3A2AA

The structure of the carboxyl-terminal domain of the human voltage-gated proton channel hv1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
RQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role and structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Voltage-gated hydrogen channel 1
total genus 18
structure length 41
sequence length 41
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16799 VGPC1_C C-terminal membrane-localisation domain of ion-channel, VCN1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a2aA00
1CI6B 1OXZA 3O8ZA 4B86A 3HE4B 1GZLA 3VTPC 1J2JB 1JUNA 5APWA 2W6AA 1FAVA 2C9NY 3I5CA 1NAFA 2Q3IA 3OAKA 3T97A 5AVVB 3B8EB 2R32A 3M0DA 5AW0B 2WPSA 4HYTB 2YO3A 1FOSF 3NMDA 3VN0A 4KHXA 4C7NA 4C46A 1JNMA 2WT7B 2Z5IA 3LIDA 3VMXA 4I6MC 5CMZA 1HUCA 1MUUA 3VMYA 3TYYA 3P7KA 3M9BA 3HE4A 3VYIA 3MD0A 2ZXEB 1DH3A 3L36A 2W27A 1H89A 1X8YA 5AW5B 2WT7A 4EOTA 2XV5A 1GU4A 5AW4B 5APXA 1H8AA 1CSBA 3NTNA 2WTYA 5AVYB 4RESB 2E42A 1IO4A 5AW3B 4JYCA 2YNYA 3M9HA 1HBWA 3KDPB 1GK4A 2QM7A 5APVA 4GKGA 3A5TA 2WPRA 2XZRA 2WWWA 5AVQB 3VMZA 5APQA 1CI6A 2ZFCA 2P67A 3HE5A 3P8MC 4AQRD 2R5DA 1GD2E 5AW7B 2H7HA 3UIAA 5AVZB 5AW8B 3A3YB 5AW2B 5AVWB 1T2KC 1OWAA 1HJBA 2XU6A 1YYCA 1MV8A 3M0AA 5AW1B 3HTKA 3L35A 5APYA 5APSA 2WPQA 4AYCA 5AVXB 1A02J 3HE5B 2JJLA 3A2AA 4XE5B 1H88A 3IR9A 1SLQA 2C9LY 2N9BA 1NWQA 5AVSB 2VRSA 2Q5UA 2YO2A 2IPPA 2Z5HA 3TNUB 1G2CB 5AW9B 1GU5A 3M06A 2E43A 5AW6B 3M91A 5AVUB 4JYBA 5APUA 3V4QA 5AVTB 4DZOA 1MFZA 3LIEA 1S9KE 3NFQA 1CZQA 2P2UA 4M3LA 3MGNA 3A7OA 4LC1A 3P32A 3TNUA 2BASA 1KQLA 1GTWA 1S9KD 1A02F 2R3CA 3L37A 3KQGA 2P7JA 4GT1A 5AVRB 1FOSE 1GK6A 4AUWA 3NXSA 3SWFA 4C7NB 2KP8A 1T2KD 4I2LC 2Q7CA 3V5BA 2QM8A 5APTA 1HWTC 3TK1A 3V4WA 2R5BA 1SP4A
chains in the Genus database with same CATH superfamily
3KXDA 1CI6B 2FY8A 3PJSK 3L72D 4W7ZA 3AE9C 1LTAC 1WMKA 2R44A 5E79E 1LT1A 1GZLA 3C1LA 3WUVA 2NPSA 3HUSB 1JUNA 1AQTA 4KT0J 1KTMA 3H6PA 2KK7A 1FS0E 4RJTA 3L73E 1HGZA 2B88A 2IBZI 1Q2NA 1YHQP 1NTZJ 1NTMK 3TF5A 2FXPA 2WPSA 4HYTB 4Y99B 1OW8A 3LW5H 2IZ0A 1PPJE 4L76A 1KQFB 4IL6E 2E76D 2E76C 3VMAA 1N7SB 1JNMA 1BSHA 2H43A 2Z5IA 1BDCA 3BCCJ 3LIDA 3GF7A 2AEFA 2QJPB 3E7KA 1NTZD 1ZW0A 4A7PA 3I56P 3L75E 3TYYA 1NU1K 1YJ9P 1FZCB 2C0XA 1LWUB 2W6BA 1KILD 1FZAA 1HTLC 3H1KG 1HH0A 1SQXG 2ZYAA 3AEFC 2QRXA 3VYIA 1DH3A 4NPDA 1LT9B 1SQBE 3SWYA 4L74A 1JOCA 3HUSC 3OW2O 2E5YA 1H89A 1J1EB 1VQMP 3CCEP 1VF5D 3FX0A 4D6TG 1GU4A 2I8DA 5APXA 1VQ5P 2OYOA 3WU2E 4OWFA 2P58A 2KS1A 5AVYB 4DOJA 3CX5E 4JYCA 1EXJA 3D6ZA 4HJGH 1USDA 3U1AA 3JC22 3ZDMA 2BEQD 4EIJA 1J1DC 3L70J 2QG4A 3OJAB 1N7SA 2XZRA 1LTJC 3FWNA 3B4SA 3USSA 1M1JC 1U7MA 1YTZI 2E74D 2FBWC 4XFJA 1M1JA 2JWAA 2YMYA 1KYOH 1T8ZA 1URQD 1X0TA 2JO1A 2ZT9B 3P8CD 5APQA 4U3FD 4MN4C 3V2RA 4DT0A 1SFCD 3TGUJ 5BVZA 5B66H 3A0BH 2R3SA 1SQQK 1PFIA 3F5HA 3RGUA 3F89A 1N2DC 4U3FJ 1QL2A 1RQUA 3CLQA 5CJ4A 4BWNA 3AE4C 2PRRA 5AVZB 1Y8AA 1NYHA 3A3YB 1T2KC 1USEA 2FXMA 2AXTE 3AEEC 1NTKJ 3CCVP 5AW1B 2KNCA 1A02F 1IFDA 3SWKA 3WUTA 1L4AA 1PGOA 1VQKP 1CW5A 3D6YA 4OGQC 1AFOA 4JBZA 1S2EA 4CPGA 1FJPA 1L0LD 5AVXB 1A02J 4H44C 1SFCB 5TISE 2QIWA 2G3AA 4U3FE 1Y47A 3A2AA 1M8OB 2IFMA 3IR9A 3G6EP 4WY4C 3RK2C 2FYUJ 2ZAEB 3TNUB 2VRSA 3L71G 1GU5A 2IPPA 2Z5HA 1G2CB 4U3FG 5AW9B 2IFNA 3L4FA 1OFCX 2N1TD 3IFMA 1FZEA 1NTMJ 2D2CD 1PP9D 3R2PA 5AW6B 1SQBG 3V2NA 2FYUE 2ZVOB 4JYBA 1RQVA 1EXIA 2E75D 3H1KE 3AE3C 2HPCA 1W5CE 1PPJD 5B5EE 1S9KE 1RF1A 3U59A 3CL3D 3NFQA 2GUVA 3D70A 2KZIA 3RK2B 3MIWA 4M3LA 1PV3A 3AE7C 3BATA 4N6JA 2RH0A 3A7OA 3H1JD 3P32A 3TGUE 1KQGB 2M3EA 1OZHA 1KQLA 1JCCA 2D2CC 1OW7A 3H1HJ 4PV1D 5KAIH 1W2BO 4HB1A 4PV1B 3L37A 3KQGA 2Y0EA 1BE3D 2B89A 2A06D 3CXHI 4GT1A 5AVRB 3H32B 1FOSE 1GK6A 2A45H 5GTHH 1KN7A 1N7SD 4IOIH 3SWFA 1VQNP 1IFMA 2L5GB 4IFFA 4I2LC 1KB9D 2QM8A 1EZVE 3L72G 5KLIC 1PPJG 3L72J 1X79B 1EZVI 2ZT9D 4YXWH 4H44B 3BRTB 1SQPE 1NTKE 3WUUA 4PV1C 1LWUC 1OXZA 2KLVA 2XKMA 1BSNA 3HE4B 1Z56A 1P84I 4GIFA 3G71P 1N73C 1VQLP 4NPEA 3ITKA 3Q1MA 1OVVA 1J2JB 1IFJA 1T3JA 2W6AA 3AE2C 1FC2C 1FAVA 4LLHA 1N86A 2BCCD 3H1JJ 4I7ZB 5CCGC 1Q7YQ 3HRNA 5K5GB 4ZKUA 2N1TA 2IZ1A 2KNCB 2R32A 5KLVD 5KJ7C 1SQVG 4YTPC 2WSEJ 2GUSA 2HG5D 1BCCG 