3A2LA

Crystal structure of dbja (mutant dbja delta)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
291
Chain Sequence
IEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 105
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2lA00
2JBWA 1CUWA 4X85A 4B0OA 5EHXA 4C88A 4Z49A 1FFCA 3GELA 5AK6A 3DLTA 1H22A 1WB4A 4UUQA 1OILA 3IUNA 5AKXA 2WJ4A 4BP9A 3MGAA 3QH4A 3RKSA 5K3FA 5FPQA 3ZWQA 3V1MA 3B5EA 3MUNA 2PSJA 4FWBA 4FNMA 3KSRA 2PSEA 3ESCA 3WWEA 1ODSA 5JARA 3PI6A 4CG2A 1CUSA 4Y2JA 1TRHA 1XQYA 1XRRA 4UBJA 2Z3ZA 2HL6A 5I9IA 4LXHA 4FFVA 3WKEA 2Y2UA 5D7BA 4UBNA 2OGTA 2WM2A 3WZMA 1HBJA 4G8DA 2ZVDA 1O6GA 5A2GA 1ZIXA 3FYTA 1QONA 4QLAA 2CKMA 1CLEA 3D3NA 2HA3A 2NW6A 3WWDA 4GXNA 1F6WA 1WCYA 1VOTA 4H0CA 1ZD2P 1LPAB 3STXA 3DKRA 1SCIA 2XLCA 2XQKA 4B81A 3O0DA 3WWCA 4WY5A 5BOVA 5BV7A 4RGYA 1JJFA 2CEKA 4GI1A 1Y37A 5FOQA 3IURA 5EIHA 1EX9A 1CUBA 2PPLA 4ZV9A 2O2HA 4AMZA 2Q0XA 4WCVA 5IVIA 2DQZA 1XZAA 2GYWA 5AKJA 4DGQA 2QXUA 1CR6A 4WJLA 2OG1A 1X2BA 2ACEA 2HFJA 1IVYA 1K63A 2CJPA 1T2NA 1QIHA 1XZKA 5A62A 5LIPA 1LPSA 1RYYA 3QM1A 1WHTA 1BEZA 4AXBA 2H7YA 3I2KA 4H35A 4ZI5A 4AZ3A 3BIXA 4GECA 3VVMA 1UK6A 3UUFA 4OU5A 4J0IA 3WA7A 3ZPXA 4FOLA 4I4CA 4EHBA 3FCXA 1MT3A 5K3CA 3O4JA 4JYMA 4CCWA 5HFAA 2D5LA 1VXRA 3DEAA 5J3JA 4J0DA 1GT6A 3O9VA 4ITVA 4X97A 3BF7A 5DLPA 5FUMA 1QFMA 5ALHA 2XUDA 4UFPA 3D7RA 4DSAA 5IVHA 1MN6A 1NU8A 5ALPA 4YK7A 5JIBA 1ACLA 3D59A 4HS9A 2BCEA 3WMRA 5HF6A 1TCCA 4J7AA 3WA6A 2BJHA 4ZV7A 2OPHA 5AI5A 1KU6A 3I2GA 4B83A 1UOQA 5AOAA 1DWPA 2BUBA 4OB7A 3STYA 3C5WP 3HACA 4UHEA 3L1JA 3AZPA 1UK8A 4UBKA 1PJAA 5CMLA 2WU4A 3IIIA 2B9VA 2W6CX 3LP5A 4QEKA 2O2GA 3HEAA 3STWA 3I2HA 1G42A 1E5TA 4GLBA 2C0PA 4X95A 6YASA 2VJCA 1DQYA 4ETWA 4PV7A 3AINA 4C01A 2JGKA 3CN7A 5ALOA 4Q05A 3U1TA 4Y2RA 2GBFA 2WUGA 1MX5A 3IUMA 2VJBA 4KRXA 1DU4A 1VJ5A 3DD5A 1P0IA 1H2ZA 2WHPB 5FV4A 2VA9A 1LNSA 1YAHA 3V1KA 2QS9A 5FP0A 4G8BA 4MQLA 3L1HA 1LZLA 