3A28A

Crystal structure of l-2,3-butanediol dehydrogenase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
257
structure length
257
Chain Sequence
SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-2.3-butanediol dehydrogenase
publication title Structural basis for chiral substrate recognition by two 2,3-butanediol dehydrogenases
pubmed doi rcsb
source organism Brevibacterium saccharolyticum
molecule tags Oxidoreductase
total genus 103
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2009-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a28A00
1XEAA 2GRAA 3O9ZA 4GBJA 5C7LO 3WLFA 3BAZA 3OETA 1IPEA 2DPHA 1P0CA 4DLBA 2JHGA 3H6KA 4KOAA 2PZKA 4XYLA 5KCZA 2QZZA 3KYDB 4IUYA 4PLFA 1YKFA 1Y5RA 2P5YA 1DO8A 3D4PA 4LMRA 3ITDA 1HKUA 5A02A 4R4JA 4IXWA 1SB8A 4YQZA 1NXQA 1SAYA 3GAFA 3PZRA 1B8UA 2V7PA 1MFZA 3LQFA 3KXDA 1H93A 3MJSA 3VVBA 2ZJ1A 1ENYA 1YL6A 3A28A 1P31A 1A7AA 1X7HA 2GD1O 1WPQA 1X1TA 2C2YA 4S1VA 5G0VA 1CIVA 3WGYA 3UOGA 4D79A 3PJFA 5GMOA 1U5AA 4CMIA 1XA0A 5T57A 4OKIA 1MG5A 3GZ4A 3LDHA 4X54A 4YDRA 4BNGA 3WTCA 3WFJA 1ULUA 4BS9A 3UCXA 2UUPA 1YL7A 2AEFA 2HMVA 2P68A 1DC4A 1VI2A 3UXYA 3L77A 1KS9A 2X9GA 1PQPA 1IOLA 1ZZEA 3BIOA 4XYGA 4CM8B 3F6YA 2FSSA 3DBVO 1P1RA 1UXGA 4XDZA 5JY1A 3HG7A 1LDYA 5CDSA 3S2GA 1TLTA 3WGQA 2BRUA 2OZPA 4YTEA 1GPJA 1YGYA 1YBMA 2C5AA 1EE2A 2GN9A 2JD1A 2Z1MA 3PGXA 1XIVA 3Q2KA 4YR9A 1EVJA 5KOIA 2O3SA 3NDRA 3RASA 1AN9A 5L53A 1Y9EA 3GMSA 4J0EA 1W6UA 4GH5A 3KTDA 2VT2A 3EAGA 5JPIA 3JD0A 1CF2O 2OP0A 1NPDA 3FHLA 1NFRA 1NQTA 4N7RA 3VZRA 1RKXA 3GNQA 3PZBA 2C07A 4QFCA 1HL3A 4BO5A 1E3SA 1Y1PA 2B5WA 3RCBA 1MG0A 4OH1A 4UEKA 2DTEA 2AE1A 3HQ4O 4IJWA 3H3JA 3DZJA 5H81A 3U4DA 3VDRA 3PGJA 2EKLA 3W8FA 1PZGA 1UXKA 1LA2A 2EKPA 1C1DA 1B8PA 2OUIA 3ONDA 4KUHA 4CM7A 3E6AA 4A2CA 3PYXA 4JP3A 5TRTA 1N9GB 3KSZO 3JQ9C 3IQDB 3ZWOA 1L7EA 2ZTVA 1KVSA 1UAGA 1XLTA 4QO7A 3T7EA 1Y9AA 1E7WA 2WD7B 5DDIP 4D42A 4YEDA 4GQAA 2Y68A 2ZKLA 3AUTA 3DR3A 5EJ2A 5F1KA 1Q1NA 1IUKA 3MOGA 1JKJA 4WGGA 4CM1A 1DDOA 4E2WA 1AXGA 1LRKA 4IQ8A 4MVJF 3D3EA 5G0SA 3TJRA 3ZWXA 5KTKA 5ER9A 2O3UA 4B7CA 5H83A 1HF3A 4YJDA 4P4LA 1PJCA 2G1UA 3PFWO 5T5QA 2EXXA 4GLOA 1CDOA 2AE2A 2Q4EA 1P1JA 2VRCA 3D3WA 1WVGA 2JJYA 1LXCA 2X5KO 4LN1A 5JLAA 5A3VA 5T64A 1O8CA 2ZK7A 1H2BA 3DEYX 3INRA 1X0VA 4UULA 4LVUA 1JVBA 2V6FA 2BGLA 3AM3A 4QX6A 1LU9A 1ULSA 3WGTA 2J3KA 1FDVA 1BMDA 1NYTA 3EGOA 1ML3A 2DBRA 4E21A 4EI2A 3UN1A 3HE3A 5ITVA 1PJQA 5EIOA 5CDTA 3OQ6A 2LDBA 3GDFA 2IRWA 1XCBA 1B3RA 3JQBC 1HWYA 3CUKA 1PGOA 4W99A 4BV8A 1O94A 3SEFA 2DLDA 3WYEA 1HE5A 2C0CA 8LDHA 3CEAA 4WNCA 5I7SA 3PQFA 3GPDG 2X5JO 4R3NA 4XRGA 2YV2A 4BO3A 5F21A 4EYEA 1BVUA 5IN4A 2BD0A 3RFVA 1NQOA 1HDGO 3F47A 4FSHA 4W7IA 4CLXA 3OJEA 3JSAA 4BNFA 3PJDA 5TS3A 4WLOA 5DCWA 1UAYA 2O48X 2VWGA 5L7WA 4CMJA 1HSZA 3TDKA 4B79A 1LEHA 1E7QA 4F6CA 4GWGA 4DMLA 3K73O 1PJTA 1EDZA 1P3DA 1WW8A 2WTBA 2I5PO 4RZIA 1LSSA 1UDAA 1WZEA 2QYTA 3K31A 3KSUA 1RPNA 4EJ0A 3NKLA 1DAOA 4AJIA 1Z7BA 5A3JA 5B12A 4R5MA 4KP7A 1SZJG 4CLRB 2A35A 2VZ8A 1G0NA 2I66A 1GEGA 4RPGA 3RC9A 1R66A 3DBLB 1T2AA 2DBVO 2VT3A 4DC0A 1P1IA 3L9WA 4RLHA 1MLDA 4IQ0A 1M75A 2OGUA 3AM4A 1CJCA 2OO5A 3K5PA 3ORFA 4UVHA 4OXKA 1VL6A 4PLYA 5BSEA 2YHIA 2NACA 3VZPA 4BNVA 1U9JA 3ETEA 5LC1A 3F4BA 4B4WA 2QRKA 5TX7A 2DM6A 3GMDA 4FFLA 3GPIA 2J5RA 1NBOA 2YUTA 3FR7A 1WDKA 1X13A 3E9NA 2HK7A 3NGLA 1Y8RA 2BKAA 2XXJA 2P9GA 1YOVA 2EIHA 2Q2QA 2XOXA 5EESA 1ZK4A 5L40A 5CAEA 4D7AA 1JAYA 4WE3A 3PHGA 1J6UA 1ZEMA 3EMKA 3GLQA 1KEVA 1N7HA 2VOJA 3NDJA 1NFFA 4WOKA 3QVTA 3UF0A 5I7VA 4QFDA 4L4SA 1ADFA 1NVGA 4R01A 5DBGA 1GL3A 4CQMA 3LT2A 2C20A 1E3WB 4N5MA 1QYDA 2JAPA 4DXHA 5KVVA 1SOVA 4W4TA 4UUNA 4U0JA 5TQVA 4A10A 2C7VA 2FMUA 4WLUA 1HE2A 2YV3A 2YYYA 4XD2A 4M8SA 4KZPA 1XYGA 5JCJA 2Q3EA 3WWYA 4UEJA 2B4TO 3W8DA 3DFZA 4RO0A 3ULKA 4CM6A 1XG5A 4P22A 3FWNA 3OQ1A 3CPSA 3RUHA 3AOEC 1IL0A 4CMEA 5B4TA 1BW9A 1DPGA 4G65A 1ISGA 3OIGA 2HCTA 2B83A 3I23A 1LX6A 4HX5A 1R4MB 1SEPA 3CKYA 3R6DA 3HZZA 1AGNA 2Y1EA 2HRBA 1ZK2A 1IULA 2UV8A 1FXSA 4Z0HO 1P0FA 2WJPA 3FNEA 4YCAA 4I9HA 3PDJA 3F3SA 3PYMA 3IS3A 5IDQA 2IZZA 4E5PA 3U3XA 2AQKA 2RBEA 3IAHA 3FI9A 1E3JA 3HB5X 4KUEA 4U6SA 3ZNPA 3MJVA 4J9VA 4DUPA 1ZK0A 1QSGA 4DQVA 3Q9UA 1A71A 3WWZA 3M2PA 5COAA 4BB6A 1KEWA 4KDFA 4MJLA 3TPCA 1EBFA 2QHXA 4YB8A 1KIFA 4DIFA 1GAEO 5HA5A 2Y0CA 3BHIA 1Q7BA 3O4RA 5C37A 3O26A 4J3FA 4BNMA 3T7CA 1LLDA 4IDCA 3P19A 3SBOA 3JYOA 1HEUA 5EQDA 5ILGA 1GDHA 3MTJA 3WR5A 4EDFA 3DHNA 4P38A 1X15A 2PR2A 2YW9A 1WZIA 3AFNA 4UUMA 3QIVA 3ZHXA 3D7LA 3DBHB 3KV3O 1UDBA 1BXKA 4W9NC 3RUFA 1YQXA 3PP8A 4BHTA 2I3AA 5DBFA 1JKIA 3ZU3A 2CSUA 3PEFA 4OO3A 3ZU2A 1AHIA 4AJKA 2HU2A 3C85A 1MFPA 3OICA 1NHGA 3EW7A 1YS4A 3D1LA 3RC7A 1EK5A 3DZBA 2BI7A 4BMSA 4FBGA 4TROA 3INGA 3KEOA 1C1XB 4DL9A 4FPXA 2HDHA 3M2TA 3DZKA 3PFFA 3ROPA 1JVSA 3PLRA 4D3FA 4BQRA 1RYDA 4DIBA 3OJOA 3HNPA 3ONEA 1EFLA 1VE9A 2R6JA 4BNXA 5IN5A 2ZB4A 1MV8A 3ZV5A 5MDHA 4PLVA 1HYGA 3GN2A 3P2OA 4XQCA 3NX4A 4JBGA 3U09A 4TZKA 4GMFA 4BGUA 1D4FA 3RI3A 1F8GA 4BL5A 5CEFA 2C29D 1I36A 3FBGA 1EVZA 3JD1A 3TOXA 3WGZA 3WMXA 2X23A 1VLLA 2Z5LA 1IE3A 4FN4A 4RVSA 3UGKA 1J4AA 