3A2AA

The structure of the carboxyl-terminal domain of the human voltage-gated proton channel hv1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
RQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Voltage-gated hydrogen channel 1
publication title The role and structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 18
structure length 41
sequence length 41
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16799 VGPC1_C C-terminal membrane-localisation domain of ion-channel, VCN1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a2aA00
3NFQA 2N9BA 4AQRD 3VMXA 2JJLA 2XZRA 2R3CA 2YO3A 1SP4A 1HJBA 1MV8A 1YYCA 2Q5UA 3IR9A 4C7NB 1GTWA 5AW3B 1H89A 1H88A 1X8YA 3L36A 3TNUA 5AVUB 5AW8B 3P32A 3SWFA 3NXSA 2QM7A 2ZXEB 5AW6B 3VYIA 1S9KE 1NWQA 1OXZA 2R5BA 3M91A 5APXA 2R32A 5APWA 5AW1B 3LIDA 2YNYA 5AVZB 4LC1A 3T97A 1GZLA 5CMZA 2C9LY 3NMDA 5AW0B 3A7OA 1T2KD 1G2CB 2R5DA 1T2KC 3TK1A 1KQLA 5AW2B 3HTKA 2Q3IA 4EOTA 5APTA 4KHXA 5AW9B 1GU4A 1CI6B 3MD0A 1MFZA 2IPPA 2P7JA 2WPRA 1GU5A 3M0AA 5AVRB 2WT7A 2E42A 2WPQA 3HE5B 3NTNA 1JUNA 5AVTB 3A2AA 1HUCA 2ZFCA 1GD2E 2YO2A 1CSBA 2WPSA 3M9HA 3P8MC 3MGNA 5AW5B 3HE4B 3O8ZA 1GK4A 1HWTC 1A02F 5APUA 2W27A 1FOSF 3V4WA 3KQGA 4C46A 2KP8A 3KDPB 4JYCA 4B86A 3TNUB 1J2JB 3VN0A 1CI6A 5AW4B 3TYYA 2E43A 4C7NA 3L35A 3HE5A 3V4QA 2W6AA 2Z5HA 4RESB 4GT1A 2H7HA 2QM8A 1MUUA 4XE5B 5APQA 5AVVB 2Z5IA 3M06A 3A3YB 5AVQB 3HE4A 1H8AA 2WTYA 2BASA 3UIAA 2WWWA 3M9BA 3VMZA 3VMYA 3VTPC 3A5TA 1FOSE 1SLQA 4AYCA 2P2UA 2Q7CA 2VRSA 3L37A 2WT7B 2C9NY 1GK6A 1DH3A 3B8EB 1IO4A 4GKGA 2XV5A 3P7KA 5AVSB 3M0DA 1OWAA 5APVA 1NAFA 5AVWB 1A02J 4AUWA 4M3LA 4I2LC 4JYBA 1HBWA 2XU6A 4I6MC 5APYA 5AVXB 3OAKA 1JNMA 1FAVA 3LIEA 2P67A 5AW7B 1CZQA 3V5BA 4DZOA 5AVYB 5APSA 1S9KD 3I5CA 4HYTB
chains in the Genus database with same CATH superfamily
3M0DC 2YKPA 1SQBD 1L2PA 1NTMD 1U7MA 3Q5SA 4WBAA 1X79B 2M3BA 1TU3F 2K9JB 1Q81Q 1J1DB 4PV1D 4PV1C 1JY2N 2QJYB 1T2KD 2V7QJ 1T2KC 5GTHE 2LKMA 5KKZC 1FS0E 1GW3A 4ZMDA 4DJGA 3F5HA 1K8AQ 2WPRA 3Q5RA 1OMIA 1YQ3C 2K9YA 3D71A 1LTGC 2RMZA 3EFFK 1G2CA 4OGQD 1FZBA 5CCGA 2PAJA 2KK7A 1RE4C 1SQPJ 1MZ9A 1NAYA 2WVRA 2H7HA 2JEEA 3H1IE 2JR8A 2WQYC 4ZKUA 3A3YB 2WSCJ 3FWNA 3HD7B 3UIAA 2N1TA 2K88A 4TT3H 1DH3A 1PPJE 2LXCB 1S5LH 1K05A 1JEKA 3V5BA 1IFIA 1S9KD 3HTKB 4OWFA 2LXBA 3NFQA 1NH4A 2SPZA 5CCHD 1T8ZA 2FXMA 5CCHC 1L0LD 3TDKA 5AW3B 1L4AA 2FFDB 1WRGA 1SQVD 1QVFO 2B9BA 3MUDA 3H25A 3WUVA 2AXTH 1QVGO 3H32B 2BEZF 2N9YB 1URQA 1YJWP 2GUSA 3L75E 1BE3D 1MKMA 4JF7A 3M9HA 2R3SA 3O6QB 2E74D 2E74C 3C9IA 3KQGA 3JC22 1KYOD 2W6BA 4Y99C 3S9OA 3CL3D 3JSVC 1VL2A 1KILB 4HH2A 3RBZA 1SQXD 1M57D 2Z5IA 3G4SP 1HGZA 1R5SA 3IN6A 2ZT9B 3VTPC 4IL6E 1FOSE 4AYCA 3AEDC 3BCCD 3L72G 4GKGA 1KYOH 4H44B 2IZ1A 2OQQA 1T3UA 2Y9ZA 5APYA 4DOJA 1QGKB 2PGDA 2ZYGA 4I7ZB 2KOGA 1XTGB 4LLHA 2ITAA 2O01H 1NTMK 3RK2D 1GL2A 3RK2C 2YMYA 1LJ2A 2YXQB 3TNUA 2E76B 4KJMA 4OH8B 1WT6A 1KQGB 1NVOA 1G2CB 3QWOC 3H1KG 1GW4A 4YXDC 2QVAA 1QEXA 1L0NJ 2M8RA 3V2NA 1M1JA 1BDDA 1BCCE 2RKLA 1FDMA 2OARA 2WPSA 3MGNA 3BRTB 1VQOP 1SQBE 2HPCB 1Y9BA 3GW6A 3L71E 1NU1E 2N1TB 3L73G 4D6TE 1VQMP 3L35A 3PRJA 4IOIH 2A06G 2MKVA 2FXOA 2A45H 5KLVG 5AVQB 1EDIA 1NGMB 1PIXA 1LWUC 1L4AB 5H2FE 5E79H 5KJ7A 1LGHB 2J58A 4QMAA 1FZFA 1OFCX 1PP9G 4HB1A 4IFDK 5CJ0A 3WMM0 1IC2A 4JYCA 2BCCG 4EYYQ 3AEFC 1L0LK 1URQB 4C7NB 1KQFB 3L36A 1SQVK 3H1HD 3TGUG 1ZW0A 1JTHA 4DT0A 3AECC 1KC8Q 1LT9C 3NMDA 1RF0C 1NTZG 1EXJA 2YXRB 1G1JA 1M7LA 1RF0A 5GTHH 3KXDA 3H1JD 3CXHD 2MJZA 2AXCA 5AVTB 1LTJA 1NOHA 1OW7A 3AE5C 3I56P 3BRVB 3KHUA 1BSHA 4MN4C 2P1JA 5GTIE 4O9BA 1MFTA 3H1ID 2KZJA 3F89A 2QRXA 3B4SA 3CXHH 2HYNA 1R8EA 1N86A 2ZJSE 1J1DC 1FZAA 4RESB 2QJYC 2K9JA 5BU5A 2JWAA 5B66E 3CWBG 1RF1A 5KLVJ 1N2DC 3M9BA 1SFCA 1GL2B 2Y0CA 2WITA 1JCDA 1SQQD 1GK6A 3D6ZA 1VQKP 1VQNP 1VQ5P 2B89A 4I2LC 4OVNF 2O1KA 1PP9J 1Y8AA 1EZVG 3USSA 1KORA 1KYOE 3SFEC 2J59M 1X8YA 5AW8B 1OZHA 1M1JB 1NTKD 1SQXE 2OYOA 2WSFH 3FXDA 4JPZB 1OXZA 1JO5A 3TGUJ 4LC1A 3L75D 3HD7D 3HD7C 3A7OA 1S1CX 3TK1A 2UWJE 3BCCE 2FYUJ 1NTZJ 1PL5A 3MD0A 1ZLLA 2XNXA 1XTCC 1Z56A 2B87A 1VQ9P 1FU1A 1HUCA 1JY3P 1JY3O 1P84E 3L72E 4L75A 3M9QA 3RK3B 1KYOI 2I1JA 1YBKA 2FFDC 2JKVA 1OVUA 