3I6MA 2ZYRA 2EDCA 3B12A 3G0GA 1XZHA 2QXTA 2OQIA 2WTMA 5HQ3A 3DJYA 1W4LA 3DOIA 2P8SA 4KE9A 4QDUA 1EK1A 2XMDA 1XZDA 3O4HA 4FKBA 3OM8A 2QKYA 4E14A 1ZI6A 3WJ2A 5JZBA 1BROA 3C6ZA 3QBJA 4BC1A 2XQGA 5K3FB 2XB6A 3VJKA 2OLEA 2DHDA 4UPDA 3JYHA 3N2ZB 3OTQA 2QUBA 2ACKA 5JAHA 2WTNA 3HZOA 2AJBA 2X76A 5IH7A 4OD0A 4KE6A 1RP1A 5AKGA 4BCDA 4L3WA 1R4ZA 2GZSA 3G0CA 5KREA 5AIBA 1QZ3A 2HA7A 3AFIA 1A88A 5E4JA 4FBLA 4LIPD 2ZJFA 1YR2A 4DMFA 3L1IA 3FAKA 1LPBB 3C6XA 2WHQA 3VJMA 3R41A 2GBIA 4QE3A 5BWBA 5EHNA 5ALSA 5CH5A 2AJ8A 1QIFA 3D4LA 4QDXA 1IUPA 1LZKA 5EFZA 1QIDA 1QIJA 1CUYA 3C45A 4TGLA 5AM0A 2WFLB 3V9AA 3FYUB 4TPKA 1CVLA 5JZ9A 2XUPA 5ALMA 4BDTA 2XT0A 2X5XA 5AJHA 7YASA 4K2AA 4X94A 1QO7A 1EHYA 2RHTA 3M82A 5ALKA 3VKFA 1Y7HA 4H7FA 2V97A 1JI3A 4A16A 4BAZA 4J0CA 2ZYHA 1CUJA 1BEEA 1JT2A 3H2HA 1ZD3A 2BUAA 4GDMA 3QMWA 1GGVA 4Y2UA 1RWQA 4E15A 1QGED 4WDQA 5AIAA 1UKAA 1QJ4A 1MNAA 2QZPA 3DL7A 3LS2A 5D3ZA 2CBGA 1R50A 4XWGA 2CMFA 1XZEA 3BL8A 4ARBA 5EHQA 4QDOA 4BVJA 2QOEA 3AUKA 2V9ZA 2GZRA 5HK8A 3C87A 1VXOA 3A2NA 4WFIA 4C6HA 1XRQA 4UBMA 3FLAA 4MJ3A 2XUFA 3W2TA 1F0NA 5HF8A 4HTAA 3O4IA 3H0CA 5BWCA 1S8OA 5CT6A 1TK3A 4H7HA 3W9BA 1E8NA 5AH0A 2OGSA 5JAUA 1XZIA 4GWLA 2K2QB 2WHPA 5SYNA 3H18A 2H9YA 4U2GA 4Q34A 5KWJA 1XROA 3ICVA 4K6GA 4OB8A 4KAAA 4N5HX 2WIGA 4H7JA 1LBSA 4CCYA 4G4GA 2WQZA 2Z8ZA 2Y1KA 1A8SA 3EQ8A 3KDAA 5C7YA 1ZGCA 1EB8A 4BZWA 1MX9A 2PSFA 4EY6A 3FNBA 3PF8A 1Z68A 4B80A 3WKDA 5LYYA 1B41A 5ALYA 4DNOA 2JGEA 3UUEA 2OCIA 3PDCA 4FNGA 1JMKC 1XLWA 1VLQA 5LZ4A 5ALRA 1SC9A 1UK7A 3T4UA 4QZVA 1XZFA 1JJIA 5AI8A 5T4EA 3DQZA 3STVA 5JASA 4L72A 2WFLA 1EA5A 2WIDA 1K6EA 3WKCA 2G5TA 2XUJA 3E4DA 3A6ZA 3C6BA 2PU7A 1TAHA 1R9NA 1Q83A 4ARAA 3FLBA 2HU5A 4FLEA 3C8DA 4X90A 5LLSA 1ZD5A 3WK9A 2XDWA 3WZLA 4X6UA 4JNCA 5K3DA 1XZCA 3C6YA 4EB0A 4MEAA 1QTRA 4BP8A 1CUGA 2XUGA 3OC0A 4D9JA 2Z3WA 3WK7A 2J4FA 4CFSA 2HADA 3TGLA 5K5EA 5E4YA 2XMSA 1SOMA 5AM1A 4KACA 5DYTA 