1SMKA 2Q4BA 4D46A 4E2XA 5IXSA 3C7DB 4Z0PA 3FNGA 1GCUA 1NNUA 1Y8QA 4IJKA 1NHWA 2PD3A 1R4NA 4WCDA 3W4IA 1B2LA 4L75A 4RQUA 4LK3A 4D45A 5THQA 1KBZA 1PJ4A 2Y1CA 3JQ7A 4BMNA 1C0LA 3C1OA 5DOVA 1DJNA 2H5LA 4L4XA 5T8KA 1WDLA 7ADHA 4L0QA 3QW2A 1E5QA 4I08A 3D0OA 4Y6RA 4BNWA 3MJTA 3WQQA 1YH3A 5KKCA 1HXHA 4D3DA 3AJRA 1TT5A 3PDUA 4J7CA 3TL3A 3QWBA 4ZQGA 2WE8A 3EK2A 3NTRA 2BGMA 3ICPA 4CM9D 5JYEA 3KM0A 1PGJA 2GF2A 3HSKA 5L4SA 2VYND 5G2OA 2OXIA 4BQPA 4BGVA 3M1LA 2Q1SA 2O23A 5ENVA 4Y98A 4JLWA 1LBEA 2HJRA 1YXMA 4FB5A 3QWFA 3NJ4A 1NWHA 1QG6A 1E7SA 3NTOA 4ALMA 4BNUA 3L4BA 4DIOA 1I24A 4JROA 4A26A 3GEGA 5BNIA 3NT5A 5JY6A 3HUDA 5A4DA 1N92A 3EVTA 4HY3A 4MVJE 2C54A 4DLAA 1I10A 1A9ZA 1PIWA 2TMDA 3PQDA 1P44A 3ICCA 3BMNA 4R1NA 3RVDA 1ZK3A 2AEJA 3GRPA 4HV4A 3FSRA 3JQEA 5F1PA 2B5VA 4R9RA 1BRMA 2GSDA 4QTZA 2HQ1A 2HMUA 1EFKA 5I8ZA 3UHAA 3ZNOA 1FDWA 2FWMX 1B8VA 3JYNA 1T2CA 2OP1A 3JD2A 2VCYA 3LVFO 4IMPA 1DRWA 3RSHA 4KWIA 4B4UA 1NM5A 4I9UA 2HAEA 3H2SA 1WLYA 5G4LA 1XDWA 5ES3A 4NK5A 4AJOA 3CXRA 3G49A 3F5QA 3JQ8A 4NBUA 3VVCA 4I9NA 3GZNB 1LDEA 3ZH2A 4D0RA 1PZHA 1E92A 4GKVA 2IYOA 4XIYA 3SC4A 5IJZA 3CTMA 3WGGA 3H9GA 3BMCA 3FTPA 3GUYA 3Q0EA 1ZIDA 1IHYA 1B14A 3H8VA 4BGEA 2YV1A 1KYQA 4IGFA 2AEMA 1GR0A 3JQAD 4Y8VA 3C7CB 2PY6A 3RQSA 4E4YA 3ZV3A 2PKQP 2Q45A 1SCUA 4IDDA 5L7YA 5JW6A 5EMHA 1X0XA 2DUUA 1J0XO 4J0FA 4RF5A 1V9LA 2X0RA 4J49A 5KJEA 2OHXA 3GG2A 3MWEB 4RF2A 2CDBA 3E5MA 1ZW1A 2CMDA 5AXDA 3KB6A 4II2A 4YJGB 5JMWA 4IJVA 3I1JA 3ZZNA 5BSFA 4O6VA 4O5OA 5G4KB 1ONPA 1I33A 3BZUA 1E6EA 1HDCA 1CYDA 3OEYA 5COBA 1J49A 4J16A 3DQPA 4BO1A 2JCYA 3U62A 3L6EA 5L4NA 2IE0A 2E49A 5JAZA 1DB3A 1LC0A 4ALIA 1UZNA 2D4AA 4BKRA 3AI2A 4IS3A 5BQFA 4LGVA 4XGIA 1HYEA 1BG6A 3UVEA 4PG7A 3IMFA 1U28A 3INTA 4FCCA 3BMOB 1T4DA 1Z82A 2PGJA 3WOHA 1ISJA 5JAIA 4NIMA 4CM4B 1GYRA 4RV9A 3ANMA 1CEQA 1HE4A 2BFPA 3WNQA 3DOOA 2O50A 3AY6A 2NWQA 3JD4A 1E1LA 3ETGA 3PHIA 3OJLA 3W4JA 2PD4A 1I3NA 2WD8A 1QKIA 2IEDA 1VJ1A 1JW9B 3PJEA 4WUVA 5KJCA 2FR0A 1Q7CA 5IDYA 4IDBA 1UUFA 1VL8A 3RC2A 3OHSX 1FDUA 4Q39A 2Q1TA 4WLFA 4OL9A 1SOWA 2A4KA 1LRLA 3QWAA 4BV9A 4AJHA 3GDOA 3ROKA 4ZU3A 3GGGA 1HDZA 4YAEA 4ND5A 3IJPA 1E7RA 1QYWA 4WKGA 1BVRA 1KY4A 3QVOA 3FPCA 3ZW9A 1I2BA 5IF3A 2P5UA 1G6KA 1WDMA 4M49A 1BTOA 4ZQEA 4G5HA 4DPKA 5HM8A 5BSGA 2DKNA 1DEHA 4CQLB 4R41A 3AUUA 4KQWA 4BMVA 4YT8A 5IG2A 3ZWWA 5CP8A 1JTVA 2EHDA 3DOCA 7MDHA 2VHVA 1O9BA 1UH5A 4H7PA 2ZTMA 3GEDA 4FFPA 3FNHA 3S2IA 5T8KC 2W98A 1K6IA 3RUEA 2W2KA 2J3JA 1DIGA 1HDXA 2VUSA 2YDYA 3QVXA 3TL2A 1I30A 3ZCXA 2OOSA 5EN4A 3KYBA 1MP0A 3HN7A 1HLPA 3QE3A 2VYVD 1HZZA 3WMWA 5K9ZA 4RQTA 4QSMA 5KKAA 2GLXA 1ADGA 4XR4A 1BSVA 1TI7A 1PZFA 2ET6A 1F12A 4JJFA 1DC3A 4ND4A 2GUGA 4J4TA 1WAMA 2DBQA 3O8QA 4FGWA 1PTJA 3KLMX 3RAJA 3LYLA 3L4SO 3GGPA 4CLEA 3RUAA 1VKOA 4XKJA 3GT0A 3X2FA 4PZEA 3I83A 1ONNA 3VKUA 4CLOB 2Q50A 2ZB3A 3WS7A 2X0JA 5FF9A 1BDMA 1SB9A 1ZEJA 2DC1A 4WPGA 3GHHA 4HFJA 1H6CA 3GF4A 3WIEA 3F9IA 4FGSA 3H9QA 3RUCA 3GVIA 4KMSA 5ADHA 5TGDA 1R37A 2DBZA 1OBFO 3IKTA 2WYVA 3M6IA 3H9EO 1IZ0A 4G2NA 4IY1A 4NHEA 3BHJA 1ONOA 3A1NA 4PLWA 1PU2A 4HWKA 1LSJA 3C24A 4HNHA 5I9MA 3DMTA 2A92A 4NBWA 2BI8A 3QVWA 2X5OA 3IOYA 5TT0A 4QUKA 2Q2WA 3WFIA 2ZIZA 3KYCB 1M66A 1LSUA 4EJMA 3Q3CA 4L9RA 2Y93A 2FR8A 4UVIA 3V2GA 1TA4A 3RBVA 3MJEA 2X6TA 1NPYA 2DT5A 3L07A 2QIOA 3WBFA 3PQEA 3MOIA 3ZWPA 1QLHA 4FJ1A 3CMMA 4U6QA 3B70A 4R1SA 1HLDA 3BTSA 4NZ9A 1LTHR 5A9SA 2D59A 1R6DA 1RM5A 4HFNA 3TRIA 4B7UA 2OL4A 4CMIB 4ZHSA 1PJ2A 3ZU4A 1NAIA 4XCVA 3QVSA 1XSEA 1Y6JA 2E6UX 3E9MA 4IM7A 4ZGWA 5LDHA 4GWKA 5T6BA 4J7XA 2VHZA 1KVRA 3NT2A 5EQFA 2W4QA 4PLGA 4JJGA 5HWSA 1CETA 4ALKA 3CSDA 4PZDA 3W8EA 5U1PA 1LRJA 2VRBA 3COSA 4N5NA 1VL0A 1PL7A 5JYDA 4F46A 5K6AC 4MIOA 1YRLA 4I1IA 1YDWA 3I4CA 4XWYA 2GN4A 4K1LA 4DTIA 5HRUA 2YQ4A 1H9BA 4PRKA 4BKUA 4CV0A 2NVUA 5TT1A 1NFQA 1NR7A 2J8ZA 2X0NA 4FQ8A 1Q2XA 1KC1A 3ZWBA 2FPGA 2NLOA 5AYVA 2O2YA 4L76A 2ZTLA 4PN3A 4ZA2A 1D8AA 4CR7A 1E3EA 5CG2A 4UVEA 1ISFA 3FRJA 1N7GA 1T25A 1JU9A 2RH8A 4O59O 3M1AA 4N18A 4TQGA 3QSGA 2DFDA 3GVXA 2HRZA 3GN1A 4CLRA 2W8ZA 1UZMA 1VJTA 1ZMOA 1DHRA 1CERA 3KEQA 2NU7A 3DBLA 5IXYA 1FK8A 1I2CA 3RD5A 3L6OO 4O0LA 5KJFA 3D5QA 2IEBA 3IIEA 3Q6IA 1J5PA 5A06A 4EEXA 1MXHA 3FNFA 4R5HA 4M87A 2Q1UA 1T2FA 3BYZA 4M89A 3RUIA 3F5SA 5ICSA 1CWUA 4BNLA 4J91A 2PLAA 1GZ3A 4CMAA 2P91A 2Q1WA 2PKQO 1E6WA 5JDIC 2XXBA 2Z1NA 3G3EA 1K89A 2RIRA 4PG4A 3WBBA 4ALNA 4BB5A 2SCUA 4DPMA 4EUFA 1XQ1A 4RCVA 3B1KA 3U4CA 1LLCA 4E2ZA 3A4VA 3AU9A 2YJZA 3ON5A 4PLZA 4NPCA 1AUPA 2Y0DA 5KJ6A 3V5NA 4QO8A 4O1MA 4GMGA 2Y1DA 4U8GA 3H5AA 3U4IA 3V1UA 3SC6A 4NU6A 1JKFA 3V8BA 2CNBA 3D3WB 1A9YA 3STHA 4R68A 2JCVA 3MZ0A 3FBTA 1QYVA 1MUUA 2AW5A 4K6CA 2EWMA 1IPFA 3H4VA 1JAXA 4TRJA 2E48A 3TF5A 1E3LA 2D0IA 3VPHA 2BMAA 4CLDA 2I9PA 3ZHZA 3WTBA 2G82A 4LSWA 4TSKA 2AMFA 3E48A 5I7EA 2BFAA 2PZLA 3VPGA 1VSUA 4RGBA 1VC2A 5THKA 4EW6A 1VKNA 4XGNA 3C3XA 4RLSA 4PLCA 3W1VA 3KETA 1H0KA 1Z73A 4BO0A 4PLPA 4CMCA 3JQGA 4M54A 4ZRNA 1ZJYA 3MCVA 3D64A 3BXXA 3ZHBA 2PTGA 3Q11A 1YWGO 2RHRA 3G1TA 1EVIA 2WYUA 4G81A 4TKLA 2VUUA 4BNYA 4YAIA 1GQ2A 3WLEA 4E31A 1I32A 2I99A 1B0AA 3L0DA 4GSKA 3U0BA 