P27A 3TNFA 4RCYA 1DOAA 2FE4A 2VP6A 1G41A 1KNXA 5DYIA 2RGGA 3KKMA 2V7QD 5CITA 2ORVA 2OESA 1UBFA 3PUWA 4NKRA 2F1IA 4PC2A 4IOLA 2C98A 2IF0A 4BFZA 2QSZA 5CK5A 5FPSA 4PHFA 1YZTA 2OCYC 2A78A 4HUQA 5H1YA 1T91A 4FMBB 4ZCLA 2QPTA 1YKSA 2HV8A 2RGBA 3CO5A 4IHQA 5GJVC 4C0JA 2VLIA 4QJ3A 2PEZA 3ONWA 3PV0A 4A4DA 4BGDA 1XPUA 1IOZA 2GNOA 5FI0B 2EVWX 3CF6R 4YDHB 1RIFA 4QHSA 3M4YA 4V03A 2FA9A 3FKSD 2XNSA 1Y3AA 3E2IA 3HDTA 4ACAA 1HURA 3EAQA 5IHPA 3UWKA 1I4TD 3QEJA 3FFBA 3UPUA 1XP8A 1YHNA 1X1SA 4WAUA 1RVDA 3KDSE 4Z54A 3AKEA 1R5NA 3CM0A 2LCFA 5BYKA 3T5DA 1R8SA 2J0VA 4PFSA 1DELA 2CHVA 4A8JC 4CT5A 3LW8A 4HAUA 4MITA 3VU9A 2ZIAA 2I3BA 1RYFA 3B60A 4JKIA 3PUXA 4E09A 3BB1A 4NZYA 4RZUA 4NYJR 1XD8A 1CR4A 4UJ5A 1U99A 4FWIB 4FCVA 2WPDD 1GP2A 2VA8A 3Q72A 4Z8YA 1MR3F 4Z51A 4TQ9A 1HYQA 2J0SA 2DCUA 4MYHA 3LXXA 2H18A 3WY9A 1N6NA 3N2EA 4P4UA 1SXJD 2CLCX 1KK0A 1G7CA 5JRZA 4FMDF 1G5PA 1ODFA 1CS4C 1W0KA 4MYCA 4M1OA 4B3GA 1E2PA 1I2MA 1T8UA 1SXJE 3B7GA 2XXAA 6Q21A 4IDQA 2HJGA 2P3SA 3IIMA 4PZLA 4PAMA 1IN6A 2GZDA 3DO6A 4UNQA 4B75A 1QRAA 1WP9A 5KSZA 2PJZA 2BIFA 3K09C 5TB5A 5AUQA 3U2QA 1GRNA 4JJZA 1X3SA 1CKEA 3VNUA 1S3SA 5KPJA 1ZM2A 4ERNA 2P2LA 3RLFA 2JDIA 2BKEA 1Z83A 3ND9A 3PQCA 5DISB 3IO5A 3K0AB 1DG3A 5DI9A 3D3QA 2ZJBA 2NG1A 4OJQA 1OKKA 2AR7A 4TZ0A 2CHGA 2W00A 2QUZA 4LCBA 1QHIA 1P5ZB 5H8WA 3FB4A 3R8CA 2WICA 5GVSA 5KNCA 5KDOA 1R5OA 2P65A 2QQEA 3QBTA 5HZHA 5HE8A 1QHHA 3EWAA 3NDPA 1NVUQ 1WE2A 2O8DA 2VBCA 1VCOA 4PAOA 4QGGA 1NG9A 4MRPA 1GILA 1XX6A 5FUXA 1Z07A 1NKSA 1SXJB 4DEXA 4PQRA 1ZC3A 3B13B 1EX6A 4PC3A 3UG6A 2ZXUA 4D0GA 3JVVA 2WOOA 3QG5A 1ZNZA 2ZRGA 3W8RA 4X8LA 4M8NE 4QL3A 2JAQA 4C0BA 2X2FA 5LBIA 4Q4HA 3GEHA 3TUZC 1N0WA 1OJLA 2ZRAA 5G40A 4D2IA 4EKDA 2BBOA 4BZPA 5FL7A 3EPLA 4PPQA 4JIMA 4FCWA 5EP4A 2E1RA 3U5ZB 3VR6A 2VPPA 5EXXA 4G5SA 3NBXX 4PXAA 2QMUA 1KSFX 2O8CA 1DAKA 5BW8A 3GLFA 1W36D 3RYTC 5FTNA 1QF9A 3AF0A 2IYXA 3BB4A 4TLEA 121PA 3OEED 1EFTA 4M9XA 2GRJA 2BOVA 4LJ7A 4DLVA 2PT7A 1COWA 2G1JA 4HAZA 2P6RA 3T06B 4I1VA 4URYR 1NJFA 1C4OA 1E1RA 4AWXA 4XWKA 5LD2C 4PC7A 1E4YA 1FNNA 1MH1A 3RS7A 4U02A 2RGNA 4HLCA 3KL4A 4GSYA 2IHYA 4LYJA 3I8SA 4OHZA 1HE8B 4JBYA 4US2R 4UNRA 4LHVA 3G5UA 1GKIA 4WOPA 1OIWA 4DZZA 4EUNA 5JBQA 2JLRA 1JJVA 1N6OA 1R2QA 5FUVA 1HT1E 1KJZA 2PCJA 4NYIR 5BXQC 2ZANA 621PA 3AB3A 3ZIAA 4RD0A 3CX6A 4OHYA 5B58C 1IXZA 4ARZB 2SHKA 3I72A 4FMCF 5EE1A 3VKWA 5HCIA 8OHMA 1VTKA 4EPVA 1XMJA 2R9VA 5FUYA 5LB4A 4XWOA 1GNQA 1OT3A 4OBEA 2Z4SA 4Q1CA 2A7QA 2Q9BA 1LV7A 2GBLC 3WMGA 2D3WA 1JPNA 2WIAA 1ZM7A 2FZLA 4GFDA 1GZSA 3I73A 1ZD1A 4JKYA 4BQSA 1N5IA 4OL0A 3THYB 1E2HA 1FTSA 3THXB 4K46A 2GCPA 1R10A 4OQFA 4C2TA 1XJ0A 3I3SR 1VG8A 4H1UA 2D7CA 4ZKEA 1OXUA 1EXMA 4HUTA 3C8UA 1A4RA 2H8KA 5EXTA 2GCOA 5K8LA 4GRAA 3BERA 3NEJA 2PCLA 3OHMA 3GLGB 2YKGA 3B85A 5E7MA 4U00A 4E22A 5KYKA 5DNYB 4TLAA 1Q1ZA 4A8JA 4KLZA 5FPYA 2XSZA 2OSBA 4W5WA 4FWTA 2PBRA 3Q5EA 4NCJA 1D2EA 3IBGA 3K53A 4JLVA 4UXHA 5EE3A 1TQ4A 3U3JA 1FTNA 3KFXA 2BBTA 3SEAA 5AUOB 2E9SA 4RD2A 4ZV4A 1AA9A 4BFTA 2JIZA 2ZYTX 3IPXA 3RS0A 4C7OA 2HLDA 1NJGA 3ZYCA 4N0DA 4EAQA 2WOJA 1F6BA 3CNOA 3WNDA 1E79A 2OZEA 4FMDB 1NIPA 4LHXA 1CR1A 3EW9A 4I81A 3ZLJA 4TMZA 1TQ2A 1J7KA 1Z6AA 4B2PA 2J9RA 3CH4B 5J4YA 2X19A 2XOKA 3BGWA 3SC3A 2ZJOA 4DLWA 1Z2AA 2V55B 4TL6A 3K09A 1VMAA 2EQBA 4CZ2A 3CRQA 2VEDA 4JJKA 4Q7JB 2IHBA 4YONB 2F9MA 5CM8B 3JZMA 1E96A 4CEJB 4ZCMA 2C95A 4BEJA 2R8RA 1T6NA 4A2QA 3C7KA 3PEWA 1YR6A 4HB4A 4A9AA 2WSSD 2ZR0A 4TTPA 1P2SA 3OE7D 3SHWA 3AF1A 4GOXA 3I32A 5BWMA 2QMHA 3UG7A 2CVFA 2KE5A 3UK6A 4Q4AA 4UQOA 1HQYE 2BVNA 3GJ7A 2QG6A 3PEYA 2XZPA 1RJ9A 2FEOA 5UKDA 3OZXA 4UNSA 3Q85A 3SR0A 2ZS8A 5AUPB 3PEUA 3CRMA 4GNKA 3WYFA 3S1AB 3VHXA 5EJEA 2R65A 2YWEA 4D25A 4IDPA 1DEKA 4W9MC 3PCRB 4JZKA 5KPDA 5EP3A 3EZ6A 2WM9B 1FP7A 4JBXA 4B43A 1CP2A 4KHZA 1N25A 3QF7A 4HZUA 1EGAA 1AKEA 2C5LA 3Q9LA 4LHZA 2GZHA 3NIBA 3KX2A 5FBQB 1N5KA 1K6MA 1OF1A 2O0JA 4OI4A 4URWR 4MRSA 2IS1A 4IOKA 1A2KC 5AJWA 5P21A 4AD8A 1UKEA 2QMOA 3QVVA 1CLUA 1U90A 3E1SA 4I1OA 2CK3A 4JYCA 2QAGB 4PHHA 3TAHA 1TF7A 4BFXA 1U9IC 4C3ZA 2Q3FA 4BASA 1H8ED 4JLOA 3BB3A 2CEAA 2ZYWX 3X1DA 1E2KA 2ZS7A 2IEZA 3R7WB 4C0SA 1TPZA 1GTVA 1N2CE 3CR8A 3DPUA 3NC1C 3W8NA 2QT0A 3W6NA 3AM1A 4DCTA 2QGNA 3OAAA 2P67A 3H4MA 4B44A 1AGRA 2NO7A 3UATA 1OH6A 2JLXA 4S2EA 2ZJZA 3F8TA 2WJGA 1S4QA 4NCNA 3L8YA 2EYUA 3QKSB 1GNRA 3U60B 4XOIA 3QOFA 1NMXA 1XF9A 3WP0A 2WZQA 3A1VA 3D6TB 4V0LA 3F5FA 3GJ6A 2ODEA 1ZVQA 3L8ZA 1D9XA 2QSYA 2LWIA 4U7DA 3VHLB 4E07A 4FMCB 3SE0A 1E9AA 3DM5A 4ZPXA 2PLRA 