1YSCA 5CT9A 1E8MA 3PUHA 1XQXA 3KXPA 2YH2A 2WG0A 3GUUA 5LKAA 3N0TA 4PF1A 2IITA 4PSDA 1G4HA 3G9UA 4EBBA 4C87A 3G9TA 2AJCA 2ONCA 1GKLA 4OSEA 1EI9A 3I1YA 4ROTA 4RE6A 1MX1A 1OCEA 4G9GA 1MNQA 2AJDA 4X93A 3AIMA 1LPOA 3AZOA 5CXXA 4F60A 4ZGBA 5I8PA 1W6RA 4DMCA 4LHEA 2AXEA 4DTCA 4WFKA 4IH4A 2WUDA 3HABA 1TIBA 4B7ZA 1N5MA 3VDXA 2R8BA 3W05A 4H7IA 4AB1A 3EQ9A 1UT6A 3MUOA 2XUKA 1QFSA 2XMBA 3ANTA 3G9ZA 4P9NA 4JH0A 1C7JA 1K8QA 3RK4A 2ZYIA 3T52A 1HL7A 3NUZA 2DFPA 3FSGA 5EIAA 4J0KA 1W76A 4G4JA 3D2AA 4Y2YA 4W1RA 2O7VA 2OAGA 4MEBA 4KE7A 5CXUA 1AQLA 1HLGA 3DNMA 5AKHA 4HRXA 2WIFA 5ALDA 1MJ5A 2Z8XA 4U2EA 3K2IA 1Q0ZA 4DMHA 3R3UA 3R3YA 4NS4A 1U8EA 1K5PA 4YASA 4PO3X 4KAJA 1P0PA 3CCBA 2XQJA 1W1IA 2YASA 3R3XA 1IMJA 1LPMA 5C81A 5JD5A 3LIPA 5E4TA 2G4LA 4EZIA 2WFMA 1IZ7A 3I6ZA 4UBOA 2WLSA 1Q0RA 2PUJA 1XRMA 4OYYA 5JADA 3DL4A 1QIIA 1ETHA 2GBGA 5HZGA 1BN7A 5CTAA 4DIUA 4J0GA 1ZGBA 1B6GA 1GPKA 1CUEA 1ZI8A 5DNVA 4CI9A 1WB6A 2XMGA 3H19A 5DYYA 2BAGA 5AM5A 4Y2TA 1JU3A 2J3DA 1XQVA 2OCKA 3EBLA 3PICA 1XRLA 3G7NA 4DM7A 4UFNA 3OOSA 4FLFA 3D2BA 2I3ZA 2OCGA 3EIOA 3WL8A 3HSSA 5ALXA 4N8EA 1CUDA 3FCYA 3IA2A 2O7RA 3GZJA 1NU6A 1XFDA 1N5RA 3WL6A 2RIPA 1I6WA 2I78A 2AJLI 4IO0A 2RI6A 1ODTC 4IH1A 4Y2PA 5DTJA 1XQWA 1L7RA 4J3JA 2X8BA 2ECFA 4QLOA 1QO9A 3W9UA 3E3AA 4BTVA 2XMQA 1YS2X 2I03A 3ESBA 1HQDA 5ALTA 2QJRA 4MYDA 3SWWA 1CUCA 4BTLA 4X6XA 1K4YA 4F0JA 1SCQA 5LZ2A 4BCCA 4Y2SA 4JYPA 4HVTA 1KEZA 3AZQA 3G02A 4RE5A 3QYJA 5FDFA 2QJWA 4MQMA 1THGA 1LPNA 3ANSA 3IUJA 4AN0A 4U2BA 1LBTA 4BAUA 2PSDA 5AK5A 2DR0A 1FFEA 3DKKA 4W1PA 2VSQA 4KEAA 3H1BA 5LKRA 1MPXA 2RGUA 4MWSA 3K9BA 2HM7A 5C8VA 1XLVA 4K5QA 2JEZA 2DSNA 1CEXA 1NX9A 4OB6A 5ALUA 3FLEA 2HA2A 3O4GA 1LLFA 5DWDA 1X2EA 4NVRA 1QTIA 4FTWA 1PV1A 1M33A 3LLCA 3F8SA 3AJAA 5AKZA 1FJ2A 5H3HA 4V2IA 3QZUA 1UFOA 3R0VA 1BCRA 4Y2QA 4IH9A 1E3QA 1DX6A 4BE4A 3I28A 3HXKA 1P0QA 4YPVA 3BF8A 5AM3A 1VA4A 3D5EA 1EXWA 3AIKA 2HRQA 1XZJA 