2ZVNB 3AE5C 4L73A 2K9JA 4XA4A 4UB8E 1FZCC 5KKZC 1PP9E 1FZBA 2KYVA 2M5AA 2WT7B 1LP1A 2O01J 2WSEH 2QJPC 3CC7P 1YJNP 4LGDE 3VMXA 2OGUA 5KTBA 2E75C 3CX5H 2WSFJ 2LXCB 4I6MC 1RE4A 5CMZA 1KORA 1HUCA 1LNQA 2MKVA 3PH0A 1FDOA 1R8EA 2JEEA 3M9BA 4PD4E 3MD0A 4H0LD 4H0LC 2BCCG 2HLOA 2A06G 2IBZD 5TISH 2PFXA 2W27A 1WT6A 1SQPK 5GTIE 3CCUP 1FZGA 2KB7P 1RF0C 1VDFA 2A06E 2E5TA 1IFIA 5AW4B 3GG2A 3B5NA 4IFMA 1JTHB 1E79H 2FYUK 5AW3B 3H1LE 4IL6X 5CCHD 1FJKA 3KDPB 4WY4B 3TGUD 4GKGA 5BU8B 1L0ND 2WPRA 1LT9C 1N73A 1U7JA 3CCQP 1LT9A 1NTMG 2IBZE 2NPSC 2ZJSE 3L75D 1VQPP 2BEZF 2IYOA 3T97B 5BU5A 1CI6A 1FE6A 2PAJA 4TLFA 4AQRD 5AW7B 2IDBA 3VOPA 2W6JH 2Q1KA 3L71E 1D7MA 5AW8B 1G2CA 2E76B 1OWAA 1SQXE 4UB6E 5M1BA 1HJBA 2OYIB 2P10A 1DEBA 1YYCA 1OIPA 1VF5C 3HTKA 3AE1C 2C0WA 1KYOD 3L35A 1Y9BA 4OGQB 2FYUG 2B87A 1GMJA 1SQVE 2WPQA 4JPZB 4UB6H 5EFWB 3FXDA 3H1IE 3RL0B 3S9OA 3VP9A 4AYCA 4D6TJ 1QEXA 2K88A 5GTHE 1N8RQ 2WSFH 2JJLA 1NU1D 2JDIH 4O9BA 1VQ8P 1KILC 1PP9G 1BGYD 1YJWP 1GL2C 1KFMA 1P84H 4PJ0E 1NWQA 5AVSB 3RBZA 1IZNB 2YKQA 1QVFO 3V6IA 4NPFX 4OGQD 4K3AA 3M06A 5CBNA 1L4AC 2M0BA 1VF5B 2LKMA 3AEDC 3U1CA 4IFDK 3B5ND 3M0DC 5AVUB 1KZUB 3CCJP 3V4QA 2AEMA 5AVTB 3WMM0 5C39A 3LIEA 1EZVG 3P8CE 1VL2A 4ASWA 2Q9IA 1KILB 1L2PA 2AEJA 1TU3F 1IC2A 1BGYJ 1Q90D 1CZQA 1GL2B 2J58A 1KB9I 2YMKA 3CXHH 1GL2D 1W2EA 2WPVB 3TNUA 4N78D 1BCCD 1KB9H 2BASA 2MJZA 1NHLA 1T3UA 1RE4C 1JM0A 1DEEG 3RL0C 1S9KD 2KIKA 1BGYE 2R3CA 1JMMA 2HR3A 3W68A 3H25A 1ZR4A 1M1KQ 2IBZG 1SVFA 1ZMEC 2G8YA 4WBAA 1JEKA 4WY4D 2ITAA 1PGQA 1DD4A 1BDDA 3NXSA 3H1HG 2O3JA 3RK3E 2K3RA 2UWJE 3CWBJ 3PHLA 1HWTC 5APTA 4UB8H 3QH9A 3BVHA 1ZP0C 3C8VA 1BGYG 2B87B 1JY3P 3L73J 4K35A 5CCGA 2D2CB 3H1JE 4RO0A 1URQA 1T6AA 2O01N 2WZ7A 1KYOI 2XNDH 1L0NG 1JMBA 3FWLA 1QLED 5CCHC 5KLIB 3CCMP 1JY3O 1L0NJ 2LR2A 3O8ZA 4R4MA 3H1IG 2O01H 2BCCE 3A0BE 3N4XA 1ZLLA 3H1IJ 2M5AB 1SQVD 1IK7A 2QJKB 4GDOA 4W7YA 3IF4A 1IFPA 3VTPC 5APWA 1LTIC 2C9NY 1M1JB 1NAFA 1JY2P 1NOHA 2ZYGA 3BCCE 1SQXD 3OAKA 1NKZB 4TT3H 1HGVA 2FYNC 3M0DA 1LTBC 5AW0B 3S1KA 2GA1A 1NTZG 4YXDC 1PL5A 2YO3A 3S4RA 1FOSF 1EDJA 3NMDA 4BXLA 2HODB 1EZVD 1S72P 2K1AA 4C7NA 1P84D 1GL2A 3KYQA 4C46A 3CCSP 1K8AQ 1NTZE 2JP3A 1NTME 3MP7B 4RKUJ 1QX8A 1S1CX 2FYZA 2IX7C 3GMAA 4U7JA 2V7QJ 3MZWB 1IFNA 1L4AB 1RY3A 3AECC 3Q3DA 2HPCB 2JR8A 1M90Q 1JTHA 2I1KA 1MUUA 2Y0CA 1SQBD 1OVUA 1SQXJ 2HFED 3EFGA 3P7KA 2AXTH 5KAIE 1DD3A 3L75G 1VQ4P 1KQSO 1RF1C 1SQPJ 1LTSC 1J1EC 3D71A 3TGUG 5KLVG 1M56D 5B66E 2QVAA 1X8YA 4ZKPA 5TJHA 5KLVJ 4IL6H 3CX5D 3H1JG 2WT7A 3L74D 1KMIZ 1RF0A 1JB0J 2DW3A 3N7NA 1NAYA 2BCCJ 1LTGC 1UIIA 3NTNA 2WTYA 2E42A 1MKMA 1P84E 1S5LX 4PJ0H 4RESB 1IO4A 2Y9YA 3JCUE 3R4YA 2YNYA 2HODA 2J59M 1J1DB 3HD7D 2RN0A 1NTKK 3M9HA 5CHXA 5CCHA 3CD6P 1HBWA 2Y9ZA 4W80A 2NPSB 3VMZA 3PP5A 1N7SC 4EI2A 1YI2P 1OVRA 2WVRA 1URQC 2POHA 2KLUA 2M3BA 3L71D 3H1LD 4Y99C 2H8PD 5KLVK 2OARA 3H1LJ 1PGPA 5H2FH 1GD2E 2H7HA 3CXHE 1SQQE 4JF7A 3EFFK 3UIAA 3Q5PA 1NU1G 1SS1A 1RHZB 3RK3B 3SFDC 1QVGO 1FZCA 3CC4P 1DIPA 2XU6A 2N1TB 2Q3EA 1MV8A 4EYYQ 4GOFA 2W8ZA 5APSA 1NU1E 1AA0A 2FYNB 2KSEA 3GLMA 4PD4D 3GW6A 3MUDA 2L91A 3RL0D 3HE5B 1KILA 2H89C 4H0LB 3L74J 4XE5B 5KAFH 1NVOA 1G1IA 1OMIA 1SLQA 3H32A 2N9BA 1LP1B 1M57D 5B5EH 3FGAD 1IJDB 2YO2A 3GF3A 1NH4A 4I1LA 3KHUA 1SQPD 3IN6A 1E5WA 1L0LE 2N1TC 3H1KD 1NU1J 3MTUE 2E43A 3M91A 1Q86Q 1PP9J 1NTMD 1PZQA 1LJ2A 1SQBJ 2YKPA 2K37A 5APUA 2Y0DA 3L74E 2JWDA 1ZV8A 1XTGB 3WU2H 2FYUD 1SQQJ 4N78E 2KI7B 3LW5J 5H2FE 1SQQG 5CBOA 1JCDA 2P2UA 3MGNA 1L0NK 2FFDC 1L0LG 2ZT9C 1ZRTD 2PGDA 1ZXGA 1S5LE 3MHVA 2WSCH 1L0LJ 2E74B 4I7ZC 1UIXA 1JY2N 1NTZK 2YIUB 3M9QA 4HH2A 1EQ7A 1ZN5A 3L70E 1SFCA 4ASVA 2CK3H 3Q5SA 1VPCA 1ZR2A 3PLNA 1K04A 2KXPB 2P7JA 4H13C 2NRGA 1GW4A 3HUSA 1LTJA 3JSVC 2K9YA 2GM4A 2KP8A 3CXHD 3BCCG 4JQ0D 1NO4A 2ZXXA 3H1ID 5KJ7D 3G4SP 3G9RA 2KSJA 3V4WA 2YXRB 5KAFE 3II6A 4Z1MH 1HJ0A 5DJUB 1GK4A 2R5BA 1H0TB 1SP4A 2P1JA 1XTCC 3Q5RA 1YQ3C 3CWBG 2PP6A 1SQPG 2RKLA 3L70D 4H13B 4B86A 3CCRP 2CPSA 3BASA 3HTKB 4H13D 2QEXP 3V2PA 1EDKA 1MFTA 1FU1A 1KILE 1QL1A 3E1RA 2OYHA 3B71A 3TDKA 3I5CA 2Q3IA 1AV1A 3T97A 4OVNF 5AVVB 2CPBA 3H1HE 4DCKA 3I55P 3B8EB 1PIXA 1K73Q 1VQ6P 1SQQD 5DJTB 1JY2O 1L0NE 2WQYC 3GHGC 3HD7A 1U57A 