1DIPA 5AVVB 2R44A 2OTKE 2XDJA 3CWBJ 2YIUB 4ZKPA 3IFMA 3TF5A 3AEBC 1IO4A 2XV5A 4IL6H 3MHVA 1A02J 2B88A 1JTHB 2KUBA 3H1KE 1CZQA 1U7JA 1JCCA 1P84I 1EQ7A 3FWLA 2QSIA 5E79E 3L74G 3U1AA 1N73A 1YYCA 3IR9A 1SQPD 1GTWA 3IF4A 2WSEJ 2D2CD 3RBXA 3V2QA 3A0BE 1KILC 1W2BO 3CCVP 1JMMA 3OA7A 3RK3E 3L73E 1KILA 2ZT9D 3B5NA 2ZT9C 1KB9D 2R5DA 1HF9A 3AE6C 2HG5D 3CMAP 4C7RA 4H44D 4H44C 1ZV8A 1GU5A 3L71D 1LTAC 1NU1D 2GA1A 2RN0A 3A2AA 4D6TD 1PGPA 1ZOYC 2YO2A 2A45I 3CCRP 2KS1B 2QG4A 1RF1B 1HWTC 1KB9H 1SFCB 2KLUA 3KDPB 1PV3A 3S4RA 1JOCA 3H1HE 3V6IA 1NKZB 3CC4P 2E76D 2E76C 1AQTA 3GMAA 1BGYJ 2KB7P 1LTBC 2XNDH 2BCCE 2QIWA 2P58A 5CCGD 1OX3A 3PTZA 5CCGC 2O01N 4RJTA 3AE2C 1YQ4C 3H1JE 3CXHE 2E75B 2JO1A 1YJ9P 3BASA 1EDJA 1VQ8P 4AUWA 5H2FH 1HBWA 1AVOA 4I6MC 1NTZE 2N1TD 1N7SA 3QH9A 2N1TC 2IZ0A 5BU8B 1IFNA 4AQRD 2HPCA 3N7NA 3L74J 2K3RA 2B87B 1LP1B 5AVUB 3AE3C 3P32A 1PZQA 2ZXEB 3SFDC 4WWIA 1JB0J 4JBZA 4EDFA 4BXLA 2C9LY 4GDOA 1SQQE 1QLED 1L4AD 1L4AC 3CXHI 3H1LG 3HUSB 1G1IA 3CX5D 3E1RA 2KI7B 1JM0A 3C8VA 2LR2A 3CWBE 3MUDC 1SQVG 2OYIA 1AV1A 3L70G 1GDTA 2OGUA 1URQD 2KP8A 1URQC 5GTIH 1L0NG 1NTKE 3CX5H 1FC2C 4C7NA 1BE3G 1KN7A 4L73A 4NPFX 3M06A 2QJKB 3EWKA 2KLVA 3HE4A 1FZCB 1H8AA 1D7MA 1J1EB 1N73B 3AEAC 3A0HH 1JMBA 2WT7B 2VRSA 3B71A 4U3FG 5B66H 1E79H 2FBWC 1EDLA 1OWAA 1RQVA 3VP8A 2GUVA 4EIJA 1LTTC 1QL2A 1LTSC 5AW7B 3B5NB 2H89C 4K35A 2NZ2A 4W7YA 1OVVA 1VF5B 4RKUJ 3RGUA 2AEMA 1RE3A 1HTLC 2Q5UA 1NHLA 3WU2E 3SWFA 2HLOA 2OTJP 2KSJA 1FJPA 3LIDA 5CMZA 1LT1A 3BVHA 1GL2D 2IYOA 1GL2C 1P84D 1SQBK 3KZIE 3L72D 1NU1K 3AE8C 3H1LJ 1IK9A 1ZXGA 2J5UA 1SQVJ 4K3AA 4N3YB 1IFMA 3KYQA 3V4WA 3L70J 1YI2P 1SQPE 1P84H 1Y47A 1KILE 1DEBA 1M1JC 4A7PA 3P8CD 1VQPP 2WMMA 3FGAD 1BE3J 1KB9E 1N7SB 3RL0B 3V2PA 2QM8A 3PP5A 3U1CA 1YTZI 3AE9C 2C0WA 1K9MQ 3H1KD 4NPDA 4TLFA 4WVZA 4OGQB 4YXWH 4U7JA 4U3FJ 3CPWO 5AVSB 2OYHA 3CC2P 2IX7C 3LIEA 2RH0A 2Q6QA 4Y28J 3RK3D 3L73D 3RK3C 5KJ7D 2N9BA 5KJ7C 3MZWB 3G71P 2M5AA 3VOPA 2V4HA 2A06D 1RY3A 3WUTA 2R5BA 2OYIB 3A0BH 1KB9I 5KLVD 1HH0A 3PLNA 4UB8E 1KQLA 3GHGB 2YIUC 3MTUE 1N7LA 1IFDA 4PD4D 5BVZA 1WMKA 1PP9D 2NPSA 1OVRA 2PP6A 3HE4B 3O8ZA 1GK4A 5APUA 1M8OB 2BCCD 2ZYAA 3EQ2A 2FYUG 3AE4C 1LNQA 1K73Q 1LTJC 1J2JB 2PRRA 4PJ0H 1CI6A 4PD4H 3TGUD 1DX7A 4DCKA 3GF3A 5APQA 1USEA 1NTZD 3CC7P 3CLQA 3SSUA 3CX5E 4LGDE 4BWNA 2Q7CA 4CPGA 2L91A 5APVA 1UIXA 2HFED 4JYBA 2XU6A 1JY3N 2QJPB 1RF1C 1SFCD 1SQXK 1SFCC 1PPJG 3A0HE 3CCSP 2KS1A 2IBZG 4WY4A 5KAFE 1HJBA 1MV8A 3WUUA 4H13B 3AE1C 2QM7A 2H43A 5APXA 2KNCA 1GZLA 4H0LB 3G6EP 3CWBD 1L0NE 2M3EA 1UIIA 2G3AA 2Q3IA 2E75D 2E75C 3CX5I 3RK2B 1Q90D 3M0AA 1KV4A 3Q1MA 4I1LA 3PH0A 2ZFCA 1EZVD 3K5BA 5AW5B 1KFNA 1FZEA 1A02F 1PFIA 2W27A 3PJSK 3R2PA 2H88C 4L76A 2OYHB 2FXPA 5AW4B 1Q7YQ 1LP1A 2Y0DA 5M1BA 5EFWB 2Z5HA 2W6JH 2K1AA 1S5LX 3CCEP 1DD4A 4XE5B 1ZN5A 1EXIA 1KD1Q 3A5TA 1HJ0A 2M5AB 3H1IJ 3HUSC 2C9NY 2QA4P 3HUSA 4M3LA 1BGYG 3JCUE 4HYTB 4N6JA 3ABVC 3OJAB 3P8CE 2R3CA 5TJHA 5TISH 2NPSB 1M1KQ 5CHXA 3WU2H 2IFMA 2QJKC 2V7QH 2Y9YA 1ZR4A 1J1EC 1X22A 1N73C 1SVFA 1KZUB 1IK7A 3GLMA 3RL0g 2W90A 1NO4A 5CBOA 1FZCA 5AW9B 1GU4A 1CI6B 2P7JA 4NPEA 5DJTB 2Q1KA 2WT7A 2WPQA 3NTNA 3GF7A 3KZIH 1HGVA 1KILD 3B5ND 3B5NC 1BSNA 2KSEA 1VF5D 1VF5C 4Z1MH 3L75J 1BCCG 4GIFA 3BATA 3L74D 3MIWA 1SQBG 1NTMG 2A06E 2WPVB 5KLVE 1H0TA 4I7ZC 4UB6E 2QEXP 2WSCH 1E5WA 5KLIB 1QX8A 4WY4B 4PJ0E 2DW3A 4PD4E 1U57A 3B8EB 4HKZH 1X0TA 5CBNA 1PP9E 3M0DA 3R4YA 1X9VA 3W68A 2KNCB 3AEEC 3LW5J 2YMKA 4XFJA 1VQ6P 1SQQK 3TGUE 2NRGA 1KMIZ 1VQLP 1N7SD 3RL0D 1NWQA 1N7SC 3RL0C 2FYUE 4EI2A 2ZAEB 4KT0J 2R32A 5APWA 5AW1B 2POHA 1YITP 5AVZB 3T97A 5AW0B 1IFJA 1GMJA 4OGQC 4GOEA 2IFNA 4EOTA 4IFFA 4UB8H 1LTIC 3G9RA 4PD4I 5KAIE 1KTMA 5AVRB 2E42A 4R4LA 2GM4A 1NTKK 3GG2A 1RE4A 1IJDB 1CSBA 1VDFA 3VP9A 1FBMA 1BDCA 2PFXA 3D6YA 1BCCJ 3VN0A 1SQBJ 1L0LG 1NTMJ 3L71J 1NU1J 1HVVA 3L4FA 3CMEP 2OYIC 2IBZE 4D6TJ 3Q3DA 2ZXXA 1JY2P 3GHGC 1AFOA 1JY2O 1RH5B 2FYNB 2OTLP 1N8RQ 3VMYA 1T6AA 3SWYA 3GHGA 1SLQA 3H1LD 5CCHA 1EZVE 3VMAA 3EFGA 4ZNCA 1JNMA 1VPCA 3KPEA 1K04A 2Q9IA 2HODB 5APSA 3L70D 5CJ4A 1AQ5A 1KFMA 5B5EE 1PGJA 1L0ND 2P10A 1DD3A 2W8ZA 1H88A 2KYVA 5KAFH 5AW6B 3M91A 2YKOA 1FE6A 2IBZI 2YNYA 2L5GB 1SQXG 1RE3C 1ZRTE 5TISE 