2PSHA 1FSSA 2QMQA 2UZ0A 3I2JA 4PSCA 5LP1A 5K3AA 2BFNA 4Y9SA 5AK3A 2HA5A 1C7IA 4PSUA 3WL7A 4KJXA 1R88A 2QR5A 3H2KA 4W1QA 3STTA 1FFBA 2HFKA 1QOZA 4KAFA 4X7BA 4H77A 3C5VA 3F9CA 3F96A 1ISPA 3NWOA 3C70A 5JD4A 1IUNA 1EVEA 3ZV7A 2Z5GA 5JAOA 3WIBA 5ALGA 4HZGA 4Q3KA 5AKKA 2J3QA 2XMRA 4UFOA 5AP9A 1N8SA 3AIOA 1EK2A 4BDSA 3H04A 1EINA 1E8DA 5A7FA 1LGYA 2EEPA 3S2ZA 2PUHA 1R1DA 3WL5A 3W04A 3FWHA 2WUEA 1CUVA 2JF0A 2YYSA 2H7CA 3H2IA 2XLBA 1A7UA 4FFWA 4BC0A 4RPCA 5HQ3B 2EDAA 3PFBA 5JALA 4I19A 3G0BA 3BJMA 4K6HA 2E3JA 4BRZA 3V48A 5CH3A 5AKIA 2C5GA 4AO8A 4WDRA 4X92A 5FKJA 2OAEA 4H7DA 2BUCA 3I6YA 4CIBA 4LYDA 2DCMA 4CCYB 3CN9A 1TQHA 2WILA 4XVCA 1VE6A 1GPNA 4I3FA 3RARA 4OU4A 1XRPA 3C8HA 3DDUA 4KRYA 3QPDA 1EB9A 2JEYA 3I2FA 4W1SA 3CXUA 2H7XA 4BBZA 1SCKA 1T4MA 1GZ7A 1X70A 3G8YA 1GXSA 2WUFA 5JAPA 1USWA 4UHBA 3OG9A 1DWOA 2C58A 5JD6A 2H1IA 5IKXA 4H7EA 3AILA 3ZLTA 1IZ8A 4U2FA 5EHZA 3DS8A 4OUKX 1E66A 2WJ3A 4X71A 4PQEA 3S8YA 1H2WA 3FYUA 4AX4A 4FMPA 4QDTA 2IX9A 5LZ9A 2XUQA 5SYMA 4WFJA 5JATA 3R3VA 5HCUA 1XZGA 3E0XA 4G4IA 5C8ZA 1DT3A 4RNCA 4C89A 2WG1A 3HLKA 4ZXFA 1Y7IA 2V98A 4JEIA 4OYLA 3WJ1A 4J0JA 1H2XA 3WKBA 3M3DA 1E89A 4L9AA 1VZ3A 1ZI9A 1OXMA 2HDWA 4IQ4A 4QWMA 3ESDA 3PE6A 5JANA 4BAGA 5CRIA 1F8UA 1MU0A 4BVLA 2Y6VA 3I2IA 3WK8A 2GYUA 1ORWA 1ZOIA 4GHWA 5T4BA 3G0DA 1MAAA 2XE4A 2PM8A 4N5IX 3BJRA 2PKYX 4HXGA 4UHDA 3BE8A 4B85A 2VJDA 5HK9A 3SX4A 5AI6A 4DNFA 2DHCA 2C4HA 4B9EA 3V1LA 4M0EA 3JW8A 3SC2A 3PUIA 1G66A 2XUHA 3ED1A 3U0VA 1WPXA 4X91A 1ZJ4A 4QNNA 2ZJ7A 3HJUA 5CT8A 2D0DA 2OXEA 3WWOA 1DQZA 5CBKA 3F67A 4G1FA 2WFZA 4UHFA 3H2JA 1DT5A 4Q3LA 1BS9A 5AICA 2BKLA 3TJMA 1AZWA 2VT6A 5AK4A 4HXFB 5LZ7A 1CUIA 5DNWA 4U2DA 1WHSA 2XI4A 1YB6A 2VAVA 4IHAA 2BGNA 2VF2A 5C8XA 1QIEA 1YAJA 4GW3A 2B4KA 2IIVA 1AC5A 1JJBA 1TKRA 1J07A 2YXPX 1F0PA 4Q3OA 4H7KA 4DSZA 1SFRA 4NMWA 5CURA 1ZJ5A 1ZICA 4BB0A 4ZWNA 3A70A 4LKOA 3OURA 2JGFA 5DNUA 1UOOA 1CUAA 3ZLVA 2QRUA 