4HKZH 1KD1Q 2QA4P 1RF1B 3FXEA 1EC5A 2KUBA 3HD7C 3KZIH 4KHXA 4PD4I 3RBXA 3VN0A 1BCCJ 1T2KD 2QE7H 4D6TE 1VQ7P 4BRYA 3H1KJ 2O1JA 3AEBC 1S4XA 1MZ9A 2LXBA 4WB4A 3K5BA 4WWIA 2KS1B 1L0LK 3JCUH 3L73G 3MUDC 3RL0g 1YIJP 3BCCD 3VMYA 1R5SA 2OTKE 1SFCC 2W83C 4YPCA 1NJIQ 3HE4A 2I1JA 2ZXEB 3O6QB 4ZMDA 3L36A 2V7QH 2NPSD 1KV4A 1BE3G 3AE6C 2QSIA 3QWOC 2H88C 1Q82Q 3CCLP 1AVOA 3C9IA 5AW5B 1R5LA 3L70G 4EOTA 2E74C 1FDIA 2XV5A 1H8AA 2XDJA 1CSBA 2AXCA 3A0HH 3CI9A 3E1IA 1X9VA 2JKVA 1RH5B 4D6TD 5E79H 2IYPA 1KFNA 4C7RA 2K9JB 5CJ0A 1LWUA 1G1JA 2QJKC 2QM7A 3L71J 3PRJA 4Y28J 5APVA 1S5LH 3TSIA 3H1LG 1IK9A 1GW3A 3A5TA 2WWWA 5AVQB 1SQVK 3RK2D 3V2QA 1URQB 1LTJB 2HYNA 3A0HE 1KC8Q 1YQ4C 4R4LA 2W90A 2OTJP 1BE3J 1FBMA 3VP8A 4WVZA 2ZFCA 3G3ZA 1SQXK 2E75B 2P67A 1EDIA 2YXQB 3HE5A 3P8MC 3CC2P 2R5DA 3CWBE 3GHGB 1X22A 3H1HD 2QJYC 1H0TA 1AVYA 2SPZA 1LGHB 2WSSH 3O6QA 2FKWB 2WMMA 2WITA 4GOEA 3RK3C 3RK3D 3SFEC 5AW2B 3L75J 5AVWB 2OYHC 1RE3A 4EDFA 4BRYB 2FFDB 3L74G 1NKNA 3IAOA 3M0AA 4QMAA 5APYA 3CPWO 1K9MQ 2A45G 2M8RA 2V4HA 1NGMB 2B9BA 1YTZT 2N9YB 4KJMA 1SQBK 1H88A 4WY4A 2QJYB 2C9LY 1FZFA 2WSCJ 2O1KA 3CX5I 1YITP 1GTWA 3HD7B 1N73B 2Q5UA 3L72E 4L75A 1S3JA 3Q2YA 1VQ9P 2XNXA 5L8RJ 1HVVA 1AJYA 3PTZA 1JY3N 3SSUA 3CMEP 1BE3E 1YBKA 1GDTA 4PD4H 3ABVC 3AEAC 3AE8C 3B5NB 3GHGA 4DZOA 1MFZA 1AQ5A 2OQQA 2ZYDA 2Q6QA 2Z4EA 3EQ2A 4GODA 1WRGA 1KB9E 1NTKD 2FFDA 2NZ2A 3OA7A 5KKZB 5KLVE 4LC1A 1NTKG 3BRVB 1OW6A 3AEGC 4OH8B 5CCGD 1EDLA 2FXOA 1SQVJ 1JO5A 4H44D 1DX7A 1L4AD 1N7LA 1M7LA 1PGJA 4N3YB 3W67A 3KPEA 2J5UA 1BCCE 4ZNCA 1KYOE 3CMAP 3B5NC 2OTLP 1FDMA 1HF9A 1Q81Q 1K05A 2OYIC 2OYHB 4AUWA 2OYIA 3EWKA 1QGKB 2RMZA 3L73D 4C7NB 1RE3C 2YKOA 2Q7CA 4DJGA 3V5BA 1VQOP 5KJ7A 3CWBD 3TK1A 1LTTC 2KOGA 2KZJA 1OX3A 1ZRTE 2YIUC 5GTIH 2A45I 3KZIE 1ZOYC
chains in the Genus database with same CATH topology
1CI6B 4W7ZA 1LTAC 1GZLA 2NPSA 3HUSB 1JUNA 3H6PA 1HGZA 1NTMK 2WPSA 4HYTB 4Y99B 3LW5H 1JNMA 1N7SB 2H43A 2Z5IA 3LIDA 3TYYA 1NU1K 2C0XA 1LWUB 2W6BA 1KILD 1FZAA 1HTLC 3VYIA 1HH0A 1DH3A 1LT9B 3SWYA 1JOCA 3HUSC 1H89A 1J1EB 1GU4A 5APXA 5AVYB 4DOJA 4JYCA 3U1AA 4EIJA 1J1DC 3OJAB 1N7SA 2XZRA 1LTJC 1M1JC 1YTZI 1M1JA 2YMYA 5APQA 1T8ZA 1URQD 3P8CD 3V2RA 5KJ7C 5BVZA 1SFCD 1SQQK 1PFIA 5CJ4A 1N2DC 1QL2A 3CLQA 5AVZB 3A3YB 1T2KC 2FXMA 5AW1B 1IFDA 1L4AA 1CW5A 1AFOA 1FJPA 5AVXB 1A02J 1SFCB 3A2AA 2IFMA 3IR9A 4WY4C 3RK2C 3TNUB 2VRSA 1GU5A 2IPPA 2Z5HA 1G2CB 5AW9B 2IFNA 3L4FA 3IFMA 2N1TD 3R2PA 1FZEA 5AW6B 3V2NA 4JYBA 2HPCA 1S9KE 1RF1A 3U59A 3CL3D 3NFQA 2GUVA 3RK2B 3MIWA 4M3LA 3BATA 4N6JA 3A7OA 3P32A 1KQLA 1JCCA 3L37A 3KQGA 4GT1A 5AVRB 3H32B 1FOSE 1GK6A 2A45H 1N7SD 3SWFA 1IFMA 2L5GB 4IFFA 4I2LC 2QM8A 1X79B 3BRTB 1LWUC 1OXZA 2KLVA 2XKMA 3HE4B 1Z56A 4GIFA 1N73C 1J2JB 1IFJA 1T3JA 2W6AA 4LLHA 1FAVA 1N86A 5CCGC 3HRNA 4ZKUA 2N1TA 2R32A 2GUSA 2HG5D 1FZCC 4XA4A 1FZBA 2KYVA 2WT7B 2WSEH 4LGDE 3VMXA 5KTBA 4I6MC 5CMZA 1RE4A 1HUCA 2JEEA 3M9BA 3MD0A 2HLOA 2W27A 1WT6A 1SQPK 1FZGA 2KB7P 1RF0C 1VDFA 1IFIA 5AW4B 3B5NA 4IFMA 1JTHB 5AW3B 2FYUK 5CCHD 1FJKA 3KDPB 4WY4B 4GKGA 5BU8B 2WPRA 1LT9C 1N73A 1LT9A 2NPSC 5BU5A 1CI6A 2PAJA 4AQRD 5AW7B 3VOPA 5AW8B 1G2CA 1OWAA 2OYIB 1HJBA 1DEBA 1YYCA 3HTKA 3L35A 2C0WA 2WPQA 4AYCA 3RL0B 3VP9A 2WSFH 2JJLA 4O9BA 1KILC 1GL2C 1KFMA 1NWQA 5AVSB 2YKQA 3M06A 4IFDK 1L4AC 2LKMA 3U1CA 3B5ND 3M0DC 5AVUB 1KZUB 3V4QA 5AVTB 3WMM0 3LIEA 3P8CE 2Q9IA 1KILB 1IC2A 1CZQA 1GL2B 2J58A 1GL2D 1W2EA 3TNUA 4N78D 2BASA 2MJZA 1NHLA 1T3UA 1RE4C 1S9KD 1GTWA 3RL0C 1A02F 2R3CA 1JMMA 1ZR4A 1SVFA 4WBAA 4WY4D 3NXSA 1HWTC 5APTA 3BVHA 1JY3P 5CCGA 1URQA 2WZ7A 1FZCB 5CCHC 1JY3O 3O8ZA 3N4XA 2O01H 1ZLLA 3VTPC 4W7YA 5APWA 1LTIC 2C9NY 1M1JB 1NAFA 1JY2P 1NOHA 3OAKA 1NKZB 1HGVA 3M0DA 1LTBC 5AW0B 2YO3A 1FOSF 3NMDA 2HODB 4C7NA 3KYQA 1GL2A 4C46A 2FYZA 2IX7C 1IFNA 1L4AB 1RY3A 2HPCB 1JTHA 2I1KA 1MUUA 3P7KA 2HFED 3EFGA 1RF1C 1LTSC 1J1EC 1X8YA 4ZKPA 2WT7A 3N7NA 1RF0A 1LTGC 3NTNA 2WTYA 2E42A 4RESB 1IO4A 3M9HA 2YNYA 2HODA 2J59M 1J1DB 3HD7D 1NTKK 5CHXA 5CCHA 1HBWA 4W80A 2NPSB 3VMZA 3PP5A 1N7SC 1URQC 2POHA 2M3BA 4Y99C 2H8PD 5KLVK 2OARA 1GD2E 2H7HA 4JF7A 3UIAA 3RK3B 1FZCA 2XU6A 2N1TB 1MV8A 5APSA 3MUDA 3RL0D 3HE5B 1KILA 4XE5B 1G1IA 1SLQA 3H32A 2N9BA 