4U3FD 5APTA 2G8YA 3PHLA 4KHXA 4GODA 1SQPK 3BCCG 1JUNA 1DEEG 2QJPC 1H0TB 1FJKA 2D2CB 1EZVI 3II6A 1CW5A 1IFPA 4N78E 3W67A 1BGYE 4H13D 4H13C 4B86A 5DJUB 3TYYA 4BRYA 2E43A 1L0LJ 3V4QA 1YJNP 4H0LD 4H0LC 4IFMA 1USDA 2K37A 3Q5PA 4PV1B 1IZNB 3N4XA 2E5YA 3VMZA 5KKZB 1QL1A 3P7KA 5AVWB 2I1KA 2WZ7A 5L8RJ 2HR3A 1FAVA 3T97B 2IDBA 3D70A 3L74E 3IAOA 3H6PA 3JCUH 2A45G 1R5LA 4ASWA 1M56D 2AEFA 3VMXA 3ZDMA 2XZRA 2YO3A 1Q82Q 2OYHC 2QE7H 2KZIA 2FY8A 1ZR2A 3FX0A 3CI9A 4L74A 1FDIA 1NTME 1SQXJ 5AW2B 2AEJA 4RO0A 4ASVA 3E1IA 1MFZA 2O01J 1Q86Q 3BCCJ 2ZVNB 2XKMA 2KXPB 4C46A 1PGOA 2I8DA 2M0BA 2NPSD 3AEGC 3L72J 2NPSC 4YTPC 1LWUA 2O1JA 4IL6X 3HE5A 3H1HG 3TSIA 2C0XA 3G3ZA 3E7KA 3CCMP 3I55P 2WTYA 1AVYA 4UB6H 3L37A 3CD6P 1S5LE 1M90Q 3H1JG 2Z4EA 3MP7B 1T3JA 4WB4A 3Q2YA 3ITKA 5KTBA 2FYUD 1VQ7P 1NJIQ 2E74B 3H1IG 1LT9A 3H1KJ 1L0NK 1W2EA 1OW6A 1EC5A 1AA0A 3NXSA 4Y99B 1S9KE 1W5CE 5C39A 5KLIC 4WY4D 1YHQP 4WY4C 1S4XA 4GOFA 2AXTE 2W83C 4YPCA 3CCLP 3H1LE 1L0LE 3L73J 1Q2NA 1YIJP 1SQVE 2IPPA 4BRYB 1SQQG 1KQSO 2FYZA 3L70E 5KAIH 1GD2E 2KIKA 1PPJD 3P8MC 2IBZD 3CCQP 3CCJP 1OIPA 3TNUB 2Q3EA 2YKQA 1BE3E 3HRNA 1ZP0C 2W6AA 2FKWB 1NTKG 4GT1A 2JWDA 3H1HJ 1MUUA 4XA4A 3L75G 4U3FE 2JDIH 2BASA 2WWWA 2BCCJ 2H8PD 1RQUA 2CPBA 3H1JJ 3OAKA 2CPSA 2O3JA 4HJGH 3S1KA 3FXEA 3OW2O 3HD7A 2BEQD 2JJLA 1FDOA 1VQ4P 1SP4A 1ZRTD 2WSEH 5B5EH 1H89A 3C1LA 1EDKA 3VYIA 3CCUP 1NKNA 2FYNC 4JQ0D 1S2EA 3HTKA 1S72P 4N78D 1LWUB 3HE5B 1SQQJ 1BGYD 2WSSH 3AE7C 2FFDA 3V2RA 2WSFJ 1PGQA 5KLVK 1FZCC 2HODA 2ZYDA 1FOSF 1ZMEC 3SWKA 2JP3A 5K5GB 1SQPG 3H32A 2CK3H 2ZVOB 1OW8A 1SS1A 1NTKJ 2Y0EA 4W80A 4W7ZA 3LW5H 3O6QA 1FZGA 1LT9B 1YTZT 1RHZB 1S3JA 2P2UA 3U59A 1LTJB 1NYHA 3L71G 1NU1G 2D2CC 1NAFA 5AVXB 2E5TA 4D6TG 2P67A 4R4MA 4DZOA 5AVYB 2FYUK 1BCCD 3I5CA 1AJYA 1NTZK 2IYPA
chains in the Genus database with same CATH topology
3RK3C 5KJ7D 2N9BA 5KJ7C 3M0DC 2YKPA 2J59M 3VOPA 1H88A 1X8YA 2KYVA 5AW8B 4WBAA 1M1JB 1X79B 2M3BA 5AW6B 2WSFH 1RY3A 1OXZA 2R5BA 1JO5A 3M91A 2YKOA 2OYIB 1J1DB 2YNYA 4LC1A 2L5GB 3HD7D 1HH0A 3HD7C 1JY2N 3A7OA 1T2KD 1T2KC 1RE3C 2LKMA 3TK1A 1KQLA 3GHGB 3MTUE 1GW3A 5APTA 4KHXA 1N7LA 3MD0A 2WPRA 1ZLLA 1SQPK 2XNXA 1IFDA 1XTCC 1Z56A 1JUNA 1FU1A 1FJKA 1LTGC 1HUCA 5BVZA 1JY3P 1JY3O 2NPSA 2PP6A 3HE4B 3II6A 3O8ZA 1GK4A 5APUA 1CW5A 3M9QA 3EQ2A 4N78E 1G2CA 1FZBA 5CCGA 3RK3B 2PAJA 4B86A 1LTJC 2I1JA 1J2JB 2FFDC 1CI6A 1RE4C 3TYYA 2E43A 3V4QA 1MZ9A 4IFMA 2H7HA 2JEEA 1DX7A 5APQA 5AVVB 4ZKUA 3A3YB 3HD7B 3CLQA 3N4XA 3UIAA 2XDJA 3VMZA 4LGDE 2N1TA 4ZKPA 3IFMA 1QL1A 2Q7CA 1DH3A 1IO4A 2XV5A 3P7KA 5APVA 5AVWB 1A02J 1JTHB 2I1KA 2HFED 2WZ7A 4JYBA 2XU6A 1JY3N 1FAVA 1RF1C 3V5BA 1CZQA 1SFCD 1IFIA 1JCCA 1SFCC 1SQXK 1S9KD 3H6PA 3HTKB 1EQ7A 2A45G 3NFQA 4WY4A 1NH4A 3U1AA 3VMXA 1N73A 5CCHD 1T8ZA 2XZRA 2FXMA 2YO3A 5CCHC 2OYHC 1HJBA 1MV8A 1YYCA 3IR9A 1GTWA 5AW3B 1L4AA 1ZR2A 3V2QA 2FFDB 2QM7A 1KILC 1WRGA 1JMMA 3OA7A 2H43A 5APXA 3CI9A 1GZLA 1KILA 3MUDA 3B5NA 2R5DA 5AW2B 2Q3IA 2HG5D 4C7RA 3E1IA 1ZV8A 3H32B 1MFZA 3RK2B 1GU5A 1LTAC 3M0AA 1URQA 2GUSA 4I1LA 3A2AA 2ZFCA 4JF7A 2YO2A 3M9HA 2A45I 5AW5B 2XKMA 1KFNA 1RF1B 1HWTC 1FZEA 1A02F 1PFIA 1SFCB 2W27A 3C9IA 3KQGA 3R2PA 4C46A 3KDPB 1JOCA 1NKZB 2NPSD 2OYHB 2W6BA 2NPSC 4Y99C 3CL3D 5AW4B 1LWUA 2O1JA 3HE5A 2Z5HA 2KB7P 1LTBC 1KILB 4HH2A 3TSIA 2C0XA 3G3ZA 4XE5B 5CCGD 2Z5IA 5CCGC 1HGZA 1ZN5A 2WTYA 3A5TA 3VTPC 1FOSE 3HUSC 4AYCA 2C9NY 3L37A 4GKGA 2Z4EA 3BASA 3HUSA 1T3JA 4AUWA 4M3LA 4WB4A 1T3UA 1HBWA 4I6MC 5APYA 4DOJA 2KOGA 2N1TD 1N7SA 5KTBA 2N1TC 4HYTB 5BU8B 1IFNA 4N6JA 1XTGB 4AQRD 4LLHA 2HPCA 1LT9A 3N7NA 3OJAB 1L0NK 1NTMK 2O01H 3P8CE 1W2EA 1GL2A 2R3CA 3RK2C 3RK2D 2YMYA 3TNUA 5AVUB 3P32A 3NXSA 2NPSB 2ZXEB 4Y99B 1S9KE 5CHXA 4OH8B 1WT6A 2IFMA 4WY4D 4WY4C 2C9LY 1ZR4A 1J1EC 1N73C 1G2CB 1SVFA 1KZUB 1L4AD 1GW4A 1L4AC 1NO4A 1FZCA 5AW9B 1GU4A 1CI6B 2IPPA 2P7JA 3HUSB 1G1IA 2M8RA 2WT7A 2WPQA 3NTNA 1HGVA 1KILD 2FYZA 3V2NA 1M1JA 3B5ND 3B5NC 1GD2E 1FDMA 2OARA 2WPSA 3P8MC 3MGNA 3BRTB 2OYIA 2HPCB 1GDTA 4GIFA 2N1TB 3BATA 1URQD 2KP8A 1URQC 3MIWA 3TNUB 2YKQA 4C7NA 3HRNA 3L35A 2W6AA 2FKWB 4GT1A 2WSCH 1E5WA 1MUUA 4XA4A 3M06A 2A45H 5AVQB 2KLVA 3HE4A 4WY4B 1FZCB 1H8AA 1J1EB 2BASA 1N73B 2WWWA 2H8PD 2WT7B 