4J6FA 2RAFA 3CZMA 3IJRA 3JQCA 4J1NA 1MC5A 4CL3A 3VH1A 1O0SA 1OOEA 4BNKA 4N5LA 1L7DA 5A5FA 3S2EA 1YL5A 3WSWA 2X9VA 3KO8A 2I65A 3PPIA 1HYHA 3VTZA 4NJMA 4J7UA 3WGOA 1O89A 1BHSA 1M76A 4YRBA 3NRCA 4Y9DA 4Q3BA 4JN6B 3F1LA 1B26A 2VUTA 3TZKA 2UYYA 1JN0A 3ASUA 3JYQA 2EEZA 1ISIA 4ALJA 3IP1A 1KC3A 1GTMA 3VPFA 1LDNA 2NU8A 1XKQA 2YDXA 4XQ9A 4J43A 4RJTA 3RKUA 5JFOA 4YT5A 1NP3A 5B1YA 3U49A 2FR1A 3WXBA 2CVQA 1TEHA 2E82A 4IDAA 1EBUA 1XU7A 4RPLA 4QQRA 5EINA 2VWPA 1DFGA 2AHRA 3ASVA 3NT4A 2ZYAA 2GERA 3MJ4A 4WCFA 1MGOA 3E5RA 4YACA 3ZWYA 3DHEA 4YYZA 5JSFA 3Q1LA 2I6TA 1HDOA 1SO8A 2G17A 2V6MA 3U5TA 5HS6A 5CEEA 3OIDA 4CLHA 2YHIB 5DP2A 1LDGA 1Z6ZA 3P2YA 3RU7A 2CDCA 4JX8A 1DAPA 2B36A 2O7SA 4EBFA 4EUEA 3F4LA 6ADHA 1KERA 4WASA 1LNQA 2F00A 4XQGA 1YQGA 4NJOA 4OM8A 5L95A 4YJHA 5G0TA 1XELA 2HO5A 1X1EA 3QLJA 4LRTB 2JAHA 2OMEA 1P9LA 2CF6A 4XB2A 4RVFA 3SVTA 2O3RA 1PL6A 1Y8RB 3G17A 4CM5A 4ROSA 1YOVB 4DC1A 3JQDA 1RJWA 1LJ8A 3B1JA 2NQ8A 4YWJA 5A04A 3DAFA 2R00A 4CM9A 1P1FA 4FDAA 3PLNA 5JMPA 4FJ2A 2VYNA 1YE3A 1HETA 2Y99A 4XYBA 9LDTA 4Z9YA 5IZCA 4Q3CA 3QP9A 3PHJA 3NUGA 3DDNA 1C14A 3DZHA 1VM6A 3OQBA 4RORA 1NTOA 2RHCA 5JDCA 4CQMB 1GYQA 1GUFA 1E1MA 4LMPA 3CIFA 4YAKA 3H9UA 5ICMA 1DXYA 1E1KA 4PVCA 1E0DA 3EY4A 3OJFA 5AVOA 5JO9A 3ZI0A 4K26A 3NEPX 4XJTA 1PX0A 5EL0A 1I8TA 3FR8A 3LT4A 3FD8A 3N58A 5IFLA 3K9QO 2Q46A 3VKVA 3LF2A 4MVJP 4UAGA 1DRUA 3WB9A 3UW3A 4Z6KA 4CV3A 4AJ1A 1PQWA 3RU9A 4CMBA 3WYBA 3HDYA 1JA9A 3HADA 5TLSA 1PGQA 1ENPA 3KRTA 1M6WA 1HRDA 1BW9B 1LDBA 1KY5A 3D4OA 3PHLA 1K6JA 2HUNA 4JJIA 4CODB 4XYEA 4EZBA 2HJSA 1E7YA 1H6AA 2QG4A 1YB5A 3N74A 4J2OA 2B35A 3GUCA 3HDJA 4YAJA 3SLKA 1WMBA 1KETA 4FFRA 1IZ9A 3ADPA 3A9WA 3DFUA 4PZCA 5DT9A 5FWNA 3I9JA 1RM0A 1M2WA 1F06A 3GG9A 3NAQA 1AHHA 4WECA 4ZN6A 3O03A 1PGPA 1I3LA 1ZCJA 3OMLA 4ZQBA 1MX3A 3FPLA 1U7TA 3I3OA 3RJ5A 4B7XA 3D4NA 1UJMA 2ZCVA 1B15A 1I3KA 2I67A 4NDNE 3VPSA 1UDCA 4OOFA 4XA8A 4OGWA 4GGOA 2E37A 3CINA 4Z0TA 2VZ0A 3VAZA 4UUOA 3PHHA 3FN4A 4E5MA 4HFMA 5H82A 1DC5A 3L9XA 4AJ2A 3R3SA 5CFZA 1V3UA 4NFYA 4IS2A 5B37A 3HDHA 3NV9A 4PRLA 3JQAA 3WQRA 2C82A 4DGSA 4AJPA 1A4IA 2NNLD 3TZQA 3WSVA 1LSOA 3BTUA 4U0KA 1P1HA 3C1AA 5ENDA 1FDTA 3OBBA 5DCYA 4RVDA 4R9SA 3E9QA 2GO1A 3GK3A 1B7GO 1K6XA 3UKOA 3WGHA 3DZGA 4Z3DA 4B3HA 3IP3A 3E8XA 5T67A 4BO6A 2FP4A 4JNKA 5GZ6A 4NR0A 1BXGA 2QQ5A 2HMSA 3JQFA 3OECA 4BIIA 2J3HA 4II3A 1NVMB 3G79A 4GX1A 2J3IA 3GQVA 1SC6A 1K2WA 3R1IA 1OFGA 3JQ6A 2Y66A 1PR9A 4MVJI 2IYPA 4NG5A 4ALLA 1BWSA 2FPPA 4IIUA 1PWZA 4AL4A 4HXYA 2D2IA 4DWVA 3C8MA 1U3UA 1U4SA 4A5OA 3JYPA 2B69A 1GZ6A 2Y1GA 4YPOA 2CVZA 2X8LA 1DBVO 4ZVVA 2Q99A 1H94A 2ZYDA 5FI5A 4FOOA 4MPDA 2QZ9A 3SJUA 3GZNA 3EZYA 1JDJA 1NR1A 5F1OA 1U5CA 1UP4A 4YT4A 2WE7A 3JTMA 1KVTA 3OEWA 4TVBA 4E0BA 2BF7A 3KLPX 4BO8A 1I5RA 1DLJA 2GZ2A 4M55A 1Q0LA 4PFJA 4XJSA 3DHYA 4BVAA 1NQ5A 3IDSA 4JXKA 1DLIA 5CPBA 3V2UA 3GR6A 1MA0A 2CDAA 3AY7A 1PR3A 2X22A 2GASA 1F17A 3BMQA 4NNJA 4CMEC 1PL8A 4MP8A 2J5QA 4WOJA 5CG1A 4DA9A 1DHTA 1Y8QB 2DFVA 5U4QA 2GYYA 2HLPA 4B3IA 2QYSA 1R4NB 1NQAO 1ARZA 1GPDG 1Z75A 4I5FA 5EERA 5B4VA 5AXCA 1KVQA 3K2BA 1PJBA 3JQ7B 4RZHA 4XEHA 2PA3A 1UXHA 4KDEA 4NU5A 4E3ZA 1PSDA 2PFGA 4XYMA 3UUWA 4MVJH 1QV6A 4ONEA 5COQA 4YA6A 2CY0A 2YZ7A 1DSSG 1GZ4A 2VNAA 4HUJA 4MO2A 2IODA 3WDSA 4NI5A 1TT5B 3AM5A 1PZEA 3MTGA 3JCZA 3KZVA 1YO6A 3WX0A 1LDMA 4HFRA 2FY8A 1DFIA 2VYVA 3PYLA 2QRJA 3RFTA 3TZ6A 1TVEA 4IPTA 2FSVA 4J1QA 2QW8A 3EVNA 1WMAA 2HMWA 4UVGA 3HHPA 1UP6A 2WSBA 3CH6A 4WEQA 3ZNQA 5GZ1A 1K0UA 3MWDB 1T1SA 3QWIA 5EPOA 5K0ZA 1KEPA 2FPIA 3RWBA 4MP3A 4B4OA 4DREA 4XGKA 4RF3A 3UICA 1ZJZA 4IMRA 3AI3A 4GI2A 4LCJA 4OOEA 5KVSA 3GEMA 2FRDA 2C59A 2YFQA 1U3TA 2OFPA 3EDMA 3PK0A 4BKOA 3K92A 3TZHA 3VZQA 5CPFA 4OMUA 1I0ZA 3JQ9A 1QV7A 1W8DA 2WWRA 2AG8A 5TJ9A 1JLLA 3JYLA 2J6IA 2FOIA 1YB4A 3E1KA 4MIYA 1S6YA 1A27A 3GVPA 3RBXA 3PWZA 2PWZA 3X2EA 1E3IA 2VHYA 3VTFA 4JBHA 3GRKA 5A1TA 1JWAB 3GGOA 1CQJA 4WEOA 4FS3A 5TJHA 2JD2A 3H2ZA 2EGGA 3DB2A 4LISA 2D3TA 1EVYA 4RVUA 5C3MA 2O7QA 2W2LD 3GDGA 3JQ8B 3KYDA 3RUDA 2DQ4A 3S2FA 3OM9A 4IDEA 3T4XA 2POQX 4INAA 2IDZA 4D44A 1EE9A 2ZQYA 1ZNQO 1B3BA 3BMCB 4IIVA 4RPKA 4YJFB 2H9IA 1A7KA 1T4BA 3VH2A 3ZHYA 1YJ8A 2B4QA 1QLJA 4AVYA 2H1SA 3GVHA 2EGHA 3ZGYA 4YRAA 4C4OA 1OC2A 4R51A 3TN7A 1SPXA 1I01A 1U3WA 1PJ3A 2DAPA 1T2EA 4WLVA 4TWRA 3ROQA 3TQHA 4PG8A 3NJ8A 1XU9A 3DBRB 3JQBA 4IDFA 2YHUA 4CJXA 1B16A 4YAGA 4P4GA 1P33A 1AE1A 5IDWA 1TT7A 2Y05A 1YJQA 3IL2A 1NWCA 2LDXA 1JWBB 2O4UX 2UAGA 1GU7A 5JE8A 1LQUA 4CM8A 4XRRA 3H5NA 2AQ8A 2EW2A 1TB4A 1XGKA 4PIVA 4MVJG 4OQYA 3IUSA 4S3MA 5I9NA 5L7TA 4E5YA 4AJNA 3V2HA 2V6BA 2P2SA 2WDZA 2Y0EA 3HN2A 3H65A 4TRMA 4YQYA 4ZICA 2OORA 1U8FO 2ZJ0A 2JL1A 2BGKA 2NTJA 1EEHA 4MVJD 4CM3A 2EV9A 1YDEA 4EEZA 8ADHA 4O63O 5GZ3A 3I5MA 3ZWCA 2BLLA 2RH4A 2IXBA 4TMFA 3KYCA 4IZHA 5C7OO 1HSOA 4RDIA 2P4QA 3OA0A 5A03A 1NX6A 5KIAA 3L4BC 4BUCA 3NGXA 3ZWVA 2JFFA 4ND3A 4GX5A 3TFOA 4HNGA 3FWZA 2CF5A 1I2ZA 4IINA 4E5KA 2PGDA 3ENNA 4WLNA 4K6FA 5JBIA 1GUZA 1XR3A 2DUWA 1N9GA 2GN8A 1O6ZA 4A73A 2BHLA 2NQTA 3PVZA 1JQBA 3PJGA 2AQHA 4A0SA 3AY3A 5L9AA 2ZATA 4ID9A 4YBZA 5DN9A 3OF2A 2WD7A 2PZJA 1DC6A 4JQCA 