3A2AA

The structure of the carboxyl-terminal domain of the human voltage-gated proton channel hv1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
RQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role and structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Voltage-gated hydrogen channel 1
total genus 18
structure length 41
sequence length 41
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16799 VGPC1_C C-terminal membrane-localisation domain of ion-channel, VCN1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a2aA00
4DZOA 2R5BA 1GD2E 3M06A 3I5CA 2QM8A 3NMDA 1JNMA 3NFQA 2E43A 1SLQA 3LIDA 5APYA 2H7HA 4M3LA 2XV5A 1T2KC 3TNUA 1CI6A 1S9KE 2IPPA 3OAKA 1T2KD 4C46A 3TK1A 2N9BA 1MUUA 1SP4A 3HE5B 5CMZA 5APVA 2WT7B 2Q5UA 3HTKA 5APSA 4JYBA 2R5DA 3TYYA 5APWA 5APXA 3MGNA 5APTA 5AW3B 3M91A 3VMZA 3M0DA 3NXSA 3P8MC 3IR9A 5AW7B 3VMXA 1NWQA 2ZXEB 5AVSB 2WT7A 4RESB 2P67A 2ZFCA 5AW0B 3A3YB 1GK4A 2YO3A 1J2JB 1HUCA 5APUA 2Q7CA 4AYCA 5AVZB 2WTYA 1CSBA 3B8EB 2P2UA 1IO4A 2VRSA 2KP8A 2WPRA 1HBWA 2W6AA 1X8YA 5AW2B 3V4WA 1GTWA 4AUWA 2WPSA 2JJLA 3VN0A 3M0AA 2Z5HA 1OWAA 1NAFA 1FOSE 5APQA 4EOTA 1MV8A 3L36A 2BASA 4C7NB 2C9NY 5AW8B 3P32A 2XU6A 3T97A 2W27A 5AW5B 2C9LY 1KQLA 1A02F 3UIAA 5AVQB 3M9BA 5AVWB 2E42A 3A5TA 2P7JA 3L37A 2WWWA 2R32A 1HWTC 2YNYA 2WPQA 3VYIA 1H8AA 1CZQA 5AW4B 2QM7A 1GK6A 3KDPB 1S9KD 4B86A 3HE4A 4XE5B 3A7OA 4LC1A 1GU4A 4I6MC 5AVUB 3SWFA 1GU5A 1HJBA 3LIEA 3M9HA 2YO2A 5AW6B 3VTPC 3HE5A 3V5BA 5AVXB 3KQGA 5AVVB 2R3CA 5AVRB 4GT1A 1FOSF 1CI6B 1FAVA 3V4QA 1OXZA 3L35A 4I2LC 1GZLA 4KHXA 3HE4B 3A2AA 5AW1B 1A02J 4GKGA 3O8ZA 3VMYA 2Z5IA 1H89A 2XZRA 1H88A 4JYCA 4C7NA 1YYCA 3MD0A 1MFZA 2Q3IA 3NTNA 3TNUB 5AVYB 1JUNA 4HYTB 5AW9B 4AQRD 1DH3A 3P7KA 5AVTB 1G2CB
chains in the Genus database with same CATH superfamily
2LXBA 4DZOA 2HFED 5KLIB 4ASVA 3PH0A 2V4HA 1VQKP 1NGMB 3H1LG 3I5CA 2KS1B 1KFMA 2IFNA 1HF9A 1BCCD 1NTZD 1SLQA 1LP1B 3LIDA 1KQGB 2FY8A 3L72D 4M3LA 2ZVNB 1N7SC 2QEXP 1T2KC 2OYOA 3M0DC 1Q82Q 1PGPA 3AE9C 1FE6A 1BSNA 2D2CC 2NZ2A 2QJYB 2IYPA 3AEDC 3EFGA 1LWUC 5H2FH 3TK1A 2FYUE 2M5AA 1KB9E 3AE2C 3H1IJ 3L71E 1JY2P 1X79B 3O6QA 1LTAC 1IJDB 3HE5B 3H1KD 3L73D 3HTKA 1HJ0A 3L72J 1AFOA 1BGYG 3Q3DA 1LTIC 1AV1A 2FYNB 1OFCX 1AQTA 2K3RA 2W6JH 3MGNA 1VQNP 4GOFA 1P84E 3A0HH 1L4AD 1QX8A 1SQPJ 3GMAA 2QJKB 1LTSC 3M0DA 3P8MC 4PJ0H 2FYUG 3VMXA 1OW6A 1L0NJ 2QG4A 3VP8A 1BSHA 1AVYA 4RESB 1L2PA 1NTZK 2P67A 2RH0A 1NKNA 2FXPA 2JWAA 2QVAA 2YMYA 2ZFCA 3OA7A 2E76C 5AW0B 1GK4A 4KT0J 1ZR2A 2Q7CA 1HVVA 3F5HA 5AVZB 5GTHH 1YQ4C 2KXPB 2AXCA 1FZBA 1TU3F 3AEGC 1VQ7P 1SQPG 1YI2P 1SQXD 5B5EH 3H1IE 3L71J 1VF5B 2FYUJ 2KP8A 2WPRA 3H32A 1Y8AA 4BRYB 1HBWA 1FU1A 1NTMK 1IK7A 1KORA 1P84H 1RQVA 2KS1A 2WSEJ 4PD4H 5KAFH 3V4WA 2HG5D 1GTWA 1NO4A 1SQBD 3AE1C 2JJLA 2WVRA 1K8AQ 3P8CE 1JM0A 4R4MA 4R4LA 2O01H 3AE6C 1JY2N 1W2BO 1NYHA 2JEEA 1LT1A 1SQBK 2Y9YA 4D6TD 3MUDA 5DJTB 4EYYQ 5GTHE 1SFCD 3CCQP 3CPWO 3L36A 1OX3A 4C7NB 4EOTA 1L4AB 2C9NY 1IFDA 3D70A 5B66E 1DD4A 2W27A 5AW5B 2GM4A 1SQVD 3II6A 1M1JC 1JTHB 1EC5A 3ABVC 5C39A 4C7RA 4WY4C 2KYVA 1A02F 2C9LY 3PTZA 1GW3A 5AVQB 1L0NE 2WZ7A 3G4SP 4UB8E 1HH0A 4JQ0D 3MUDC 4L74A 1YIJP 4L73A 2WWWA 3IF4A 1NU1D 4TT3H 1KV4A 1PL5A 2Y0DA 1NOHA 2YNYA 3ZDMA 2QRXA 1VQ9P 2KIKA 1URQA 2H89C 5KTBA 3BVHA 3Q5PA 2M5AB 1USDA 3GHGB 1BGYJ 1S3JA 1WRGA 2Y0EA 1IC2A 1OIPA 2AXTH 3BRTB 3FXEA 1MFTA 4LC1A 4WY4A 1GU5A 4N3YB 1DX7A 3G9RA 1FZAA 4RJTA 4IL6X 1DEEG 3B5ND 2H43A 1HJBA 1ZR4A 1T6AA 3H1LE 5AW6B 3E1RA 1SQPK 5KJ7D 2IFMA 2OTLP 1BE3G 5CCGC 2A06E 3AE7C 1SQQE 2QSIA 4PD4D 2IBZE 4ASWA 4WWIA 4DT0A 5KKZC 1GW4A 5CCGD 5B5EE 2PAJA 1PV3A 1M90Q 4GT1A 1K05A 1AJYA 2KK7A 3HE5A 1ZRTE 3SSUA 3H1JG 4I2LC 5AVTB 5KAFE 3L71G 1OW7A 1N7LA 2WPVB 2IBZI 3A2AA 1JUNA 3AE5C 1NTMJ 2Q1KA 3PHLA 3JCUE 3SFDC 3OW2O 3GG2A 5BU5A 3T97B 3VMYA 1J1EC 3CCJP 1JY3O 2ZXXA 2J58A 2E74C 1P84D 4ZMDA 1YYCA 3FXDA 3RK2B 2UWJE 1AVOA 2E75C 2K9JB 4L75A 1PP9D 1S2EA 1U7MA 2FKWB 3IN6A 1W5CE 3KZIE 3QWOC 3S4RA 2E75D 1K73Q 4AQRD 2A06D 4LLHA 1JO5A 1RF0C 1G2CB 1URQD 3FWLA 1OMIA 1PFIA 4WY4D 2E74B 2NPSD 1KILE 3CI9A 3M06A 3RK2D 1PP9J 1XTCC 2JKVA 2QE7H 1JY2O 1IZNB 2A45H 3H32B 3NFQA 4DCKA 1NJIQ 4RO0A 2KI7B 