2VRSA 1LWUC 1L4AB 3B8EB 2CPBA 5KJ7A 3M0DA 1OWAA 1X9VA 1LGHB 3VP8A 2J58A 2GUVA 4EIJA 1FZFA 1LTTC 1QL2A 3OAKA 1LTSC 2CPSA 5AW7B 3B5NB 4IFDK 5CJ0A 3WMM0 1IC2A 4JYCA 4W7YA 3HD7A 2JJLA 1RE3A 1SP4A 1HTLC 1L0LK 1SQQK 1URQB 1NHLA 2Q5UA 2WSEH 4C7NB 1H89A 3L36A 3SWFA 1SQVK 2HLOA 3VYIA 1N7SD 3RL0D 1NWQA 1N7SC 3RL0C 1JTHA 2KSJA 2R32A 5APWA 5AW1B 1FJPA 2POHA 3LIDA 5AVZB 3T97A 1NKNA 5CMZA 3BVHA 1LT9C 3NMDA 5AW0B 1RF0C 1GL2D 1IFJA 1GL2C 3HTKA 2IFNA 1G1JA 4EOTA 1SQBK 1M7LA 1RF0A 4IFFA 1LTIC 1NU1K 4N78D 1LWUB 5AVRB 2E42A 3HE5B 1IK9A 2MJZA 5AVTB 2GM4A 1LTJA 1NOHA 2FFDA 1NTKK 3V2RA 1RE4A 1IJDB 1CSBA 3BRVB 1VDFA 5KLVK 1FZCC 3VP9A 4N3YB 2P1JA 1IFMA 1FBMA 2HODA 3KYQA 4O9BA 1FOSF 3V4WA 1DEBA 3VN0A 1M1JC 3H32A 3P8CD 2HYNA 1HVVA 3L4FA 2OYIC 1N86A 1J1DC 1FZAA 4RESB 1N7SB 3RL0B 3V2PA 2QM8A 4W80A 1JY2P 3GHGC 5BU5A 3PP5A 3U1CA 1AFOA 1JY2O 4W7ZA 3LW5H 1YTZI 1RF1A 1LT9B 1YTZT 1N2DC 2C0WA 1FZGA 3VMYA 3M9BA 1SFCA 1GL2B 3SWYA 2WITA 3GHGA 1SLQA 2P2UA 1JCDA 1GK6A 3U59A 1LTJB 5AVSB 1NAFA 5CCHA 2OYHA 4I2LC 3EFGA 5AVXB 1JNMA 1VPCA 3KPEA 2O1KA 2IX7C 3LIEA 2P67A 4DZOA 2Q9IA 2HODB 5AVYB 5APSA 5CJ4A 1AQ5A 2FYUK 3I5CA 1NTZK 3RK3D 1KFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFQ A;  2N9B A;  4AQR D;  3VMX A;  2JJL A;  2XZR A;  2R3C A;  2YO3 A;  1SP4 A;  1HJB A;  1MV8 A;  1YYC A;  2Q5U A;  3IR9 A;  4C7N B;  1GTW A;  5AW3 B;  1H89 A;  1H88 A;  1X8Y A;  3L36 A;  3TNU A;  5AVU B;  5AW8 B;  3P32 A;  3SWF A;  3NXS A;  2QM7 A;  2ZXE B;  5AW6 B;  3VYI A;  1S9K E;  1NWQ A;  1OXZ A;  2R5B A;  3M91 A;  5APX A;  2R32 A;  5APW A;  5AW1 B;  3LID A;  2YNY A;  5AVZ B;  4LC1 A;  3T97 A;  1GZL A;  5CMZ A;  2C9L Y;  3NMD A;  5AW0 B;  3A7O A;  1T2K D;  1G2C B;  2R5D A;  1T2K C;  3TK1 A;  1KQL A;  5AW2 B;  3HTK A;  2Q3I A;  4EOT A;  5APT A;  4KHX A;  5AW9 B;  1GU4 A;  1CI6 B;  3MD0 A;  1MFZ A;  2IPP A;  2P7J A;  2WPR A;  1GU5 A;  3M0A A;  5AVR B;  2WT7 A;  2E42 A;  2WPQ A;  3HE5 B;  3NTN A;  1JUN A;  5AVT B;  3A2A A;  1HUC A;  2ZFC A;  1GD2 E;  2YO2 A;  1CSB A;  2WPS A;  3M9H A;  3P8M C;  3MGN A;  5AW5 B;  3HE4 B;  3O8Z A;  1GK4 A;  1HWT C;  1A02 F;  5APU A;  2W27 A;  1FOS F;  3V4W A;  3KQG A;  4C46 A;  2KP8 A;  3KDP B;  4JYC A;  4B86 A;  3TNU B;  1J2J B;  3VN0 A;  1CI6 A;  5AW4 B;  3TYY A;  2E43 A;  4C7N A;  3L35 A;  3HE5 A;  3V4Q A;  2W6A A;  2Z5H A;  4RES B;  4GT1 A;  2H7H A;  2QM8 A;  1MUU A;  4XE5 B;  5APQ A;  5AVV B;  2Z5I A;  3M06 A;  3A3Y B;  5AVQ B;  3HE4 A;  1H8A A;  2WTY A;  2BAS A;  3UIA A;  2WWW A;  3M9B A;  3VMZ A;  3VMY A;  3VTP C;  3A5T A;  1FOS E;  1SLQ A;  4AYC A;  2P2U A;  2Q7C A;  2VRS A;  3L37 A;  2WT7 B;  2C9N Y;  1GK6 A;  1DH3 A;  3B8E B;  1IO4 A;  4GKG A;  2XV5 A;  3P7K A;  5AVS B;  3M0D A;  1OWA A;  5APV A;  1NAF A;  5AVW B;  1A02 J;  4AUW A;  4M3L A;  4I2L C;  4JYB A;  1HBW A;  2XU6 A;  4I6M C;  5APY A;  5AVX B;  3OAK A;  1JNM A;  1FAV A;  3LIE A;  2P67 A;  5AW7 B;  1CZQ A;  3V5B A;  4DZO A;  5AVY B;  5APS A;  1S9K D;  3I5C A;  4HYT B; 
#chains in the Genus database with same CATH topology
 3M0D C;  2YKP A;  1SQB D;  1L2P A;  1NTM D;  1U7M A;  3Q5S A;  4WBA A;  1X79 B;  2M3B A;  1TU3 F;  2K9J B;  1Q81 Q;  1J1D B;  4PV1 D;  4PV1 C;  1JY2 N;  2QJY B;  1T2K D;  2V7Q J;  1T2K C;  5GTH E;  2LKM A;  5KKZ C;  1FS0 E;  1GW3 A;  4ZMD A;  4DJG A;  3F5H A;  1K8A Q;  2WPR A;  3Q5R A;  1OMI A;  1YQ3 C;  2K9Y A;  3D71 A;  1LTG C;  2RMZ A;  3EFF K;  1G2C A;  4OGQ D;  1FZB A;  5CCG A;  2PAJ A;  2KK7 A;  1RE4 C;  1SQP J;  1MZ9 A;  1NAY A;  2WVR A;  2H7H A;  2JEE A;  3H1I E;  2JR8 A;  2WQY C;  4ZKU A;  3A3Y B;  2WSC J;  3FWN A;  3HD7 B;  3UIA A;  2N1T A;  2K88 A;  4TT3 H;  1DH3 A;  1PPJ E;  2LXC B;  1S5L H;  1K05 A;  1JEK A;  3V5B A;  1IFI A;  1S9K D;  3HTK B;  4OWF A;  2LXB A;  3NFQ A;  1NH4 A;  2SPZ A;  5CCH D;  1T8Z A;  2FXM A;  5CCH C;  1L0L D;  3TDK A;  5AW3 B;  1L4A A;  2FFD B;  1WRG A;  1SQV D;  1QVF O;  2B9B A;  3MUD A;  3H25 A;  3WUV A;  2AXT H;  1QVG O;  3H32 B;  2BEZ F;  2N9Y B;  1URQ A;  1YJW P;  2GUS A;  3L75 E;  1BE3 D;  1MKM A;  4JF7 A;  3M9H A;  2R3S A;  3O6Q B;  2E74 D;  2E74 C;  3C9I A;  3KQG A;  3JC2 2;  1KYO D;  2W6B