2QX7A 1P74A 4UREA 5MGBA 4R3WA 3P5SA 4MP6A 2GPTA 1FDSA 1GADO 3GH3A 3WIDA 4E12A 1ENZA 2XPCA 1X14A 4GLLA 3ZW8A 1N2SA 3B6ZA 1U4OA 4PG6A 3ST7A 2P9CA 3RFXA 3WNVA 1CQIA 3PI7A 4L8VA 3H9JA 4WJZA 1VSVA 5L3ZA 5I8WA 1V3VA 2W2KB 2PK3A 2R2GA 3K8ZA 5DP1A 1DIBA 3GFBA 3S8MA 3GFGA 3QHAA 1V6AA 4MDHA 1HDYA 1PEDA 4ZD6A 4NBRA 2QRLA 3DZIA 3PIIA 4PLTA 3AI1A 4QXMA 4D41A 2G5CA 4W6ZA 4J9UE 3U9LA 4B8ZA 4DLLA 3QRWA 4M1QA 1MXFA 5L51A 2NTVA 3GHYA 3O8QB 1ZXBA 3E82A 1PGNA 4J4HA 3ZWAA 2JHFA 3FF4A 4J1TA 1X7GA 3PXXA 2EERA 4OIMA 4AICA 1R15A 1K3TA 3WYCA 3SJ7A 3A06A 4IZIA 1Q7GA 3AOEA 1H2HA 4PVDA 1LC3A 2PD6A 3KVOA 5IAAA 4W82A 3SLGA 4A7PA 2ZB8A 2ZQZA 1C3VA 2H6EA 1UZLA 3ENKA 3RROA 2EP5A 4QECA 5BNTA 2DPGA 1ZVMA 4C7KA 4D43A 3LC2O 1U8XX 4OKNA 4OSPA 3BTOA 4BNJA 2OBYA 3EUWA 3H7AA 4XQEA 1GQQA 3RIHA 3DOJA 2PV7A 1R0LA 2ZTUA 3W4KA 4DPLA 1C0KA 2Q2VA 3AWDA 4AJJA 4CMHA 4JBIA 2EJWA 3MEQA 5BR7A 5TIIA 3UFXA 1ZSNA 5A5EA 3W6ZA 2WYWA 5C5IA 2UUOA 1N1GA 1GD1O 1YONA 1FF9A 4JGBA 1L1FA 4BGIA 4MKZA 2ZB7A 1W0CA 1YBAA 1D3AA 3E03A 1HT0A 1HZJA 1PJSA 4ZQHA 4LCEA 1UP7A 4XR9A 5DULA 3MJCA 4GVXA 5L4LA 3BHMA 3RJ9A 5KJ1A 1IYZA 3ZDFA 4D3SA 1PWXA 1VRWA 4MKXA 1GYPA 1LUAA 4OXNA 3PWSA 1EUCA 2D5CA 5I9LA 3GAZA 3OJ0A 1YBVA 5AOVA 2UVDA 1ORRA 2GNAA 4CUKA 1SBYA 4YT2A 1C1DB 3OFSA 4Z9XA 2GGSA 4ITUA 3DXFA 4W9NA 2CVOA 3ZV6A 5GY7A 5A9SB 1HE3A 3DO5A 3TNLA 3VC7A 3HFGA 1ZSYA 1ZXLA 1YQDA 4E5NA 1VPDA 1PJLA 4R1UA 3C7AA 3F1KA 4F3YA 3DTTA 3HFSA 2AQIA 3HWRA 3GNSA 1H5QA 4TVOA 3ROMA 5CHEA 4FOSA 4E6PA 4Y6SA 1G0OA 4AJ4A 4RF4A 2Y1FA 4RVGA 1GQYA 4J1SA 1DIAA 1SEVA 1F8FA 5A9TA 2NUAA 3I9KA 3A14A 1A4UA 2E4AA 4CR6A 4F6LA 2YY7A 4KQXA 4RDHA 4WLEA 4CV2A 1OAAA 4OXYA 4DBZA 2NU6A 4J90A 4NFHA 2NVUB 1FMCA 4FC6A 3WG9A 1E3WA 1QORA 3DMYA 3Q9NA 6LDHA 1F0YA 1R0KA 4P4NA 4XZ3A 4DQXA 3E18A 4BKQA 3KOUA 3QY9A 1SNYA 3VOSA 3DAGA 3ZWMA 4DYDA 2EF1A 3K2EA 5L45A 3WJ7A 2GZ1A 1KVUA 4OYRA 2D1YA 3EC7A 3RC1A 3F46A 4PLHA 2VHXA 2VTDA 1IY8A 3FCOA 3HJAA 4H15A 4FD3A 2NU9A 3LT1A 1PQUA 2BFMA 2CUKA 1BXZA 1R4MA 2YFHA 4GPD1 4XDYA 5JC1A 1QP8A 3NTQA 1V3TA 3ZNNA 1Y5MA 2CD9A 1QYXA 5CDGA 4MIEA 3SX2A 4KTTE 1DJQA 3P7MA 4FFNA 2EKQA 3TOZA 4XX0A 4ZQFA 1PS0A 2O4CA 4FW8A 3GA0A 5AXAA 4NMHA 5JAMA 1EUZA 2A9FA 4KWHA 1Z7EA 2V65A 2CFCA 3DMTC 3N7UA 1ZO8A 1YB1A 1ZMTA 2WMDA 1HTBA 2VRCD 2X58A 5HBRA 3GVCA 4JCOA 3S55A 1GV0A 3AUAA 3VDQA 2IZ1A 2PZMA 4ILKA 1QRRA 2AXQA 3JV7A 4W7HA 1DOHA 2DVMA 4PGFA 1S7CA 5ITWA 2VN8A 3LU1A 4C7JA 4ESOA 4MKRA 1N1EA 4NBVA 4HADA 3CE6A 3DBHA 3TFQA 1QYCA 4R69A 1VJ0A 1U7HA 3PRJA 3PTZA 4IXTA 1EUDA 1ZSVA 3GNTA 4L73A 4CR8A 2O3TA 5JNLA 4H16A 4AJLA 3LK7A 3DAPA 4Z3KA 1E6UA 5G0WA 4A27A 3IKVA 1P77A 5AXBA 1M67A 1V8BA 3TWOA 2IXAA 1O95A 4BNTA 5KWEA 3BA1A 3JQGB 3VZSA 5JO0A 1CRWG 2GCGA 2EJVA 2FN7A 3TSCA 3VH3A 1ZBQA 2DTDA 1W73A 1C1XA 3NYWA 2EP7A 5DF1A 1FJHA 2DTXA 3W6UA 1K5HA 2HKIA 4BNIA 5AQ1A 4BNZA 1ISHA 2O2SA 3OIFA 1H6DA 4Y67A 1H6BA 1DRVA 2PH5A 3AFMA 3V1TC 1GEEA 4U5QA 1EMDA 4UUPA 2VWHA 4NJMB 3KUXA 5CDUA 3JD3A 2HK9A 1WWKA 1O5IA 4P8RA 2XF8A 1D7OA 1UXIA 5CEJA 1ENOA 2G76A 1V0JA 1F14A 4BO7A 1WNTA 5IZ4A 2EW8A 3AU8A 3I6QA 2WEKA 2I3GA 3CMCO 4UVDA 4NH4A 3ONFA 2B37A 3WGIA 3I6IA 4NK4A 4FFMA 3ETDA 4GVLA 2WM3A 1LLQA 4WCFB 4YXFA 2PH3A 3I9OA 4B3JA 1T2DA 2VWQA 1T26A 4GKBA 3T4EA 4MINA 3ZV4A 9LDBA 1PS9A 3LLVA 2BELA 3GC6A 5DOZA 4DVJA 4YVFA 3B1FA 3I9LA 1C0IA 2NV6A 3OP4A 3UH1A 4YJHB 4BO2A 5JCXA 4ZJUA 3QV1A 2C5EA 1OZAA 4B8WA 1Q0QA 4ND2A 3I9NA 5DCUA 1QR6A 1EQ2A 4HBGA 3LT0A 1YVEI 1NASA 2NADA 3DTYA 2I76A 3NDIA 5U9CA 3EHEA 4LRSB 4ZRMA 1A72A 1T24A 1ADCA 1RWBA 4J4BA 2NVBA 1E77A 4CQMD 4E32A 3DONA 2X7HA 4L74A 4AG3A 2D5AA 4RVHA 4K28A 1ID1A 1BDBA 5F5NA 3ZWNA 1OI7A 4GX2A 2J5KA 4LW8A 2DU8A 1U3VA 5JCJD 1MC4A 1V35A 4Q9NA 4M86A 1DIHA 4FR5A 1RM4A 1T1RA 3U4HA 1Y81A 3FTNA 3LC7O 2H63A 4Q3DA 3VPXA 4E33A 4F45A 3OSUA 4ND1A 4I8XA 4BOYA 2D8AA 4EGFA 5F5LA 1D1SA 3ITKA 1Z74A 4I5GA 3AW9A 4JIGA 4PG5A 1XWFA 3QJ5A 4TZTA 1ZH8A 1TXGA 4AFNA 4CMKA 2UDPA 4BNNA 4RPJA 4XIJA 4R54A 3L6DA 2EG9A 2VTEA 3ABIA 4XB1A 5JC8A 4GX0A 2NTNA 5TNXA 1W4ZA 1Z45A 3LC1O 3C1TA 5ILOA 1LQTA 4U7WA 2W2LA 4JP2A 3AUSA 4CL8A 3I9MA 3DWFA 4WNIA 4IGEA 2AA3A 1E7MA 2HSDA 1M6HA 3ANLA 2VQ3A 1UXJA 2Y67A 3BTVA 1ZK1A 4R1TA 4CV1A 3CZRA 4IJUA 1ADBA 4OSOA 3KHUA 2VOEA 4FC7A 1ZUD1 1GCOA 5DBIA 5BT9A 5FFFA 3KSDO 4Q3EA 1P1KA 4OQZA 2V6GA 4YRDA 1Q0HA 3S1LA 4DYVA 1MB4A 3HB4X 3H3FA 2XAAA 1GV1A 2G0TA 5DNAA 3R0IA 3DL2A 2VZ9A 4I5EA 3WJAA 3JQAB 4IQGA 4IBOA 5A05A 4CPDA 3WQSB 1H9AA 4WCFC 1I3MA 1OC4A 4MOWA 3EZLA 4YJGA 3PWKA 4CUJA 5TF4A 2NM0A 5FI3A 5JXWA 3UCFA 4FFOA 3ZU5A 5G4KA 1BGVA 3I52A 4NBTA 3LF1A 4B4VA 1U2GA 1RM3A 2O3QA 1BXGB 1ZFNA 2NSDA 4TRNA 3DZFA 1EQUA 4LVCA 4Y6PA 1GFSA 1Y7TA 1WP4A 1EZ4A 1RYEA 2X0IA 3ZN2A 2C2XA 1IB6A 4FIZA 4AJEA 3GY0A 4LSMA 2ILTA 3WICA 1G1AA 2Z95A 1P45A 2VNSA 3SXPA 3BMOA 4FJ0A 4IDGA 4GGPA 5KNLA 2JFHA 4DQUA 4DRYA 2R00C 4CM4A 4K9DA 4MVJA 5BSHA 1DFHA 2BFOA 4CMGA 2FZWA 1U1IA 5LDGA 4OJNA 4EJ6A 3B20A 3O38A 5IZCC 5FEUA 2YQ5A 5TC4A 3G1UA 5CDYA 4I5DA 5BNFA 5JDCC 4QT0A 3TZCA 5HS4A 1GY8A 1HDRA 3H5RA 2FHSA 4YJFA 4CUZA 5JAQA 5LCXA 4PCVA 5JS6A 1LI4A 1LLUA 4H3VA 2IZ0A 5J23A 1KOLA 3AOGA 4HP8A 3BMNB 