3OEHD 4LJ6A 1RW4A 1YR7A 4JLBA 1KK1A 3W9YA 2QPOA 4Q9IA 4OHWA 4QNRA 2D7DA 2GBLA 4XJXA 4MKIA 2OAP1 3TQFA 2C77A 3QVUA 3BFKA 3CIOA 2BCGY 1W2HA 3QENA 5CYOA 5JI3E 4IVQA 1SHZA 1ZNYA 4OI2A 3TJZA 2WMNB 1G4AE 2J59A 1O3YA 1U0HC 4EPWA 1NMZA 2O0KA 4G0NA 3REFA 4LYHA 5BQ5A 1TNDA 1K5GA 4M1KA 4C0AC 5KNDA 2EW1A 4NE2A 4QGAA 4BLTA 2QY9A 1U2RA 1P9NA 3H86A 1CBUA 3OIVA 5L3VA 4HYYA 2NTYC 1IXRC 1XMSA 2BBSA 4O2LA 4EQ6A 4LJ9A 4TMWA 4QFMA 3KJIA 3ZQ6A 3UMSA 4BZQA 1OH8A 4D0NA 5KSOA 2ZVQX 3CW2A 1XD2B 1HV8A 4WZBE 5FTJA 1BYUA 2CNWD 5DI3B 3UXMA 3GLHA 1XXHE 3LBIA 1Q1QA 1MKYA 1IN8A 2V9PA 4G1UC 5JJKA 3AQ4A 4BLRA 2V54A 2QTVB 2OV2A 4RD4A 1GKUB 2FU5C 3P1JA 4GI7A 1D2NA 4LBVA 3KFVA 2FFHA 4YXWA 2GCNA 4DCUA 2GAOA 1SKYE 2WWXA 4L16A 1P4SA 2E87A 3U44B 2WKPA 2KBFA 4RJLA 4V0NA 2QENA 1G64A 1EFHA 3A1TA 1PZNA 3T61A 2FPMA 4EIWA 4XVUA 3IEVA 1ZINA 2X1VA 3LLUA 2WJYA 1U8AA 1P2VA 5IK2A 2NMVA 5G3YA 2V3CC 1T3SA 4QBHA 3LBNA 2GDJA 3A4MA 4GPTA 5DGXA 1G17A 2ZJAA 1KO7A 3BD9A 2XJ9A 3QKRB 5FR2A 2OFXA 1Z6YA 2ZVPX 2ZI7A 2F7SA 2W6JA 3A1WA 5L3RA 2A2ZA 3AVOA 3KTAA 4RZXA 3WRYC 4M1YA 3ZD6A 4DUGD 4LJ8A 1VCMA 4Q4LA 1PUJA 4BE7B 1XU4A 3U4QB 4DB2A 3LQQA 5JMTA 1GWNA 3AP2A 1XXHB 4LPKA 2C9CA 4HATA 1QHGA 1TL7C 3IGFA 3NVAA 5A5GA 1E9FA 2GJAA 1II8A 1P3JA 4IEEA 3N2IA 1KDOA 2ORWA 3ZS8A 2NZJA 1KNQA 1SKYB 2IW3A 3W6PA 3AVUA 3SJBA 2XTNA 1VKJA 1G20E 2OM2A 2R6DA 3HPRA 1L4UA 5FBRB 2AK3A 1T9HA 3W90A 1G19A 3NDBB 2EFCB 1Z6TA 2QEQA 5F9HA 1G8GA 1IONA 2CCKA 1T5IA 3BAFA 1E2DA 2Y8EA 4L15A 1BMFD 1KI6A 2CDNA 4URVR 2IK8A 2JLQA 2ZS9A 1JR3D 3I62A 3KB2A 2MMGA 1XPRA 2ZUBA 3CH5A 1TUEA 1QHXA 3ZD7A 1V5WA 4BLOA 2CCGA 4A6PA 2YVUA 1JR3E 1X8KA 3PR1A 5IDVA 2GILA 1BO6A 1OPXA 1CF4A 1Q21A 1WRBA 1ONBA 3LVRE 4OHXA 3Q5DA 5TV2A 1DAHA 4JVMA 1KK2A 4NU0A 2ZU0C 4KYIB 4CYMA 3H2YA 1H8HD 3B78A 2QROA 4LPSA 3NKVA 3P26A 2WIBA 4TN1A 3HYRA 2AD1A 2ZSDA 1E0JA 3LBHA 1GVNB 4TT3A 1XEXB 4YMWA 5D3QA 4ZI2A 4MDFA 4GDFA 4TMTA 4IXNA 4BLSA 4BLPA 1N6HA 2VHQA 3KUCA 4CDGA 4G3XA 2P5TB 2WAXA 3LVQE 4TTRA 1GL7A 2BV3A 4PPNA 1W49A 1G7RA 4B6FA 2DPXA 2B8TA 1MRNA 5TVKA 2QP3A 4A82A 1PVOA 5GADl 3UMFA 3MLEA 2REBA 4RFSA 1JBKA 4MRVA 4TYYA 1D8TA 4MH0R 1TAGA 3FTQA 4OQNA 1I2DA 1F2TB 1MO3A 4F91B 1IXSB 3NBYC 3DZ8A 1IN7A 1G6HA 1JEEA 4DDUA 5L3SA 1OFIA 1Q3TA 3SQXA 4OQXA 1AZTA 1E1QA 4AYWA 2GZAA 1A5TA 4G01B 4IOMA 1Z6GA 2J87A 1N6IA 4FCTA 3AF4A 4B3FX 1XTIA 2W6ID 1E9BA 1TF2A 3X1YA 1P62B 2CL6X 2MMCA 2OG2A 1ELOA 1Z08A 3KKOA 1BIFA 3QEOA 3RS5A 5KTYA 1D6JA 1KI7A 3VMFA 4NYMQ 4A0RA 5JFGA 1JAIA 4IDHA 1MO4A 5SZJA 1E0SA 2GEUA 3IUYA 3Q7QA 4XSGA 3DMDA 4XSHA 2PJRA 2ZETA 4HEJA 2CXXA 2QL6A 4PSVA 4OI0A 4Q19A 1OH5A 2V8OA 5H68A 2ZR7A 1LF5A 2NPFA 4B76A 4KU4A 3B2EA 1K8RA 3UKDA 3KXIA 2QBYB 4GZMA 5KSPA 4DLYA 5FPTA 3KQUA 1IJEA 4MDEA 1OXSC 2ZROA 4QC2A 3K0SA 2ZQ5A 3K70D 3VTKA 1IAQA 3K0CC 2C99A 2EYQA 3AUYA 1LY1A 3AGPA 2F1JA 5DHFA 5GVRA 1E98A 4M1SA 1XTSA 2BJVA 3FGNA 3W6OA 4BPBA 3QY0A 2JLVA 4TTQA 3WYGA 3KKQA 3BFXA 4HDCA 4AK9A 5JS8A 3TKLA 1AZSC 3GEEA 2AK2A 1IM2A 4DRZA 5JHHB 4DSTA 1CRPA 2NO0A 3CNLA 2EWWA 4DT1A 4EJSA 5AJVB 4C0QC 2WHXA 2BKUA 5E7IA 2RHDA 3AUXA 3IBYA 4KI0A 3N70A 1DTSA 2R6FA 4IVRA 4RCZA 2AWOA 2LKDA 1XEWY 1TMKA 1W44A 4MGZR 5D3MB 2AHOA 2IX3A 4KSCA 1UDWA 5CJ2A 2XNDA 4QBGB 3W3AA 5HKKA 5F3WB 5L3QB 4HUQB 2REXB 4QGHA 3P4YA 2G0TA 3GLIB 3GFOA 3B1XA 1W0KD 4WA7A 2VP2A 4Q66C 3AVWA 3I8XA 2BBWA 3RWOA 1ESMA 3K70B 2HYIC 3WNBA 4PQFA 4IKEA 4MUBA 2OO7A 1E0AA 2QN6A 3ADDA 4JLMA 2YHSA 2DY1A 3Q3JB 3U6BA 4TZ6A 1PLLA 3BS4A 2ATVA 2FPLA 1WMSA 3QQ5A 4KO8A 2H92A 4C0LA 2QP9X 1IY0A 2JDID 1ZNXA 2UZIR 3C15C 4A92A 2WWYA 4HLDA 2ZAMA 1SVKA 2ZUCA 2DFNA 5FTKA 1OKKD 2ZYVX 2NGRA 2AXNA 4CIDA 4P0TA 2HF8A 2C03A 3QJYA 5EE0A 2DWPA 5TDHA 4DLTA 4MKGA 1DAGA 5IRCD 2G9NA 4QM7A 1E2QA 2R2AA 4HLQB 4RSGA 2HJVA 4OK5A 3E70C 3KKNA 2QNRA 2HYDA 2J1LA 3TSOA 1HA3A 2JJ2A 2GXUA 2OXRA 2VO1A 2L0XA 3E5HA 4R98A 1US8A 1D5CA 2GEDA 1S96A 4RKEA 1NP6A 1HT2E 1TQ6A 3LA6A 1TU4A 4LOAA 2JLUA 1RRCA 5KDDA 1NVVR 4XTCS 2J46A 2JLSA 5EP1A 4YMSA 3KJGA 4DBLC 4YMVA 3CPJB 3BC1A 4A0FA 3B6EA 4IXMA 3AF2A 4BECA 5C18A 5FL7D 2ANCA 2UVQA 1OW3B 3MWLA 4HZIA 4HDOB 2WKQA 2RAPA 1VIYA 5FOSA 3RC3A 4QOSA 1UBCA 5AJXA 2BMEA 3QXJA 1UFQA 4FIDA 4MKFA 2ZYUX 4QBIA 5FL3A 4KSBA 3RHFA 4FI3C 3K0AA 4BWYA 1ZUHA 3HJNA 3Q7PA 4IOJA 4ZDWA 1ZC4A 1COWD 3GLFE 4F7WA 3BORA 3UANA 3B9QA 2ZR9A 4AY2A 1FMLA 4TYQA 3O8CA 3VR1A 4FN5A 4B34A 4PZYA 1E1RD 2ZRPA 3A58B 2ZRBA 3GCGA 4TLDA 5E7JA 4JLJA 4N3NA 3MJRA 3PENA 5AWFC 1U81A 4YC7A 3X1WA 2BM0A 2JCSA 3I61A 3B1YA 1F2UB 1FPMA 1Z3IX 3LFUA 3VR3A 