A;  4Y99 C;  3S9O A;  3CL3 D;  3JSV C;  1VL2 A;  1KIL B;  4HH2 A;  3RBZ A;  1SQX D;  1M57 D;  2Z5I A;  3G4S P;  1HGZ A;  1R5S A;  3IN6 A;  2ZT9 B;  3VTP C;  4IL6 E;  1FOS E;  4AYC A;  3AED C;  3BCC D;  3L72 G;  4GKG A;  1KYO H;  4H44 B;  2IZ1 A;  2OQQ A;  1T3U A;  2Y9Z A;  5APY A;  4DOJ A;  1QGK B;  2PGD A;  2ZYG A;  4I7Z B;  2KOG A;  1XTG B;  4LLH A;  2ITA A;  2O01 H;  1NTM K;  3RK2 D;  1GL2 A;  3RK2 C;  2YMY A;  1LJ2 A;  2YXQ B;  3TNU A;  2E76 B;  4KJM A;  4OH8 B;  1WT6 A;  1KQG B;  1NVO A;  1G2C B;  3QWO C;  3H1K G;  1GW4 A;  4YXD C;  2QVA A;  1QEX A;  1L0N J;  2M8R A;  3V2N A;  1M1J A;  1BDD A;  1BCC E;  2RKL A;  1FDM A;  2OAR A;  2WPS A;  3MGN A;  3BRT B;  1VQO P;  1SQB E;  2HPC B;  1Y9B A;  3GW6 A;  3L71 E;  1NU1 E;  2N1T B;  3L73 G;  4D6T E;  1VQM P;  3L35 A;  3PRJ A;  4IOI H;  2A06 G;  2MKV A;  2FXO A;  2A45 H;  5KLV G;  5AVQ B;  1EDI A;  1NGM B;  1PIX A;  1LWU C;  1L4A B;  5H2F E;  5E79 H;  5KJ7 A;  1LGH B;  2J58 A;  4QMA A;  1FZF A;  1OFC X;  1PP9 G;  4HB1 A;  4IFD K;  5CJ0 A;  3WMM 0;  1IC2 A;  4JYC A;  2BCC G;  4EYY Q;  3AEF C;  1L0L K;  1URQ B;  4C7N B;  1KQF B;  3L36 A;  1SQV K;  3H1H D;  3TGU G;  1ZW0 A;  1JTH A;  4DT0 A;  3AEC C;  1KC8 Q;  1LT9 C;  3NMD A;  1RF0 C;  1NTZ G;  1EXJ A;  2YXR B;  1G1J A;  1M7L A;  1RF0 A;  5GTH H;  3KXD A;  3H1J D;  3CXH D;  2MJZ A;  2AXC A;  5AVT B;  1LTJ A;  1NOH A;  1OW7 A;  3AE5 C;  3I56 P;  3BRV B;  3KHU A;  1BSH A;  4MN4 C;  2P1J A;  5GTI E;  4O9B A;  1MFT A;  3H1I D;  2KZJ A;  3F89 A;  2QRX A;  3B4S A;  3CXH H;  2HYN A;  1R8E A;  1N86 A;  2ZJS E;  1J1D C;  1FZA A;  4RES B;  2QJY C;  2K9J A;  5BU5 A;  2JWA A;  5B66 E;  3CWB G;  1RF1 A;  5KLV J;  1N2D C;  3M9B A;  1SFC A;  1GL2 B;  2Y0C A;  2WIT A;  1JCD A;  1SQQ D;  1GK6 A;  3D6Z A;  1VQK P;  1VQN P;  1VQ5 P;  2B89 A;  4I2L C;  4OVN F;  2O1K A;  1PP9 J;  1Y8A A;  1EZV G;  3USS A;  1KOR A;  1KYO E;  3SFE C;  2J59 M;  1X8Y A;  5AW8 B;  1OZH A;  1M1J B;  1NTK D;  1SQX E;  2OYO A;  2WSF H;  3FXD A;  4JPZ B;  1OXZ A;  1JO5 A;  3TGU J;  4LC1 A;  3L75 D;  3HD7 D;  3HD7 C;  3A7O A;  1S1C X;  3TK1 A;  2UWJ E;  3BCC E;  2FYU J;  1NTZ J;  1PL5 A;  3MD0 A;  1ZLL A;  2XNX A;  1XTC C;  1Z56 A;  2B87 A;  1VQ9 P;  1FU1 A;  1HUC A;  1JY3 P;  1JY3 O;  1P84 E;  3L72 E;  4L75 A;  3M9Q A;  3RK3 B;  1KYO I;  2I1J A;  1YBK A;  2FFD C;  2JKV A;  1OVU A;  1DIP A;  5AVV B;  2R44 A;  2OTK E;  2XDJ A;  3CWB J;  2YIU B;  4ZKP A;  3IFM A;  3TF5 A;  3AEB C;  1IO4 A;  2XV5 A;  4IL6 H;  3MHV A;  1A02 J;  2B88 A;  1JTH B;  2KUB A;  3H1K E;  1CZQ A;  1U7J A;  1JCC A;  1P84 I;  1EQ7 A;  3FWL A;  2QSI A;  5E79 E;  3L74 G;  3U1A A;  1N73 A;  1YYC A;  3IR9 A;  1SQP D;  1GTW A;  3IF4 A;  2WSE J;  2D2C D;  3RBX A;  3V2Q A;  3A0B E;  1KIL C;  1W2B O;  3CCV P;  1JMM A;  3OA7 A;  3RK3 E;  3L73 E;  1KIL A;  2ZT9 D;  3B5N A;  2ZT9 C;  1KB9 D;  2R5D A;  1HF9 A;  3AE6 C;  2HG5 D;  3CMA P;  4C7R A;  4H44 D;  4H44 C;  1ZV8 A;  1GU5 A;  3L71 D;  1LTA C;  1NU1 D;  2GA1 A;  2RN0 A;  3A2A A;  4D6T D;  1PGP A;  1ZOY C;  2YO2 A;  2A45 I;  3CCR P;  2KS1 B;  2QG4 A;  1RF1 B;  1HWT C;  1KB9 H;  1SFC B;  2KLU A;  3KDP B;  1PV3 A;  3S4R A;  1JOC A;  3H1H E;  3V6I A;  1NKZ B;  3CC4 P;  2E76 D;  2E76 C;  1AQT A;  3GMA A;  1BGY J;  2KB7 P;  1LTB C;  2XND H;  2BCC E;  2QIW A;  2P58 A;  5CCG D;  1OX3 A;  3PTZ A;  5CCG C;  2O01 N;  4RJT A;  3AE2 C;  1YQ4 C;  3H1J E;  3CXH E;  2E75 B;  2JO1 A;  1YJ9 P;  3BAS A;  1EDJ A;  1VQ8 P;  4AUW A;  5H2F H;  1HBW A;  1AVO A;  4I6M C;  1NTZ E;  2N1T D;  1N7S A;  3QH9 A;  2N1T C;  2IZ0 A;  5BU8 B;  1IFN A;  4AQR D;  2HPC A;  3N7N A;  3L74 J;  2K3R A;  2B87 B;  1LP1 B;  5AVU B;  3AE3 C;  3P32 A;  1PZQ A;  2ZXE B;  3SFD C;  4WWI A;  1JB0 J;  4JBZ A;  4EDF A;  4BXL A;  2C9L Y;  4GDO A;  1SQQ E;  1QLE D;  1L4A D;  1L4A C;  3CXH I;  3H1L G;  3HUS B;  1G1I A;  3CX5 D;  3E1R A;  2KI7 B;  1JM0 A;  3C8V A;  2LR2 A;  3CWB E;  3MUD C;  1SQV G;  2OYI A;  1AV1 A;  3L70 G;  1GDT A;  2OGU A;  1URQ D;  2KP8 A;  1URQ C;  5GTI H;  1L0N G;  1NTK E;  3CX5 H;  1FC2 C;  4C7N A;  1BE3 G;  1KN7 A;  4L73 A;  4NPF X;  3M06 A;  2QJK B;  3EWK A;  