3CWBE 2QJPB 1VQMP 2V7QJ 1S9KE 5CCGA 3OAKA 1N7SD 2CPSA 2PGDA 1T2KD 1CW5A 2OARA 4W7YA 1NTMD 1L0LD 4RKUJ 4W7ZA 1N73B 2P58A 2W83C 3BCCJ 1MUUA 1Y47A 5CMZA 1R8EA 3L70E 5APVA 3SWYA 1FJKA 2GUSA 4JYBA 5KJ7C 2JP3A 2ZT9B 5DJUB 3B71A 1LTJC 5APTA 5AW3B 3L70D 2WSEH 1SS1A 2YXQB 3M91A 3NXSA 5H2FE 1LTJB 3CXHH 4YXDC 2SPZA 1RF1A 1ZLLA 1IFPA 1JCDA 5EFWB 5AW7B 3USSA 5AVSB 2WT7A 1FZCB 1MZ9A 5KAIE 4OVNF 2HODA 5B66H 1KQFB 2H8PD 1ZN5A 3G3ZA 1S1CX 2XKMA 1LGHB 3A3YB 3C8VA 5APUA 1Q81Q 2B88A 2OYIA 1EXIA 2OYHC 4GODA 3CCEP 3CD6P 1SVFA 2LXCB 3H1JJ 2WTYA 3B8EB 1Y9BA 5K5GB 1IO4A 2IBZD 1IFNA 2K37A 1SQQK 1LT9C 2W6AA 1BGYE 4N78E 2O3JA 1X8YA 3R4YA 2HR3A 2L91A 1JMBA 4H13C 5AW2B 2A45I 3AE4C 4AUWA 2WPSA 2A45G 3BCCD 3KXDA 1M1JA 3H6PA 3VN0A 4Y99C 3G6EP 2WSFJ 4NPFX 2IX7C 3TGUG 4IFDK 1X0TA 2AXTE 2K9JA 3TDKA 5KLVE 3WUUA 4PV1B 3CXHI 1NHLA 1NAYA 2BCCD 5E79E 1Q7YQ 3Q1MA 1QVGO 1RE3C 2XU6A 4BWNA 4H13D 2JDIH 1OW8A 2LKMA 4H0LB 1PPJE 2MKVA 1Q86Q 1S5LE 1PGJA 5AVWB 1YQ3C 1SQBJ 1VF5C 4HJGH 3RK3D 5BVZA 1L0ND 3CX5I 3TGUE 2E42A 3CCUP 1VF5D 2R32A 1ZOYC 2JO1A 2AEJA 3CXHD 1L0NK 1EDLA 3TGUD 2FYUD 3VYIA 1BE3J 4U3FD 1H8AA 2ZYAA 3VOPA 2YKOA 2WSFH 3CX5E 2XNDH 2QM7A 4IL6E 4BXLA 1X22A 4HKZH 3Q2YA 1S9KD 1YJWP 3A7OA 3U1AA 1GU4A 3SWFA 1FOSE 1LNQA 3C9IA 1BE3D 1L4AC 1ZW0A 4U3FJ 1NH4A 1QGKB 1SQBE 1E79H 3TGUJ 2OTJP 5KLVD 3M9HA 4GOEA 2I1KA 1NTMG 3GHGA 3V5BA 1N73A 1JCCA 2O01J 3O6QB 1ZV8A 1N7SA 4PD4E 1QLED 4A7PA 3LW5J 4I7ZB 1OVRA 1DD3A 2RMZA 3B4SA 1BDCA 4MN4C 1SQBG 1CI6B 1MKMA 4U3FG 3V2PA 3WU2E 2D2CB 3V4QA 1SQXE 3L35A 3H1HE 4KHXA 1L0LK 3IAOA 1IFMA 3L70G 3CCVP 2N1TC 3B5NB 3L72E 2Q3EA 4GKGA 5CCHA 3O8ZA 3SFEC 3Q5SA 1PP9G 1H88A 4I7ZC 4PV1C 1ZXGA 4EIJA 1G2CA 1SFCC 2C0XA 1NTKE 1URQC 2P1JA 2WMMA 2OQQA 3JC22 3LW5H 2Y9ZA 1SQVG 2O01N 3H1JE 3NTNA 2FFDA 1KZUB 2J59M 1G1IA 1GL2B 1OVVA 2ZYGA 1N86A 2M3BA 2G3AA 5KLVK 2YIUB 1YJ9P 5CJ4A 4Z1MH 2NPSC 3H1JD 2FYNC 2R5BA 1LT9B 3BCCG 3MHVA 2YMKA 1NTKG 2QM8A 3AEFC 2OYHA 2I8DA 3E1IA 3NMDA 3AE8C 3N4XA 2E43A 2L5GB 2KUBA 1RHZB 3PP5A 1S4XA 3D6ZA 1FDMA 1VQ5P 3AEBC 2GA1A 3EFFK 3GF7A 1PZQA 1WMKA 3H1HD 4C46A 3L70J 2HODB 1PIXA 3BCCE 3HRNA 2I1JA 1NTZE 2E5TA 3N7NA 2M8RA 1HGVA 2Q5UA 4JBZA 4NPDA 1FZCC 1FBMA 3TYYA 2POHA 4UB6E 1IFIA 3V2NA 5APWA 5APXA 2FBWC 3CWBJ 4DJGA 2OYIC 5L8RJ 3IFMA 1U57A 2ZYDA 3H1LD 3VMZA 5TISH 3L71D 3CCLP 4IFMA 1M8OB 1L0LG 1U7JA 2ZXEB 1NWQA 1VQPP 1M57D 1FC2C 4TLFA 3PRJA 4D6TE 1SQVK 3H25A 4H13B 1LWUB 4AYCA 2LR2A 4K35A 5TJHA 2KZJA 3M9QA 4L76A 2Q9IA 1EZVE 1Z56A 5KKZB 1CSBA 2FFDB 1R5LA 4WY4B 1EQ7A 3HD7A 4OGQB 3RL0D 2VRSA 1JB0J 1L0LJ 1NU1K 1PGOA 2E5YA 1JTHA 2K9YA 2JWDA 3AEAC 1BDDA 2H88C 2N1TA 2NRGA 1SFCA 3L75G 5TISE 5GTIE 3H1KE 3L73E 1L4AA 1YTZI 2WSCJ 4H44C 3V2QA 3CCMP 1YHQP 2YIUC 3H1KJ 3L73J 5KLIC 1GMJA 1NTZG 3HD7B 1GL2C 4NPEA 1L0LE 2BCCE 3CWBG 1D7MA 1LTBC 1KB9H 1LP1A 1RF0A 3PLNA 2E74D 3R2PA 5APQA 1MV8A 2ZJSE 2DW3A 3RK2C 3ITKA 1JY3P 1SQPD 2N1TB 3T97A 3FGAD 1RE4A 1BCCJ 4BRYA 1QL2A 3SWKA 1RH5B 3W67A 3A5TA 1GL2A 2P7JA 1S5LX 2Y0CA 3GF3A 3RK3C 1ZMEC 3H1ID 1RE3A 5CBOA 3BASA 4I1LA 3S1KA 3RBZA 1KFNA 2V7QH 3C1LA 1CZQA 3RL0g 3V2RA 2QJKC 1YTZT 1KN7A 1KILC 1GK6A 1NTZJ 4I6MC 5AVUB 2W8ZA 2AEMA 2RKLA 1YITP 1N8RQ 2CPBA 1N2DC 2IYOA 3LIEA 1SQXG 2FXOA 3PJSK 3VTPC 3L74E 2OTKE 3KHUA 1JMMA 3JSVC 1AA0A 1NU1G 3CLQA 1T8ZA 3KPEA 1KYOH 5AVVB 5AVXB 2O1JA 3D71A 2Z4EA 3CC4P 2R3CA 2YKQA 5M1BA 1SQVJ 4KJMA 1FOSF 1JY3N 1FAVA 3FWNA 4K3AA 3A0HE 1NKZB 4DOJA 2KB7P 1OXZA 4HH2A 1GZLA 4PJ0E 3HE4B 2IZ1A 3CC2P 1KC8Q 4EI2A 1K9MQ 1BE3E 1EZVI 2OGUA 3L75J 3CWBD 2PFXA 1LT9A 1NU1J 2GUVA 2FYUK 2Z5IA 2XZRA 1NTKJ 4WBAA 4D6TG 3CCSP 3FX0A 3B5NA 4C7NA 3I55P 4Y28J 1KYOI 3Q5RA 3MD0A 2NPSB 2KLUA 4H0LD 1IFJA 3VP9A 3CXHE 2HPCA 2PRRA 2QIWA 5AVYB 1G1JA 3L75D 3G71P 1AQ5A 3H1HJ 1VPCA 1SQXJ 5AVRB 1DH3A 1QVFO 1A02J 3KYQA 5KAIH 3RK3E 3BATA 4LGDE 4OGQD 1SFCB 1GD2E 4ZNCA 1M7LA 2XNXA 4EDFA 3RK3B 2KLVA 4XFJA 1JNMA 2QJPC 3L74G 1SQPE 2WSSH 3B5NC 4GIFA 3CMAP 5APYA 3QH9A 1LTJA 2H7HA 2XV5A 4ZKPA 1SQXK 3TNUA 1CI6A 1UIIA 1RF1C 1H0TB 3S9OA 2IPPA 1HGZA 3HUSA 3CX5D 3CC7P 1WT6A 1DIPA 1QEXA 2FXMA 4U3FE 1X9VA 1FZEA 1JOCA 2E76B 3VMAA 2YXRB 2N9BA 1KILA 2Q6QA 1LTTC 1KD1Q 1SP4A 1NU1E 2HLOA 3EWKA 2WT7B 2KNCA 2B9BA 3L75E 2R5DA 