1T5LA 2WWFA 1W0JA 1SXJA 1QG4A 3TQCA 1H65A 1AK2A 2OBLA 1BYIA 3LY5A 3ZIAD 3TSWA 2W0MA 1NL3A 3ZVMA 4EPTA 2WWGA 4MGIR 4PC6A 3AVTA 2QU8A 3ASZA 3MG9A 1AIPA 4ILEA 2OILA 4US1R 1L8QA 3BIFA 4Q1EA 2X8AA 2YOFA 2YYZA 4Q4JA 1OB5A 2Z6VA 2ZRLA 1SVSA 3TVDA 3T15A 1JQJC 3GLFB 1KSJA 3R8FA 1OHHA 2D62A 1DAIA 1VCIA 1L7VC 3K0CA 4LBYA 3VR5A 1DARA 2LKCA 3CF2A 2ZEJA 3ZDQA 4L4UA 1X8LA 4G5QA 1FUUA 1EWRA 4XD7A 3V00A 4BUJA 1JECA 3T35A 4LUCA 4ZIRB 1P2UA 1OXVA 2MSCB 4V02A 4X8OA 1BS1A 1J99A 3DHWC 1PLKA 2WWIA 3HR7A 2ZI4A 3IHWA 2IYTA 1Z63A 2G88A 2ERXA 4NH0A 2ODWA 4POAA 1VYVA 2D2FA 2TMKA 2XSZD 4NTZA 2P6UA 2DWOA 3EC2A 3R20A 4AYTA 2QI9C 4C9BA 2JJ8A 3FHOA 3O8BA 1SKQA 3IQXA 4TLBA 1U98A 1NLFA 3MFYA 4M9SA 3DZDA 1W5SA 3LRPA 2WTUA 2AKYA 3BRWD 2YC4C 2ZE5A 2HLDD 4LRWA 1W36B 2FFQA 1E79D 1ETUA 2B7BA 3CBQA 1LW7A 5HE9A 4ASUA 5DE3A 3QPWA 4LBZA 1TTTA 2CCJA 1EFRA 1TUIA 1R5BA 4QJ4A 1CJVC 3QI2A 4DJTA 2RKOA 2XOKD 3THXA 3K9GA 3QNUA 1XMVA 3FMFA 5FBWB 1J8YF 3A8TA 3EASA 1WA5A 2AFHE 4NDZA 4CEIA 4KXFB 2GCOB 1NNEA 2ZRKA 3I5XA 2B8WA 4PTLA 1A1VA 1Q44A 2ONJA 3AVPA 5DHAA 1Z0FA 5CJPA 3GLGA 1GDDA 2DFTA 4QGFA 5KUTA 2VF7A 2Q21A 2WMOB 2VSOA 4PHGA 3DKPA 4D0LB 1W4CA 3GFTA 4A8JB 5K8IA 1CU1A 3THWB 1QHSA 2Q3HA 3WBJA 4KITB 1OV4A 3T1TA 2ODBA 1R8QA 4Z1MD 1FZQA 2AD5A 5EE5B 3PEVA 1GOTA 3FFAA 5JHGB 1ZMXA 4LJ4A 3U7GA 1RE0A 3QKTA 4TLCA 2F1HA 2B21A 4Q01A 1G6OA 3GJ8A 5EXPA 4M21A 2ZSAA 2OFOA 3U6KA 1M7HA 5FOXA 4M2LA 4FW9A 1S8FA 3P32A 5CK4A 1MABB 3O8RA 2JJ1A 5FH9A 4IDNA 4C30A 5JJIA 1FX0A 2FF7A 2QE7D 1M1YE 2ZJYA 4DDVA 1M7BA 3W3ZB 2CK3D 4D4MA 3PUZA 3FDIA 3H1TA 2KWIA 4CEJA 2O8EA 4P4SB 1Z0AA 3ZVRA 4EPYA 1ZNWA 2FGKA 1Q12A 2KJQA 1S9DA 1Z8FA 2R44A 1E0KA 3MWKA 5JEDA 1N6LA 2HT6A 4KVGA 4LHWA 3B1ZA 3HPQA 5FBVB 2IC5A 4LX0A 3VR4A 2YINC 3M0EA 4LSGA 1NLZA 4AG6A 3OAAD 5JSZA 1XNJA 3ZVNA 2BM1A 1KY2A 4WW0A 1ZIOA 5TMPA 2MSEB 5FI1B 3AP3A 3FPAA 4TL8A 3KQNA 4D4JA 4OJKA 3S1AA 4TYNA 1DAEA 1ZM3A 4R2IA 2ZE7A 2F3RA 3AVYA 4L8GA 2G77B 4A0HA 3FVQA 4IEIA 2F43B 1P7CA 1Z2CA 4GT1A 1EG7A 1SVMA 821PA 4XWAA 4RZ2A 4QM6A 3NWJA 5AK0A 1II0A 4KBGA 3ZQJA 4D4KA 4B3DA 2BEKA 4JLNA 4RVCA 1LS6A 2OT3B 3L82B 1NSFA 5ANRB 1TEVA 3B1VA 2WWWA 4BFVA 2O8FB 3TGPA 3RS3A 3ZH9B 2QORA 4KAXA 3ZS9A 4A0GA 2VL7A 2ZRNA 3L0IB 2W83A 4BRWA 1GRRA 1OXXK 1I4DD 1S0UA 5G53C 3QXCA 1WBDA 5BYJA 1DAMA 1GL9B 3K0EA 4JVLA 3R7WA 1A7JA 1QVAA 2OCAA 1YZUA 1P9RA 4C4PA 1FUKA 4M1TA 1XWIA 1KMQA 5LD2B 4A15A 5CDFA 3W5IA 5CYPA 5C4GB 1RPZA 3ZVLA 3KQHA 3MRSA 2DR3A 3MWYW 4ITRC 2GF9A 3RRNA 3C41J 4D6PA 1DPFA 2J45A 3VNVA 3HU3A 1MO5A 2A9KA 5M04A 1NBMA 4LJYA 2OCBA 2A5JA 4AC9A 3TUIC 3U3MA 4V0MA 1OXTA 2EFDB 1KMHB 4KFSA 1OSNA 1XCMA 2VTKA 4Q7KA 2IT1A 2JA1A 2I1QA 3GLHE 3GMTA 3ADBA 1WDTA 4YXWD 5FUWA 3TBKA 1E9RA 2F6RA 2IYSA 2VHCA 3BXZA 2FFBA 1ZCAA 1P6XA 4G5GA 1UF9A 4X8MA 3RRMA 2AKAB 5F9FA 1M2OB 2OLKA 1QHNA 3TVTA 1G1MA 2IUSA 3U61B 4AYXA 1E9CA 4CEHA 1E2EA 1NVWQ 3QSYA 3WMEA 5IK2D 1XZPA 2DFKB 2IWRA 1Z0JA 3G82C 4AURA 4EFMA 2I4IA 1HQCA 5JWOA 4BFUA 2WKRA 4OQLA 3GD7A 2W6JD 2FSHA 3TE6A 4LJAA 1WB9A 5C2JB 5FFMA 1KI3A 3CB4A 1NKTA 3CLVA 3MJHA 1S1MA 2FSGA 2OAQ1 3ZJYA 2C2HA 2QM8A 4HAVA 3RS4A 4DIEA 2CHQA 1XRJA 5JCPA 2J7PA 4KV9A 2OXCA 2WJJA 2OBMA 1SQ5A 1XD2A 2CMKA 4BRUA 2XAUA 2YJTD 3GLHB 3GP8A 4NYJQ 5DI3A 1HY3A 2FX3A 2ZI3A 1Z06A 4L9SA 1JQLB 1N5LA 3LD9A 3R9WA 2C04A 5JLJA 2RCNA 2N1BA 4B48A 1HEIA 3FHCB 3AKYA 4B3XA 4BEBA 2NO9A 1UBGA 4UXJA 4P33A 3AEZA 2QAJA 1SVIA 4DLRA 1KHTA 3NC0C 3H84A 2ZE6A 5LB2A 2VQSA 2YOHA 2KSQA 3EX7C 1OLOA 3K0FB 1N5JA 4EJSC 4F4IA 2WV9A 1Q20A 3F0TA 1Z6XA 1GNPA 2ZUDA 1YZQA 2V6IA 4D26A 2CVHA 1KAGA 3VKHA 1G3QA 3OFNA 5AR1A 4I4LA 1Z5ZA 2Q9CA 1UKZA 1U0JA 2GK7A 3QBVA 4DIDA 3EIQA 2GJKA 1Q0UA 4H1VA 2QRNA 1QHYA 1S2MA 1VDZA 3SBEA 1DO2A 2BHRA 2QGZA 5FPKA 1N0UA 2ZSBA 2ZRMA 3NHBA 1M7GA 3CRVA 3U4QA 4NHOA 3LX5A 4R7ZA 3THOA 2ZI6A 4NCIA 1LS1A 1XMIA 2DHRA 3ZGXA 1S9HA 1M6NA 4GOJA 1C9KA 1KGDA 1II8B 4TT3D 1KOFA 2HT1A 3X2SA 2CJWA 3MD0A 2ZRDA 1N0VC 3ZZ0A 4KYUA 2O8BB 4R2HA 3C5HA 3RSLA 3GQBA 4RKFA 4CRWB 1TEXA 2GF0A 4DSOA 1IY1A 4NPHA 4WZAE 2PX0A 3HP1A 3PG5A 3C14C 3CR7A 3LX8A 2YNMA 1JR6A 3VAAA 1KO8A 2QTHA 4KJZA 2JEOA 1NN5A 5J4HA 3MMPA 1J90A 1AS3A 1XTKA 4W7SA 4WIAA 5DO9A 1SZPA 5KO2A 1KKLA 3A1SA 1OB2A 1P60A 1WQ1R 2OFWA 4NCKA 3RRZA 5JCZA 3SFZA 3NXSA 5CM9C 1E2MA 1YE8A 2PL3A 1FQKA 1E99A 2QT1A 4AKHA 5J4KA 4DVGA 3ADCA 3F3YA 3TLXA 2R62A 2HF9A 1XFAA 1CULC 1QBKC 1R0XA 2YOGA 3TH5A 2IF2A 1E1QD 4LGMA 3MAAC 1JALA 2FMXA 1EK0A 3QPVA 1Z22A 3SJZA 4DWJA 3FMOB 2RGCA 1CJUC 2D74A 3QPUA 4V0KA 1XTRA 1SGWA 3CRW1 