1IJDB 2YO2A 1NH4A 4I1LA 1E5WA 2N1TC 3MTUE 2E43A 3M91A 5APUA 2YKPA 1ZV8A 1XTGB 4N78E 1JCDA 2P2UA 3MGNA 1L0NK 2FFDC 2WSCH 1JY2N 1NTZK 3M9QA 4HH2A 1EQ7A 1ZN5A 1SFCA 1VPCA 1ZR2A 2P7JA 1GW4A 3HUSA 1LTJA 2GM4A 2KP8A 1NO4A 5KJ7D 2KSJA 3V4WA 3II6A 2R5BA 1GK4A 1SP4A 2P1JA 1XTCC 2PP6A 4B86A 2CPSA 3BASA 3HTKB 3V2PA 1QL1A 1FU1A 2OYHA 3I5CA 2Q3IA 3T97A 5AVVB 2CPBA 3B8EB 1JY2O 3GHGC 3HD7A 1RF1B 3HD7C 3VN0A 4KHXA 2O1JA 1MZ9A 4WB4A 1L0LK 3VMYA 1SFCC 3HE4A 2I1JA 2ZXEB 3L36A 2NPSD 3C9IA 5AW5B 4EOTA 2XV5A 1H8AA 2XDJA 1CSBA 3E1IA 3CI9A 1X9VA 1KFNA 4C7RA 5CJ0A 1LWUA 1G1JA 5APVA 2QM7A 3TSIA 3A5TA 1IK9A 1GW3A 2WWWA 5AVQB 1SQVK 3RK2D 3V2QA 1URQB 1LTJB 2HYNA 1FBMA 3VP8A 2ZFCA 3G3ZA 1SQXK 2P67A 3HE5A 3P8MC 2R5DA 3GHGB 1LGHB 1GDTA 2FKWB 3RK3C 2WITA 3RK3D 5AW2B 5AVWB 2OYHC 1RE3A 2FFDB 1NKNA 3M0AA 5APYA 2A45G 2M8RA 1YTZT 1SQBK 1H88A 4WY4A 2C9LY 1FZFA 2O1KA 3HD7B 1N73B 2Q5UA 2XNXA 1HVVA 1JY3N 3B5NB 1AQ5A 3GHGA 4DZOA 1MFZA 2Z4EA 3EQ2A 1WRGA 2FFDA 3OA7A 4LC1A 3BRVB 4OH8B 5CCGD 1JO5A 1DX7A 1L4AD 1N7LA 1M7LA 4N3YB 3KPEA 1FDMA 3B5NC 2OYIC 2OYHB 4AUWA 2OYIA 4C7NB 1T2KD 1RE3C 2YKOA 2Q7CA 3V5BA 5KJ7A 3TK1A 1LTTC 2KOGA 2A45I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI6 B;  1OXZ A;  3O8Z A;  4B86 A;  3HE4 B;  1GZL A;  3VTP C;  1J2J B;  1JUN A;  5APW A;  2W6A A;  1FAV A;  2C9N Y;  3I5C A;  1NAF A;  2Q3I A;  3OAK A;  3T97 A;  5AVV B;  3B8E B;  2R32 A;  3M0D A;  5AW0 B;  2WPS A;  4HYT B;  2YO3 A;  1FOS F;  3NMD A;  3VN0 A;  4KHX A;  4C7N A;  4C46 A;  1JNM A;  2WT7 B;  2Z5I A;  3LID A;  3VMX A;  4I6M C;  5CMZ A;  1HUC A;  1MUU A;  3VMY A;  3TYY A;  3P7K A;  3M9B A;  3HE4 A;  3VYI A;  3MD0 A;  2ZXE B;  1DH3 A;  3L36 A;  2W27 A;  1H89 A;  1X8Y A;  5AW5 B;  2WT7 A;  4EOT A;  2XV5 A;  1GU4 A;  5AW4 B;  5APX A;  1H8A A;  1CSB A;  3NTN A;  2WTY A;  5AVY B;  4RES B;  2E42 A;  1IO4 A;  5AW3 B;  4JYC A;  2YNY A;  3M9H A;  1HBW A;  3KDP B;  1GK4 A;  2QM7 A;  5APV A;  4GKG A;  3A5T A;  2WPR A;  2XZR A;  2WWW A;  5AVQ B;  3VMZ A;  5APQ A;  1CI6 A;  2ZFC A;  2P67 A;  3HE5 A;  3P8M C;  4AQR D;  2R5D A;  1GD2 E;  5AW7 B;  2H7H A;  3UIA A;  5AVZ B;  5AW8 B;  3A3Y B;  5AW2 B;  5AVW B;  1T2K C;  1OWA A;  1HJB A;  2XU6 A;  1YYC A;  1MV8 A;  3M0A A;  5AW1 B;  3HTK A;  3L35 A;  5APY A;  5APS A;  2WPQ A;  4AYC A;  5AVX B;  1A02 J;  3HE5 B;  2JJL A;  3A2A A;  4XE5 B;  1H88 A;  3IR9 A;  1SLQ A;  2C9L Y;  2N9B A;  1NWQ A;  5AVS B;  2VRS A;  2Q5U A;  2YO2 A;  2IPP A;  2Z5H A;  3TNU B;  1G2C B;  5AW9 B;  1GU5 A;  3M06 A;  2E43 A;  5AW6 B;  3M91 A;  5AVU B;  4JYB A;  5APU A;  3V4Q A;  5AVT B;  4DZO A;  1MFZ A;  3LIE A;  1S9K E;  3NFQ A;  1CZQ A;  2P2U A;  4M3L A;  3MGN A;  3A7O A;  4LC1 A;  3P32 A;  3TNU A;  2BAS A;  1KQL A;  1GTW A;  1S9K D;  1A02 F;  2R3C A;  3L37 A;  3KQG A;  2P7J A;  4GT1 A;  5AVR B;  1FOS E;  1GK6 A;  4AUW A;  3NXS A;  3SWF A;  4C7N B;  2KP8 A;  1T2K D;  4I2L C;  2Q7C A;  3V5B A;  2QM8 A;  5APT A;  1HWT C;  3TK1 A;  3V4W A;  2R5B A;  1SP4 A; 
#chains in the Genus database with same CATH topology
 3KXD A;  1CI6 B;  2FY8 A;  3PJS K;  3L72 D;  4W7Z A;  3AE9 C;  1LTA C;  1WMK A;  2R44 A;  5E79 E;  1LT1 A;  1GZL A;  3C1L A;  3WUV A;  2NPS A;  3HUS B;  1JUN A;  1AQT A;  4KT0 J;  1KTM A;  3H6P A;  2KK7 A;  1FS0 E;  4RJT A;  3L73 E;  1HGZ A;  2B88 A;  2IBZ I;  1Q2N A;  1YHQ P;  1NTZ J;  1NTM K;  3TF5 A;  2FXP A;  2WPS A;  4HYT B;  4Y99 B;  1OW8 A;  3LW5 H;  2IZ0 A;  1PPJ E;  4L76 A;  1KQF B;  4IL6 E;  2E76 D;  2E76 C;  3VMA A;  1N7S B;  1JNM A;  1BSH A;  2H43 A;  2Z5I A;  1BDC A;  3BCC J;  3LID A;  3GF7 A;  2AEF A;  2QJP B;  3E7K A;  1NTZ D;  1ZW0 A;  4A7P A;  3I56 P;  3L75 E;  3TYY A;  1NU1 K;  1YJ9 P;  1FZC B;  2C0X A;  1LWU B;  2W6B A;  1KIL D;  1FZA A;  1HTL C;  3H1K G;  1HH0 A;  1SQX G;  2ZYA A;  3AEF C;  2QRX A;  3VYI A;  1DH3 A;  4NPD A;  1LT9 B;  1SQB E;  3SWY A;  4L74 A;  1JOC A;  3HUS C;  3OW2 O;  2E5Y A;  1H89 A;  1J1E B;  1VQM P;  3CCE P;  1VF5 D;  3FX0 A;  4D6T G;  1GU4 A;  2I8D A;  5APX A;  1VQ5 P;  2OYO A;  3WU2 E;  4OWF A;  2P58 A;  2KS1 A;  5AVY B;  4DOJ A;  3CX5 E;  4JYC A;  1EXJ A;  3D6Z A;  4HJG H;  1USD A;  3U1A A;  