2KLV A;  3HE4 A;  1FZC B;  1H8A A;  1D7M A;  1J1E B;  1N73 B;  3AEA C;  3A0H H;  1JMB A;  2WT7 B;  2VRS A;  3B71 A;  4U3F G;  5B66 H;  1E79 H;  2FBW C;  1EDL A;  1OWA A;  1RQV A;  3VP8 A;  2GUV A;  4EIJ A;  1LTT C;  1QL2 A;  1LTS C;  5AW7 B;  3B5N B;  2H89 C;  4K35 A;  2NZ2 A;  4W7Y A;  1OVV A;  1VF5 B;  4RKU J;  3RGU A;  2AEM A;  1RE3 A;  1HTL C;  2Q5U A;  1NHL A;  3WU2 E;  3SWF A;  2HLO A;  2OTJ P;  2KSJ A;  1FJP A;  3LID A;  5CMZ A;  1LT1 A;  3BVH A;  1GL2 D;  2IYO A;  1GL2 C;  1P84 D;  1SQB K;  3KZI E;  3L72 D;  1NU1 K;  3AE8 C;  3H1L J;  1IK9 A;  1ZXG A;  2J5U A;  1SQV J;  4K3A A;  4N3Y B;  1IFM A;  3KYQ A;  3V4W A;  3L70 J;  1YI2 P;  1SQP E;  1P84 H;  1Y47 A;  1KIL E;  1DEB A;  1M1J C;  4A7P A;  3P8C D;  1VQP P;  2WMM A;  3FGA D;  1BE3 J;  1KB9 E;  1N7S B;  3RL0 B;  3V2P A;  2QM8 A;  3PP5 A;  3U1C A;  1YTZ I;  3AE9 C;  2C0W A;  1K9M Q;  3H1K D;  4NPD A;  4TLF A;  4WVZ A;  4OGQ B;  4YXW H;  4U7J A;  4U3F J;  3CPW O;  5AVS B;  2OYH A;  3CC2 P;  2IX7 C;  3LIE A;  2RH0 A;  2Q6Q A;  4Y28 J;  3RK3 D;  3L73 D;  3RK3 C;  5KJ7 D;  2N9B A;  5KJ7 C;  3MZW B;  3G71 P;  2M5A A;  3VOP A;  2V4H A;  2A06 D;  1RY3 A;  3WUT A;  2R5B A;  2OYI B;  3A0B H;  1KB9 I;  5KLV D;  1HH0 A;  3PLN A;  4UB8 E;  1KQL A;  3GHG B;  2YIU C;  3MTU E;  1N7L A;  1IFD A;  4PD4 D;  5BVZ A;  1WMK A;  1PP9 D;  2NPS A;  1OVR A;  2PP6 A;  3HE4 B;  3O8Z A;  1GK4 A;  5APU A;  1M8O B;  2BCC D;  2ZYA A;  3EQ2 A;  2FYU G;  3AE4 C;  1LNQ A;  1K73 Q;  1LTJ C;  1J2J B;  2PRR A;  4PJ0 H;  1CI6 A;  4PD4 H;  3TGU D;  1DX7 A;  4DCK A;  3GF3 A;  5APQ A;  1USE A;  1NTZ D;  3CC7 P;  3CLQ A;  3SSU A;  3CX5 E;  4LGD E;  4BWN A;  2Q7C A;  4CPG A;  2L91 A;  5APV A;  1UIX A;  2HFE D;  4JYB A;  2XU6 A;  1JY3 N;  2QJP B;  1RF1 C;  1SFC D;  1SQX K;  1SFC C;  1PPJ G;  3A0H E;  3CCS P;  2KS1 A;  2IBZ G;  4WY4 A;  5KAF E;  1HJB A;  1MV8 A;  3WUU A;  4H13 B;  3AE1 C;  2QM7 A;  2H43 A;  5APX A;  2KNC A;  1GZL A;  4H0L B;  3G6E P;  3CWB D;  1L0N E;  2M3E A;  1UII A;  2G3A A;  2Q3I A;  2E75 D;  2E75 C;  3CX5 I;  3RK2 B;  1Q90 D;  3M0A A;  1KV4 A;  3Q1M A;  4I1L A;  3PH0 A;  2ZFC A;  1EZV D;  3K5B A;  5AW5 B;  1KFN A;  1FZE A;  1A02 F;  1PFI A;  2W27 A;  3PJS K;  3R2P A;  2H88 C;  4L76 A;  2OYH B;  2FXP A;  5AW4 B;  1Q7Y Q;  1LP1 A;  2Y0D A;  5M1B A;  5EFW B;  2Z5H A;  2W6J H;  2K1A A;  1S5L X;  3CCE P;  1DD4 A;  4XE5 B;  1ZN5 A;  1EXI A;  1KD1 Q;  3A5T A;  1HJ0 A;  2M5A B;  3H1I J;  3HUS C;  2C9N Y;  2QA4 P;  3HUS A;  4M3L A;  1BGY G;  3JCU E;  4HYT B;  4N6J A;  3ABV C;  3OJA B;  3P8C E;  2R3C A;  5TJH A;  5TIS H;  2NPS B;  1M1K Q;  5CHX A;  3WU2 H;  2IFM A;  2QJK C;  2V7Q H;  2Y9Y A;  1ZR4 A;  1J1E C;  1X22 A;  1N73 C;  1SVF A;  1KZU B;  1IK7 A;  3GLM A;  3RL0 g;  2W90 A;  1NO4 A;  5CBO A;  1FZC A;  5AW9 B;  1GU4 A;  1CI6 B;  2P7J A;  4NPE A;  5DJT B;  2Q1K A;  2WT7 A;  2WPQ A;  3NTN A;  3GF7 A;  3KZI H;  1HGV A;  1KIL D;  3B5N D;  3B5N C;  1BSN A;  2KSE A;  1VF5 D;  1VF5 C;  4Z1M H;  3L75 J;  1BCC G;  4GIF A;  3BAT A;  3L74 D;  3MIW A;  1SQB G;  1NTM G;  2A06 E;  2WPV B;  5KLV E;  1H0T A;  4I7Z C;  4UB6 E;  2QEX P;  2WSC H;  1E5W A;  5KLI B;  1QX8 A;  4WY4 B;  4PJ0 E;  2DW3 A;  4PD4 E;  1U57 A;  3B8E B;  4HKZ H;  1X0T A;  5CBN A;  1PP9 E;  3M0D A;  3R4Y A;  1X9V A;  3W68 A;  2KNC B;  3AEE C;  3LW5 J;  2YMK A;  4XFJ A;  1VQ6 P;  1SQQ K;  3TGU E;  2NRG A;  1KMI Z;  1VQL P;  1N7S D;  3RL0 D;  1NWQ A;  1N7S C;  3RL0 C;  2FYU E;  4EI2 A;  2ZAE B;  4KT0 J;  2R32 A;  5APW A;  5AW1 B;  2POH A;  1YIT P;  5AVZ B;  3T97 A;  5AW0 B;  1IFJ A;  1GMJ A;  4OGQ C;  4GOE A;  2IFN A;  4EOT A;  4IFF A;  4UB8 H;  1LTI C;  3G9R A;  4PD4 I;  5KAI E;  1KTM A;  5AVR B;  2E42 A;  4R4L A;  2GM4 A;  1NTK K;  3GG2 A;  1RE4 A;  1IJD B;  1CSB A;  1VDF A;  3VP9 A;  1FBM A;  1BDC A;  2PFX A;  3D6Y A;  1BCC J;  3VN0 A;  1SQB J;  1L0L G;  1NTM J;  3L71 J;  1NU1 J;  1HVV A;  3L4F A;  3CME P;  2OYI C;  2IBZ E;  4D6T J;  3Q3D A;  2ZXX A;  1JY2 P;  3GHG C;  1AFO A;  1JY2 O;  1RH5 B;  2FYN B;  2OTL P;  1N8R Q;  3VMY A;  1T6A A;  3SWY A;  3GHG A;  1SLQ A;  3H1L D;  5CCH A;  1EZV E;  3VMA A;  3EFG