3CX7A 1OFTA 1UPTA 3EWSA 4H9GA 2QTFA 4LY6A 2HDNB 5CIWA 5DYGA 3O47A 2J5XA 2VF8A 2ZRHA 1TU3A 3IKJA 4MGKR 1XPOA 4DB4A 3SDZA 5K8TA 5J40A 1TQDA 5HCNA 1YJ5A 2OBNA 3ETLA 3IQWA 3K9NA 3SZRA 5HZKA 5BN5A 1XTJA 2IYYA 3A4NA 3LAWA 4Q47A 1F3OA 4NYIQ 1AQUA 1W47A 2ZTSA 5DN6A 3U7HB 3AVQA 3TW8B 2WWHA 4Q9KA 3NEYA 2DWQA 4PPGA 2R6GA 3DOFA 2J0UA 1XDBA 1AS0A 1W2GA 2PZFA 2WSMA 221PA 2GJ9A 3AVXA 3I92A 1ZAKA 4DC9A 4L5BA 3RDPA 2PT5A 5TARA 4JL5A 1NN3A 3LW7A 1G291 2HXYA 1MT0A 1F2TA 2WJVA 4KLNA 1G4UR 2O0HA 1BKDR 1GITA 1P61B 2GJ8A 2VHUA 3BBPA 2IS2A 2GVDC 2VP4A 3QF4A 4OK3A 1E32A 1DVRA 5C1BA 2CLDX 1SXJC 4F38A 3ZZUA 3C16C 1Q57A 2NIPA 2B92A 4LV5B 4TSFA 4DDTA 5FTLA 5FR1A 3CPHA 2HEIA 3EPHA 1P73A 1YR8A 1R0WA 4QRHA 1JAHA 1W46A 1AS2A 5DIFA 1VG9B 1D2MA 4JYBA 2XNDD 5J47A 4NP6A 2EFHB 2A5GA 1XTQA 1FFHA 5FOVA 4ON9A 1O87A 2KB0A 3DDCA 1UBEA 4TMXA 1DS6A 3C5CA 5GJWC 1G9XA 2BJWA 1ZP6A 1Z0DA 3H0KA 2OLJA 2FJUA 4WVFA 2OHFA 1WXQA 5J4VA 3U3RA 2QBYA 4ZI3A 4NONA 1G3RA 1VCNA 3GJ5A 4FXPA 4HI0E 1OYYA 5B2ZA 2BWJA 2H16A 3QIAA 2XITA 2CL0X 3EZ9A 3BH7A 4D82A 2JLZA 3A4LA 2GJSA 1GIAA 4Q21A 5AUNB 3QUSA 1CTQA 1X8JA 4Q9LA 4EPXA 3RVBA 4JLPA 4IVPA 5CLQA 3WRXC 2QMEA 4B74A 3DOEA 1AQYA 4D81A 4LHYA 3EA5A 4UNPA 3L43A 4B32A 1KSHA 5FBLB 1OYWA 2F3TA 2FNAA 1ZD8A 2EFEB 4TQUS 4PO9A 4ESHA 2FGJA 2AFIE 2RGXA 3BE4A 2W2XA 1AM4D 2GA8A 1WCV1 4II7A 4DT1B 4PX9A 4CVNA 4JLDA 4AKIA 3SNHA 3IILA 2C9YA 1L2TA 5FTMA 2PH1A 2F9LA 2RGEA 1SULA 4Y0AA 1VHTA 1YRBA 5D3MA 3X1ZA 4F92B 1KZGB 4IW3B 3LWNA 3MWJA 1XEFA 1M8PA 2RGDA 4LC0A 4B2IA 2W2VA 2JJ2D 3G0HA 4B73A 1MRSA 4HB3A 4JMPA 2AXPA 1C1YA 1YQTA 5L3QA 1CRQA 1W36C 1VG1A 2HUPA 3CUEF 1ZU4A 3SN6A 2VP9A 4PZZA 1VPLA 3GLIA 2RHMA 3CKLA 1E4VA 1PV4A 5A4JA 3WHKA 4CT4B 2ZITA 2VSXA 3KUDA 1XCGB 4NCHA 1YZLA 4MQBA 1ZM4A 3FKQA 3LO5A 3T1QA 1N3BA 2IS6A 3HR8A 2VSFA 3IIJA 3OIWA 4RD6A 4HB0A 5JZVA 4M9QA 3IIKA 4GMXA 5DLQC 1VG0B 3TR0A 3ICQB 1EWQA 3N5CA 2FFAA 2Z4RA 4MGYR 4B3BA 2GXQA 2C96A 3LNCA 3VU9B 521PA 5E3HA 3OESA 3GJ3A 4D4LA 3RAPR 2B6HA 4PC1A 2Q3MA 1RZ3A 4MKHA 1X1RA 1YZGA 2FSIA 2QZ4A 2XJ4A 3FYHA 4HB2A 4OKSA 2Z0MA 1N6RA 3SBDA 4IRUB 3VFDA 4QNMA 1Q22A 5L8VA 3U7FB 2OEPA 2V7QA 2V6JA 1KJYA 1UJ2A 3VQTA 4URXR 2ZRJA 1AGPA 2H5EA 1KZ7B 4DLUA 4PR0A 2K5UA 3M1IA 1CIPA 2XZLA 1NG1A 5E95A 2F55A 4GP7A 1RRFA 2XXAB 4DKXA 1M34E 3SHFA 3KQLA 3IHLA 4ZO4A 1W0JD 1US8B 4GMDA 3IPYA 2NO1A 1QDEA 3DM9B 4JT4A 1M74A 3FKSA 3CNNA 3SQWA 1Z0KA 2DBYA 4AI6A 2BMFA 5J5CA 4GZLA 4DEYA 3EZFA 3LLMA 3V9PA 2EWVA 3D7MA 5JI2E 4KVAA 3ICEA 1GAJA 2PZEA 1NN1A 1YU9A 4N0EA 1XCPA 2Z43A 3DVLA 5CLLA 5LDDC 2J7KA 2A30A 4TWZA 3JZAA 1OHHD 4ZDJA 2H7VA 4RZ3A 4PSKA 4Q7LA 3CWZA 1QG2A 3PVSA 2WJHA 4LDJA 2PMDA 1QHHB 2JATA 2X77A 4XD7D 1E2NA 4Q9HA 3CWQA 5AJYA 4C0KA 5FOWA 2WPDA 2O8DB 5A0FA 2PEYA 1WF3A 2FSFA 3WNCA 2H57A 3SOPA 1Z47A 1P72A 1JNYA 2XEXA 3L0OA 1JEDA 3KXKA 1NN0A 1CXZA 4GOKA 2A5YB 4V0OA 4DLSA 1SVLA 5HR5A 3I5YA 4LC1A 1T8TA 3PIRA 5HPYB 2JLWA 3RABA 3QXHA 4PANA 5JWHA 5EP2A 1F2UA 1P75A 1RFLA 3C4JA 4Q4HB 4F4CA 2OCPA 4Q9JA 4K8OA 1GRQA 2NQ2C 2H17A 2ZRFA 4UXIA 4M0LA 1G7TA 5KNBA 5CB6A 2QAGC 1SVWA 4UKDA 1IQPA 3GJXC 3QE0A 4NL4H 3P4XA 4LZZA 2O8CB 1SHKA 2PX3A 4IJMA 4WZ6A 3A6PC 1JJ7A 2ODNA 3LQRA 3GFPA 3PITA 1OFUX 4ASUD 4Q4JB 5K8UA 1EFRD 1KI8A 1KAOA 1FMJA 2IYRA 4LJ5A 1FP6A 3CRRA 1BOFA 4JL6A 3CPEA 1NY6A 3T1OA 2JLYA 3TK1A 2RB4A 3A36A 4OQMA 3RANA 1J8MF 2VYFA 3ASYA 4LK2A 1Q1EA 2V1XA 3CZPA 4ZIRA 3EA0A 2ASEA 2FZ4A 1ZU5A 3T1VA 1KI2A 3RRYA 1VECA 2G6BA 1E94E 2IS4A 1UAAA 1DO0A 4FD2A 3GLGE 2Q6TA 4URZR 3WHLA 2GTPA 4F93B 2V4ZA 2ZI9A 5JEEA 2REOA 1X6VA 2JIZD 4ARZA 1ZUNB 3JVUA 4AKEA 1W4BA 4TMVA 1OFHA 3P20A 3NH6A 4I1UA 1ESNA 3ADKA 2R6CA 2YWFA 3AP1A 1KO1A 1G8FA 4BZXA 1G8PA 2ZU6A 4K81B 2IXGA 2IYUA 1VYUA 3X1XA 2GESA 4WXPA 2IYZA 2PZGA 2BMJA 3THYA 1HE1C 1W48A 1XJQA 2NPIA 5LPNA 2PMKA 1FNMA 4JVSB 1ZUIA 3SI7A 2XZOA 1A2BA 3OEEA 2XTMA 4M22A 3T34A 4L9WA 2ZJ2A 3KB1A 1GM5A 2GXAA 2ERYA 3EIEA 4MUAA 1W4RA 2JJ1D 1KKMA 4QG7A 1KJWA 3SYLA 2GAAA 1R7RA 2RMKA 2VRWA 2W0SA 3EPKA 4ZCIA 2XX3A 3AF3A 1NI3A 4CEIB 1KK3A 1P2TA 4A1FA 1E2GA 3MUFA 3PUYA 4NYMR 1EFUA 3VR2A 5B57C 2QA5A 2PLFA 721PA 2ZRCA 2C78A 1NMYA 3CX8A 4Q00A 5G41A 1CJTC 2QQ0A 3EZ7A 4Q1AA 3WBKA 1E69A 2C9OA 2GETA 2HXSA 3THWA 1KO5A 1IHUA 3NBFA 4C7OB 4Q1DA 3DL0A 3V4RA 3FMIA 1G18A 2NZ8A 4DSNA 1JI0A 3Q8XB 3BWDD 4HLUC 2WAYA 2AL7A 3RSOA 1G16A 3U3OA 3HWSA 1YZNA 3L0SA 4JBWA 4DCNA 4P31A 2W2TA 2ZJ5A 2XGJA 2IUTA 1IN4A 4IDOA 4O25A 1B0UA 3TIFA 2NOAA 3FWYA 3LV8A 2MSDB 1RRPA 4URUR 4PQYA 5JS7A 3PJRA 1G21E 2WBLC 1YR9A 2DFLA 3DKVA 4LYFA 1NF3A 1G5TA 1G3IA 3TAUA 1MABA 2R6AA 2FDCA 1FX0B 3I4LA