3JC2 2;  3ZDM A;  2BEQ D;  4EIJ A;  1J1D C;  3L70 J;  2QG4 A;  3OJA B;  1N7S A;  2XZR A;  1LTJ C;  3FWN A;  3B4S A;  3USS A;  1M1J C;  1U7M A;  1YTZ I;  2E74 D;  2FBW C;  4XFJ A;  1M1J A;  2JWA A;  2YMY A;  1KYO H;  1T8Z A;  1URQ D;  1X0T A;  2JO1 A;  2ZT9 B;  3P8C D;  5APQ A;  4U3F D;  4MN4 C;  3V2R A;  4DT0 A;  1SFC D;  3TGU J;  5BVZ A;  5B66 H;  3A0B H;  2R3S A;  1SQQ K;  1PFI A;  3F5H A;  3RGU A;  3F89 A;  1N2D C;  4U3F J;  1QL2 A;  1RQU A;  3CLQ A;  5CJ4 A;  4BWN A;  3AE4 C;  2PRR A;  5AVZ B;  1Y8A A;  1NYH A;  3A3Y B;  1T2K C;  1USE A;  2FXM A;  2AXT E;  3AEE C;  1NTK J;  3CCV P;  5AW1 B;  2KNC A;  1A02 F;  1IFD A;  3SWK A;  3WUT A;  1L4A A;  1PGO A;  1VQK P;  1CW5 A;  3D6Y A;  4OGQ C;  1AFO A;  4JBZ A;  1S2E A;  4CPG A;  1FJP A;  1L0L D;  5AVX B;  1A02 J;  4H44 C;  1SFC B;  5TIS E;  2QIW A;  2G3A A;  4U3F E;  1Y47 A;  3A2A A;  1M8O B;  2IFM A;  3IR9 A;  3G6E P;  4WY4 C;  3RK2 C;  2FYU J;  2ZAE B;  3TNU B;  2VRS A;  3L71 G;  1GU5 A;  2IPP A;  2Z5H A;  1G2C B;  4U3F G;  5AW9 B;  2IFN A;  3L4F A;  1OFC X;  2N1T D;  3IFM A;  1FZE A;  1NTM J;  2D2C D;  1PP9 D;  3R2P A;  5AW6 B;  1SQB G;  3V2N A;  2FYU E;  2ZVO B;  4JYB A;  1RQV A;  1EXI A;  2E75 D;  3H1K E;  3AE3 C;  2HPC A;  1W5C E;  1PPJ D;  5B5E E;  1S9K E;  1RF1 A;  3U59 A;  3CL3 D;  3NFQ A;  2GUV A;  3D70 A;  2KZI A;  3RK2 B;  3MIW A;  4M3L A;  1PV3 A;  3AE7 C;  3BAT A;  4N6J A;  2RH0 A;  3A7O A;  3H1J D;  3P32 A;  3TGU E;  1KQG B;  2M3E A;  1OZH A;  1KQL A;  1JCC A;  2D2C C;  1OW7 A;  3H1H J;  4PV1 D;  5KAI H;  1W2B O;  4HB1 A;  4PV1 B;  3L37 A;  3KQG A;  2Y0E A;  1BE3 D;  2B89 A;  2A06 D;  3CXH I;  4GT1 A;  5AVR B;  3H32 B;  1FOS E;  1GK6 A;  2A45 H;  5GTH H;  1KN7 A;  1N7S D;  4IOI H;  3SWF A;  1VQN P;  1IFM A;  2L5G B;  4IFF A;  4I2L C;  1KB9 D;  2QM8 A;  1EZV E;  3L72 G;  5KLI C;  1PPJ G;  3L72 J;  1X79 B;  1EZV I;  2ZT9 D;  4YXW H;  4H44 B;  3BRT B;  1SQP E;  1NTK E;  3WUU A;  4PV1 C;  1LWU C;  1OXZ A;  2KLV A;  2XKM A;  1BSN A;  3HE4 B;  1Z56 A;  1P84 I;  4GIF A;  3G71 P;  1N73 C;  1VQL P;  4NPE A;  3ITK A;  3Q1M A;  1OVV A;  1J2J B;  1IFJ A;  1T3J A;  2W6A A;  3AE2 C;  1FC2 C;  1FAV A;  4LLH A;  1N86 A;  2BCC D;  3H1J J;  4I7Z B;  5CCG C;  1Q7Y Q;  3HRN A;  5K5G B;  4ZKU A;  2N1T A;  2IZ1 A;  2KNC B;  2R32 A;  5KLV D;  5KJ7 C;  1SQV G;  4YTP C;  2WSE J;  2GUS A;  2HG5 D;  1BCC G;  2ZVN B;  3AE5 C;  4L73 A;  2K9J A;  4XA4 A;  4UB8 E;  1FZC C;  5KKZ C;  1PP9 E;  1FZB A;  2KYV A;  2M5A A;  2WT7 B;  1LP1 A;  2O01 J;  2WSE H;  2QJP C;  3CC7 P;  1YJN P;  4LGD E;  3VMX A;  2OGU A;  5KTB A;  2E75 C;  3CX5 H;  2WSF J;  2LXC B;  4I6M C;  1RE4 A;  5CMZ A;  1KOR A;  1HUC A;  1LNQ A;  2MKV A;  3PH0 A;  1FDO A;  1R8E A;  2JEE A;  3M9B A;  4PD4 E;  3MD0 A;  4H0L D;  4H0L C;  2BCC G;  2HLO A;  2A06 G;  2IBZ D;  5TIS H;  2PFX A;  2W27 A;  1WT6 A;  1SQP K;  5GTI E;  3CCU P;  1FZG A;  2KB7 P;  1RF0 C;  1VDF A;  2A06 E;  2E5T A;  1IFI A;  5AW4 B;  3GG2 A;  3B5N A;  4IFM A;  1JTH B;  1E79 H;  2FYU K;  5AW3 B;  3H1L E;  4IL6 X;  5CCH D;  1FJK A;  3KDP B;  4WY4 B;  3TGU D;  4GKG A;  5BU8 B;  1L0N D;  2WPR A;  1LT9 C;  1N73 A;  1U7J A;  3CCQ P;  1LT9 A;  1NTM G;  2IBZ E;  2NPS C;  2ZJS E;  3L75 D;  1VQP P;  2BEZ F;  2IYO A;  3T97 B;  5BU5 A;  1CI6 A;  1FE6 A;  2PAJ A;  4TLF A;  4AQR D;  5AW7 B;  2IDB A;  3VOP A;  2W6J H;  2Q1K A;  3L71 E;  1D7M A;  5AW8 B;  1G2C A;  2E76 B;  1OWA A;  1SQX E;  4UB6 E;  5M1B A;  1HJB A;  2OYI B;  2P10 A;  1DEB A;  1YYC A;  1OIP A;  1VF5 C;  3HTK A;  3AE1 C;  2C0W A;  1KYO D;  3L35 A;  1Y9B A;  4OGQ B;  2FYU G;  2B87 A;  1GMJ A;  1SQV E;  2WPQ A;  4JPZ B;  4UB6 H;  5EFW B;  3FXD A;  3H1I E;  3RL0 B;  3S9O A;  3VP9 A;  4AYC A;  4D6T J;  1QEX A;  2K88 A;  5GTH E;  1N8R Q;  2WSF H;  2JJL A;  1NU1 D;  2JDI H;  4O9B A;  1VQ8 P;  1KIL C;  1PP9 G;  1BGY D;  1YJW P;  1GL2 C;  1KFM A;  1P84 H;  4PJ0 E;  1NWQ A;  5AVS B;  3RBZ A;  1IZN B;  2YKQ A;  1QVF O;  3V6I A;  4NPF X;  4OGQ D;  4K3A A;  3M06 A;  5CBN A;  1L4A C;  2M0B A;  1VF5 B;  2LKM A;  3AED C;  3U1C A;  4IFD K;  3B5N D;  3M0D C;  5AVU B;  1KZU B;  3CCJ P;  3V4Q A;  2AEM