2CZCA 1QXSA 4A03A 5B4UA 3PIDA 4GL4A 3UCEA 1NVTA 2X86A 3UAGA 4NQZA 1X7DA 3LLSA 3D5TA 1R12A 3IC5A 2GZ3A 4WK6A 1EDOA 2P4HX 4Z9FA 2Q49A 3DBRA 3KBOA 1QMGA 3BMQB 2GDZA 2ZYGA 2ZCUA 3EYWA 1D1TA 4CQLA 4DMMA 4RL6A 4DBVO 5HTOA 3DC2A 2X1HA 1A5ZA 2F1KA 4BNHA 4BO9A 3ADOA 3ANNA 2RCYA 4Q3NA 5ER6A 4KTVE 4E30A 2BH9A 2JD0A 2NVWA 3RKRA 2JFGA 4E13A 3HDQA 4R16A 1R16A 3VHRA 1EK6A 5K6AA 1C0PA 2P9EA 3QWHA 3K96A 1OMOA 2GN6A 1N5DA 1AXEA 5DZSA 2TMGA 3V1YA 4TKMA 1DIRA 3K30A 5F3RA 3IUPA 2GR9A 5I7FA 4BO4A 1N8KA 1PS8A 2HMTA 5IDXA 2O3JA 2X4GA 5A9RA 3LZ6A 4BKPA 5KVQA 3I4FA 4TRRA 3R3JA 1XHLA 3OH8A 4JK3A 1E1NA 1U2DA 2X9NA 4E2YA 2PGLA 4EUHA 5TSDA 3OA2A 1NAHA 4HKTA 1WXDA 1ZKMA 4L4RA 2JCXA 4CLOA 4D0SA 4OAQA 4EITA 2PKRA 4Q3AA 2FZEA 4RPHA 4QEDA 1KEUA 4GSLA 1ISMA 2B0JA 2Y1OA 5G0UA 3QA9A 3LSYA 4J2HA 4NFSA 3Q2IA 3JQFC 4KUGA 2W90A 1NPTO 5FYDA 3VH4A 1E5LA 1XQ6A 3G0OA 5C7IO 1R0SA 4N54A 2HK8A 3RBZA 2AG5A 2B4RO 2C7GA 3AK4A 3K6JA 4URFA 5JDIA 5KVCA 3GOHA 1UR5A 2OBNA 4OHUA 3QQPA 2PNFA 4GAEA 1IHXA 4MVJM 2JKVA 2A94A 2VHWA 1GUYA 4UEOA
chains in the Genus database with same CATH superfamily
1KOGA 4C6TB 2HL6A 3KOMA 5C7LO 3BAZA 5D01A 2VXCA 3DDSA 3ZCPA 1AJEA 1B0ZA 4TMKA 1ZUWA 4LF6B 3MBIA 1RMTA 4UBNA 2JHGA 3H6KA 2HGSA 2O2XA 4KOAA 4HB2A 4WNYA 3C8ZA 2CLLB 3KYDB 3UO8B 5KCZA 4PLFA 1YKFA 3K5HA 2WQ7A 4K8RB 4A0FA 1DO8A 2HA3A 3JRNA 5KNBA 4MVWA 2QI9F 2XB6A 2PWPA 2XTNA 1EGHA 1OLSA 5T3YA 1HI9A 3NM4A 1DWOA 3GAFA 4XWGA 5IK2A 4RGYA 4CQJA 2V7PA 2ZRKA 1MFZA 3LC0A 2J7PA 3LQFA 3OTGA 3B13B 3HB0A 1RRVA 1NBMA 3HBLA 1WCYA 3EEIA 3MJSA 2H2WA 1C8VB 1YL6A 2ZJ1A 4TTSA 3B6EA 1ZISA 1N6IA 5FOUA 4GSYA 2FLWA 2WF6A 2GD1O 1TRKA 1EA5A 4JLAA 5E6UB 1WPQA 3EMBA 4B5LA 2CLIB 5G0VA 4P5PA 3HJNA 3IODA 3AFOA 2IDJA 5E0OA 1L0BA 4D79A 5E9AA 5HOEA 4CMIA 3N8IA 3IVMA 1MG5A 5DIZA 1VG8A 4LUCA 4E5SA 3GZ4A 3WTCA 2WJVA 4DR1B 3O9MA 2UUPA 1YL7A 3HFJA 2PKCA 2P68A 2HDWA 4NONA 1AA6A 3ESZA 1VI2A 3NETA 3RVMA 3OG9A 3JW8A 1U8ZA 1ZZEA 1NNI1 1NY5A 4NF2A 3W2HA 3UMMA 1OTYA 4CM8B 5AI5A 3L7KA 1GRVA 2I4OA 4E08A 1YZYA 2FSSA 4UD2A 3WIUA 1U2ZA 2QM0A 3AB8A 5JOQA 3GB9A 3V4ZA 4ARAA 4B74A 3E70C 4WRRA 5CDSA 3BZBA 3S2GA 4D97A 2GCNA 2HJVA 3KKQA 1GPJA 1YGYA 4NCIA 3Q2KA 1W87A 3ZGNA 2ZI7A 1EVJA 4JQSA 3UATA 3FMGA 4Q1CA 3QPAA 1AN9A 3KU1A 4DJFC 1SELA 3LA8A 4LPSA 3K8QA 1CJTC 2CMFA 5BYKA 1W0KD 3JD0A 3EIFA 2OP0A 4C88A 3DXXA 3MRVA 3FHLA 4UNRA 4N7RA 1SC4A 3H19A 2Q62A 4MV3A 3PZBA 2FSVC 4XM1A 1JDPA 1ZD9A 4JB3A 4BO5A 2CEKA 5FFNA 3RCBA 1MG0A 4UEKA 2WG2A 3GJXC 1F2UA 3M83A 3U4GA 3FTFA 5JISA 2G88A 2RG1A 2ZXUA 1EJ6A 2RGYA 1UBKS 1ZA1A 4OP1A 4QUGA 4AUMA 1ILEA 4NCAA 2P6PA 1ODLA 3TRKA 2XB9A 2OK8A 4JP5A 5EMMA 2I4NA 5TMDA 1RYZA 4K81B 1Y3IA 4WKNA 2DJ5A 3JX9A 1UXKA 3CRW1 3MILA 1D2CA 3A1DA 4KV7A 4NZZA 1B8PA 3QPVA 2OUIA 4LJ6A 4KUHA 3HV2A 2VO1A 4F2HA 1IZ7A 1U0OC 3T1OA 2A1TS 3NHAA 3E6AA 1EFPA 4L28A 3VO1A 3NVMB 2ZDGA 4XUDA 4AURA 5FPSA 3UB4A 1OIVA 2NTYC 2PLFA 2ZTVA 2HNBA 3CJRA 5C8YA 3X3HA 1JPVA 1PT8A 3L8YA 4UHCA 4L7QA 1EHCA 3EGVA 4OFXA 3TLEA 4R6XA 3T7EA 4YLGA 4LSGA 4OUDB 1ODSA 3NHRA 1WU7A 2J9FB 3PQCA 5BUQA 4XARA 3PX2A 1TEVA 1Q19A 3EVAA 5LDDC 1C7EA 2Y68A 2ZKLA 4DFDA 1Q1NA 4A2WA 3VR1A 3GT3A 2O8CB 1DDOA 4E2WA 1AXGA 4MVJF 5JANA 1F9AA 1CNEA 1CULC 1WO8A 2H7XA 2P35A 3BL6A 5FWAA 3KQLA 3JYHA 3N2ZB 4DR2B 3ZWXA 1JBQA 4MVXA 4L22A 2TECE 5JZVA 3I5AA 2P67A 3WMEA 2P8JA 4C7VA 2W6JA 4YJDA 2VQFB 2R79A 4Y2YA 2G1UA 2Z3WA 4L07A 4B3RB 5T5QA 1H2WA 2WYIA 2EXXA 5EJAA 4IH4A 3EZFA 5TB5A 3PFNA 1GPAA 4FEGA 1U31A 1WVGA 4CT5A 4GI1A 3SG0A 5K05A 4KFRA 4N3NA 4M8IA 3T7TA 4BXOA 5A3VA 4X8HA 3OPYI 4Z2YA 3AESB 3GIWA 4LVUA 1JVBA 5CCDA 5B3JC 2QJWA 1QO0A 3X1DA 2XUOA 2FW6A 1BMDA 1Z2OX 1ML3A 3P0RA 3PC8A 1XVUA 2NO6A 1CP2A 1TRHA 4CEJA 4GLBA 5EIOA 3TUJC 4NESA 1FNMA 3GDFA 2G9UA 1NVVQ 4GQBA 4JDUA 4LCBA 4S35A 5BQOA 4BLQA 2FKAA 2ZBFA 3KX2A 3T3HA 5C35A 1LI7A 2RK4A 1J70A 3AF1A 3JQBC 5KHOC 2RHBA 2QMYA 4JYMA 1PGOA 5HF6A 3FYSA 5K7SA 3BFPA 3C6MA 4MDYA 2XSZA 2CD7A 4HUTA 3NTLA 2X77A 4ZAFA 1L7QA 4WNCA 3TE6A 5HRAA 3PRHA 2BUBA 3B5IA 3ZQKA 3RWOA 2X5JO 4XRGA 2EBHX 1KJZA 1A7UA 1E0AA 5T4HA 1Y3CE 2WWYA 1XLVA 1MH9A 3IEXA 3DDUA 4LY0A 3QQ5A 4NKRA 3N86A 1Y6RA 1SWVA 3F47A 4W8HA 3RFVA 2TYSB 2GVZC 3JSAA 3UFXB 4DA6A 1G21A 1T4GA 2FZLA 1P4SA 1QK3A 3L6RA 2BR4A 4I6GA 4HPWA 4MGEA 4RK6A 5FNVA 5K3FA 5AK0A 1HFKA 2LXNA 4RC9A 4MB0A 3HKCB 4UFNA 1UZUA 3DE6X 2WPDD 4I3FA 3KSBC 3B7GA 1CIPA 1T5BA 3HDVA 4GWGA 3LX4A 1EDZA 3PPVA 4RMIA 1XVIA 4RZIA 3K0EA 1ECBA 4GGMX 2HBYA 3UBMA 2NV2B 1Z4KA 1MZPA 1FX0B 1DAOA 1Z7BA 1Q44A 4Y1GA 5CTAA 4QIHA 1J2UA 2CJYA 4XLLA 3FNIA 2O1XA 4WXRA 4DR6B 1TM3E 4MW4A 2QX4A 1NMXA 1RWOA 1RW4A 2I66A 4EY6A 2BUCA 1W94A 2WKWA 4MUBA 4DC0A 1YQWA 3JY6A 1PVDA 3Q5DA 1AZWA 3WRYA 5EUMA 3HK2A 1WKVA 1ABEA 3NBZC 4LTDA 4UCXA 4Y2XA 5HNKA 5CB6A 2OO5A 4EJSC 2YWGA 4OXKA 4WVFA 3L8FA 2YHIA 4JQZA 3MRXA 4QYIB 2NACA 1GWNA 1KMHB 4GC5A 5T4EA 1O57A 2JKYA 3QEAZ 1U9JA 1CY2A 2F3TA 5AQEA 1SIBE 4UHFA 5LC1A 1RRMA 3AJDA 3F4BA 2QRKA 3IDAA 4HNVA 1THMA 5IHXA 2NO5A 3K5IA 2PAAA 2VLIA 2YBDA 2B1RA 3QNUA 3HGMA 3FR7A 3QKTA 1CRPA 1G4UR 2GJAA 1GQOA 3AKCA 4W8GA 1FJ2A 1LS1A 3KHKA 4X8OA 2P9GA 1WMSA 1E2NA 1YOVA 2D54A 3EDRA 