chains in the Genus database with same CATH superfamily
1YCHA 1HL7A 1JMYA 1N3IA 2P6NA 3R24A 3IDQA 4QHTA 3E9RA 2CLEB 5JH7F 4H4EA 4JSTA 1HT3A 1J22A 3KAKA 2BDTA 4G5RA 3AUFA 4Q4AB 3ZDFA 1B6SA 2ORIA 3NATA 2WHEA 3GPLA 3NHYA 2C0QA 3HU1A 1RJ9B 4CF7A 3DE3X 1YJXA 1TADA 3KZ1E 4Q34A 4QATA 1E89A 2FR8C 1YOVA 1NVTA 3WX0A 4W7IA 4G0UA 2XQFA 5ENVA 5HW0A 5DTQA 3DPIA 1EXNA 1HDRA 1M9NA 5JSZB 1YRHA 2QDXA 4GBMA 3P0EA 3CTMA 1REQB 4H77A 5D7NA 1OD6A 5KU1A 2WNSA 1IZ9A 1D9ZA 2G71A 4Z1MA 3NBZC 3QW4B 3REQB 1VJCA 4PPFA 3VJMA 1EUCA 4O1HA 2D2EA 1TF5A 1P9WA 4EDHA 4KR0A 1R8XA 1KDTA 1IY2A 2BGMA 2RI0A 3AETB 1UT8A 5ADVA 5M2QA 2W58A 1G5RA 2I0FA 1T4CA 1NBMD 1U1DA 5FWXA 2DP4E 3KKPA 2ALJA 3BXEA 3EDQA 4L0DA 3TRKA 2PT6A 1NF8A 2ZVJA 2AF4C 2D06A 3OIYA 4M98A 1XL0A 4BKUA 1QWSA 1KSGA 1S1CA 2RK4A 2Q0HA 3HKCB 4XDYA 4C3VA 3L6RA 3SEZA 2IXEA 3IAAA 1ZH0A 2X1MA 2PL5A 3V97A 4V0ME 1LDMA 1JDVA 3R0JA 2DCMA 1WUYA 1UC4B 2Q7XA 2JAWA 4X1YA 1BU5A 3U1BA 2CV2A 3MHTA 2XB4A 2B1JA 5FOTA 1W2WB 3E2MA 4GEGA 4RZSA 1TDJA 4Q5IA 3OJXA 2JCXA 3HBMA 1P4GA 2R1ZA 3OE7A 2DYKA 4NJEB 4C0HA 5KNBH 5EZSA 3PRHA 1ORIA 1DKNA 2ZYRA 2P0AA 5EG5A 4KZKA 1K5DA 4AJIA 4R2XA 1EU1A 3JQ8B 4ACBA 2PQ0A 2SKEA 1O54A 1MFZA 4D9KA 4YV1A 1SPBS 3FMGA 3Q8WA 4TSKA 1RKUA 2B78A 1OASA 2EFGA 3ZDXB 1S01A 2O20A 5IZCC 3RC8A 3NWOA 3EEFA 4OEHA 1BDBA 2VDWB 4CLRB 2GVZC 3TKYA 4KAFA 1XIVA 1RYHA 3VPGA 4KXLA 2GD2A 1JU4A 1HH4A 3TUZC 1E9SA 4ML3A 2PV0A 2B1IA 3NYRA 4OAOA 1KDVA 4F5YA 2HF2A 3EFHA 5CTJA 3DLIA 4CMEC 1EX7A 5COBA 3JQCA 1U04A 2KI5A 1IJFA 5B64A 1QAMA 3T12A 2C8VA 4QO8A 3MSXA 3PQ5A 4PO8A 3HR4A 1BE8A 1CSEE 2ZB2A 3R09A 1V7CA 2IEGA 2AWNA 4D9BA 4E5MA 3M6MD 3BFPA 3R0VA 4JQOA 4BNGA 4DXAA 1ZW6A 4QUAA 3SJAA 5TEVA 2HMAA 1SEVA 2BGRA 3A1UA 3AB8A 5IU6A 4D1YA 1AH2A 3PNKA 2IA5A 3QKWA 3DFUA 4EYEA 3QPCA 4H7PA 2HHJA 4XX0B 3W9SA 2VH5R 5L7WA 4PSAA 4YCDA 1Z0IA 2DB3A 2UKDA 4KWIA 5ADHA 5F4BA 1TUBB 4JDUA 2GK3A 3QM1A 4M53A 4HDRA 2P9BA 1ZK3A 3M3PA 5JWRA 1O5IA 1M72A 3DMGA 3L0PA 3OCUA 1NY5A 1KFKB 1PQUA 4UPVA 5BP7A 1S8NA 1V39A 2AN9A 3AKCA 4FDAA 2OWDA 4EQ6B 1AJEA 2D4HA 1S6YA 4TQAA 3W04A 4YLGA 5H70A 3EZ2A 4HAIA 3CT6A 2ZXEA 4OXKA 3RK4A 1BEUB 2OQRA 1YTLA 4I5IA 3JQAD 3B2QA 2X9GA 3E84A 2HL6A 4MTLA 2IBMA 1FOEB 1HDOA 1SCQA 1A82A 3JQ7A 3RKUA 3USES 3KL2A 1KI1A 1ZD5A 1ACLA 4M0MA 4GD3Q 1L3CA 4GVXA 5BUZA 4L4ZA 2ZSFA 1EM8A 1C7EA 4WERA 4QBFA 1U9ZA 1ZCBA 2FVYA 4QUBA 4R2HA 4R7GA 1Z9BA 1I33A 2FG5A 2IXFA 3NIGB 4EPRA 5KSYA 2I9KA 4HAXA 3R3JA 4MJ7A 4WXRA 4YH1A 1M2FA 1LDYA 3TEFA 3DEFA 1ZHHA 2H1LA 2EU8A 2Q8NA 2CDAA 4CLHA 5A5EA 1R50A 2CLSA 1UKCA 1P8JA 1Z28A 1PX2A 4WBNA 5EHNA 3OF5A 3WFZA 4FSDA 5AI0A 1AXGA 2C5HA 3HU2A 5AQ1A 5I7HA 3B89A 3ND8A 4B2LA 4BX8A 3RYCA 3I0ZA 1E0DA 2YYAA 1R0ZA 2VYVD 3FUTA 5TY0A 2C7OA 1TX4B 4XYEA 1Q1GA 3OLCX 2BGLA 1XDGA 2QYTA 4KODA 5H02A 3CHYA 4IDCA 1A4UA 1SUBA 1T3HA 3OH8A 2ET6A 1MJ5A 4M38A 3OE4A 5IH3A 4QZVA 2F48A 4ZEMA 4O2RA 2H1OA 4G5OA 5LM3A 1RIIA 3HE3A 1YVDA 3DBIA 3UGJA 1GR1A 1PUIA 3EC7A 3K5WA 3LZDA 4RKWA 4XGRA 4LI0A 3S2UA 2DX7A 1QYIA 5GMOA 3PQEA 3EIHA 1KTVA 4PO1A 3D8BA 4R7TA 1SQGA 4QE3A 4O33A 2CNWA 1ST3A 4OMCA 4MV1A 3S27A 3CRZA 2LXNA 1MOZA 4US0R 5TQ0B 1LFDB 2PS3A 4N8EA 5K0TA 1SCJA 3TZLA 3DAHA 1YRLA 4BTEA 4PO3X 1XTBA 2VJYA 4KN5A 4UNNA 1UFRA 1O1YA 2CFOA 5AW0A 1IN5A 1S3GA 3AYXB 2QMZA 4UASA 1E7WA 4RF2A 3ENZA 3RJZA 1J0XO 3PQDA 4J0FA 4LVOA 2CBZA 4FN4A 3BWEA 5F21A 2P5SA 2CJWB 4KQMA 2JCYA 1CUEA 3D3NA 3JPWA 3UY4A 3WP1B 2O8BA 2HZBA 1EBBA 1PN3A 3GPBA 4P81A 2YMQA 4KP7A 4DE5A 3KSAC 2ZLBA 4EYOA 2Q4BA 4PINA 1ORTA 4GU5A 3DGEC 4XTRA 4UTVA 3K70C 3NH9A 4LTNA 1O08A 4FFBB 4ZI5A 1XK6A 4R1LA 1M75A 2VHJA 2VJMA 1CY2A 1OVMA 1U65A 1KYTA 3NM5A 5LOVB 3IEMA 3IQHX 3Q11A 3ZE9A 5DN6D 1MFPA 2I7TA 2ZIUB 1XCJA 2PH7A 2YWHA 1D7AA 2XW6A 4FNOA 1YC5A 2WQZA 1JLLA 1XEWX 2M1XA 3ZY4A 4BWGA 3IX7A 4MRRA 4QUKA 1OE0A 2WAOA 3FOZA 2IU6A 1MV8A 3OG9A 1G7SA 1P19A 3KJHA 4QUJA 1AKVA 2H51A 2GK6A 2IOYA 2J5KA 2OUKA 4M1WA 4N3GA 1PZGA 1Z75A 3H11B 4FHFA 4ZDKA 5B1YA 4N12A 2IYQA 3M82A 4KTTE 1U8ZA 3A6KA 1U9IA 1BXRB 4L0CA 2JBAA 1D5WA 3GVCA 3U09A 2P75A 3R9IA 4AZ3B 4BQIA 5CUQA 3CUYA 3DZHA 2OK8A 5DTJA 2OXFA 1G20A 5GOTA 2HLHA 2VBIA 4IQGA 3NAMA 5LQKA 3BCRA 3DZBA 3SAJA 4EGSA 4YJDA 2XAAA 2VUSA 4LYAA 1FP2A 3KELA 5IZCA 2HRBA 3S2EA 4QUHA 2DOKA 4K6MA 2F1RA 4QJ5A 1UZNA 3BMNA 1Q11A 1IUNA 4ABYA 1WW2A 4NBSA 3MIZA 5T67A 1SG9A 2V7PA 2YW2A 1QU3A 1K7EB 4YP0A 1PD0A 4CMEA 4EJFA 2Y0BA 1A9PA 1F9AA 3K0KA 4GZ3A 4OAQA 3SXJA 1Y0BA 4Y0VA 1MAWA 2ZREA 