A;  5AVT B;  3WMM 0;  5C39 A;  3LIE A;  1EZV G;  3P8C E;  1VL2 A;  4ASW A;  2Q9I A;  1KIL B;  1L2P A;  2AEJ A;  1TU3 F;  1IC2 A;  1BGY J;  1Q90 D;  1CZQ A;  1GL2 B;  2J58 A;  1KB9 I;  2YMK A;  3CXH H;  1GL2 D;  1W2E A;  2WPV B;  3TNU A;  4N78 D;  1BCC D;  1KB9 H;  2BAS A;  2MJZ A;  1NHL A;  1T3U A;  1RE4 C;  1JM0 A;  1DEE G;  3RL0 C;  1S9K D;  2KIK A;  1BGY E;  2R3C A;  1JMM A;  2HR3 A;  3W68 A;  3H25 A;  1ZR4 A;  1M1K Q;  2IBZ G;  1SVF A;  1ZME C;  2G8Y A;  4WBA A;  1JEK A;  4WY4 D;  2ITA A;  1PGQ A;  1DD4 A;  1BDD A;  3NXS A;  3H1H G;  2O3J A;  3RK3 E;  2K3R A;  2UWJ E;  3CWB J;  3PHL A;  1HWT C;  5APT A;  4UB8 H;  3QH9 A;  3BVH A;  1ZP0 C;  3C8V A;  1BGY G;  2B87 B;  1JY3 P;  3L73 J;  4K35 A;  5CCG A;  2D2C B;  3H1J E;  4RO0 A;  1URQ A;  1T6A A;  2O01 N;  2WZ7 A;  1KYO I;  2XND H;  1L0N G;  1JMB A;  3FWL A;  1QLE D;  5CCH C;  5KLI B;  3CCM P;  1JY3 O;  1L0N J;  2LR2 A;  3O8Z A;  4R4M A;  3H1I G;  2O01 H;  2BCC E;  3A0B E;  3N4X A;  1ZLL A;  3H1I J;  2M5A B;  1SQV D;  1IK7 A;  2QJK B;  4GDO A;  4W7Y A;  3IF4 A;  1IFP A;  3VTP C;  5APW A;  1LTI C;  2C9N Y;  1M1J B;  1NAF A;  1JY2 P;  1NOH A;  2ZYG A;  3BCC E;  1SQX D;  3OAK A;  1NKZ B;  4TT3 H;  1HGV A;  2FYN C;  3M0D A;  1LTB C;  5AW0 B;  3S1K A;  2GA1 A;  1NTZ G;  4YXD C;  1PL5 A;  2YO3 A;  3S4R A;  1FOS F;  1EDJ A;  3NMD A;  4BXL A;  2HOD B;  1EZV D;  1S72 P;  2K1A A;  4C7N A;  1P84 D;  1GL2 A;  3KYQ A;  4C46 A;  3CCS P;  1K8A Q;  1NTZ E;  2JP3 A;  1NTM E;  3MP7 B;  4RKU J;  1QX8 A;  1S1C X;  2FYZ A;  2IX7 C;  3GMA A;  4U7J A;  2V7Q J;  3MZW B;  1IFN A;  1L4A B;  1RY3 A;  3AEC C;  3Q3D A;  2HPC B;  2JR8 A;  1M90 Q;  1JTH A;  2I1K A;  1MUU A;  2Y0C A;  1SQB D;  1OVU A;  1SQX J;  2HFE D;  3EFG A;  3P7K A;  2AXT H;  5KAI E;  1DD3 A;  3L75 G;  1VQ4 P;  1KQS O;  1RF1 C;  1SQP J;  1LTS C;  1J1E C;  3D71 A;  3TGU G;  5KLV G;  1M56 D;  5B66 E;  2QVA A;  1X8Y A;  4ZKP A;  5TJH A;  5KLV J;  4IL6 H;  3CX5 D;  3H1J G;  2WT7 A;  3L74 D;  1KMI Z;  1RF0 A;  1JB0 J;  2DW3 A;  3N7N A;  1NAY A;  2BCC J;  1LTG C;  1UII A;  3NTN A;  2WTY A;  2E42 A;  1MKM A;  1P84 E;  1S5L X;  4PJ0 H;  4RES B;  1IO4 A;  2Y9Y A;  3JCU E;  3R4Y A;  2YNY A;  2HOD A;  2J59 M;  1J1D B;  3HD7 D;  2RN0 A;  1NTK K;  3M9H A;  5CHX A;  5CCH A;  3CD6 P;  1HBW A;  2Y9Z A;  4W80 A;  2NPS B;  3VMZ A;  3PP5 A;  1N7S C;  4EI2 A;  1YI2 P;  1OVR A;  2WVR A;  1URQ C;  2POH A;  2KLU A;  2M3B A;  3L71 D;  3H1L D;  4Y99 C;  2H8P D;  5KLV K;  2OAR A;  3H1L J;  1PGP A;  5H2F H;  1GD2 E;  2H7H A;  3CXH E;  1SQQ E;  4JF7 A;  3EFF K;  3UIA A;  3Q5P A;  1NU1 G;  1SS1 A;  1RHZ B;  3RK3 B;  3SFD C;  1QVG O;  1FZC A;  3CC4 P;  1DIP A;  2XU6 A;  2N1T B;  2Q3E A;  1MV8 A;  4EYY Q;  4GOF A;  2W8Z A;  5APS A;  1NU1 E;  1AA0 A;  2FYN B;  2KSE A;  3GLM A;  4PD4 D;  3GW6 A;  3MUD A;  2L91 A;  3RL0 D;  3HE5 B;  1KIL A;  2H89 C;  4H0L B;  3L74 J;  4XE5 B;  5KAF H;  1NVO A;  1G1I A;  1OMI A;  1SLQ A;  3H32 A;  2N9B A;  1LP1 B;  1M57 D;  5B5E H;  3FGA D;  1IJD B;  2YO2 A;  3GF3 A;  1NH4 A;  4I1L A;  3KHU A;  1SQP D;  3IN6 A;  1E5W A;  1L0L E;  2N1T C;  3H1K D;  1NU1 J;  3MTU E;  2E43 A;  3M91 A;  1Q86 Q;  1PP9 J;  1NTM D;  1PZQ A;  1LJ2 A;  1SQB J;  2YKP A;  2K37 A;  5APU A;  2Y0D A;  3L74 E;  2JWD A;  1ZV8 A;  1XTG B;  3WU2 H;  2FYU D;  1SQQ J;  4N78 E;  2KI7 B;  3LW5 J;  5H2F E;  1SQQ G;  5CBO A;  1JCD A;  2P2U A;  3MGN A;  1L0N K;  2FFD C;  1L0L G;  2ZT9 C;  1ZRT D;  2PGD A;  1ZXG A;  1S5L E;  3MHV A;  2WSC H;  1L0L J;  2E74 B;  4I7Z C;  1UIX A;  1JY2 N;  1NTZ K;  2YIU B;  3M9Q A;  4HH2 A;  1EQ7 A;  1ZN5 A;  3L70 E;  1SFC A;  4ASV A;  2CK3 H;  3Q5S A;  1VPC A;  1ZR2 A;  3PLN A;  1K04 A;  2KXP B;  2P7J A;  4H13 C;  2NRG A;  1GW4 A;  3HUS A;  1LTJ A;  3JSV C;  2K9Y A;  2GM4 A;  2KP8 A;  3CXH D;  3BCC G;  4JQ0 D;  1NO4 A;  2ZXX A;  3H1I D;  5KJ7 D;  3G4S P;  3G9R A;  2KSJ A;  3V4W A;  2YXR B;  5KAF E;  3II6 A;  4Z1M H;  1HJ0 A;  5DJU B;  1GK4 A;  2R5B A;  1H0T B;  1SP4 A;  2P1J A;  1XTC C;  3Q5R A;  1YQ3 C;  3CWB G;  2PP6 A;  1SQP G;  2RKL A;  3L70 D;  4H13 B;  4B86 A;  3CCR P;  2CPS A;  3BAS A;  3HTK B;  4H13 D;  