5APSA 5CCHC 4N78D 3I56P 4IFFA 1FZFA 4ZKUA 3F89A 5BU8B 2IDBA 3JCUH 2B87B 1DEBA 3MZWB 1EZVG 4XA4A 3WU2H 1KB9I 1PPJG 3D6YA 3H1HG 1SQVE 1OVUA 2W90A 2YKPA 3HTKB 3IR9A 4UB6H 1N73C 4Y99B 1S5LH 3V6IA 4CPGA 4YXWH 3A0BE 4QMAA 1FS0E 2BEZF 1URQB 1YJNP 2BEQD 1LTGC 3AE3C 2ITAA 3H1KG 3L73G 1KYOD 3KZIH 2N1TD 2YO3A 3L74J 1J2JB 1HUCA 2WITA 2QJYC 2QA4P 1VQLP 1YBKA 3CX5H 4YPCA 4YTPC 1EDKA 2HPCB 4GDOA 3CL3D 2C0WA 2P2UA 5KLVJ 2KNCB 2WQYC 2A06G 4N6JA 4IL6H 3CMEP 4WVZA 1BCCG 1RY3A 2K1AA 2ZT9D 4H0LC 4OH8B 4U7JA 3RBXA 3WUVA 5CHXA 3U1CA 3RL0C 1RE4C 1OZHA 3E7KA 3L74D 3TF5A 4JPZB 3M0AA 1VQ8P 1LJ2A 2Z5HA 3GHGC 3RL0B 1KQSO 1OWAA 2E76D 1NAFA 2O1KA 1SQQG 5CJ0A 4H44B 1W2EA 3W68A 1KMIZ 1H0TA 1J1DB 2BASA 3HD7C 5AW8B 3P32A 3K5BA 1BCCE 2IZ0A 2KZIA 3U59A 2FYZA 3HD7D 2CK3H 1S72P 1FZGA 1FJPA 4OGQC 1VQ6P 1KQLA 1Q90D 1ZRTD 2KOGA 1VL2A 3UIAA 4W80A 3M9BA 1IK9A 3RGUA 3WUTA 1BGYD 2KSJA 3L37A 2W6BA 3EQ2A 1M1JB 2BCCJ 4JF7A 4WB4A 1SQQD 1KB9D 1PPJD 2RN0A 2R3SA 3AECC 1EZVD 1HWTC 3HUSC 1N7SB 2WPQA 1NTME 2G8YA 1EXJA 1KTMA 1FZCA 2ZAEB 1T3JA 3H1IG 3MTUE 5AW4B 2D2CD 3KDPB 4IOIH 1EDIA 3L72G 4B86A 1XTGB 1ZP0C 2ZVOB 3HE4A 4XE5B 4O9BA 1T3UA 1VQ4P 3A0BH 1J1EB 4OWFA 2YO2A 2KSEA 1SQQJ 2JR8A 2OYIB 1EDJA 1KILD 5CCHD 2ZT9C 3P8CD 2E75B 3MIWA 1P84I 1KILB 1FDOA 1L0NG 2K88A 3GLMA 1QL1A 3H1LJ 2AEFA 2P10A 3KQGA 1USEA 5E79H 3TSIA 5GTIH 1PP9E 4UB8H 1GDTA 1UIXA 1JEKA 2WSCH 3HUSB 1RF1B 5CBNA 2M0BA 2B87A 2R44A 3CCRP 1KYOE 4D6TJ 1NTKD 3BRVB 1RQUA 2BCCG 3OJAB 1M1KQ 5KLVG 1VQOP 2NPSA 2FFDC 2XDJA 1GL2D 3AEEC 5AW1B 4PD4I 1VDFA 1E5WA 3WMM0 1PGQA 1NTKK 1FDIA 4PV1D 5KJ7A 4H44D 1H89A 2OYHB 2J5UA 4JYCA 1K04A 2MJZA 1NVOA 1Q2NA 4HB1A 1HTLC 1MFZA 1J1DC 2Q3IA 2M3EA 3TNUB 2HYNA 1M56D 3L4FA 3MP7B 1R5SA 2N9YB 2PP6A 2IBZG 3GW6A 1LWUA 3P7KA 4HYTB 2B89A 5AW9B
chains in the Genus database with same CATH topology
4DZOA 2HFED 3I5CA 1KFMA 2IFNA 1SLQA 3LIDA 4M3LA 1N7SC 1T2KC 3M0DC 3EFGA 1LWUC 3TK1A 1JY2P 1X79B 1LTAC 1IJDB 3HE5B 3HTKA 1AFOA 1LTIC 3MGNA 3M0DA 1L4AD 3P8MC 1LTSC 3VMXA 3VP8A 4RESB 1NTZK 2P67A 2ZFCA 1NKNA 2YMYA 1ZR2A 3OA7A 5AW0B 1GK4A 2Q7CA 1HVVA 5AVZB 1FZBA 3H32A 2KP8A 2WPRA 1HBWA 1FU1A 1NTMK 3V4WA 2HG5D 1GTWA 1NO4A 2JJLA 3P8CE 2O01H 1JY2N 2JEEA 1SQBK 3MUDA 4EOTA 1SFCD 3L36A 4C7NB 2C9NY 1L4AB 1IFDA 2W27A 5AW5B 2GM4A 3II6A 1M1JC 1JTHB 4C7RA 4WY4C 2KYVA 1A02F 2C9LY 1GW3A 5AVQB 2WZ7A 1HH0A 2WWWA 1NOHA 2YNYA 1URQA 5KTBA 3BVHA 3GHGB 1WRGA 1IC2A 3BRTB 4WY4A 4LC1A 1GU5A 4N3YB 1DX7A 1FZAA 3B5ND 2H43A 1HJBA 1ZR4A 5AW6B 1SQPK 5KJ7D 2IFMA 5CCGC 1GW4A 5CCGD 2PAJA 4GT1A 4I2LC 1N7LA 3A2AA 5BU5A 3VMYA 1J1EC 1JY3O 2J58A 1YYCA 3RK2B 2FKWB 1JUNA 4AQRD 1JO5A 4LLHA 1RF0C 1G2CB 1URQD 1PFIA 4WY4D 3CI9A 2NPSD 3M06A 3RK2D 1XTCC 1JY2O 2A45H 3H32B 3NFQA 1S9KE 5CCGA 3OAKA 1N7SD 2CPSA 1T2KD 1CW5A 2OARA 4W7YA 4W7ZA 1N73B 1MUUA 5CMZA 5APVA 3SWYA 1FJKA 2GUSA 4JYBA 5KJ7C 1LTJC 5APTA 5AW3B 3M91A 2WSEH 3NXSA 1RF1A 1LTJB 1ZLLA 1JCDA 5AW7B 5AVSB 2WT7A 1FZCB 1MZ9A 2HODA 2H8PD 3G3ZA 1ZN5A 3A3YB 2XKMA 1LGHB 5APUA 2OYIA 2OYHC 1SVFA 2WTYA 3B8EB 1IO4A 1IFNA 1SQQK 1LT9C 2W6AA 4N78E 1X8YA 5AW2B 2A45I 4AUWA 2WPSA 2A45G 1M1JA 3H6PA 3VN0A 4Y99C 2IX7C 4IFDK 1NHLA 1RE3C 2XU6A 2LKMA 5AVWB 3RK3D 5BVZA 2E42A 2R32A 1L0NK 3VYIA 1H8AA 3VOPA 2YKOA 2WSFH 2QM7A 1S9KD 1GU4A 1FOSE 3A7OA 3U1AA 3SWFA 3C9IA 1L4AC 1NH4A 3M9HA 2I1KA 3GHGA 3V5BA 1N73A 1JCCA 1ZV8A 1N7SA 1CI6B 3V2PA 3V4QA 3L35A 4KHXA 1L0LK 1IFMA 2N1TC 3B5NB 4GKGA 5CCHA 3O8ZA 1H88A 4EIJA 1G2CA 1SFCC 2C0XA 2P1JA 1URQC 3LW5H 3NTNA 2FFDA 1KZUB 2J59M 1G1IA 1GL2B 5KLVK 1N86A 2M3BA 5CJ4A 2NPSC 2R5BA 1LT9B 2QM8A 2OYHA 3NMDA 3E1IA 2E43A 3N4XA 2L5GB 3PP5A 4C46A 2HODB 3HRNA 2I1JA 3N7NA 2M8RA 1HGVA 2Q5UA 1FZCC 1FBMA 3TYYA 2POHA 1IFIA 3V2NA 5APWA 5APXA 2OYIC 3IFMA 3VMZA 4IFMA 1NWQA 2ZXEB 1SQVK 1LWUB 4AYCA 3M9QA 2Q9IA 1Z56A 1CSBA 2FFDB 4WY4B 1EQ7A 3HD7A 3RL0D 2VRSA 1NU1K 1FDMA 1JTHA 2N1TA 1SFCA 1L4AA 1YTZI 3V2QA 3HD7B 1GL2C 1LTBC 1RF0A 3R2PA 5APQA 1MV8A 3RK2C 1JY3P 3T97A 2N1TB 1RE4A 1QL2A 3A5TA 1GL2A 2P7JA 3RK3C 1RE3A 3BASA 4I1LA 1KFNA 1CZQA 3V2RA 1YTZT 1KILC 1GK6A 4I6MC 5AVUB 2CPBA 1N2DC 3LIEA 3VTPC 1JMMA 5AVXB 3CLQA 1T8ZA 3KPEA 5AVVB 2Z4EA 2O1JA 2R3CA 2YKQA 1FOSF 1JY3N 1FAVA 4DOJA 1NKZB 2KB7P 