5JNWA 3VJLA 2YUIA 4ZT5A 4UBKA 3CNNA 5EESA 4RADA 1G42A 1NKTA 2AX4A 5L40A 2IY8A 1VOTA 2RB5A 1JAYA 1IPHA 1RKUA 3C6ZA 3P96A 1J6UA 3EMKA 3PHGA 3GLQA 2NUAB 3W3ZB 1RWVA 2HN9A 2VOJA 3GZTB 5KSPA 2X13A 2PGXA 5H59A 4ZXPA 1CB0A 2PZAA 4EHHA 2Q1YA 1CUGA 1UWKA 3B89A 1ADFA 2QU7A 4IFTA 4BJHB 1GL3A 2C1EA 3EGDA 3LT2A 4YHBA 3BL8A 1NNLA 2QDKA 2J5XA 3UTDA 3QE9Y 1SBQA 1XZCA 1ZZGA 2JAPA 3ONWA 1KIAA 2R1VB 3QMMA 2IL1A 3A11A 4ZKDA 4EHKA 3I61A 2I6UA 1JRLA 3HHEA 4UASA 3IHLA 2ASVA 4A10A 2FMUA 5FQNA 4WLUA 2XZOA 4XD2A 1H2RS 4G5SA 2V7VA 2VK8A 4UEJA 1ZP6A 3DFZA 1KAEA 1L8XA 4YGXB 4WBNB 2ERYA 3FWNA 4KZKA 4ZT3A 1YR2A 3CPSA 4ZYUA 1IL0A 5HILA 3EFOB 4ZZIA 1CHDA 5B4TA 1BW9A 2ZE5A 1KH2A 1C29B 2AOTA 2VK2A 3KQWA 3OLXA 5HZGA 3TQQA 3NLLA 3VDMA 5JG7A 2I2DA 3OIGA 1YVPA 2C3PA 2VHEA 1S8NA 2DR3A 3NNDA 4XJXA 1LX6A 5EYPA 4HX5A 3CKYA 3K9BA 4RFVA 2UKDA 3N2EA 4TGLA 1IULA 3SQLA 1FXSA 2ZIXB 4IXNA 2WJPA 2QAGA 1CHNA 4YCAA 3IBCA 4RSGA 3HCPA 3D0KA 3PGLA 4MUHA 5C0OE 5J58A 3CR8A 5ABPA 3T7RA 1GGMA 3HCNA 4LMBA 1RWKA 2RBEA 4F4CA 3IAHA 3RFFA 1CVIA 5GIOE 3TTXA 2RK3A 4CN9A 1QE5A 3PD1A 2GUWA 4PPGA 4L3VA 3KJXA 5KAPA 2PT6A 3ZNPA 4BE7B 1ZK0A 1VBFA 2Z58A 9MHTA 3M2PA 5COAA 1MVNA 1KEWA 1WXQA 1NLZA 3ESQA 3M3PA 1YMQA 1X9IA 2OFXA 1EBFA 5IJWA 5FL3A 3VNSA 4G67A 2PLWA 4DIFA 3VPCA 4J0KA 1JJAA 2OD2A 4MPTA 3BHIA 1Q7BA 3O4RA 3VA7A 1KSHA 2QJOA 2ZSAA 4NVRA 4RX1A 3SBEA 3TJZA 2Z30A 2ZTHA 3T7CA 4DB2A 1A4XA 3LWBA 2G9VA 4RUKA 3T7AA 4P86A 3E8MA 1NLFA 2M6RA 4Y2SA 1GDHA 3MTJA 1QHHA 2OAQ1 3RYFA 4EDFA 1Z07A 1RADA 2PR2A 5EVJA 4II7A 1WZIA 4PHTA 4C7MA 5EHQA 3U1BA 1OXSC 2GILA 3D7LA 3LW7A 2B1IA 1UDBA 1QJ4A 1XVLA 4W9NC 1G60A 1YQXA 3PP8A 4EENA 4N0PA 2XQGA 1EUDB 1FPQA 1GCGA 3FPJA 3QIAA 4HQOA 4XWTA 5SYNA 4C0SA 2E0IA 1KARA 3MAAC 2EFDB 3B48A 4TTIA 1JXMA 3PHBE 1V48A 3RARA 3T12A 4OI4A 2CL7X 2HU2A 3OX3A 3C85A 1NATA 1R5BA 1F4PA 3EWAA 2REBA 1UIRA 1GZ5A 2FN8A 2ZBQA 1I51A 3CF6R 4UM9D 4HZUB 5AJUA 1QG0A 2QTAA 4FHGA 2WT4A 2R48A 5AUNB 2WM9B 2XMSA 4JT2A 1C1XB 1VIMA 2ZIFA 1AUQA 4D9FA 2VSYA 3LK6A 3M2TA 4RTSA 3NOXA 4I1OA 1TX4B 1G9XA 1P1CA 2PGIA 1Y5NA 2HWWA 3EGIA 3IP9A 3VMMA 5CW1A 3C3YA 4KFCA 4BQRA 5IMBA 2SICE 3TTTA 5IBPA 4F5YA 3IX7A 1BJTA 4B09A 3WV4A 1SOMA 4UTPA 1EFLA 1VE9A 4G09A 2V8BA 4HWSA 5J4KA 1B6SA 4Q7LA 4RTNA 3ZV5A 5KYWB 3K9NA 4FSDA 2R85A 1FFDA 1OBOA 1YFZA 3LUFA 4WL0A 4D8XA 2C3OA 4S1OA 1D4FA 1PF7E 2HTFA 2AUTA 2P6MA 2CXUA 3RHZA 4HGPA 1G17A 1E9SA 2FWRA 3MXOA 1C4KA 13PKA 3CX7A 5AJTA 1ODIA 4US1R 4LZOA 5CEFA 1KWKA 1NJGA 4LF5B 1W1IA 4OQEA 5DKFA 4FDMA 1JAHA 3JD1A 1EVZA 4UTOA 1OASA 2AR7A 3GEBA 4D0LB 5C9ZA 2C4TA 2PJDA 2HLDA 2Z5LA 1Z16A 2FOLA 4RVSA 5ERYA 3UGKA 1U0RA 3AF6A 1SMKA 3RREA 2OV1A 4LYYA 1S2LA 1E3TA 2QTVA 1YIOA 2C8JA 3FNGA 4LJRA 1GZDA 3MWKA 5AM0A 1NHWA 2FUKA 1R4NA 4FOTA 4QEZA 1B2LA 3W4IA 4RQUA 4D45A 5THQA 2Y1CA 4KXMA 1INLA 3JQ7A 3JZAA 1C0LA 4H1TA 1NKSA 1Q3HA 2HSWA 2QN7A 3LLMA 2BSXA 1FFHA 4BEWA 2YV4A 4RTPA 4Q3OA 3AZOA 1RP7A 5FP0A 5IX8A 1RJ9B 1EFVB 1V9CA 3M6FA 4BFVA 2IX9A 3D0OA 2ZM5A 1I1QB 2EZ9A 2R8YA 1FXWF 4HQNA 2ZIVB 3R7LA 1TZKA 2YCBA 2A67A 1HXHA 4M1MA 1QVZA 4D3DA 4YV7A 5JROA 5K3DA 2GLUA 3L4EA 3QTLA 4J7CA 1X6VA 2WSSD 3ANXA 3MCUA 4XD7A 2XDQB 4CM9D 2HA2A 1NI4A 2I6FA 3KM0A 5LQRA 2GF2A 4Q1DA 5L4SA 3U7FB 1JT2A 1TJNA 5EJIA 2VYND 3FIJA 4JLJA 3O3CA 5G2OA 4BQPA 4W5TA 3PVSA 1YR3A 2Q1SA 3BJZA 1J1UA 1I3CA 1V43A 1I80A 4P3KA 4Y98A 1ANKA 2XW6A 1F6BA 2XIJA 4JLWA 4O2BA 3U1TA 3TGPA 5KO2A 1U0LA 5SY6A 1UXOA 4BNUA 2IYVA 2XV1A 3Q6MA 3ZY2A 2R7NA 5ICCA 4MJ7A 1W19A 4JROA 5HDQA 3GEGA 1ZVQA 2IUUA 2W2VA 4ILEA 4Q7JB 5F2KA 1EIZA 2IYNA 3FJ1A 4BWYA 1TVMA 2HCRA 3OZXA 2C54A 3OPMA 1TF5A 4DV4B 3ER8A 2CUZA 1ZITA 2TMDA 3WZMA 4WUTA 4KAAA 3VM6A 4C6RA 1LFDB 5KQPA 1ZK3A 2Q5LA 1SVIA 1ECPA 2ZTSA 3GRPA 2YCLA 3KZ1E 2B5VA 1O4WA 3F6BX 3F5FA 3OU2A 4FYXA 1N5OX 1BRMA 4UTZA 2HQ1A 3SIPA 5HZHA 2GEDA 3C1UA 1K8RA 2ZJ7A 4EHJA 1FDWA 3FFAA 5IHPA 3R7FA 1UINA 3F7TA 2AJDA 3Q6NA 1CY6A 3OCJA 1GG2A 2FRVA 4RH0A 6CHYA 3LVFO 2FQ1A 3ESCA 4PM4A 4GDFA 1VPVA 4E1BA 4B4UA 3DE3X 3ZLVA 2HAEA 3EQ2A 1NBWB 1IY1A 2YH2A 4AJOA 4NK5A 3RS0A 4DXAA 1L5KA 1U0BB 3JQ8A 3PEEA 1JDNA 4FDVA 4AULA 2DSTA 4MS1B 4A23A 3U7IA 1MCZA 3GZNB 3ZH2A 2CLSA 3KKLA 1E6KA 4ZXFA 3SC4A 3TMAA 5K0LA 3HEMA 3K15A 2HZBA 3PCXA 1CR4A 1BOOA 3GUYA 3N07A 5F5XA 1F3OA 1U9CA 3BUSA 1IHYA 1DAIA 1SG9A 3T3GA 5K3CA 4BGEA 4C3ZA 4D6XA 4IGFA 1BQ4A 1DO0A 2AEMA 1NVXQ 4XPIA 3TG8A 3L0YA 3IURA 1B23P 4K40A 5BVGB 4E03A 4LJAA 3JQAD 3C7CB 3PNPA 2VP4A 3D6NB 5ARBA 3SDSA 1EM8A 3KQPA 1AO0A 4YDQA 1E3MA 1YCFA 1RZUA 3OESA 2XYVA 5KJEA 4RF5A 4J49A 2WWFA 5ALPA 2OHXA 3GG2A 3MA0A 4RZ3A 2K7FA 2CDBA 3REGA 4E4RA 3W0LB 3SZ3A 4MV7A 1PV1A 5AXDA 3FUWA 1U0GA 3W2FA 2JLZA 3U4QB 1HV8A 1L5LA 3PL1A 5AP9A 1IBSA 4ATNA 2XRZA 3U4MA 1VKRA 4HH1A 3SF8B 1ONPA 1Z62A 1E6EA 5G3ZA 1HDCA 1LBSA 3RS4A 1J49A 4J16A 1UBEA 1HRKA 1YVRA 4TSFD 3SVLA 4GU5A 1BN6A 3MMXA 2YY6A 3U62A 3ONVA 2JJ2D 3B5EA 1Z26A 2C84A 2VJYA 3FE2A 3L6EA 1K7YA 2E49A 2REXB 3A9SA 3VR4H 4QNRA 5KINB 2IYYA 2Y3IA 2JLBA 3TINA 4JIMA 1UMDB 1HA3A 2IYSA 3AI2A 4BKRA 3V4OA 4NV3A 2P11A 2RKWA 4EIWA 1J0BA 1ZHHA 3K09C 4TUYA 4PG7A 2FFQA 2F3UA 4RFSA 1FFYA 1ICEA 3BMOB 4RA6B 1OZFA 