2QEX P;  3V2P A;  1EDK A;  1MFT A;  1FU1 A;  1KIL E;  1QL1 A;  3E1R A;  2OYH A;  3B71 A;  3TDK A;  3I5C A;  2Q3I A;  1AV1 A;  3T97 A;  4OVN F;  5AVV B;  2CPB A;  3H1H E;  4DCK A;  3I55 P;  3B8E B;  1PIX A;  1K73 Q;  1VQ6 P;  1SQQ D;  5DJT B;  1JY2 O;  1L0N E;  2WQY C;  3GHG C;  3HD7 A;  1U57 A;  4HKZ H;  1KD1 Q;  2QA4 P;  1RF1 B;  3FXE A;  1EC5 A;  2KUB A;  3HD7 C;  3KZI H;  4KHX A;  4PD4 I;  3RBX A;  3VN0 A;  1BCC J;  1T2K D;  2QE7 H;  4D6T E;  1VQ7 P;  4BRY A;  3H1K J;  2O1J A;  3AEB C;  1S4X A;  1MZ9 A;  2LXB A;  4WB4 A;  3K5B A;  4WWI A;  2KS1 B;  1L0L K;  3JCU H;  3L73 G;  3MUD C;  3RL0 g;  1YIJ P;  3BCC D;  3VMY A;  1R5S A;  2OTK E;  1SFC C;  2W83 C;  4YPC A;  1NJI Q;  3HE4 A;  2I1J A;  2ZXE B;  3O6Q B;  4ZMD A;  3L36 A;  2V7Q H;  2NPS D;  1KV4 A;  1BE3 G;  3AE6 C;  2QSI A;  3QWO C;  2H88 C;  1Q82 Q;  3CCL P;  1AVO A;  3C9I A;  5AW5 B;  1R5L A;  3L70 G;  4EOT A;  2E74 C;  1FDI A;  2XV5 A;  1H8A A;  2XDJ A;  1CSB A;  2AXC A;  3A0H H;  3CI9 A;  3E1I A;  1X9V A;  2JKV A;  1RH5 B;  4D6T D;  5E79 H;  2IYP A;  1KFN A;  4C7R A;  2K9J B;  5CJ0 A;  1LWU A;  1G1J A;  2QJK C;  2QM7 A;  3L71 J;  3PRJ A;  4Y28 J;  5APV A;  1S5L H;  3TSI A;  3H1L G;  1IK9 A;  1GW3 A;  3A5T A;  2WWW A;  5AVQ B;  1SQV K;  3RK2 D;  3V2Q A;  1URQ B;  1LTJ B;  2HYN A;  3A0H E;  1KC8 Q;  1YQ4 C;  4R4L A;  2W90 A;  2OTJ P;  1BE3 J;  1FBM A;  3VP8 A;  4WVZ A;  2ZFC A;  3G3Z A;  1SQX K;  2E75 B;  2P67 A;  1EDI A;  2YXQ B;  3HE5 A;  3P8M C;  3CC2 P;  2R5D A;  3CWB E;  3GHG B;  1X22 A;  3H1H D;  2QJY C;  1H0T A;  1AVY A;  2SPZ A;  1LGH B;  2WSS H;  3O6Q A;  2FKW B;  2WMM A;  2WIT A;  4GOE A;  3RK3 C;  3RK3 D;  3SFE C;  5AW2 B;  3L75 J;  5AVW B;  2OYH C;  1RE3 A;  4EDF A;  4BRY B;  2FFD B;  3L74 G;  1NKN A;  3IAO A;  3M0A A;  4QMA A;  5APY A;  3CPW O;  1K9M Q;  2A45 G;  2M8R A;  2V4H A;  1NGM B;  2B9B A;  1YTZ T;  2N9Y B;  4KJM A;  1SQB K;  1H88 A;  4WY4 A;  2QJY B;  2C9L Y;  1FZF A;  2WSC J;  2O1K A;  3CX5 I;  1YIT P;  1GTW A;  3HD7 B;  1N73 B;  2Q5U A;  3L72 E;  4L75 A;  1S3J A;  3Q2Y A;  1VQ9 P;  2XNX A;  5L8R J;  1HVV A;  1AJY A;  3PTZ A;  1JY3 N;  3SSU A;  3CME P;  1BE3 E;  1YBK A;  1GDT A;  4PD4 H;  3ABV C;  3AEA C;  3AE8 C;  3B5N B;  3GHG A;  4DZO A;  1MFZ A;  1AQ5 A;  2OQQ A;  2ZYD A;  2Q6Q A;  2Z4E A;  3EQ2 A;  4GOD A;  1WRG A;  1KB9 E;  1NTK D;  2FFD A;  2NZ2 A;  3OA7 A;  5KKZ B;  5KLV E;  4LC1 A;  1NTK G;  3BRV B;  1OW6 A;  3AEG C;  4OH8 B;  5CCG D;  1EDL A;  2FXO A;  1SQV J;  1JO5 A;  4H44 D;  1DX7 A;  1L4A D;  1N7L A;  1M7L A;  1PGJ A;  4N3Y B;  3W67 A;  3KPE A;  2J5U A;  1BCC E;  4ZNC A;  1KYO E;  3CMA P;  3B5N C;  2OTL P;  1FDM A;  1HF9 A;  1Q81 Q;  1K05 A;  2OYI C;  2OYH B;  4AUW A;  2OYI A;  3EWK A;  1QGK B;  2RMZ A;  3L73 D;  4C7N B;  1RE3 C;  2YKO A;  2Q7C A;  4DJG A;  3V5B A;  1VQO P;  5KJ7 A;  3CWB D;  3TK1 A;  1LTT C;  2KOG A;  2KZJ A;  1OX3 A;  1ZRT E;  2YIU C;  5GTI H;  2A45 I;  3KZI E;  1ZOY C; 
#chains in the Genus database with same CATH homology
 1CI6 B;  4W7Z A;  1LTA C;  1GZL A;  2NPS A;  3HUS B;  1JUN A;  3H6P A;  1HGZ A;  1NTM K;  2WPS A;  4HYT B;  4Y99 B;  3LW5 H;  1JNM A;  1N7S B;  2H43 A;  2Z5I A;  3LID A;  3TYY A;  1NU1 K;  2C0X A;  1LWU B;  2W6B A;  1KIL D;  1FZA A;  1HTL C;  3VYI A;  1HH0 A;  1DH3 A;  1LT9 B;  3SWY A;  1JOC A;  3HUS C;  1H89 A;  1J1E B;  1GU4 A;  5APX A;  5AVY B;  4DOJ A;  4JYC A;  3U1A A;  4EIJ A;  1J1D C;  3OJA B;  1N7S A;  2XZR A;  1LTJ C;  1M1J C;  1YTZ I;  1M1J A;  2YMY A;  5APQ A;  1T8Z A;  1URQ D;  3P8C D;  3V2R A;  5KJ7 C;  5BVZ A;  1SFC D;  1SQQ K;  1PFI A;  5CJ4 A;  1N2D C;  1QL2 A;  3CLQ A;  5AVZ B;  3A3Y B;  1T2K C;  2FXM A;  5AW1 B;  1IFD A;  1L4A A;  1CW5 A;  1AFO A;  1FJP A;  5AVX B;  1A02 J;  1SFC B;  3A2A A;  2IFM A;  3IR9 A;  4WY4 C;  3RK2 C;  3TNU B;  2VRS A;  1GU5 A;  2IPP A;  2Z5H A;  1G2C B;  5AW9 B;  2IFN A;  3L4F A;  3IFM A;  2N1T D;  3R2P A;  1FZE A;  5AW6 B;  3V2N A;  4JYB A;  2HPC A;  1S9K E;  1RF1 A;  3U59 A;  3CL3 D;  3NFQ A;  2GUV A;  3RK2 B;  3MIW A;  4M3L A;  3BAT A;  4N6J A;  3A7O A;  3P32 A;  1KQL A;  1JCC A;  3L37 A;  3KQG A;  4GT1 A;  5AVR