1OXZA 4HH2A 1GZLA 3HE4B 1LT9A 2GUVA 2FYUK 2Z5IA 2XZRA 4WBAA 4C7NA 3B5NA 3MD0A 2NPSB 1IFJA 3VP9A 2HPCA 5AVYB 1G1JA 1AQ5A 1VPCA 1DH3A 5AVRB 3KYQA 3BATA 4LGDE 1GD2E 1SFCB 1M7LA 2XNXA 3RK3B 2KLVA 1JNMA 4GIFA 3B5NC 5APYA 2H7HA 1LTJA 2XV5A 4ZKPA 1SQXK 3TNUA 1CI6A 1RF1C 2IPPA 1HGZA 3HUSA 1WT6A 2FXMA 1X9VA 1FZEA 1JOCA 2N9BA 1KILA 1LTTC 1SP4A 2HLOA 2WT7B 5APSA 5CCHC 2R5DA 4N78D 4IFFA 1FZFA 4ZKUA 5BU8B 1DEBA 4XA4A 2YKPA 3HTKB 3IR9A 1N73C 4Y99B 1URQB 1LTGC 2N1TD 2YO3A 1J2JB 1HUCA 2WITA 2HPCB 3CL3D 2C0WA 2P2UA 4N6JA 1RY3A 3U1CA 4OH8B 5CHXA 3RL0C 1RE4C 3M0AA 2Z5HA 3GHGC 3RL0B 1OWAA 1NAFA 2O1KA 5CJ0A 1W2EA 1J1DB 2BASA 3HD7C 5AW8B 3P32A 3U59A 1FJPA 2FYZA 3HD7D 1FZGA 1KQLA 2KOGA 3UIAA 4W80A 3M9BA 1IK9A 2KSJA 3L37A 2W6BA 3EQ2A 1M1JB 4JF7A 4WB4A 1HWTC 3HUSC 1N7SB 2WPQA 1FZCA 1T3JA 3MTUE 5AW4B 3KDPB 4B86A 1XTGB 3HE4A 4XE5B 4O9BA 1T3UA 1J1EB 2OYIB 2YO2A 1KILD 5CCHD 3P8CD 3MIWA 3HE5A 1KILB 1QL1A 3KQGA 3TSIA 1GDTA 2WSCH 1RF1B 3HUSB 3BRVB 3OJAB 2NPSA 2FFDC 2XDJA 1GL2D 5AW1B 3WMM0 1A02J 1VDFA 1E5WA 5KJ7A 1NTKK 2OYHB 1H89A 4JYCA 2MJZA 1HTLC 1MFZA 1J1DC 2Q3IA 3TNUB 2HYNA 3L4FA 4HYTB 5AW9B 2PP6A 1LWUA 3P7KA 5AVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZO A;  2R5B A;  1GD2 E;  3M06 A;  3I5C A;  2QM8 A;  3NMD A;  1JNM A;  3NFQ A;  2E43 A;  1SLQ A;  3LID A;  5APY A;  2H7H A;  4M3L A;  2XV5 A;  1T2K C;  3TNU A;  1CI6 A;  1S9K E;  2IPP A;  3OAK A;  1T2K D;  4C46 A;  3TK1 A;  2N9B A;  1MUU A;  1SP4 A;  3HE5 B;  5CMZ A;  5APV A;  2WT7 B;  2Q5U A;  3HTK A;  5APS A;  4JYB A;  2R5D A;  3TYY A;  5APW A;  5APX A;  3MGN A;  5APT A;  5AW3 B;  3M91 A;  3VMZ A;  3M0D A;  3NXS A;  3P8M C;  3IR9 A;  5AW7 B;  3VMX A;  1NWQ A;  2ZXE B;  5AVS B;  2WT7 A;  4RES B;  2P67 A;  2ZFC A;  5AW0 B;  3A3Y B;  1GK4 A;  2YO3 A;  1J2J B;  1HUC A;  5APU A;  2Q7C A;  4AYC A;  5AVZ B;  2WTY A;  1CSB A;  3B8E B;  2P2U A;  1IO4 A;  2VRS A;  2KP8 A;  2WPR A;  1HBW A;  2W6A A;  1X8Y A;  5AW2 B;  3V4W A;  1GTW A;  4AUW A;  2WPS A;  2JJL A;  3VN0 A;  3M0A A;  2Z5H A;  1OWA A;  1NAF A;  1FOS E;  5APQ A;  4EOT A;  1MV8 A;  3L36 A;  2BAS A;  4C7N B;  2C9N Y;  5AW8 B;  3P32 A;  2XU6 A;  3T97 A;  2W27 A;  5AW5 B;  2C9L Y;  1KQL A;  1A02 F;  3UIA A;  5AVQ B;  3M9B A;  5AVW B;  2E42 A;  3A5T A;  2P7J A;  3L37 A;  2WWW A;  2R32 A;  1HWT C;  2YNY A;  2WPQ A;  3VYI A;  1H8A A;  1CZQ A;  5AW4 B;  2QM7 A;  1GK6 A;  3KDP B;  1S9K D;  4B86 A;  3HE4 A;  4XE5 B;  3A7O A;  4LC1 A;  1GU4 A;  4I6M C;  5AVU B;  3SWF A;  1GU5 A;  1HJB A;  3LIE A;  3M9H A;  2YO2 A;  5AW6 B;  3VTP C;  3HE5 A;  3V5B A;  5AVX B;  3KQG A;  5AVV B;  2R3C A;  5AVR B;  4GT1 A;  1FOS F;  1CI6 B;  1FAV A;  3V4Q A;  1OXZ A;  3L35 A;  4I2L C;  1GZL A;  4KHX A;  3HE4 B;  3A2A A;  5AW1 B;  1A02 J;  4GKG A;  3O8Z A;  3VMY A;  2Z5I A;  1H89 A;  2XZR A;  1H88 A;  4JYC A;  4C7N A;  1YYC A;  3MD0 A;  1MFZ A;  2Q3I A;  3NTN A;  3TNU B;  5AVY B;  1JUN A;  4HYT B;  5AW9 B;  4AQR D;  1DH3 A;  3P7K A;  5AVT B;  1G2C B; 
#chains in the Genus database with same CATH topology
 2LXB A;  4DZO A;  2HFE D;  5KLI B;  4ASV A;  3PH0 A;  2V4H A;  1VQK P;  1NGM B;  3H1L G;  3I5C A;  2KS1 B;  1KFM A;  2IFN A;  1HF9 A;  1BCC D;  1NTZ D;  1SLQ A;  1LP1 B;  3LID A;  1KQG B;  2FY8 A;  3L72 D;  4M3L A;  2ZVN B;  1N7S C;  2QEX P;  1T2K C;  2OYO A;  3M0D C;  1Q82 Q;  1PGP A;  3AE9 C;  1FE6 A;  1BSN A;  2D2C C;  2NZ2 A;  2QJY B;  2IYP A;  3AED C;  3EFG A;  1LWU C;  5H2F H;  3TK1 A;  2FYU E;  2M5A A;  1KB9 E;  3AE2 C;  3H1I J;  3L71 E;  1JY2 P;  1X79 B;  3O6Q A;  1LTA C;  1IJD B;  3HE5 B;  3H1K D;  3L73 D;  3HTK A;  1HJ0 A;  3L72 J;  1AFO A;  1BGY G;  3Q3D A;  1LTI C;  1AV1 A;  2FYN B;  1OFC X;  1AQT A;  2K3R A;  2W6J H;  3MGN A;  1VQN P;  4GOF A;  1P84 E;  3A0H H;  1L4A D;  1QX8 A;  1SQP J;  3GMA A;  2QJK B;  1LTS C;  3M0D A;  3P8M C;  4PJ0 H;  2FYU G;  3VMX A;  1OW6 A;  1L0N J;  2QG4 A;  3VP8 A;  1BSH A;  1AVY A;  4RES B;  1L2P A;  1NTZ K;  2P67 A;  2RH0 A;  1NKN A;  2FXP A;  2JWA A;  2QVA A;  2YMY A;  2ZFC A;  3OA7 A;  2E76 C;  5AW0 B;  1GK4 A;  4KT0 J;  1ZR2 A;  2Q7C A;  1HVV A;  3F5H A;  5AVZ B;  5GTH H;  1YQ4 C;  2KXP B;  