A;  4ZNC A;  1JNM A;  1VPC A;  3KPE A;  1K04 A;  2Q9I A;  2HOD B;  5APS A;  3L70 D;  5CJ4 A;  1AQ5 A;  1KFM A;  5B5E E;  1PGJ A;  1L0N D;  2P10 A;  1DD3 A;  2W8Z A;  1H88 A;  2KYV A;  5KAF H;  5AW6 B;  3M91 A;  2YKO A;  1FE6 A;  2IBZ I;  2YNY A;  2L5G B;  1SQX G;  1RE3 C;  1ZRT E;  5TIS E;  4U3F D;  5APT A;  2G8Y A;  3PHL A;  4KHX A;  4GOD A;  1SQP K;  3BCC G;  1JUN A;  1DEE G;  2QJP C;  1H0T B;  1FJK A;  2D2C B;  1EZV I;  3II6 A;  1CW5 A;  1IFP A;  4N78 E;  3W67 A;  1BGY E;  4H13 D;  4H13 C;  4B86 A;  5DJU B;  3TYY A;  4BRY A;  2E43 A;  1L0L J;  3V4Q A;  1YJN P;  4H0L D;  4H0L C;  4IFM A;  1USD A;  2K37 A;  3Q5P A;  4PV1 B;  1IZN B;  3N4X A;  2E5Y A;  3VMZ A;  5KKZ B;  1QL1 A;  3P7K A;  5AVW B;  2I1K A;  2WZ7 A;  5L8R J;  2HR3 A;  1FAV A;  3T97 B;  2IDB A;  3D70 A;  3L74 E;  3IAO A;  3H6P A;  3JCU H;  2A45 G;  1R5L A;  4ASW A;  1M56 D;  2AEF A;  3VMX A;  3ZDM A;  2XZR A;  2YO3 A;  1Q82 Q;  2OYH C;  2QE7 H;  2KZI A;  2FY8 A;  1ZR2 A;  3FX0 A;  3CI9 A;  4L74 A;  1FDI A;  1NTM E;  1SQX J;  5AW2 B;  2AEJ A;  4RO0 A;  4ASV A;  3E1I A;  1MFZ A;  2O01 J;  1Q86 Q;  3BCC J;  2ZVN B;  2XKM A;  2KXP B;  4C46 A;  1PGO A;  2I8D A;  2M0B A;  2NPS D;  3AEG C;  3L72 J;  2NPS C;  4YTP C;  1LWU A;  2O1J A;  4IL6 X;  3HE5 A;  3H1H G;  3TSI A;  2C0X A;  3G3Z A;  3E7K A;  3CCM P;  3I55 P;  2WTY A;  1AVY A;  4UB6 H;  3L37 A;  3CD6 P;  1S5L E;  1M90 Q;  3H1J G;  2Z4E A;  3MP7 B;  1T3J A;  4WB4 A;  3Q2Y A;  3ITK A;  5KTB A;  2FYU D;  1VQ7 P;  1NJI Q;  2E74 B;  3H1I G;  1LT9 A;  3H1K J;  1L0N K;  1W2E A;  1OW6 A;  1EC5 A;  1AA0 A;  3NXS A;  4Y99 B;  1S9K E;  1W5C E;  5C39 A;  5KLI C;  4WY4 D;  1YHQ P;  4WY4 C;  1S4X A;  4GOF A;  2AXT E;  2W83 C;  4YPC A;  3CCL P;  3H1L E;  1L0L E;  3L73 J;  1Q2N A;  1YIJ P;  1SQV E;  2IPP A;  4BRY B;  1SQQ G;  1KQS O;  2FYZ A;  3L70 E;  5KAI H;  1GD2 E;  2KIK A;  1PPJ D;  3P8M C;  2IBZ D;  3CCQ P;  3CCJ P;  1OIP A;  3TNU B;  2Q3E A;  2YKQ A;  1BE3 E;  3HRN A;  1ZP0 C;  2W6A A;  2FKW B;  1NTK G;  4GT1 A;  2JWD A;  3H1H J;  1MUU A;  4XA4 A;  3L75 G;  4U3F E;  2JDI H;  2BAS A;  2WWW A;  2BCC J;  2H8P D;  1RQU A;  2CPB A;  3H1J J;  3OAK A;  2CPS A;  2O3J A;  4HJG H;  3S1K A;  3FXE A;  3OW2 O;  3HD7 A;  2BEQ D;  2JJL A;  1FDO A;  1VQ4 P;  1SP4 A;  1ZRT D;  2WSE H;  5B5E H;  1H89 A;  3C1L A;  1EDK A;  3VYI A;  3CCU P;  1NKN A;  2FYN C;  4JQ0 D;  1S2E A;  3HTK A;  1S72 P;  4N78 D;  1LWU B;  3HE5 B;  1SQQ J;  1BGY D;  2WSS H;  3AE7 C;  2FFD A;  3V2R A;  2WSF J;  1PGQ A;  5KLV K;  1FZC C;  2HOD A;  2ZYD A;  1FOS F;  1ZME C;  3SWK A;  2JP3 A;  5K5G B;  1SQP G;  3H32 A;  2CK3 H;  2ZVO B;  1OW8 A;  1SS1 A;  1NTK J;  2Y0E A;  4W80 A;  4W7Z A;  3LW5 H;  3O6Q A;  1FZG A;  1LT9 B;  1YTZ T;  1RHZ B;  1S3J A;  2P2U A;  3U59 A;  1LTJ B;  1NYH A;  3L71 G;  1NU1 G;  2D2C C;  1NAF A;  5AVX B;  2E5T A;  4D6T G;  2P67 A;  4R4M A;  4DZO A;  5AVY B;  2FYU K;  1BCC D;  3I5C A;  1AJY A;  1NTZ K;  2IYP A; 
#chains in the Genus database with same CATH homology
 3RK3 C;  5KJ7 D;  2N9B A;  5KJ7 C;  3M0D C;  2YKP A;  2J59 M;  3VOP A;  1H88 A;  1X8Y A;  2KYV A;  5AW8 B;  4WBA A;  1M1J B;  1X79 B;  2M3B A;  5AW6 B;  2WSF H;  1RY3 A;  1OXZ A;  2R5B A;  1JO5 A;  3M91 A;  2YKO A;  2OYI B;  1J1D B;  2YNY A;  4LC1 A;  2L5G B;  3HD7 D;  1HH0 A;  3HD7 C;  1JY2 N;  3A7O A;  1T2K D;  1T2K C;  1RE3 C;  2LKM A;  3TK1 A;  1KQL A;  3GHG B;  3MTU E;  1GW3 A;  5APT A;  4KHX A;  1N7L A;  3MD0 A;  2WPR A;  1ZLL A;  1SQP K;  2XNX A;  1IFD A;  1XTC C;  1Z56 A;  1JUN A;  1FU1 A;  1FJK A;  1LTG C;  1HUC A;  5BVZ A;  1JY3 P;  1JY3 O;  2NPS A;  2PP6 A;  3HE4 B;  3II6 A;  3O8Z A;  1GK4 A;  5APU A;  1CW5 A;  3M9Q A;  3EQ2 A;  4N78 E;  1G2C A;  1FZB A;  5CCG A;  3RK3 B;  2PAJ A;  4B86 A;  1LTJ C;  2I1J A;  1J2J B;  2FFD C;  1CI6 A;  1RE4 C;  3TYY A;  2E43 A;  3V4Q A;  1MZ9 A;  4IFM A;  2H7H A;  2JEE A;  1DX7 A;  5APQ A;  5AVV B;  4ZKU A;  3A3Y B;  3HD7 B;  3CLQ A;  3N4X A;  3UIA A;  2XDJ A;  3VMZ A;  4LGD E;  2N1T A;  4ZKP A;  3IFM A;  1QL1 A;  2Q7C A;  1DH3 A;  1IO4 A;  2XV5 A;  3P7K A;  5APV A;  5AVW B;  1A02 J;  1JTH B;  2I1K A;  2HFE D;  