B;  3H32 B;  1FOS E;  1GK6 A;  2A45 H;  1N7S D;  3SWF A;  1IFM A;  2L5G B;  4IFF A;  4I2L C;  2QM8 A;  1X79 B;  3BRT B;  1LWU C;  1OXZ A;  2KLV A;  2XKM A;  3HE4 B;  1Z56 A;  4GIF A;  1N73 C;  1J2J B;  1IFJ A;  1T3J A;  2W6A A;  4LLH A;  1FAV A;  1N86 A;  5CCG C;  3HRN A;  4ZKU A;  2N1T A;  2R32 A;  2GUS A;  2HG5 D;  1FZC C;  4XA4 A;  1FZB A;  2KYV A;  2WT7 B;  2WSE H;  4LGD E;  3VMX A;  5KTB A;  4I6M C;  5CMZ A;  1RE4 A;  1HUC A;  2JEE A;  3M9B A;  3MD0 A;  2HLO A;  2W27 A;  1WT6 A;  1SQP K;  1FZG A;  2KB7 P;  1RF0 C;  1VDF A;  1IFI A;  5AW4 B;  3B5N A;  4IFM A;  1JTH B;  5AW3 B;  2FYU K;  5CCH D;  1FJK A;  3KDP B;  4WY4 B;  4GKG A;  5BU8 B;  2WPR A;  1LT9 C;  1N73 A;  1LT9 A;  2NPS C;  5BU5 A;  1CI6 A;  2PAJ A;  4AQR D;  5AW7 B;  3VOP A;  5AW8 B;  1G2C A;  1OWA A;  2OYI B;  1HJB A;  1DEB A;  1YYC A;  3HTK A;  3L35 A;  2C0W A;  2WPQ A;  4AYC A;  3RL0 B;  3VP9 A;  2WSF H;  2JJL A;  4O9B A;  1KIL C;  1GL2 C;  1KFM A;  1NWQ A;  5AVS B;  2YKQ A;  3M06 A;  4IFD K;  1L4A C;  2LKM A;  3U1C A;  3B5N D;  3M0D C;  5AVU B;  1KZU B;  3V4Q A;  5AVT B;  3WMM 0;  3LIE A;  3P8C E;  2Q9I A;  1KIL B;  1IC2 A;  1CZQ A;  1GL2 B;  2J58 A;  1GL2 D;  1W2E A;  3TNU A;  4N78 D;  2BAS A;  2MJZ A;  1NHL A;  1T3U A;  1RE4 C;  1S9K D;  1GTW A;  3RL0 C;  1A02 F;  2R3C A;  1JMM A;  1ZR4 A;  1SVF A;  4WBA A;  4WY4 D;  3NXS A;  1HWT C;  5APT A;  3BVH A;  1JY3 P;  5CCG A;  1URQ A;  2WZ7 A;  1FZC B;  5CCH C;  1JY3 O;  3O8Z A;  3N4X A;  2O01 H;  1ZLL A;  3VTP C;  4W7Y A;  5APW A;  1LTI C;  2C9N Y;  1M1J B;  1NAF A;  1JY2 P;  1NOH A;  3OAK A;  1NKZ B;  1HGV A;  3M0D A;  1LTB C;  5AW0 B;  2YO3 A;  1FOS F;  3NMD A;  2HOD B;  4C7N A;  3KYQ A;  1GL2 A;  4C46 A;  2FYZ A;  2IX7 C;  1IFN A;  1L4A B;  1RY3 A;  2HPC B;  1JTH A;  2I1K A;  1MUU A;  3P7K A;  2HFE D;  3EFG A;  1RF1 C;  1LTS C;  1J1E C;  1X8Y A;  4ZKP A;  2WT7 A;  3N7N A;  1RF0 A;  1LTG C;  3NTN A;  2WTY A;  2E42 A;  4RES B;  1IO4 A;  3M9H A;  2YNY A;  2HOD A;  2J59 M;  1J1D B;  3HD7 D;  1NTK K;  5CHX A;  5CCH A;  1HBW A;  4W80 A;  2NPS B;  3VMZ A;  3PP5 A;  1N7S C;  1URQ C;  2POH A;  2M3B A;  4Y99 C;  2H8P D;  5KLV K;  2OAR A;  1GD2 E;  2H7H A;  4JF7 A;  3UIA A;  3RK3 B;  1FZC A;  2XU6 A;  2N1T B;  1MV8 A;  5APS A;  3MUD A;  3RL0 D;  3HE5 B;  1KIL A;  4XE5 B;  1G1I A;  1SLQ A;  3H32 A;  2N9B A;  1IJD B;  2YO2 A;  1NH4 A;  4I1L A;  1E5W A;  2N1T C;  3MTU E;  2E43 A;  3M91 A;  5APU A;  2YKP A;  1ZV8 A;  1XTG B;  4N78 E;  1JCD A;  2P2U A;  3MGN A;  1L0N K;  2FFD C;  2WSC H;  1JY2 N;  1NTZ K;  3M9Q A;  4HH2 A;  1EQ7 A;  1ZN5 A;  1SFC A;  1VPC A;  1ZR2 A;  2P7J A;  1GW4 A;  3HUS A;  1LTJ A;  2GM4 A;  2KP8 A;  1NO4 A;  5KJ7 D;  2KSJ A;  3V4W A;  3II6 A;  2R5B A;  1GK4 A;  1SP4 A;  2P1J A;  1XTC C;  2PP6 A;  4B86 A;  2CPS A;  3BAS A;  3HTK B;  3V2P A;  1QL1 A;  1FU1 A;  2OYH A;  3I5C A;  2Q3I A;  3T97 A;  5AVV B;  2CPB A;  3B8E B;  1JY2 O;  3GHG C;  3HD7 A;  1RF1 B;  3HD7 C;  3VN0 A;  4KHX A;  2O1J A;  1MZ9 A;  4WB4 A;  1L0L K;  3VMY A;  1SFC C;  3HE4 A;  2I1J A;  2ZXE B;  3L36 A;  2NPS D;  3C9I A;  5AW5 B;  4EOT A;  2XV5 A;  1H8A A;  2XDJ A;  1CSB A;  3E1I A;  3CI9 A;  1X9V A;  1KFN A;  4C7R A;  5CJ0 A;  1LWU A;  1G1J A;  5APV A;  2QM7 A;  3TSI A;  3A5T A;  1IK9 A;  1GW3 A;  2WWW A;  5AVQ B;  1SQV K;  3RK2 D;  3V2Q A;  1URQ B;  1LTJ B;  2HYN A;  1FBM A;  3VP8 A;  2ZFC A;  3G3Z A;  1SQX K;  2P67 A;  3HE5 A;  3P8M C;  2R5D A;  3GHG B;  1LGH B;  1GDT A;  2FKW B;  3RK3 C;  2WIT A;  3RK3 D;  5AW2 B;  5AVW B;  2OYH C;  1RE3 A;  2FFD B;  1NKN A;  3M0A A;  5APY A;  2A45 G;  2M8R A;  1YTZ T;  1SQB K;  1H88 A;  4WY4 A;  2C9L Y;  1FZF A;  2O1K A;  3HD7 B;  1N73 B;  2Q5U A;  2XNX A;  1HVV A;  1JY3 N;  3B5N B;  1AQ5 A;  3GHG A;  4DZO A;  1MFZ A;  2Z4E A;  3EQ2 A;  1WRG A;  2FFD A;  3OA7 A;  4LC1 A;  3BRV B;  4OH8 B;  5CCG D;  1JO5 A;  1DX7 A;  1L4A D;  1N7L A;  1M7L A;  4N3Y B;  3KPE A;  1FDM A;  3B5N C;  2OYI C;  2OYH B;  4AUW A;  2OYI A;  4C7N B;  1T2K D;  1RE3 C;  2YKO A;  2Q7C A;  3V5B A;  5KJ7 A;  3TK1 A;  1LTT C;  2KOG A;  2A45 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...