2AXC A;  1FZB A;  1TU3 F;  3AEG C;  1VQ7 P;  1SQP G;  1YI2 P;  1SQX D;  5B5E H;  3H1I E;  3L71 J;  1VF5 B;  2FYU J;  2KP8 A;  2WPR A;  3H32 A;  1Y8A A;  4BRY B;  1HBW A;  1FU1 A;  1NTM K;  1IK7 A;  1KOR A;  1P84 H;  1RQV A;  2KS1 A;  2WSE J;  4PD4 H;  5KAF H;  3V4W A;  2HG5 D;  1GTW A;  1NO4 A;  1SQB D;  3AE1 C;  2JJL A;  2WVR A;  1K8A Q;  3P8C E;  1JM0 A;  4R4M A;  4R4L A;  2O01 H;  3AE6 C;  1JY2 N;  1W2B O;  1NYH A;  2JEE A;  1LT1 A;  1SQB K;  2Y9Y A;  4D6T D;  3MUD A;  5DJT B;  4EYY Q;  5GTH E;  1SFC D;  3CCQ P;  3CPW O;  3L36 A;  1OX3 A;  4C7N B;  4EOT A;  1L4A B;  2C9N Y;  1IFD A;  3D70 A;  5B66 E;  1DD4 A;  2W27 A;  5AW5 B;  2GM4 A;  1SQV D;  3II6 A;  1M1J C;  1JTH B;  1EC5 A;  3ABV C;  5C39 A;  4C7R A;  4WY4 C;  2KYV A;  1A02 F;  2C9L Y;  3PTZ A;  1GW3 A;  5AVQ B;  1L0N E;  2WZ7 A;  3G4S P;  4UB8 E;  1HH0 A;  4JQ0 D;  3MUD C;  4L74 A;  1YIJ P;  4L73 A;  2WWW A;  3IF4 A;  1NU1 D;  4TT3 H;  1KV4 A;  1PL5 A;  2Y0D A;  1NOH A;  2YNY A;  3ZDM A;  2QRX A;  1VQ9 P;  2KIK A;  1URQ A;  2H89 C;  5KTB A;  3BVH A;  3Q5P A;  2M5A B;  1USD A;  3GHG B;  1BGY J;  1S3J A;  1WRG A;  2Y0E A;  1IC2 A;  1OIP A;  2AXT H;  3BRT B;  3FXE A;  1MFT A;  4LC1 A;  4WY4 A;  1GU5 A;  4N3Y B;  1DX7 A;  3G9R A;  1FZA A;  4RJT A;  4IL6 X;  1DEE G;  3B5N D;  2H43 A;  1HJB A;  1ZR4 A;  1T6A A;  3H1L E;  5AW6 B;  3E1R A;  1SQP K;  5KJ7 D;  2IFM A;  2OTL P;  1BE3 G;  5CCG C;  2A06 E;  3AE7 C;  1SQQ E;  2QSI A;  4PD4 D;  2IBZ E;  4ASW A;  4WWI A;  4DT0 A;  5KKZ C;  1GW4 A;  5CCG D;  5B5E E;  2PAJ A;  1PV3 A;  1M90 Q;  4GT1 A;  1K05 A;  1AJY A;  2KK7 A;  3HE5 A;  1ZRT E;  3SSU A;  3H1J G;  4I2L C;  5AVT B;  5KAF E;  3L71 G;  1OW7 A;  1N7L A;  2WPV B;  2IBZ I;  3A2A A;  1JUN A;  3AE5 C;  1NTM J;  2Q1K A;  3PHL A;  3JCU E;  3SFD C;  3OW2 O;  3GG2 A;  5BU5 A;  3T97 B;  3VMY A;  1J1E C;  3CCJ P;  1JY3 O;  2ZXX A;  2J58 A;  2E74 C;  1P84 D;  4ZMD A;  1YYC A;  3FXD A;  3RK2 B;  2UWJ E;  1AVO A;  2E75 C;  2K9J B;  4L75 A;  1PP9 D;  1S2E A;  1U7M A;  2FKW B;  3IN6 A;  1W5C E;  3KZI E;  3QWO C;  3S4R A;  2E75 D;  1K73 Q;  4AQR D;  2A06 D;  4LLH A;  1JO5 A;  1RF0 C;  1G2C B;  1URQ D;  3FWL A;  1OMI A;  1PFI A;  4WY4 D;  2E74 B;  2NPS D;  1KIL E;  3CI9 A;  3M06 A;  3RK2 D;  1PP9 J;  1XTC C;  2JKV A;  2QE7 H;  1JY2 O;  1IZN B;  2A45 H;  3H32 B;  3NFQ A;  4DCK A;  1NJI Q;  4RO0 A;  2KI7 B;  3CWB E;  2QJP B;  1VQM P;  2V7Q J;  1S9K E;  5CCG A;  3OAK A;  1N7S D;  2CPS A;  2PGD A;  1T2K D;  1CW5 A;  2OAR A;  4W7Y A;  1NTM D;  1L0L D;  4RKU J;  4W7Z A;  1N73 B;  2P58 A;  2W83 C;  3BCC J;  1MUU A;  1Y47 A;  5CMZ A;  1R8E A;  3L70 E;  5APV A;  3SWY A;  1FJK A;  2GUS A;  4JYB A;  5KJ7 C;  2JP3 A;  2ZT9 B;  5DJU B;  3B71 A;  1LTJ C;  5APT A;  5AW3 B;  3L70 D;  2WSE H;  1SS1 A;  2YXQ B;  3M91 A;  3NXS A;  5H2F E;  1LTJ B;  3CXH H;  4YXD C;  2SPZ A;  1RF1 A;  1ZLL A;  1IFP A;  1JCD A;  5EFW B;  5AW7 B;  3USS A;  5AVS B;  2WT7 A;  1FZC B;  1MZ9 A;  5KAI E;  4OVN F;  2HOD A;  5B66 H;  1KQF B;  2H8P D;  1ZN5 A;  3G3Z A;  1S1C X;  2XKM A;  1LGH B;  3A3Y B;  3C8V A;  5APU A;  1Q81 Q;  2B88 A;  2OYI A;  1EXI A;  2OYH C;  4GOD A;  3CCE P;  3CD6 P;  1SVF A;  2LXC B;  3H1J J;  2WTY A;  3B8E B;  1Y9B A;  5K5G B;  1IO4 A;  2IBZ D;  1IFN A;  2K37 A;  1SQQ K;  1LT9 C;  2W6A A;  1BGY E;  4N78 E;  2O3J A;  1X8Y A;  3R4Y A;  2HR3 A;  2L91 A;  1JMB A;  4H13 C;  5AW2 B;  2A45 I;  3AE4 C;  4AUW A;  2WPS A;  2A45 G;  3BCC D;  3KXD A;  1M1J A;  3H6P A;  3VN0 A;  4Y99 C;  3G6E P;  2WSF J;  4NPF X;  2IX7 C;  3TGU G;  4IFD K;  1X0T A;  2AXT E;  2K9J A;  3TDK A;  5KLV E;  3WUU A;  4PV1 B;  3CXH I;  1NHL A;  1NAY A;  2BCC D;  5E79 E;  1Q7Y Q;  3Q1M A;  1QVG O;  1RE3 C;  2XU6 A;  4BWN A;  4H13 D;  2JDI H;  1OW8 A;  2LKM A;  4H0L B;  1PPJ E;  2MKV A;  1Q86 Q;  1S5L E;  1PGJ A;  5AVW B;  1YQ3 C;  1SQB J;  1VF5 C;  4HJG H;  3RK3 D;  5BVZ A;  1L0N D;  3CX5 I;  3TGU E;  2E42 A;  3CCU P;  1VF5 D;  2R32 A;  1ZOY C;  2JO1 A;  2AEJ A;  3CXH D;  1L0N K;  1EDL A;  3TGU D;  2FYU D;  3VYI A;  1BE3 J;  4U3F D;  1H8A A;  2ZYA A;  3VOP A;  2YKO A;  2WSF H;  3CX5 E;  2XND H;  2QM7 A;  4IL6 