1H0HA 5LXTF 5K0GA 5C52B 1JE0A 2BFBB 4DRXB 1AD2A 1SZCA 1BDMA 4Q03A 1MC8A 4JB3A 4PBRA 4B4UA 5F7OA 1XRLA 1QP8A 1ZEJA 3IUJA 1H3NA 4G8BA 4V0RA 2QTLA 1T5DX 3PLNA 4FINA 3WZ2A 1OIXA 3MJSA 3MCAA 1XZQA 3BK7A 3PC3A 1VE3A 4LRUA 1ANKA 2Q0SA 4ZVNA 1ZJ6A 3GX1A 3VU0A 3EG5A 3EXHB 2CL7X 3MTIA 3C5VA 3QYFA 1GPMA 3SZ3A 4L51A 1RZRD 4O02B 2P8SA 1LTQA 2F9FA 1CV2A 3EC1A 1N7HA 4L4RA 4M6WA 4BN4A 3VGJA 5KOYA 1JLMA 3VX3A 1P7YA 3JWEA 4Z4HA 1DIAA 1TD1A 4WK0B 2FN9A 2F64A 3WMFA 4DUPA 1C8KA 2CE7A 4OHPA 2RE8A 1WHSA 1VYTA 3E5NA 1RAEA 3R3VA 4NV3A 3INNA 4TS1A 2QP4A 3UWOA 2QPAA 1E2JA 2NN3C 4LXIA 4W5RA 3OX1A 1KOLA 3GH3A 4P38A 2DPYA 4FW8A 4ND8B 5HKKD 2H4XA 4FB5A 3WL8A 1MJGA 1Q0PA 4BO0A 3W5BA 3TCXB 4Q15A 2LCQA 3PNBA 1LVUA 1J7JA 3EARA 4LQCA 5CVCA 5ESWA 1IPFA 1COZA 4I5GA 3C7AA 4LJLA 1G8YA 1J0DA 4LHEA 4PZCA 1YONA 5GAJA 4CN9A 3RYFA 2IYLD 1ONOA 4ZVTA 2G72A 1Y63A 3IP9A 4WXMA 3TW4A 4B47A 5C5DA 3SOZA 2A3RA 3FLBA 1C1DB 2BE9A 4M8LA 4C2UA 3R3XA 1FS6A 3DE0X 2JZCA 2YQ5A 4IHJB 1KI9A 3F6BX 4KB5A 5AO9A 1VC2A 5FT9A 4EA7A 1RRVA 4LY3A 3AF6A 3OWXA 1VP9A 4JXJA 4MWCA 3R0ZA 4YFYA 2B7CA 2RGNC 3AH8A 2X76A 3PRKE 3TECE 1C7ZA 3KE9A 1RP1A 1M2EA 3A9TA 4ONEA 1DTEA 2BC9A 1J70A 4FZRA 1JAXA 3HRIA 3QA9A 3BKXA 1WVIA 1MZVA 1OWOA 3W5CA 2A1IA 3CVUA 1XJCA 2AHRA 1NUSA 3P27A 4HUJA 4PVCA 1JDTA 1TO1E 5FTWA 3TNFA 1U0BB 2FE4A 4LQDA 2WWRA 1KNXA 4D8XA 4WOJA 2WKWA 4QYIB 4E3ZA 1A8SA 1PEDA 5CM2Z 2J07A 5EKXA 2OESA 1J0CA 4MNTA 2JI6A 4H3SA 3KKEA 4YP5A 1MJGM 4BFZA 3K73O 4EOGA 1X92A 1YZTA 4PHFA 4FLEA 1UJMA 4RHFA 4ZOBA 3HXOA 3PGVA 3LYLA 2QPTA 2RGBA 2HV8A 4C0JA 3UJAA 3GRCA 4FX2A 4MV4A 1FUEA 1RQ2A 1ZDMA 4TS9A 4DCPA 3TLBA 1I36A 4BQPA 1T26A 3G2MA 4UE6A 5BSRA 4BQEA 2PAFA 1FB5A 3CF6R 4X1IA 5LP6B 1NQUA 1T2UA 4PBTA 4YAKA 2IV3A 1RR6A 1Y3AA 4DGQA 2XMGA 3A9VA 1HURA 2O0MA 4YX9A 3UWKA 3DZJA 1M66A 3VU8A 2FUG1 1OQAA 3QEJA 4Y8VA 2JA2A 2OZKA 1W85A 3COZA 1BTOA 3LPNA 3UPUA 3KDSE 5H16A 2H7YA 3PXAA 1LLDA 3T5DA 1R8SA 4PFSA 2P1ZA 3WIOA 1RJDA 2CHVA 3HCAA 2YXLA 1I4WA 1A95A 3HDVA 2V0CA 3GLSA 3LW8A 1E6WA 2XDQA 4HAUA 1W19A 5DM60 3DEZA 3GMSA 3HN2A 3EFOB 4JI5B 5LUAA 3OQOA 1B16A 3EA4A 2I3BA 1RYFA 3M5CA 4TKZA 4F2GA 3AC0A 2QJFA 1E3DA 5IS2A 4RZUA 4JA2A 1LZKA 3IOCA 1CR4A 1QR2A 4ZJZA 4FCVA 1SELA 2A3NA 4DCCA 1MR3F 3P52A 4KO3S 3DCJA 1DPGA 5JXJA 2O06A 3C3EA 2W2LA 1V6SA 1OU4A 1AZWA 2I2WA 3A1CA 3LXXA 4H60A 2H18A 4RCVA 1HI9A 5JYBA 1Y8QB 2WHYA 1MC5A 4P4UA 3T9CA 3NHJA 1G7CA 1JDPA 5JRZA 4FMDF 1G5PA 4OJNA 1SKMA 2A86A 1CS4C 4BO6A 3N86A 2D13A 3RSFA 1ECBA 1T5OA 1XZLA 1SXJE 3QITA 4QRIA 2VK1A 5CR9A 3IIMA 2P3SA 4PZLA 4RIGA 1U2TA 3CUUA 2PKCA 3GN2A 4UNQA 3BMCB 3JZDA 1QRAA 4FEGA 2PKXA 4WBXC 5TB5A 5I5EA 3A28A 2YQ4A 3I8OA 1DUIA 1ESDA 3U2QA 3RFFA 4FUTA 1POWA 4JDPA 1X3SA 4JJZA 1U0SY 4NBVA 4Q9NA 3ACDA 2EX1A 3EVTA 3II6X 4LGVA 3RKRA 4DNXA 1IM8A 1C0KA 5AVOA 3H5RA 3RLFA 3M1AA 1AHNA 3IA2A 4PAWA 2G5GX 1C50A 5ERYA 3UK2A 1QYRA 1EA5A 1T4DA 1A88A 1JLRA 4J8PA 2H85A 4F2PA 1Y7IA 4UDNA 3BGVA 2OD2A 1QXSA 2Z3ZA 3LT2A 4UC0A 3ABRB 3I4FA 1L9XA 4OBXA 4LCBA 3O3MB 1VE1A 1WHTB 1P5ZB 1DWUA 1IMJA 2YASA 4BOYA 3KD2A 1K6EA 1WTAA 1MZPA 3IHKA 4K2HA 4CF5A 3QBTA 5HE8A 1QHHA 4Q6WA 3QTTA 3EWAA 3NDPA 4G97A 1YNSA 4ZT6A 2ZYHA 3O95A 4G4GA 4DMKA 2VBCA 4CKCB 5K5EA 1ACJA 3ZNNA 4CKYA 2JAPA 2QQFA 4FXOA 4QGGA 2XCRB 1NG9A 4MRPA 1XX6A 2WU0A 3ONVA 5FUXA 1JZTA 4GO1A 2UYGA 4MUHA 1GEEA 1QR6A 3IP7A 3OT1B 4DEXA 4YJ2A 1ZC3A 4TTJA 2J30A 2JH9A 4MP3A 4PC3A 1MVNA 3D6NB 1N2XA 5TS2A 4F5ZA 1Z4QA 5F1KA 2WOOA 1Q6YA 1UOEA 2R60A 2FCAA 2YWDA 4WGGA 1ZNZA 1BDJA 1YO6A 3RV4A 5DK6A 2B69A 2JAQA 3FYTA 1VYHA 3O4GA 4C0BA 4X93A 3H9BA 3E58A 1N0WA 1O0SA 4V0QA 4GZ5A 1GLGA 2XMPA 3PQ6A 2BBOA 2PZMA 3L5KA 4RO0A 4HWTA 5FL7A 4BZPA 1L6RA 1JHQA 3ANXA 4JIMA 3F5DA 1T9CA 4LRXA 4QQFA 1KOGA 2YJGA 3PP8A 1CB0A 2WYUA 3GUZA 3DTYA 3NBXX 4GM4A 1F0PA 1GPNA 1OI4A 5FCDA 4O2BA 2ZB7A 5IFLA 1W36D 1I2AA 5A04A 2AF3C 2W22A 4XGIA 3H97A 2G4CA 3UCFA 2JH3A 3V6LA 1U2PA 2BOVA 2JIMA 1TCAA 3K8ZA 1BRMA 5EIFA 3UCXA 1XKXA 3GRKA 1E3JA 3GG9A 3PRJA 3CBGA 5TPWA 3UGQA 2P8JA 1C4OA 1E1RA 3C8HA 4AWXA 4DMGA 2H1VA 2HY7A 5K2MA 2RGNA 1RLMA 4RHTA 3KV3O 1LC3A 4QLBA 4LYJA 2FQXA 1M54A 1KZ1A 1YJQA 4BEVA 3VR2D 1RCUA 3OLYA 2V65A 3OIGA 1FNDA 4WOPA 1RI3A 2LE0A 1N6OA 3I4CA 4FX5A 5FUVA 3SDBA 1GFZA 4DJJA 5JCJD 3BT7A 3I2FA 1ZH8A 1LI7A 2FPWA 4NYIR 3OZVA 4OGWA 3RQSA 4DWOA 1OYVA 5DRYA 1FTWA 1HKHA 4O4HA 2FR1A 4K9KA 4FMCF 1N0IA 8OHMA 4G86A 3Q88A 4R40A 5BYAA 2Z1DA 5LB4A 1X9IA 4LGCA 3TS1A 1GNQA 1OT3A 4OBEA 4UOQA 4Y67A 5HF9A 1A2QA 2GBLC 5IWAB 3BZWA 4LDPA 2WIAA 3H7AA 