5GGYA 3W78A 5HJ5A 2JAWA 3WOHA 1ISJA 3CYFA 4IV0A 5JAIA 3EXG1 3TR5A 1XROA 1F38A 4KQ9A 4NIMA 1GYRA 5DPMA 1W0KA 2I6SA 4Z4QA 3AR5A 3VQTA 4G36A 3WGKA 2CVPA 4B6QA 3EA4A 5CLJA 4G3XA 5I8PA 2YHSA 1E1LA 2C8VA 2WABA 4Q4DA 3PHIA 3OJLA 4HEJA 1V1RB 1I3NA 3CLVA 121PA 2IEDA 3HKBB 4J03A 1QIKA 4HLUC 2D0PB 3GJTA 4NCKA 5E0KB 2ZBRA 3RF7A 3VYUB 5JLJA 1ULZA 2FPIB 4IDBA 1QH8A 5IDYA 1UUFA 1VL8A 3B51X 3EBOA 3LHFA 5P21A 4EW3A 4QUIA 2Q1TA 4WSOA 1UC8A 4RVNA 1D2RA 3O93A 3QWAA 5IVDA 3E1GA 3Q3VA 4Q18A 3L0SA 2XGGA 3ZW7A 3ZWDA 2MYPA 3ROKA 2X6RA 3W90A 2NMVA 1YQTA 4YCMA 3SOPA 1JEAA 2BFNA 4LOJA 1E7RA 5FA6A 1JLLB 2RBKA 2PMKA 5IF3A 3HBJA 3RGWS 3WV5A 2P5UA 1BOFA 1WDMA 4M49A 1BTOA 4YCJA 1Y1TA 4ZZ1A 5JW6A 5IYZF 1M54A 5HZMA 1AB6A 3L1JA 2IDKA 4CQLB 4UOEA 3PFCA 2W6ZA 4H1VA 1KE1A 4BMVA 4YT8A 2IF0A 2EFJA 3ZWWA 3IUQA 1HDIA 4QRDA 2BFBB 4HRYA 2VHVA 1UH5A 4M8LA 1OYYA 2J9ZB 3GEDA 1EG7A 2LE0A 3KP1A 3OZAA 4FFPA 4J2TA 4JXXA 2VH1A 1DINA 3D31A 1R4ZA 1XE3A 5LYJB 4FU0A 1U5BA 3B8EA 3R77A 1DIGA 1XZKA 2W0MA 1HDXA 2GAOA 2VUSA 1NQUA 5EQJB 1I30A 2OOSA 3D2BA 1HNXB 4UMDA 3TPZA 5HKOA 5JYBA 1X8JA 2H8KA 2YHBA 3GMIA 5J1SB 1QTRA 3DPIA 2RJOA 2H92A 1HZZA 3WMWA 4AYTA 2IU4A 4HAIA 3PXUA 4QSMA 4Z4HA 3HXKA 2VAPA 2PMCA 1TI7A 2CNDA 3V4LA 2HEIA 2WFZA 4GD3Q 1DC3A 1YFKA 2AVNA 4HNUA 1L7RA 2JLSA 2YICA 1IHUA 4WZBB 5E4JA 1LZLA 5HK9A 5EP3A 4IIJA 4FOPA 4FYPA 1FFXB 4CETA 3I62A 3UJPA 5KYXB 4PXAA 2XUDA 3F97A 4PC6A 3RT1A 3ZBUA 2JCBA 4CLEA 3RUAA 2W70A 1L8AA 3JVUA 4XKJA 3I83A 2AJLI 1ZM4A 1KYTA 3VKUA 1A9XB 4LOKA 1J90A 5AVZA 2VQSA 2J0VA 3WS7A 3TIFA 2BDUA 1NA5A 3KOYA 1V1JA 2WWXA 2C0PA 1BDMA 2DC1A 1WKBA 2IX3A 2VPPA 3MJHA 1DQRA 4KPFC 2YWXA 2OB1A 4KXLA 4U39A 3DOHA 2JI9A 1JP7A 3PUZA 3GAAA 1U2GC 4DLPA 1QP4A 1GG5A 1YOBA 4G5QA 5C1DA 2JCGA 1CEEA 3MK31 2DFLA 5IAOA 5H5JA 3RUCA 3K0FA 1IEVA 5ADHA 1CT9A 4FGLA 3C48A 3R75A 3CW9A 1J9EA 4AT1A 3IKTA 1A04A 4AD8A 3KPYA 2G4VA 3NBYC 4GT1A 4XM0A 2NPFA 2JRLA 4G2NA 3B3QA 2ZYIA 4OXIA 4D8YA 3BHJA 2XMDA 3DE5X 3GLGE 4CKWB 3NGMA 1H3EA 3H87A 2YN4A 4PLWA 3B7WA 4LXUA 1PU2A 4PSVA 5F3DA 3C24A 1WPRA 5I9MA 1TU4A 3VR4D 3WWOA 4EW2A 3IOYA 4PHHA 1N2XA 4QUKA 4HVAA 3IIJA 2WPDA 3VVLA 1LSUA 1X38A 2Q0QA 2FZKA 1T29A 3NEJA 4L9RA 5FV7A 1QU2A 4NV1A 3V00A 3E2PA 4YJ2F 1TA4A 1USGA 4DCJA 1MO5A 1ONBA 5E95A 2FFHA 4PTYA 4WQMA 5FTKA 1V7QA 2P75A 4EHBA 5AJHA 5GJVC 1QLHA 4L6IA 1QOQB 2GWRA 2RD2A 4ZYZA 3Q8LA 1M74A 3GFPA 3ZJYA 3NEAA 4R1SA 4ZK6A 4C4AA 4ETIA 1MQ8B 1T3GA 1XD8A 2I7CA 4UM8B 4MVYA 1U0FA 7MHTA 1UK6A 3G8AA 2QUHA 3MT9A 3P0HA 5KQSA 5TQ2B 1XCPA 1PJ2A 4WFJA 1NAIA 3ZBTA 1VKHA 5I9IA 4Q1EA 4HEA1 2E6UX 2RHHA 3E9MA 4GZ3A 4IM7A 4EABA 3DM9B 5LDHA 4YUWA 2WHYA 5T7BA 1KMQA 4BTEA 5EKSA 3FVQA 1GVHA 3NT2A 5EQFA 3TB4A 3EBLA 4RY2A 1FSFA 4S12A 1G6HA 4JJGA 5HWSA 2G4CA 5DTQA 4PZDA 1CY7A 2DKFA 3VKWA 3W8EA 4LWQA 2O5CA 1QZXA 1G7TA 2B1QA 3JALB 3W9BA 2VRBA 4FFVA 2GAFA 1KOFA 2P9ZA 4RESA 3OPNA 2H7YA 5JYDA 3JRWA 4F46A 5K6AC 3KB8A 5A6SA 3RABA 3SZMA 4W1PA 1QBKC 1OREA 2FW7A 3AUXA 4MKGA 1PT9A 4XWYA 2V9CA 5F7OA 5DLDA 4Y7DA 5LXTA 1NW4A 1P9RA 2ISSD 3AI7A 3IALA 4B82A 5TT1A 3GV0A 1NFQA 4ZVTA 4L3OA 3TW4A 4RXMA 1W5FA 1AQNA 3ZWBA 1SUIA 1Q1QA 2ZB2A 4YUVA 1QB7A 1KDTA 1FSZA 1MT0A 2BFCB 2JW5A 1B8NA 4ARBA 3JAWB 3O8CA 5JI2E 4PO9A 4DABA 3DMDA 1L9KA 4PNPA 4EAQA 1U2DC 4TTVA 1ISFA 3FRJA 5F77A 1JU9A 3GMTA 3M1AA 3GLFB 2PCJA 3QLVA 1KDRA 3BWMA 4MWEA 1NIJA 4OHXA 1VJTA 2QSUA 2F9MA 1ZMOA 1QANA 2W2XA 1CERA 2WLTA 2V7WA 4XVCA 2BLNA 1FK8A 5FBLB 5I4CA 2NXCA 1U2QA 1MKYA 2LW7A 1KEKA 1OV6A 1E9DA 4QJ5A 3UV3A 4O0LA 1P6UA 4O4JB 2QD1A 2IEBA 3U39A 3EGXA 4RKRA 3ZGOA 3DCNA 6Q21A 1J5PA 3F67A 3GI1A 2HBRA 1MXHA 3FNFA 3LY7A 1N0UA 2WVGA 1SZPA 3HYNA 4I19A 3BKXA 4R5HA 2AK2A 2F67A 3OQIB 2HQSA 2IK8A 4M89A 3F5SA 3H8SA 5ICSA 1CWUA 4OPMA 5JRDS 4KQ2A 1A50B 4UNNA 1JB1A 4Y2HA 2QTLA 2Q1WA 3JWHA 5AKGA 1E6WA 3P9PA 5I7RA 3D59A 2XXBA 3G3EA 3WBBA 1K89A 2J0SA 2SCUA 2VYCA 4DPMA 1JKJB 2H5EA 1N6NA 2XDAA 1OAOA 2QZ4A 1RRKA 4HAOA 4HAXA 4B3CA 3FB4A 2BZSA 1F0PA 2F59A 3EZ6A 3GP3A 2XBUA 4O1MA 4QO8A 2O8FA 1YA4A 5LMNB 4U8GA 1D09A 3ZE7A 5KWJA 4NU6A 3SE0A 5LB4A 4UU1A 4AZ3A 1FW8A 2PAFA 1R9GA 4S2EA 4B83A 2VJAA 5DYIA 2FMXA 2ZSFA 1KFEB 1Q1GA 2JCVA 3MZ0A 3FBTA 4EUKA 1R8SA 3VPBA 5IWAB 2V5UA 1OKKD 4QDOA 4GVPA 1VLZA 5ALUA 3TF5A 1OD6A 1E3LA 1KP2A 1X3LA 4RM2A 3VPHA 1KRWA 3Q2OA 2XUFA 1U2SA 4QOFA 5DXJA 4X64B 2HQBA 3EZ9A 1B8OA 1KYWA 1T34A 3W5VA 2BE9A 1IOVA 2I29A 2RHDA 3M8KA 4H7IA 4TSKA 2R68A 4XEUA 3O2SB 4M0DA 1QTIA 1FU4A 2BZ0A 2BFAA 2PZLA 2J59A 2BHRA 2W11A 3G0CA 3L1KA 3SHOA 4CKXA 1VSUA 2JI6A 1S01A 1JNYA 1UOEA 4RLFA 4EW6A 3Q5EA 3OAAD 4D81A 3A4MA 3KR1A 3T7SA 1VXOA 1RD4A 1J5XA 5B1SA 4PLPA 4BO0A 3NIFB 3CJTA 1XEXB 1ZJYA 1ZUHA 1W30A 2HCFA 3NKVA 5KYUB 2VYQA 1HNZB 2PTGA 3SMQA 3CT6A 1MRNA 4DIDA 1EVIA 4GWLA 3PE4A 4QSHA 4R9UC 2VUUA 4CHGA 2VF2A 3REOA 2F6RA 1G16A 2QR2A 4RM3A 3V7YA 3FZYA 3IJRA 3CZMA 4BVJA 1OVGA 4DQDA 3FVVA 4BNKA 1GZVA 5DBHX 4D4JA 4N5LA 2XMQA 1L7DA 4MKIA 4H3HB 1JEOA 5EPUA 4D0NA 1AV6A 2X9VA 2WD9A 3OOHA 4NJMA 3UV6A 3WGOA 4BNDA 1O89A 6PFKA 4HC4A 4L85A 4YRBA 5K45A 3COVA 5IWCA 5C4GB 4JN6B 2CV1A 2VUTA 4X92A 3TDMA 1VZ3A 2PBLA 3LMKA 2BH2A 4ALJA 1FNNA 3H4IA 