2WZ7 A;  4JYB A;  2XU6 A;  1JY3 N;  1FAV A;  1RF1 C;  3V5B A;  1CZQ A;  1SFC D;  1IFI A;  1JCC A;  1SFC C;  1SQX K;  1S9K D;  3H6P A;  3HTK B;  1EQ7 A;  2A45 G;  3NFQ A;  4WY4 A;  1NH4 A;  3U1A A;  3VMX A;  1N73 A;  5CCH D;  1T8Z A;  2XZR A;  2FXM A;  2YO3 A;  5CCH C;  2OYH C;  1HJB A;  1MV8 A;  1YYC A;  3IR9 A;  1GTW A;  5AW3 B;  1L4A A;  1ZR2 A;  3V2Q A;  2FFD B;  2QM7 A;  1KIL C;  1WRG A;  1JMM A;  3OA7 A;  2H43 A;  5APX A;  3CI9 A;  1GZL A;  1KIL A;  3MUD A;  3B5N A;  2R5D A;  5AW2 B;  2Q3I A;  2HG5 D;  4C7R A;  3E1I A;  1ZV8 A;  3H32 B;  1MFZ A;  3RK2 B;  1GU5 A;  1LTA C;  3M0A A;  1URQ A;  2GUS A;  4I1L A;  3A2A A;  2ZFC A;  4JF7 A;  2YO2 A;  3M9H A;  2A45 I;  5AW5 B;  2XKM A;  1KFN A;  1RF1 B;  1HWT C;  1FZE A;  1A02 F;  1PFI A;  1SFC B;  2W27 A;  3C9I A;  3KQG A;  3R2P A;  4C46 A;  3KDP B;  1JOC A;  1NKZ B;  2NPS D;  2OYH B;  2W6B A;  2NPS C;  4Y99 C;  3CL3 D;  5AW4 B;  1LWU A;  2O1J A;  3HE5 A;  2Z5H A;  2KB7 P;  1LTB C;  1KIL B;  4HH2 A;  3TSI A;  2C0X A;  3G3Z A;  4XE5 B;  5CCG D;  2Z5I A;  5CCG C;  1HGZ A;  1ZN5 A;  2WTY A;  3A5T A;  3VTP C;  1FOS E;  3HUS C;  4AYC A;  2C9N Y;  3L37 A;  4GKG A;  2Z4E A;  3BAS A;  3HUS A;  1T3J A;  4AUW A;  4M3L A;  4WB4 A;  1T3U A;  1HBW A;  4I6M C;  5APY A;  4DOJ A;  2KOG A;  2N1T D;  1N7S A;  5KTB A;  2N1T C;  4HYT B;  5BU8 B;  1IFN A;  4N6J A;  1XTG B;  4AQR D;  4LLH A;  2HPC A;  1LT9 A;  3N7N A;  3OJA B;  1L0N K;  1NTM K;  2O01 H;  3P8C E;  1W2E A;  1GL2 A;  2R3C A;  3RK2 C;  3RK2 D;  2YMY A;  3TNU A;  5AVU B;  3P32 A;  3NXS A;  2NPS B;  2ZXE B;  4Y99 B;  1S9K E;  5CHX A;  4OH8 B;  1WT6 A;  2IFM A;  4WY4 D;  4WY4 C;  2C9L Y;  1ZR4 A;  1J1E C;  1N73 C;  1G2C B;  1SVF A;  1KZU B;  1L4A D;  1GW4 A;  1L4A C;  1NO4 A;  1FZC A;  5AW9 B;  1GU4 A;  1CI6 B;  2IPP A;  2P7J A;  3HUS B;  1G1I A;  2M8R A;  2WT7 A;  2WPQ A;  3NTN A;  1HGV A;  1KIL D;  2FYZ A;  3V2N A;  1M1J A;  3B5N D;  3B5N C;  1GD2 E;  1FDM A;  2OAR A;  2WPS A;  3P8M C;  3MGN A;  3BRT B;  2OYI A;  2HPC B;  1GDT A;  4GIF A;  2N1T B;  3BAT A;  1URQ D;  2KP8 A;  1URQ C;  3MIW A;  3TNU B;  2YKQ A;  4C7N A;  3HRN A;  3L35 A;  2W6A A;  2FKW B;  4GT1 A;  2WSC H;  1E5W A;  1MUU A;  4XA4 A;  3M06 A;  2A45 H;  5AVQ B;  2KLV A;  3HE4 A;  4WY4 B;  1FZC B;  1H8A A;  1J1E B;  2BAS A;  1N73 B;  2WWW A;  2H8P D;  2WT7 B;  2VRS A;  1LWU C;  1L4A B;  3B8E B;  2CPB A;  5KJ7 A;  3M0D A;  1OWA A;  1X9V A;  1LGH B;  3VP8 A;  2J58 A;  2GUV A;  4EIJ A;  1FZF A;  1LTT C;  1QL2 A;  3OAK A;  1LTS C;  2CPS A;  5AW7 B;  3B5N B;  4IFD K;  5CJ0 A;  3WMM 0;  1IC2 A;  4JYC A;  4W7Y A;  3HD7 A;  2JJL A;  1RE3 A;  1SP4 A;  1HTL C;  1L0L K;  1SQQ K;  1URQ B;  1NHL A;  2Q5U A;  2WSE H;  4C7N B;  1H89 A;  3L36 A;  3SWF A;  1SQV K;  2HLO A;  3VYI A;  1N7S D;  3RL0 D;  1NWQ A;  1N7S C;  3RL0 C;  1JTH A;  2KSJ A;  2R32 A;  5APW A;  5AW1 B;  1FJP A;  2POH A;  3LID A;  5AVZ B;  3T97 A;  1NKN A;  5CMZ A;  3BVH A;  1LT9 C;  3NMD A;  5AW0 B;  1RF0 C;  1GL2 D;  1IFJ A;  1GL2 C;  3HTK A;  2IFN A;  1G1J A;  4EOT A;  1SQB K;  1M7L A;  1RF0 A;  4IFF A;  1LTI C;  1NU1 K;  4N78 D;  1LWU B;  5AVR B;  2E42 A;  3HE5 B;  1IK9 A;  2MJZ A;  5AVT B;  2GM4 A;  1LTJ A;  1NOH A;  2FFD A;  1NTK K;  3V2R A;  1RE4 A;  1IJD B;  1CSB A;  3BRV B;  1VDF A;  5KLV K;  1FZC C;  3VP9 A;  4N3Y B;  2P1J A;  1IFM A;  1FBM A;  2HOD A;  3KYQ A;  4O9B A;  1FOS F;  3V4W A;  1DEB A;  3VN0 A;  1M1J C;  3H32 A;  3P8C D;  2HYN A;  1HVV A;  3L4F A;  2OYI C;  1N86 A;  1J1D C;  1FZA A;  4RES B;  1N7S B;  3RL0 B;  3V2P A;  2QM8 A;  4W80 A;  1JY2 P;  3GHG C;  5BU5 A;  3PP5 A;  3U1C A;  1AFO A;  1JY2 O;  4W7Z A;  3LW5 H;  1YTZ I;  1RF1 A;  1LT9 B;  1YTZ T;  1N2D C;  2C0W A;  1FZG A;  3VMY A;  3M9B A;  1SFC A;  1GL2 B;  3SWY A;  2WIT A;  3GHG A;  1SLQ A;  2P2U A;  1JCD A;  1GK6 A;  3U59 A;  1LTJ B;  5AVS B;  1NAF A;  5CCH A;  2OYH A;  4I2L C;  3EFG A;  5AVX B;  1JNM A;  1VPC A;  3KPE A;  2O1K A;  2IX7 C;  3LIE A;  2P67 A;  4DZO A;  2Q9I A;  2HOD B;  5AVY B;  5APS A;  5CJ4 A;  1AQ5 A;  2FYU K;  3I5C A;  1NTZ K;  3RK3 D;  1KFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...