4E46A 4N8DA 1UKBA 5A7HA 2OGZA 1UXOA 2QVBA 2VAXA 5HF9A 1P0MA 5T4HA 1MTZA 4XJVA 4K6KA 1QE3A 1CUXA 2FJ0A 3KOOA 2G63A 3NGMA 2QT9A 5LZ5A 2PVSA 3BIWA 1AUOA 1U2EA 4MXDA 5AKYA 1CUZA 5EI5A 5A7GA 1L7AA 5AI0A 5IVDA 2VEOA 3QMVA 2VT7A 3QMMA 5CH8A 5HKAA 1U65A 3WK5A 3WI7A 1AGYA 1BU8A 4BZZA 1AX9A 1YB7A 2WG2A 4F5ZA 1CFJA 4O08A 4J03A 3QPAA 2GBCA 1WB5A 4GEGA 1MO2A 5K3BA 2B61A 1R3DA 5AKEA 1VE7A 4XIIA 3IBTA 2CZQA 5ALJA 1G5FA 5ALEA 4C4YA 2XUOA 5ALQA 5FRDA 5HKBA 4C4XA 4TVKA 1XZBA 4DNQA 3WK4A 2WSLA 2ZSHA 3B3QA 5AI4A 5FXMA 4FHZA 2WIKA 1DINA 3FVTA 1CUUA 1CQWA 2JGLA 3QVMA 4BYMA 1ACJA 4FDMA 3EQ7A 4BATA 4DNPA 3RM3A 3R3ZA 3HC7A 2OQVA 2FUKA 1D07A 2XMZA 5YASA 3OPMA 5T4FA 5HF5A 4B9AA 5A71A 3HRHA 2ORYA 4J0HA 1Q84A 2HU7A 5CT4A 3LCRA 3ZLUA 2WKWA 2GYVA 4ZRDA 3M81A 4G8CA 2CB9A 4AO7A 4U2CA 2J4CA 5F4ZA 1JMYA 1YCDA 4M0FA 4CG1A 3F98A 3KWFA 1KU0A 2JGIA 1DX4A 3UMJA 3WIOA 3H17A 1QIKA 1MAHA 1QIMA 2QTBA 3BDIA 4H18A 3FBWA 3IUQA 4FBMA 3BDVA 2I3DA 4B6GA 3MVEA 1A8UA 1EDBA 1UZAA 2VJAA 3K6KA 5ALWA 1EDEA 3Q8WA 2WHRA 1VA5A 2XUAA 2JGJA 3FSGD 3VISA 1XZLA 2XQIA 1GQSA 3HI4A 1FFAA 4AMYA 3GBSA 4AN1A 2DHEA 1O6FA 5JYCA 3DOHA 4UHHA 2W22A 4HRYA 5ISMA 3A2MA 3D0KA 4OPMA 1PFQA 2VATA 5AOBA 4M0MA 3R3WA 5AHXA 2ZYSA 1CPYA 2RHWA 4Y2VA 2C0QA 1H23A 5FLKA 1J06A 1H2YA 2LIPA 4S0XA 1C4XA 3A2LA 5KWIA 5K3EA 2ZJ6A 4PNZA 1HPLA 5HFNA 4Y7DA 3WWPA 4E11A 2XQFA 4Y2XA 2WJ6A 5CT5A 3G0IA 4EY5A 1UK9A 2FJPA 3DYIA 5FPPA 4LXIA 3SK0A 3C43A 2HA4A 3E1GA 3ZI7A 1GKKA 3O9MA 3TEJA 3P2MA 1QLWA 2QUAA 1CRLA 5D6OA 4QA9A 2Y2VA 3IVMA 1QIGA 1ORVA 3YASA 3ESAA 1CUHA 1XKTA 2OCLA 4CIAA 1EVQA 2PBLA 1N1MA 5AM4A 2CUTA 4EA6A 3KD2A 1W52X 1JKMA 3VJLA 1AKNA 1TCBA 3LIIA 4EY8A 1YA8A 3TRDA 1DWQA 4AQDA 4WY8A 3R40A 4XX1A 5ALIA 1EH5A 4P93A 2PL5A 1LPPA 1VZ2A 1J2EA 4LXGA 5ALLA 3I1IA 1JFRA 3BXPA 1CV2A 2O2IA 1YA4A 3VXKA 4FLMA 4P08A 1W75A 4BE9A 2B20A 1ZD4A 2HIHA 5IVKA 2PU5A 3D2CA 1XRNA 2G5PA 4PW0A 4G5XA 5ALVA 1WM1A 5EGNA 