E;  4BXL A;  1X22 A;  4HKZ H;  3Q2Y A;  1S9K D;  1YJW P;  3A7O A;  3U1A A;  1GU4 A;  3SWF A;  1FOS E;  1LNQ A;  3C9I A;  1BE3 D;  1L4A C;  1ZW0 A;  4U3F J;  1NH4 A;  1QGK B;  1SQB E;  1E79 H;  3TGU J;  2OTJ P;  5KLV D;  3M9H A;  4GOE A;  2I1K A;  1NTM G;  3GHG A;  3V5B A;  1N73 A;  1JCC A;  2O01 J;  3O6Q B;  1ZV8 A;  1N7S A;  4PD4 E;  1QLE D;  4A7P A;  3LW5 J;  4I7Z B;  1OVR A;  1DD3 A;  2RMZ A;  3B4S A;  1BDC A;  4MN4 C;  1SQB G;  1CI6 B;  1MKM A;  4U3F G;  3V2P A;  3WU2 E;  2D2C B;  3V4Q A;  1SQX E;  3L35 A;  3H1H E;  4KHX A;  1L0L K;  3IAO A;  1IFM A;  3L70 G;  3CCV P;  2N1T C;  3B5N B;  3L72 E;  2Q3E A;  4GKG A;  5CCH A;  3O8Z A;  3SFE C;  3Q5S A;  1PP9 G;  1H88 A;  4I7Z C;  4PV1 C;  1ZXG A;  4EIJ A;  1G2C A;  1SFC C;  2C0X A;  1NTK E;  1URQ C;  2P1J A;  2WMM A;  2OQQ A;  3JC2 2;  3LW5 H;  2Y9Z A;  1SQV G;  2O01 N;  3H1J E;  3NTN A;  2FFD A;  1KZU B;  2J59 M;  1G1I A;  1GL2 B;  1OVV A;  2ZYG A;  1N86 A;  2M3B A;  2G3A A;  5KLV K;  2YIU B;  1YJ9 P;  5CJ4 A;  4Z1M H;  2NPS C;  3H1J D;  2FYN C;  2R5B A;  1LT9 B;  3BCC G;  3MHV A;  2YMK A;  1NTK G;  2QM8 A;  3AEF C;  2OYH A;  2I8D A;  3E1I A;  3NMD A;  3AE8 C;  3N4X A;  2E43 A;  2L5G B;  2KUB A;  1RHZ B;  3PP5 A;  1S4X A;  3D6Z A;  1FDM A;  1VQ5 P;  3AEB C;  2GA1 A;  3EFF K;  3GF7 A;  1PZQ A;  1WMK A;  3H1H D;  4C46 A;  3L70 J;  2HOD B;  1PIX A;  3BCC E;  3HRN A;  2I1J A;  1NTZ E;  2E5T A;  3N7N A;  2M8R A;  1HGV A;  2Q5U A;  4JBZ A;  4NPD A;  1FZC C;  1FBM A;  3TYY A;  2POH A;  4UB6 E;  1IFI A;  3V2N A;  5APW A;  5APX A;  2FBW C;  3CWB J;  4DJG A;  2OYI C;  5L8R J;  3IFM A;  1U57 A;  2ZYD A;  3H1L D;  3VMZ A;  5TIS H;  3L71 D;  3CCL P;  4IFM A;  1M8O B;  1L0L G;  1U7J A;  2ZXE B;  1NWQ A;  1VQP P;  1M57 D;  1FC2 C;  4TLF A;  3PRJ A;  4D6T E;  1SQV K;  3H25 A;  4H13 B;  1LWU B;  4AYC A;  2LR2 A;  4K35 A;  5TJH A;  2KZJ A;  3M9Q A;  4L76 A;  2Q9I A;  1EZV E;  1Z56 A;  5KKZ B;  1CSB A;  2FFD B;  1R5L A;  4WY4 B;  1EQ7 A;  3HD7 A;  4OGQ B;  3RL0 D;  2VRS A;  1JB0 J;  1L0L J;  1NU1 K;  1PGO A;  2E5Y A;  1JTH A;  2K9Y A;  2JWD A;  3AEA C;  1BDD A;  2H88 C;  2N1T A;  2NRG A;  1SFC A;  3L75 G;  5TIS E;  5GTI E;  3H1K E;  3L73 E;  1L4A A;  1YTZ I;  2WSC J;  4H44 C;  3V2Q A;  3CCM P;  1YHQ P;  2YIU C;  3H1K J;  3L73 J;  5KLI C;  1GMJ A;  1NTZ G;  3HD7 B;  1GL2 C;  4NPE A;  1L0L E;  2BCC E;  3CWB G;  1D7M A;  1LTB C;  1KB9 H;  1LP1 A;  1RF0 A;  3PLN A;  2E74 D;  3R2P A;  5APQ A;  1MV8 A;  2ZJS E;  2DW3 A;  3RK2 C;  3ITK A;  1JY3 P;  1SQP D;  2N1T B;  3T97 A;  3FGA D;  1RE4 A;  1BCC J;  4BRY A;  1QL2 A;  3SWK A;  1RH5 B;  3W67 A;  3A5T A;  1GL2 A;  2P7J A;  1S5L X;  2Y0C A;  3GF3 A;  3RK3 C;  1ZME C;  3H1I D;  1RE3 A;  5CBO A;  3BAS A;  4I1L A;  3S1K A;  3RBZ A;  1KFN A;  2V7Q H;  3C1L A;  1CZQ A;  3RL0 g;  3V2R A;  2QJK C;  1YTZ T;  1KN7 A;  1KIL C;  1GK6 A;  1NTZ J;  4I6M C;  5AVU B;  2W8Z A;  2AEM A;  2RKL A;  1YIT P;  1N8R Q;  2CPB A;  1N2D C;  2IYO A;  3LIE A;  1SQX G;  2FXO A;  3PJS K;  3VTP C;  3L74 E;  2OTK E;  3KHU A;  1JMM A;  3JSV C;  1AA0 A;  1NU1 G;  3CLQ A;  1T8Z A;  3KPE A;  1KYO H;  5AVV B;  5AVX B;  2O1J A;  3D71 A;  2Z4E A;  3CC4 P;  2R3C A;  2YKQ A;  5M1B A;  1SQV J;  4KJM A;  1FOS F;  1JY3 N;  1FAV A;  3FWN A;  4K3A A;  3A0H E;  1NKZ B;  4DOJ A;  2KB7 P;  1OXZ A;  4HH2 A;  1GZL A;  4PJ0 E;  3HE4 B;  2IZ1 A;  3CC2 P;  1KC8 Q;  4EI2 A;  1K9M Q;  1BE3 E;  1EZV I;  2OGU A;  3L75 J;  3CWB D;  2PFX A;  1LT9 A;  1NU1 J;  2GUV A;  2FYU K;  2Z5I A;  2XZR A;  1NTK J;  4WBA A;  4D6T G;  3CCS P;  3FX0 A;  3B5N A;  4C7N A;  3I55 P;  4Y28 J;  1KYO I;  3Q5R A;  3MD0 A;  2NPS B;  2KLU A;  4H0L D;  1IFJ A;  3VP9 A;  3CXH E;  2HPC A;  2PRR A;  2QIW A;  5AVY B;  1G1J A;  3L75 D;  3G71 P;  1AQ5 A;  3H1H J;  1VPC A;  1SQX J;  5AVR B;  1DH3 A;  1QVF O;  1A02 J;  3KYQ A;  5KAI H;  3RK3 E;  3BAT A;  4LGD E;  4OGQ D;  1SFC B;  1GD2 E;  4ZNC A;  1M7L A;  2XNX A;  4EDF A;  3RK3 B;  2KLV A;  4XFJ A;  1JNM A;  2QJP C;  3L74 G;  1SQP E;  2WSS H;  3B5N C;  4GIF A;  3CMA P;  5APY A;  3QH9 A;  1LTJ A;  2H7H A;  2XV5 A;  4ZKP A;  1SQX K;  3TNU A;  1CI6 A;  1UII A;  