4ZARA 4K88A 2FZLA 5SYMA 2WSIA 4IZHA 1SC6A 4BQSA 2XZDA 1YB4A 1N5IA 1RWMA 3QVSA 4OL0A 1R10A 4ZVQA 1H23A 4OQFA 1NLMA 1YULA 1XJ0A 3GGGA 5KYNA 1I5OA 1KQGA 1KXZA 1I5RA 3STWA 3BDAA 3V9AA 5EL0A 1EXMA 2NU9B 1L5WA 2I3AA 3C3PA 5E7QA 3ZW9A 4CCYA 4N54A 3U80A 2CD7A 2WD7A 4YAUA 5INTA 1GYPA 2WT9A 3EPPA 3F9RA 2Q7OE 3HNRA 1K6IA 3RPEA 3Q15C 3P9KA 4A2CA 5ED0A 4Z4CA 3GLGB 2YKGA 2XA9A 5JVDA 3FPGA 5E7MA 3O4HA 3HZHA 1JDBC 3MQFA 4RXMA 3WSTA 4EX6A 3MUEA 2OENG 2CZQA 1N9ZA 1NC1A 2C4KA 4YUVA 4I8IA 5FPYA 2XSZA 2ZB4A 2W6CX 3FSRA 3RO7A 1FRNA 2MYNA 1GGVA 1D2EA 5BSUA 1NOJA 4I55F 4B4DA 3EZYA 3IBGA 3MT7A 1U8EA 4KQ2A 1TQ4A 2EBWA 2JHAA 4UXHA 4JI1B 3SEAA 1V95A 4Y9SA 2D0PB 4O4LA 1I32A 3QKIA 1AA9A 4XPIB 2VLBA 2X23A 3HVUA 2E4ZA 2OP1A 4H7HA 1JX6A 1JSCA 2O2GA 3LLSA 5CJJA 5ALNA 4Y6PA 4HXYA 3RS0A 5IKMA 1Y6FA 2HLDA 3YASA 4IH1A 3SQDA 3ZYCA 1D07A 2DLNA 5ALGA 4CTNA 5JS1A 4Q12A 2WP8J 3R5SA 4XIIA 1L4EA 1QVWA 3LF1A 4ZCRA 2PPVA 1P3Y1 3D6MA 5CP8A 1C9MA 3SXPA 1MAAA 1T24A 1T6ZA 1Z6AA 4QDKA 2J9RA 4KQGA 4RABA 2QVZX 2X19A 2X58A 4PZDA 4CNBA 5J4YA 3SC3A 2XGOA 5EJFA 4DLWA 4BN0A 4L8WB 2OBBA 1EPUA 1SNYA 2R7LA 4KWTA 5IUNC 1IHXA 3G2OA 4ZAYA 4ZZ2A 5CH5A 3RUAA 5IFKA 5ILOA 4J49A 1IHPA 5FFNA 1I2ZA 4UEQA 5CM8B 1BC5A 1E5DA 3JZMA 2ERCA 2CBGA 3QPDA 2R8RA 4ZYTA 4ZZ1A 4S1OA 1L4NA 1YS4A 2ZWMA 4A2QA 1QIFA 3AXTA 4ENPA 3LUAA 1ZX1A 4HB4A 2WSSD 4DR1B 2YV2A 2P35A 4TTPA 4X9XA 4Q16A 2HA7A 4GOXA 3I32A 3NHWA 3OLWA 4F9GA 3O8LA 2KE5A 4FC7A 1CK4A 1LH0A 4HWRA 3GJ7A 4ZU1X 1PU2A 5BWNA 3CRNA 1M3SA 4DYHA 5K4HA 1O6GA 3HV2A 4GYYA 3UF0A 1YOVB 3Q0IA 4UNSA 3VPDA 5BVGA 1QV6A 1SOUA 2ZTVA 2ZS8A 5KQPA 1Z5UA 1E61A 3WYFA 5FUMA 3VHXA 1YD7A 4C76A 5J2UF 2CSXA 4HRYA 4PFQA 2DKNA 4HDSB 4IDPA 4Y1FA 1DEKA 2V45A 3PCRB 3CGWA 4B43A 1CP2A 3E7PA 4J6EA 1N25A 3U3ZA 1EGAA 1GUBA 5LQCA 2A9FA 2AEJA 1XCBA 2IV2X 3CSUA 1YUBA 2O48X 4K28A 1O9GA 4J9UE 1OZGA 1Z2PX 3U7JA 4U8HA 3A04A 2K2QB 2VF2A 4JJIA 5AJWA 6ABPA 1UKEA 4IS3A 2Z8ZA 3KSZO 4FONA 1CRLA 4WGFA 3SIPA 4JYCA 4LGYA 2Q3FA 1NVMB 3NTOA 1IH8A 3GNTA 4BASA 1Y6GA 1H8ED 1ICIA 3U7IA 3BB3A 4X1YB 3W8EA 3L0YA 2DTEA 2Q41A 3ILVA 4M3NA 3WSWA 2ZIEA 3IDOA 3ZV6A 1F5SA 4MVJE 4L02A 3T7JA 3JQ9C 3PJGA 5KQLA 3H9CA 3FJYA 2HK8A 2AR9A 3CMCO 4XAQA 4WKGA 2QM3A 2ZCUA 1NW9B 1C8LA 4ER6A 3O82A 3AM1A 3OPMA 2O1WA 5A6SA 2ILTA 4FOSA 3STTA 3SR3A 1JSZA 4UEOA 1QF7A 4GKAA 2D1YA 1SHLA 4RENA 4YBRA 5TIIA 2JLXA 1SC9A 3W9BA 4OHUA 1J2YA 4HNSA 4L3WA 4B46A 1G8AA 3U60B 4MQ4A 3QOFA 1NMXA 3Q87B 3I76A 3SQNA 3H5VA 1I24A 1M67A 2SECE 1E1NA 4EHHA 3GJ6A 1USIA 2WC1A 3ZYZA 5G0UA 5ALIA 4DC0A 3I30X 1NW6A 2R68A 1E8MA 2HWWA 3L8CA 4MYHA 1VSVA 2WF8A 4X3OA 4BNXA 1LKZA 3AHIA 2OHIA 5HA5A 2QSYA 2LWIA 3GDOA 3VZBA 2GERA 3AI3A 5U4QA 1BEZA 2A88A 5REQA 3SE0A 2J6HA 4ETIA 3SZGA 4EB6B 1QRRA 3JRXA 4JLBA 8LDHA 2QPOA 4XFKA 4QNRA 1AK9A 1FP4A 2BGTA 4J0JA 2H9YA 2GBLA 2D7DA 5HEKA 1W9HA 3I45A 4RTMA 4NNPA 4I3HA 3V7NA 3D54D 3ZIUA 2HQSA 1HYHA 1X1CA 1C5KA 3L0ZA 3ZD8A 3BFKA 5JI3E 3Q5GA 4OI2A 3JAMA 3NEPX 3NLLA 1HKUA 5YASA 4EPWA 1NMZA 3T3GA 3REFA 2FW9A 3QLUA 4HDRB 2WG2A 5ALSA 5A7GA 5BQ5A 4M1KA 3DXXA 3CNBA 4AN4A 3AZOA 5D6NA 4PNEA 2EW1A 4XWWA 3MWDB 3GCWA 4BLTA 4J7XA 4GH5A 2QY9A 3EEIA 4HQFA 4I8DA 5BMVF 1P9NA 3VBEA 1YIAA 5KVQA 3PGJA 3R77A 1CBUA 1SXGA 4GX0A 3P5SA 1RXIA 1P17A 5FNVB 5KWVA 5L3VA 3D2AA 4DV0B 2W2MA 4CF6A 1IXRC 1RHQA 4FR2A 4N5NA 4GC5A 3COVA 4BNIA 4FSXA 5GV7A 1A97A 2H2AA 1ZGJA 3ZQ6A 1NVBA 1UQUA 4HGNA 1KZYC 1NDHA 2JIOA 2ZVQX 3QVTA 4WZBE 4D0NA 4ISCA 2C8LA 1Z26A 1ML3A 3UXMA 2Y0PA 3QUBA 5I4BA 1SA0B 1MKYA 1IN8A 1NMQA 3L6BA 3NXKA 4G1UC 1Y3IA 3JQ7B 4MDHA 4MEBA 3C48A 4WSOA 4ZI7B 4HS4A 1AUPA 3EEYA 4A91A 2C94A 4XSVA 2ZBRA 2P4HX 5C3MA 1EM8B 3C1UA 2VDPB 3FCSB 3CLTC 4BIMA 3CN7A 3TLJA 4O4JF 1Z5OA 2WWXA 3E9YA 2IJGX 4L16A 4KQIA 3WXBA 2KMLA 2WKPA 2M32A 3EIOA 1T2NA 2BFOA 4V0NA 5JU6A 2C2ZA 3MLAA 4MB0A 2HU2A 2RIRA 4PG5A 4U6NA 1U8FO 4UBLA 3WK6A 1P2VA 2JKZA 3FFWA 3OJOA 2DUNA 4IFIA 5G3YA 2V3CC 1WR8A 5KVCA 3RYCB 4RL6A 1XLTC 1H0KA 3BD6A 2OV6A 3A4MA 1K5HA 1SOMA 1R37A 1T0PA 2OCLA 5HJ7A 5FR2A 4PGFA 2ORED 5DCWA 2ZVPX 1RYDA 2F7SA 4WXHA 1CT9A 1C7IA 2WUVA 1TAQA 2ZIZA 2AOXA 2A2ZA 2QRGA 2CDBA 5L3RA 2P9FA 5LA6F 3WRYC 4AXXA 3FPCA 4DYVA 4DUGD 3W1EA 1T2AA 4H17A 1A9XA 1XZGA 2WF9A 4R83A 5BNWA 1U4SA 1J42A 2D0OB 4UUMA 5L40A 1CJCA 1GWNA 4L5YA 1LBQA 1UXKA 4P7FA 2PGAA 4RTPA 2ZUFA 1AKUA 5CPBA 4TXJA 3MJFA 5L95A 1EVZA 1NVEA 4EHDA 1II8A 4HVAA 4KJXA 1Q1NA 1XF1A 3QUQA 1KNQA 1PDVA 1RXEA 1ULHA 2H54A 2I8CA 4IGIA 2B94A 5KQSA 3CCCA 4NBLA 1J24A 3HPRA 1L4UA 1P91A 4G5XA 4FZJA 1OI7A 