2XMCA 2ZSIA 1VKHA 1A8QA 4X3CA 1BRTA 4B82A 3Q0TA 4JUIA 3H2GA 3WQHA 1XZMA 1CQZA 1CUFA 1THTA 1U4NA 1BE0A 1R9MA 2R11A 4F21A 5ALNA 5DTIA 1HKHA 4LYEA 3V1NA 5ALFA 3WLAA 4UBIA 4DLNA 2QM0A 2XUIA 3G9XA 2WIJA 1BCSA 3IULA 4EY4A 1GQRA 1YASA 5AI9A 2WU3A 1JU4A 5LZ8A 3O95A 4ZREA 3IB3A 2C5FA 3ILSA 3HYSA 1UOPA 1EDDA 4Q1VA 3EF3A 3FOBA 4X00A 4BRSA 3H1AA 4KR0A 1BN6A 4G9EA 2RAUA 2ROQA 3GA7A 3F97A 5E2IA 1AURA 1XKLA 4QDZA 2HRRA 5ESRA 3NOXA 2HHAA 4GBGA 2Y6UA 4UHCA 2DQYA 2JIDA 3WYDA 4N8SA 4EUSA 1TCAA 3PFCA 4Q82A 2ES4A 2V96A 4KE8A 3W06A 3FYUC 3KWJA 1DTEA 3M83A 4CG3A 5D3KA 2JGMA 3QITA 4OCZA 3FVRA 4B84A 4HXEB 5JZSA 3GROA 4EY7A 4DYHA 3CCCA 3JWEA 3DCNA 4NZZA 3GFFA 2HU8A 2HA6A 5DJ5A 3BWXA 4AZ0A 1AMNA 4A23A 4DMKA 4B0PA 2RONA 5ALZA 4BVKA 4C4ZA 4KYVA 2C7BA 1FFDA 4A5SA 5I7UA 1ODCA 5AOCA 4HAIA 1WPRA 1HDEA 3PF9A 5KBYA 1CIJA 4BCBA 4MYSA 5AM2A 2BGRA 3VVLA 1WOMA 5DYWA 2HA0A 4W9RA 3WK6A 5AKLA 4UBLA 3STUA 4YX9A 5AO9A 1J1IA 3IDAA 1ZIYA 1UWCA 5EIEA 3QPCA 3ICWA 1GPLA 3RLIA 1IUOA 1UKCA 4INZA 2FX5A 3X3HA 2VTVA 4MWTA 4X6YA 5A6VA 5CW2A 2PX6A 4L0CA 4QWWA 2VQ6A 4AO6A 1YS1X 4P92A 3DYVA 1L7QA 4W63A 3WYNA 1XLUA 3WKAA
chains in the Genus database with same CATH superfamily
4IZOA 4MA0A 4M6WA 2PEYA 2V4ZA 2GSDA 3TLJA 4EI2A 1I3MA 1XYGA 2NX2A 1WZUA 4LHVA 4RK1A 5IWCA 2AOUA 3GELA 4PAQA 2BF7A 5G40A 5AW4A 1WW2A 3LW7A 3NWBA 2JCGA 3FOAA 1I3OA 1QVAA 2WSIA 4KL8S 2OC9A 2Q6VA 3H97A 2Z2JA 4Q9IA 3ZQUA 1Z7EA 3LYHA 3P2JA 5JSUA 4C7JA 1E2GA 5J1TB 3MGAA 3RC2A 3QH4A 3VKWA 4OVKA 3LNCA 3RKSA 1WF3A 1L5FA 4CN8A 5K3FA 4F5YA 5CA1B 2E1RA 1O9HA 4DLLA 4UQLA 2WJWA 3B5EA 1D1PA 1EE1A 4QUBA 1R12A 3SR0A 3TPFA 1SKYE 2PO7A 3TLGA 1SKYB 1T4CA 4DJ5X 2A35A 1UCFA 2LGJA 1KH1A 4FNMA 4ZT3A 2VHWA 3RVRA 2GESA 2ZJYA 2W2QA 4KGVA 5K3OA 1JR3E 3EZNA 4QFMA 3BK1A 4GM1A 1BU5A 4B75A 4Z51A 4XIFA 2VJMB 3JD3A 4JI6B 4E51A 1NR5A 4G5SA 5F3WB 1CS0B 3C5CA 1CUSA 3L7NA 4Y2JA 3DTVD 4C4SA 4EMUA 1A7JA 1TRHA 4IOKA 2XCQA 