1RF1 C;  1H0T B;  3S9O A;  2IPP A;  1HGZ A;  3HUS A;  3CX5 D;  3CC7 P;  1WT6 A;  1DIP A;  1QEX A;  2FXM A;  4U3F E;  1X9V A;  1FZE A;  1JOC A;  2E76 B;  3VMA A;  2YXR B;  2N9B A;  1KIL A;  2Q6Q A;  1LTT C;  1KD1 Q;  1SP4 A;  1NU1 E;  2HLO A;  3EWK A;  2WT7 B;  2KNC A;  2B9B A;  3L75 E;  2R5D A;  5APS A;  5CCH C;  4N78 D;  3I56 P;  4IFF A;  1FZF A;  4ZKU A;  3F89 A;  5BU8 B;  2IDB A;  3JCU H;  2B87 B;  1DEB A;  3MZW B;  1EZV G;  4XA4 A;  3WU2 H;  1KB9 I;  1PPJ G;  3D6Y A;  3H1H G;  1SQV E;  1OVU A;  2W90 A;  2YKP A;  3HTK B;  3IR9 A;  4UB6 H;  1N73 C;  4Y99 B;  1S5L H;  3V6I A;  4CPG A;  4YXW H;  3A0B E;  4QMA A;  1FS0 E;  2BEZ F;  1URQ B;  1YJN P;  2BEQ D;  1LTG C;  3AE3 C;  2ITA A;  3H1K G;  3L73 G;  1KYO D;  3KZI H;  2N1T D;  2YO3 A;  3L74 J;  1J2J B;  1HUC A;  2WIT A;  2QJY C;  2QA4 P;  1VQL P;  1YBK A;  3CX5 H;  4YPC A;  4YTP C;  1EDK A;  2HPC B;  4GDO A;  3CL3 D;  2C0W A;  2P2U A;  5KLV J;  2KNC B;  2WQY C;  2A06 G;  4N6J A;  4IL6 H;  3CME P;  4WVZ A;  1BCC G;  1RY3 A;  2K1A A;  2ZT9 D;  4H0L C;  4OH8 B;  4U7J A;  3RBX A;  3WUV A;  5CHX A;  3U1C A;  3RL0 C;  1RE4 C;  1OZH A;  3E7K A;  3L74 D;  3TF5 A;  4JPZ B;  3M0A A;  1VQ8 P;  1LJ2 A;  2Z5H A;  3GHG C;  3RL0 B;  1KQS O;  1OWA A;  2E76 D;  1NAF A;  2O1K A;  1SQQ G;  5CJ0 A;  4H44 B;  1W2E A;  3W68 A;  1KMI Z;  1H0T A;  1J1D B;  2BAS A;  3HD7 C;  5AW8 B;  3P32 A;  3K5B A;  1BCC E;  2IZ0 A;  2KZI A;  3U59 A;  2FYZ A;  3HD7 D;  2CK3 H;  1S72 P;  1FZG A;  1FJP A;  4OGQ C;  1VQ6 P;  1KQL A;  1Q90 D;  1ZRT D;  2KOG A;  1VL2 A;  3UIA A;  4W80 A;  3M9B A;  1IK9 A;  3RGU A;  3WUT A;  1BGY D;  2KSJ A;  3L37 A;  2W6B A;  3EQ2 A;  1M1J B;  2BCC J;  4JF7 A;  4WB4 A;  1SQQ D;  1KB9 D;  1PPJ D;  2RN0 A;  2R3S A;  3AEC C;  1EZV D;  1HWT C;  3HUS C;  1N7S B;  2WPQ A;  1NTM E;  2G8Y A;  1EXJ A;  1KTM A;  1FZC A;  2ZAE B;  1T3J A;  3H1I G;  3MTU E;  5AW4 B;  2D2C D;  3KDP B;  4IOI H;  1EDI A;  3L72 G;  4B86 A;  1XTG B;  1ZP0 C;  2ZVO B;  3HE4 A;  4XE5 B;  4O9B A;  1T3U A;  1VQ4 P;  3A0B H;  1J1E B;  4OWF A;  2YO2 A;  2KSE A;  1SQQ J;  2JR8 A;  2OYI B;  1EDJ A;  1KIL D;  5CCH D;  2ZT9 C;  3P8C D;  2E75 B;  3MIW A;  1P84 I;  1KIL B;  1FDO A;  1L0N G;  2K88 A;  3GLM A;  1QL1 A;  3H1L J;  2AEF A;  2P10 A;  3KQG A;  1USE A;  5E79 H;  3TSI A;  5GTI H;  1PP9 E;  4UB8 H;  1GDT A;  1UIX A;  1JEK A;  2WSC H;  3HUS B;  1RF1 B;  5CBN A;  2M0B A;  2B87 A;  2R44 A;  3CCR P;  1KYO E;  4D6T J;  1NTK D;  3BRV B;  1RQU A;  2BCC G;  3OJA B;  1M1K Q;  5KLV G;  1VQO P;  2NPS A;  2FFD C;  2XDJ A;  1GL2 D;  3AEE C;  5AW1 B;  4PD4 I;  1VDF A;  1E5W A;  3WMM 0;  1PGQ A;  1NTK K;  1FDI A;  4PV1 D;  5KJ7 A;  4H44 D;  1H89 A;  2OYH B;  2J5U A;  4JYC A;  1K04 A;  2MJZ A;  1NVO A;  1Q2N A;  4HB1 A;  1HTL C;  1MFZ A;  1J1D C;  2Q3I A;  2M3E A;  3TNU B;  2HYN A;  1M56 D;  3L4F A;  3MP7 B;  1R5S A;  2N9Y B;  2PP6 A;  2IBZ G;  3GW6 A;  1LWU A;  3P7K A;  4HYT B;  2B89 A;  5AW9 B; 
#chains in the Genus database with same CATH homology
 4DZO A;  2HFE D;  3I5C A;  1KFM A;  2IFN A;  1SLQ A;  3LID A;  4M3L A;  1N7S C;  1T2K C;  3M0D C;  3EFG A;  1LWU C;  3TK1 A;  1JY2 P;  1X79 B;  1LTA C;  1IJD B;  3HE5 B;  3HTK A;  1AFO A;  1LTI C;  3MGN A;  3M0D A;  1L4A D;  3P8M C;  1LTS C;  3VMX A;  3VP8 A;  4RES B;  1NTZ K;  2P67 A;  2ZFC A;  1NKN A;  2YMY A;  1ZR2 A;  3OA7 A;  5AW0 B;  1GK4 A;  2Q7C A;  1HVV A;  5AVZ B;  1FZB A;  3H32 A;  2KP8 A;  2WPR A;  1HBW A;  1FU1 A;  1NTM K;  3V4W A;  2HG5 D;  1GTW A;  1NO4 A;  2JJL A;  3P8C E;  2O01 H;  1JY2 N;  2JEE A;  1SQB K;  3MUD A;  4EOT A;  1SFC D;  3L36 A;  4C7N B;  2C9N Y;  1L4A B;  1IFD A;  2W27 A;  5AW5 B;  2GM4 A;  3II6 A;  1M1J C;  1JTH B;  4C7R A;  4WY4 C;  2KYV A;  1A02 F;  2C9L Y;  1GW3 A;  5AVQ B;  2WZ7 A;  1HH0 A;  2WWW A;  1NOH A;  2YNY A;  1URQ A;  5KTB A;  3BVH A;  3GHG B;  1WRG A;  1IC2 A;  3BRT B;  4WY4 A;  4LC1 A;  1GU5 A;  4N3Y B;  1DX7 A;  1FZA A;  3B5N D;  2H43 A;  1HJB A;  1ZR4 A;  5AW6 B;  1SQP K;  5KJ7 D;  2IFM A;  5CCG C;  1GW4 A;  5CCG D;  2PAJ A;  4GT1 A;  4I2L C;  1N7L A;  3A2A A;  5BU5 A;  3VMY A;  1J1E C;  1JY3 O;  2J58 A;  