3KAPA 4MAMA 1MB9A 1WUJS 2F67A 3B3AA 3LRXA 1T9HA 2IZ1A 1ZCFA 1G19A 3JRNA 4XGNA 2WMYA 4WK2B 3W90A 4RDXA 1MU0A 5F9HA 3A6FA 5JSUA 2Y8EA 4S1VA 1BMFD 2CDNA 1KH2A 2PBLA 3MXTA 1F4VA 1DDOA 1S2DA 1V16B 2JLQA 1JR3D 3AHFA 3FCCA 4JBLA 1DBIA 3KB2A 2OMEA 2B4YA 5TVGA 3UAWA 3URMA 5EERA 3CH5A 2Y67A 1TUEA 2VZ8A 2PR2A 4H7KA 2FFJA 5LCXA 1IL0A 3HCDA 2H3EA 2YRXA 3A27A 3AUSA 3FNIA 1HFWA 1BO6A 4MS1A 2VTVA 5CLJA 4IMRA 3S2IA 1DQSA 4N7BA 1ZSNA 2H1RA 3V2IA 1ONBA 2CXPA 3WK4A 4O6VA 5BWLA 2P2SA 4OHXA 3Q5DA 2Z30A 1DAHA 1XCLA 3DXFA 1P2FA 3AIKA 3GA5A 4HZGA 2WU4A 3H2YA 1KBQA 2HCRA 3B78A 3UHPA 3SJUA 4ZHQB 5AJTA 2WIBA 4YK7A 3HYRA 1LGYA 2ZSDA 3KDAA 4EO4A 1T1IA 1G20B 1H9BA 3SX2A 3ZI7A 1ZJZA 1OGJA 4WZAA 2VATA 3OT4A 5LDGA 1DT5A 4DADA 1XALA 2PZJA 1HQDA 1MOQA 1X38A 2O3JA 3DBRA 4GDFA 3MINA 1AV6A 2IPAB 4TMTA 2JD0A 4I66A 4F5DA 1FDRA 1N6HA 2VHQA 2Y05A 1QONA 3C8DA 1XRPA 4L3OA 1TMOA 3OOYA 1J21A 1IEXA 2ECPA 2BV3A 3WLTA 2IW1A 2M9MA 4DY6A 3TZHA 2H2IA 4DHWA 4TWRA 5GINE 1NXXA 1SEPA 3GDGA 3T0GA 4MAAA 4MVWA 4JXXA 2LBPA 2QG4A 1PVOA 1R4NB 3C24A 1R0SA 1WZUA 4QGBA 2NTJA 3KOUA 4B80A 1Y3DE 1XE3A 3K3PA 1NI4A 3LVFO 4LSZA 4O2AB 4RL4A 2PMWB 4RH0A 4RFSA 4WCVA 1BDIA 3QQPA 4TYYA 1AHPA 1D0IA 3FAZA 3ZVKA 1I2DA 1SVNA 5F51A 1QH1A 3DVSX 4F91B 4X1OA 3BQNB 1QCZA 2QTRA 3Q7EA 1E6LA 3JX9A 1JEEA 4OMFG 5FA8A 3SQXA 4YCCA 4NOKA 3C87A 4ZTZB 4AYWA 2GZAA 1U3UA 3ILHA 1A5TA 2FRDC 3OETA 1Z6GA 3L9XA 2ZWAA 4FCTA 4G01B 4IOMA 1NYRA 4W9NC 1QGOA 2W6ID 3C6XA 5E1BA 5AVUA 4M6WB 1E9BA 4WESA 1P62B 1UIRA 2QX8A 5EKUA 3IP1A 3KJNA 3ZX4A 4CG3A 1YI0A 4XWYA 3RVQA 1NV8A 3EODA 4KE9A 3KKOA 1B3BA 3LLVA 3QEOA 2P41A 1KI7A 5M5BA 1PTKA 5JFGA 1JAIA 4IDHA 1KWKA 3ENWA 2GEUA 3IUYA 4BNDA 3DMDA 4DR2B 2XVZA 5I7OA 3HEBA 5J58A 3AW8A 2QL6A 3EBPA 5AVQA 3G2NA 4Q19A 5BNZA 3IAXA 4AG3A 2FQWA 3E23A 3H8WA 3DDUA 1GGHA 3JWPA 5AJUA 5A5DA 1VKRA 2IGBA 2AGVA 3KYBA 1N3LA 3R6WA 2NPFA 2PUGA 5HUHA 2CDCA 1Y4ZA 1TYDE 4DQXA 3UKDA 1SKBA 4R3WA 2NU6A 3OOSA 4JEMA 5TF0A 1JQDA 1WZEA 5BO5A 4DLYA 5FPTA 3VAYA 1F2DA 2BJHA 1ZMTA 1SM4A 3G0IA 4I14A 4QC2A 3UT5B 4DC1A 2P68A 4RXTA 1JIXA 2C5GA 2I4TA 3VZDA 3K70D 5KWSA 3DMTC 1BW9A 2C99A 5CLFA 2EYQA 3AUYA 5DHFA 4KIFA 3OZBA 1LJLA 2EGUA 4MHSA 5GVRA 1HDXA 1L8AA 3OCZA 3UFXB 5BVGB 3JWIA 4HX2A 4FIZA 3QY0A 4QXOA 3EEQA 3C2QA 3FI0A 3NKFA 3TZ6A 3B1KA 4UPEA 2JLVA 3UYKA 3LBFA 3RIGA 1JYSA 3AY0A 2YTZA 4AK9A 5JS8A 4RLHA 1XLTA 2Y76A 4JLUA 4U7WA 1O6BA 2BISA 1PGPA 2D2XA 1E3WB 1X13A 4Y2UA 3CNQS 1BGWA 1FFSA 2EWWA 1UKAA 3EEBA 1SVUA 3A6EA 4J1TC 4EJSA 2YS6A 2RHDA 3CGGA 3HBNA 4KI0A 3KVVA 4ZT5A 1DTSA 1R0RE 3AILA 3TWOA 3WRYA 3LZCA 3W8FA 1XEWY 3D1JA 3VZRA 5D3MB 4FYMA 3UUGA 5AVSA 4IWYA 4UOEA 1SUSA 4KSCA 1P9LA 1P45A 1D1QA 1W29A 4LZJA 3VH2A 4EW3A 1VIMA 4BQOA 4U4AA 3QIVA 4DWVA 4RVFA 2Q99A 4M0UA 1LSJA 1S7GA 1UBSB 2EGHA 2YMLA 3EXFB 1IM5A 1DFGA 1A5AB 3U0BA 2CGEA 4MQUA 1W0KD 4P2BA 2CYCA 2GZ3A 3KSMA 4WA7A 5BXYA 1VMEA 4YV2A 4IZIA 4N41A 1ONSA 3FZEA 3AHDA 1M1ZA 5BUQA 3R6TA 2ZBQA 2YHAA 4MMXB 5CFPA 1W73A 3W7VA 1E6UA 3OPYI 4X1IB 3NHUA 4H7FA 3ENNA 4JITA 1ZH4A 4L8VA 2E7ZA 4CQLA 4JLMA 2YHSA 3ADDA 2CZGA 2DY1A 2HEGA 3B9RA 3Q3JB 1OX4B 1RQXA 1WMSA 2AFIA 3MJEA 3N7AA 1I1QB 4N6OA 5AI8A 2CLLB 2VQDA 1L7MA 4DA8A 2CC2A 1IY0A 4TKMA 2WWYA 2LD4A 3W4IA 3V7WA 1JEYA 1IIRA 1E7MA 4JASB 4C78A 1HDGO 2G9ZA 2ZUCA 3ENQA 3IUPA 2DFNA 4BO1A 3E22A 1PBTA 1LX7A 5AK6A 3V3KA 1OKKD 4RK5A 5EXDA 8ADHA 4LSWA 2QUJA 3HYCA 2XDQB 3GEBA 1A9ZA 3FR8A 4EEXA 2H0AA 5FAXA 5SICE 1I1HA 2A14A 2HF8A 3CV3A 2R97A 5AW9A 3K31A 1V96A 4P4LA 5EE0A 2X9VA 1KPGA 2Q50A 3DEIA 4ROTA 1SG0A 2DPMA 2DWPA 3OCYA 4DLTA 5KNCD 1BDHA 5FF9A 4QM7A 1E2QA 4HRVA 3Q9UA 2FPPB 1E18A 2GASA 2INGX 2N75A 2OUIA 2W5UA 2Y1KA 3EQ6A 3F7NA 4KR9A 4RSGA 2LCIA 4I4TA 5CA1F 3E70C 1H2BA 3QEBZ 3KKNA 3NORA 2IYEA 1HA3A 4JJFA 3UH1A 2GXUA 3F6CA 2VO1A 4OTZA 1SURA 4QPNA 1OT5A 2LIVA 4R98A 5LKAA 1S96A 2EX0A 4Z4FA 3UAOA 1HT2E 1MXFA 3WOHA 1TU4A 4BVLA 1RRCA 1JL3A 2J46A 1X8XA 2FLVA 2C2OA 2JLSA 2PGXA 5EP1A 2H2WA 2XE6A 1FDTA 4YMSA 4CR7A 4OP3A 5DXAA 1T5TA 1XWWA 4ARUA 5HYVA 3B6EA 3N8DA 3AF2A 4IXMA 3GZJA 4MKRA 4RKRA 1ZGCA 4ENTA 2Y68A 2ZIXA 2AQHA 3ET4A 4HZIA 5ALYA 2FHPA 2WKQA 3H4VA 4OYYA 2RAPA 1VIYA 4WKOA 4Y9UA 3PUHA 3IR6A 2QRJA 4JK3A 2Z4TA 3RC3A 2CY0A 3VR6D 2VNSA 4K6GA 3PU6A 4JUFA 3QXJA 2EP8A 4FIDA 1JG3A 3NBAA 4FI3C 3H16A 4BWYA 1ZUHA 4UMVA 1NBAA 1JHAA 3GDHA 1ZC4A 1TC1A 1OBVA 1COWD 1MEJA 2QRPA 1R5JA 3G2QA 4ZTBA 1QPGA 4J7CA 2YX1A 3RNOA 3UANA 1O9BA 4ND5A 5CGZA 3TVYA 3N8NA 4FP9A 3VR1A 4B34A 1H66A 1TIPA 1ZLYA 2IODA 2RDMA 3GCGA 3LPMA 2FRDA 3PDUA