4YUZA 1N77A 1X1BA 4J16C 3AEQB 3TK1A 5I9IA 4EO7A 4LXHA 3L7IA 1KL7A 2WKRA 1NRIA 4CLRB 3U09A 1V6CA 3O9ZA 2VPZA 2IPOA 4F8YA 3IAM6 4Z2AA 3RSLA 5BW8A 2SNIE 3MWDA 1RXIA 2QL7A 4OMFG 2OGTA 1CQIB 3ZBPA 3OQIA 3HH8A 4YRSA 1P9NA 3LY7A 2P6NA 1FS6A 1GTVA 2ZPTX 1NATA 3A1DA 2PH7A 3NZEA 1W9HA 4ZT7A 4QLAA 1QONA 2CKMA 1ZG3A 3TAHA 5DN6D 4WHMA 4MW2A 3EFBA 3SC3A 3E53A 5KSPA 3WWDA 1TQ6A 3N7UA 1OFUX 1JFFA 2WB4A 2IOFK 3CISA 5EEHA 3W1EA 1F6WA 1QE0A 4FYPA 1FYVA 4DR7B 1NURA 2Q0HA 4H0CA 2HOQA 4DRZA 5BNIA 1AKYA 1DIAA 3BBPA 1JKFA 3V2IA 1LPAB 3MOSA 2XLCA 5DRYA 2XQKA 2B83A 4Q0MA 3HVHA 4EHHA 4HP8A 4CIXA 2XW6A 3O0DA 4Q4JA 3G17A 2XEDA 4LAFA 1DVRA 3PFGA 4WADA 1BD4A 1ND6A 5ILOA 1PJQA 2ZE7A 3B1YA 3KVVA 4B4UA 3NPAA 4G85A 5C8YB 3COSA 1LDMA 1N5OX 3CF0A 4IQGA 4JHXA 1A5AB 4WY5A 3WYCA 3ZCPA 1HEYA 2Z1DA 1NR7A 1E98A 4DQVA 4QRDA 4ZZ2A 1JJFA 3NCTA 1MDBA 3STHA 3JQFC 3AEUA 3KVOA 2NG1A 5EUCA 5EIHA 4XAQA 2YV5A 5AVVA 4RS3A 3VU3A 3NC0C 3KQNA 3EMBA 1K86A 3OUZA 3ZWNA 2B4RO 4MJLA 3HS3A 1M67A 4H1UA 4L6AA 1N6OA 4TV8F 4DCUA 3ELBA 2JD1A 2Q0XA 4EYOA 3PENA 4CF5A 2QN7A 1V11B 1GNVA 5IYZA 1XZAA 2GYWA 2XB4A 4MRMB 4HVCA 3REQA 4CLOA 5I4BA 3VR5H 4WJLA 1W4BA 1FUKA 1PHPA 3KJXA 2P2DA 2GF2A 3LWZA 1X2BA 1U3UA 1V47A 2D1FA 3ESYA 3IH5A 1K9VF 3MYRA 4O1MA 2IXFA 2ZB7A 1RQRA 2ACVA 1L0BA 4CT0A 1F60A 1H5NA 1BDHA 4PLTA 4KH0A 3GRRA 4TUYF 1E99A 4AF8A 5ITZB 1JR3D 1ZVVA 3B2EA 4P36A 5ADVA 4NEQA 2BFFA 4ISCA 2JI4A 1QG2A 4AXBA 2ODEA 2GN6A 2H7YA 3MGCA 3CUKA 4NYJQ 2ETXA 1RS0A 1DV1A 1TYDE 3FOWA 3LBNA 1KY2A 4H35A 4MVWA 3H9EO 1OAAA 2RJ3A 5JXGA 3VM6A 2GXAA 1JHZA 4LTNA 2IYLD 2XR1A 1FRZA 5BYBA 2GZDA 2W58A 1G21A 2H00A 2COKA 2WKQA 4R1UA 5LUAA 4OU5A 4W82A 4J0IA 3RJ9A 2IEAA 4IDFA 3TYXA 4FUQA 2NU9B 3TQTA 2RBKA 3T4PA 1TK2A 2XTAA 4NBLA 1RIIA 4KQGA 2XNDD 1O7JA 2AHOA 3U4GA 1E69A 3IVXA 1OD6A 1SUFA 2W2LD 5LN1A 5E38A 1QHXA 2OC4A 2B8TA 3QK7A 2IIPA 3SZGA 3O4JA 3D8UA 5LSAA 2XE8A 2Q8NA 2C4UA 1GJRA 5HFAA 1O94C 