1YYC A;  3RK2 B;  2FKW B;  1JUN A;  4AQR D;  1JO5 A;  4LLH A;  1RF0 C;  1G2C B;  1URQ D;  1PFI A;  4WY4 D;  3CI9 A;  2NPS D;  3M06 A;  3RK2 D;  1XTC C;  1JY2 O;  2A45 H;  3H32 B;  3NFQ A;  1S9K E;  5CCG A;  3OAK A;  1N7S D;  2CPS A;  1T2K D;  1CW5 A;  2OAR A;  4W7Y A;  4W7Z A;  1N73 B;  1MUU A;  5CMZ A;  5APV A;  3SWY A;  1FJK A;  2GUS A;  4JYB A;  5KJ7 C;  1LTJ C;  5APT A;  5AW3 B;  3M91 A;  2WSE H;  3NXS A;  1RF1 A;  1LTJ B;  1ZLL A;  1JCD A;  5AW7 B;  5AVS B;  2WT7 A;  1FZC B;  1MZ9 A;  2HOD A;  2H8P D;  3G3Z A;  1ZN5 A;  3A3Y B;  2XKM A;  1LGH B;  5APU A;  2OYI A;  2OYH C;  1SVF A;  2WTY A;  3B8E B;  1IO4 A;  1IFN A;  1SQQ K;  1LT9 C;  2W6A A;  4N78 E;  1X8Y A;  5AW2 B;  2A45 I;  4AUW A;  2WPS A;  2A45 G;  1M1J A;  3H6P A;  3VN0 A;  4Y99 C;  2IX7 C;  4IFD K;  1NHL A;  1RE3 C;  2XU6 A;  2LKM A;  5AVW B;  3RK3 D;  5BVZ A;  2E42 A;  2R32 A;  1L0N K;  3VYI A;  1H8A A;  3VOP A;  2YKO A;  2WSF H;  2QM7 A;  1S9K D;  1GU4 A;  1FOS E;  3A7O A;  3U1A A;  3SWF A;  3C9I A;  1L4A C;  1NH4 A;  3M9H A;  2I1K A;  3GHG A;  3V5B A;  1N73 A;  1JCC A;  1ZV8 A;  1N7S A;  1CI6 B;  3V2P A;  3V4Q A;  3L35 A;  4KHX A;  1L0L K;  1IFM A;  2N1T C;  3B5N B;  4GKG A;  5CCH A;  3O8Z A;  1H88 A;  4EIJ A;  1G2C A;  1SFC C;  2C0X A;  2P1J A;  1URQ C;  3LW5 H;  3NTN A;  2FFD A;  1KZU B;  2J59 M;  1G1I A;  1GL2 B;  5KLV K;  1N86 A;  2M3B A;  5CJ4 A;  2NPS C;  2R5B A;  1LT9 B;  2QM8 A;  2OYH A;  3NMD A;  3E1I A;  2E43 A;  3N4X A;  2L5G B;  3PP5 A;  4C46 A;  2HOD B;  3HRN A;  2I1J A;  3N7N A;  2M8R A;  1HGV A;  2Q5U A;  1FZC C;  1FBM A;  3TYY A;  2POH A;  1IFI A;  3V2N A;  5APW A;  5APX A;  2OYI C;  3IFM A;  3VMZ A;  4IFM A;  1NWQ A;  2ZXE B;  1SQV K;  1LWU B;  4AYC A;  3M9Q A;  2Q9I A;  1Z56 A;  1CSB A;  2FFD B;  4WY4 B;  1EQ7 A;  3HD7 A;  3RL0 D;  2VRS A;  1NU1 K;  1FDM A;  1JTH A;  2N1T A;  1SFC A;  1L4A A;  1YTZ I;  3V2Q A;  3HD7 B;  1GL2 C;  1LTB C;  1RF0 A;  3R2P A;  5APQ A;  1MV8 A;  3RK2 C;  1JY3 P;  3T97 A;  2N1T B;  1RE4 A;  1QL2 A;  3A5T A;  1GL2 A;  2P7J A;  3RK3 C;  1RE3 A;  3BAS A;  4I1L A;  1KFN A;  1CZQ A;  3V2R A;  1YTZ T;  1KIL C;  1GK6 A;  4I6M C;  5AVU B;  2CPB A;  1N2D C;  3LIE A;  3VTP C;  1JMM A;  5AVX B;  3CLQ A;  1T8Z A;  3KPE A;  5AVV B;  2Z4E A;  2O1J A;  2R3C A;  2YKQ A;  1FOS F;  1JY3 N;  1FAV A;  4DOJ A;  1NKZ B;  2KB7 P;  1OXZ A;  4HH2 A;  1GZL A;  3HE4 B;  1LT9 A;  2GUV A;  2FYU K;  2Z5I A;  2XZR A;  4WBA A;  4C7N A;  3B5N A;  3MD0 A;  2NPS B;  1IFJ A;  3VP9 A;  2HPC A;  5AVY B;  1G1J A;  1AQ5 A;  1VPC A;  1DH3 A;  5AVR B;  3KYQ A;  3BAT A;  4LGD E;  1GD2 E;  1SFC B;  1M7L A;  2XNX A;  3RK3 B;  2KLV A;  1JNM A;  4GIF A;  3B5N C;  5APY A;  2H7H A;  1LTJ A;  2XV5 A;  4ZKP A;  1SQX K;  3TNU A;  1CI6 A;  1RF1 C;  2IPP A;  1HGZ A;  3HUS A;  1WT6 A;  2FXM A;  1X9V A;  1FZE A;  1JOC A;  2N9B A;  1KIL A;  1LTT C;  1SP4 A;  2HLO A;  2WT7 B;  5APS A;  5CCH C;  2R5D A;  4N78 D;  4IFF A;  1FZF A;  4ZKU A;  5BU8 B;  1DEB A;  4XA4 A;  2YKP A;  3HTK B;  3IR9 A;  1N73 C;  4Y99 B;  1URQ B;  1LTG C;  2N1T D;  2YO3 A;  1J2J B;  1HUC A;  2WIT A;  2HPC B;  3CL3 D;  2C0W A;  2P2U A;  4N6J A;  1RY3 A;  3U1C A;  4OH8 B;  5CHX A;  3RL0 C;  1RE4 C;  3M0A A;  2Z5H A;  3GHG C;  3RL0 B;  1OWA A;  1NAF A;  2O1K A;  5CJ0 A;  1W2E A;  1J1D B;  2BAS A;  3HD7 C;  5AW8 B;  3P32 A;  3U59 A;  1FJP A;  2FYZ A;  3HD7 D;  1FZG A;  1KQL A;  2KOG A;  3UIA A;  4W80 A;  3M9B A;  1IK9 A;  2KSJ A;  3L37 A;  2W6B A;  3EQ2 A;  1M1J B;  4JF7 A;  4WB4 A;  1HWT C;  3HUS C;  1N7S B;  2WPQ A;  1FZC A;  1T3J A;  3MTU E;  5AW4 B;  3KDP B;  4B86 A;  1XTG B;  3HE4 A;  4XE5 B;  4O9B A;  1T3U A;  1J1E B;  2OYI B;  2YO2 A;  1KIL D;  5CCH D;  3P8C D;  3MIW A;  3HE5 A;  1KIL B;  1QL1 A;  3KQG A;  3TSI A;  1GDT A;  2WSC H;  1RF1 B;  3HUS B;  3BRV B;  3OJA B;  2NPS A;  2FFD C;  2XDJ A;  1GL2 D;  5AW1 B;  3WMM 0;  1A02 J;  1VDF A;  1E5W A;  5KJ7 A;  1NTK K;  2OYH B;  1H89 A;  4JYC A;  2MJZ A;  1HTL C;  1MFZ A;  1J1D C;  2Q3I A;  3TNU B;  2HYN A;  3L4F A;  4HYT B;  5AW9 B;  2PP6 A;  1LWU A;  3P7K A;  5AVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...