4DCPA 2XD4A 3ZH9B 2BF4A 4EZEA 1XKQA 4FYYA 2GPJA 4IOJA 5AVXA 3R7BA 3AEQB 1JXQA 1C4WA 2Q28A 3BG5A 3RKUA 3E22A 1GNPA 5JSYA 5B3AA 4BLOA 3FBWA 2KBEA 4S0XA 1Z2EA 3ELDA 1NYLA 1EBUA 1XU7A 3W5HA 4GP9A 2VBGA 3BE8A 3M4JA 2VWPA 3NWEA 5EINA 2AHRA 2E4WA 1POXA 4KYVA 2GERA 1V11B 3D6FA 3E5RA 5FTNA 5JSFA 1Z4IA 1G8JA 2EZ8A 3C3CA 3ZQJA 2GM4A 2GFIA 2I03A 3C3JA 1HDOA 1JILA 4EYQA 1BHO1 2PJUA 2AOUB 2V6MA 3U5TA 3E53A 3D4IA 1P72A 2UYGA 3BXHA 3OIDA 1U0EA 1Z6ZA 2PHZA 1Z2CA 1DAPA 2B36A 2O7SA 4EBFA 4EUEA 4IJ6A 3TLGA 1AUOA 1LNQA 1XLTC 3QHQA 3Q12A 2J30A 4K9KA 4G0VA 4BRSA 1VE3A 4CCYA 3WRVA 3AERB 4FT2A 4C89A 3QLJA 1R64A 4KV9A 2GEFA 4QWMA 4UHEA 2CF6A 1QG2A 3BSWA 4TQAA 5LA6F 2QSZA 5TE9A 4UMVA 5IKOA 1AUVA 1DADA 2YJTD 1WJGA 3DO6A 1U8YA 3G17A 1PL6A 1DAMA 1Z68A 4B2LA 3VU0A 2YXLA 4PYNA 5I4KA 2QVBA 3JQDA 4OG2A 2WSSA 3CPEA 4HRVA 2NQ8A 4US0R 4M76B 2B3TA 5A04A 1FMTA 2PV0A 3RVLA 1YMUA 1QHGA 4CM9A 3PLNA 4RK0A 5CAEB 4ARZB 1TL7C 5JMPA 3O8OA 4FJ2A 2VYNA 4FZ5A 1TTQB 1W88B 1YE3A 2Y99A 2IELA 1Q92A 2ZSEA 3EZNA 1C3XA 1UKBA 3H97A 4Z9YA 1Z7YA 1UPFA 2OD7A 1Z3IX 2ATCA 5H4GA 5E4FA 3RT9A 4QUAA 3DDNA 4ZI7A 3SQWA 3KZKA 1SULA 1ZGGA 2D5LA 3OZWA 4KCGA 1E1MA 2AFVA 4GEKA 4KWCA 3VJMA 5ICMA 1I7QB 1L8LA 4NENA 2IV7A 3E35A 4ER6A 5K8TA 1G8MA 2CXOA 3GYBA 4RCYA 3QNWA 4GMHA 3TLAA 2F8TA 2Y0PA 1ULBA 3MD0A 4K26A 2I7TA 2NZWA 3GBSA 1PX0A 1E1YA 2VK4A 3PC2A 8ATCA 2C9DA 3ZK9A 1WF6A 1XDZA 3LT4A 2W9XA 4MZXA 1I3OA 2OZLA 4V2IA 4C0BA 3WB9A 3COZA 1DKMA 3UW3A 3M70A 5JHHB 3QUAA 4G5GA 4KK4A 2ZUWA 4G0YA 4P93A 2XUGA 1JT9A 1ENPA 3RYIB 2CL6X 2EL9A 2HY7A 1HRDA 2IEIA 3PHLA 1K6MA 1KY5A 1LPNA 1XYVA 2I6XA 3K2QA 4P4SA 2BFFA 4DNQA 4UBMA 2ORVA 5M34A 3HYTA 5C1PA 1E7YA 4BB0A 4OU5A 4JI1B 2XUZA 3VAAA 4U2FA 4X1KB 5HF9A 4BUJA 1A82A 1OPXA 3DFUA 4C0HA 1BCRA 2OGZA 4JQOA 4OXXA 5DT9A 4H4DA 1KNQA 4HDNA 4MR9B 3H2YA 2X15A 2I4MA 3R3WA 5FBRB 1NN5A 1ZC4A 3R6TA 3NAQA 2BYTA 4CIWA 1VIDA 3F7NA 1WKCA 3FDZA 2E89A 1PGPA 4FKBA 1Q1EA 2C97A 4MS4B 2OHGA 3I28A 3QBVA 5DW0A 4L5JA 5EZ6B 3FPLA 2OHOA 1U7TA 3DOFA 4U9IS 4B7XA 1TA9A 4TTAA 3L1IA 1U6IA 2B8NA 2JAUA 3L79A 3VPSA 4NDNE 4X1YB 1DG3A 5LQAA 1UDCA 4X3PA 4XA8A 3AMVA 3AY0A 5B7QA 5E6RA 4NBSA 1ZQ9A 4WA8A 2QLNA 3I0ZA 4JHLA 5IBQA 1XEWX 4B47A 1XXLA 3HN6A 4C7XA 1XMIA 1XC7A 4DHEA 3OE5A 1B2RA 3SI7A 3HDTA 2IPLA 2NXEA 5CFZA 3DPSA 4WJLA 4CTJA 4MYSA 1DAGA 2X9LA 3DDHA 3JQAA 5DYNA 2NPOA 3CS3A 1Y34E 3B2NA 3RYCA 1A4IA 2NNLD 3WSVA 5IABA 1JIJA 5KWIA 1RBYA 1XDUA 3BTUA 4Z7OB 3C1AA 3LQQA 4IVPA 4I7EA 3IDFA 1TGYA 2OXCA 3HJGA 1MOPA 1GT91 3WL4A 1OW3B 2Z4TA 4JJZA 3E9QA 1TUBA 2XX3A 3TTWA 1FVOA 2GO1A 3GK3A 1RPZA 2OLKA 1REQB 3PNYA 5AVWA 1M6NA 1RMYA 3GX1A 5THXA 4B3HA 1SXJC 5AKIA 5BV2P 3RTAA 1YZ3A 2VATA 3EFBA 4ON9A 5NLLA 2XIQA 1BXGA 1OFUX 2HRCA 2QQ5A 1MF7A 4MGHA 3OECA 5E3JA 3TW0A 4BIIA 1ESMA 1NVMB 2YJ6A 1RLJA 3CF4G 3NYQA 3LDAA 2J3IA 2WJAA 2YMPA 4TSFA 2R44A 4AN1A 2B8JA 1TU0A 2A2ZA 1K2WA 5ALMA 2A9KA 3HKDA 2JJ2A 3R0VA 3ZY6A 4OKSA 1NXPA 2BM0A 3JQ6A 2RGCA 1PR9A 3PVCA 1JUDA 1NGSA 4Q9LA 2IYPA 4YJ3B 1VPWA 4ZU1X 4CBVA 2QVGA 1E5VA 2VRWA 3ILYA 4IIUA 3WKCA 5DLYA 4HXYA 4IIBA 1B00A 1EDEA 4W1QA 2A57A 3DMRA 3FAZA 1PJAA 2V97A 3T1HB 2C03A 4FCVA 4MLDA 4A5OA 1L9XA 3VUFA 3V9AA 3NRJA 1GZ6A 4IVRA 4YPOA 1IBLB 2X8LA 1H94A 3CQ9A 3VNQA 1S7GA 1BJRE 4REQA 4FWTA 1KFBB 1RLMA 1DEKA 2QRZA 2XTZA 5JWOA 3H84A 1UP4A 1JQDA 1QCZA 1GXSB 3ESRA 5HSGA 5EZYB 1KVTA 2EQAA 3OEWA 4E0BA 1AGXA 5JQGA 2BF7A 3KLPX 3R7DA 4YIHA 4BO8A 1YNOA 3IYLW 1I5RA 1DBIA 1NZJA 1DV1A 2FVXA 2PRKA 3AKDA 4M55A 4YDSA 4BLRA 1BFDA 1QAMA 1EGAA 2DWOA 2FEKA 1JSRA 2ZOSA 3IDSA 3PRYA 4H1UA 4BVAA 4C0KA 1ZAYA 2HIHA 4DSZA 4LPKA 3PDWA 4MYUA 3GR6A 1MA0A 1M33A 3PC6A 3PF8A 4BMDA 1UZAA 5FA5A 2J5BA 4Q7QA 1PR3A 3G0GA 2GASA 1F17A 4X8LA 1MPTA 1RXCA 5FOQA 5J2UA 4R2MA 4CMEC 3THYA 1WS6A 1NONA 3DE1X 2YXDA 4C05A 1T15A 3R9KA 4EMSA 4DA9A 3CPHA 1DHTA 1Y8QB 2Q3JA 2X6QA 4M60A 2HLPA 3I1IA 2Q5JA 4YRPA 5K3OA 1GPDG 4NU8X 2FUCA 5EERA 2NXJA 5LYYA 4PNZA 4B46A 5K1ZA 2JFPA 1VXRA 1X7XA 3BREA 2PA3A 1UXHA 4KDEA 4KPUB 1FBTA 3WAGA 4MVJH 3DD5A 1V4NA 2AN4A 3CURA 5L45A 4ZRDA 2AN9A 2CY0A 1BWQA 3IR6A 3IP6A 1GZ4A 5ALTA 2VNAA 4EL5A 1UK7A 3QMWA 5LP6F 4MO2A 1AKRA 2IODA 4ZT4A 3WDSA 1WB5A 2DEUA 3H8WA 3K9WA 4MW6A 3CFYA 4PX2A 2D00A 4JUBA 1RIIA 3L7YA 3JCZA 2XA9A 3KZVA 1ZI6A 4NLLA 4DMFA 1LDMA 1Z5PA 2DWPA 4RYLA 4ZDJA 4LGYA 2PQ6A 2IUFA 2I33A 2QR3A 2PKXA 3UGTA 5BWMA 3IO3A 3RFTA 2C3YA 3VX4A 4IPTA 2FSVA 4NZMA 4P31A 2PT7A 2M6KA 4M7OA 3EVNA 1NQVA 2HMWA 4MLZA 2Y2UA 3CH6A 3A9CA 3EYAA 3S2SA 4QYMA 4QJIA 3MWDB 1O8BA 3LLUA 3WGVA 1RDFA 3QPDA 3QWIA 1L4GA 5E8RA 5K0ZA 3W3AH 2JBHA 3SQDA 1XMPA 1FP6A 4HDCA 4FYMA 4XGKA 3DVAA 1X70A 2A1UB 4RF3A 1ZJZA 2A5DA 4IIEA 1T8YA 1WSAA 2FEXA 4JVOA 3GEMA 1MMFB 4IO1A 2P7IA 2XE7A 1GRRA 2C59A 1BCSA 3LVQE 4PE5B 4YONB 5FBKA 2OFPA 1N2ZA 4AWAA 4EHAA 1SUPA 1YACA 4GKAA 5KYVA 5FLXA 3VZQA 2Q29A 4JLKA 5CPFA 3LJKA 4O4HB 5JUWA 5EAIA 3HCOA 2AI2A 1WUJS 2F2TA 2WWRA 2C9YA 1D1QA 3RRJA 2FOIA 2O2CA 1EUYA 3Q0TA 3LD9A 3E1KA 1XJCA 2NYUA 1J06A 1NXXA 2W93A 3AINA 4WZAA 5CR9A 3JAKA 3T9DA 1Y3HA 4NNPA 4P0TA 3VO9A 3GP5A 4ENQA 3RC8A 1QU3A 1E94E 1MRZA 2GDJA 2VHYA 3EDQA 2WIGA 5F64A 3GRKA 1E2UA