1AK2A 3WQQA 4P0QB 5C80A 2AWNA 1KK1A 2P0AA 4UMDA 3ZVRA 2AK2A 1Q7TA 3NRBA 2XJ4A 3PLRA 5IP5A 1SQFA 1YJXA 3DEAA 3F3YA 1T2VA 1YE5A 4IIUA 4CQMA 3O9VA 2JH9A 3DAHA 4P4GA 4ZYZA 5IPFA 5J2UF 1Z0KA 2X3YA 4MV4A 4D9EA 1SKBA 2WVHA 2NOAA 3CT4A 4ITVA 4NJMB 5AJWA 2ENUA 3DXFA 3R74A 1K9SA 3SHTA 4DJEC 2JHGA 4X97A 3BF7A 4RACA 2O0MA 3LK7A 5DLPA 3AFNA 1V8ZA 5LBTA 1RPNA 3WG9A 4RMJA 1F3OA 3OCUA 1JHPA 2XUDA 2X4IA 2YDXA 4ND6A 5GIPE 4KBYA 1O08A 1GR0A 3U39A 4ASUD 5IVHA 2KB0A 4WLEA 2JVJA 3ZD6A 1RHJA 4F45A 1VTKA 3E2MA 1NULA 4CNQA 1XTKA 5LD2B 2VDKB 3IOEA 4Z1OA 3GFBA 4ZCPA 1VJCA 1V1MA 4I81A 3P20A 3ZVMA 5D3MA 2ZS9A 1SHZA 1N2HA 1TVKB 3WA6A 3ZZTA 2BJHA 1D4OA 1PT6A 1QHYA 3DVAA 5EP4A 3WGYA 1U90A 2NZVG 4KXMA 4Y1EA 4B83A 1Y1SA 3IT0A 1FLDA 3E3NA 2BUBA 4OB7A 4RJIA 3MTEA 1PD1A 1U1FA 4XH9B 4HGOA 4BUCA 3TMYA 3STYA 1GA4A 5A1TA 3CMMA 1KFKB 1VHLA 1DG9A 4TXHA 4UHEA 1VQ1A 3L1JA 5EY5B 4CR6A 2DFTA 4C4AA 4DDTA 1NTRA 4K6FA 1M6EX 4BJ5A 4C4PA 1W35A 3K0SA 1NG9A 1PJAA 2AYZA 1VG0B 4ZEWA 2RE8A 4LG1A 3DOEA 5F23A 1HZJA 4RADA 2WU4A 1CQJB 1PEAA 1RPJA 1RYNA 2Q1SA 3VO8A 4ZZ0A 1QU2A 3DM9B 4IOLA 5KNBA 5C2JB 3LVBA 3OIVA 1FFSA 4PXSA 2D7DA 3HVIA 4NZMA 3DOOA 1T1EA 5HR5A 2HHLA 2ZQ5A 3ZV5A 1G42A 1KDRA 3WGZA 3ESQA 3VHQA 1KI3A 3GLFA 2BIFA 2ZKLA 3N58A 6YASA 1Y6GA 5K3SA 3QNWA 2NV0A 4G67A 3AINA 3QA9A 3BKWA 1P2DA 1YJBA 1T25A 3C1OA 5FOXA 2JGKA 4BWGA 3COJA 1GP2A 2PJUA 4Q05A 4YP9A 2H1CA 1O89A 2L2QA 2LTAA 4RPJA 2PNJA 4FCWA 3VC3A 4KGDA 5H82A 3GQBB 1RD4A 1MX5A 3TSZA 3H1PA 5FJJA 4N39A 3H2BA 1V3TA 2IDKA 5KMGB 2WJHA 1ISMA 1D6SA 4QXAA 3E22B 2QN1A 4L7VA 2ZZKA 2C9OA 4M55A 2R7NA 2LW7A 3AI3A 4J29A 4YB8A 3G2LA 4D1YA 2AZTA 3COVA 3DD5A 1NVMB 1QX3A 1ZNZA 3A37A 1H0KA 2GN0A 3GUHA 3ZBUA 1A5ZA 3K09A 3MT7A 2HLDD 5J63A 4ZYYA 1UADA 4KO3S 5FP0A 2N1BA 4AJLA 3V6LA 3EZ9A 4U6SA 2Y0PA 2ZJZA 3H8VA 4WV3A 5HIJA 4M8KA 3MMZA 3KYCA 3C3PA 1JYFA 3GJ4A 3IIJA 3QV1A 3MINA 5K8CA 2VTBA 1NAIA 1XAGA 3PHHA 4QX6A 1L7EA 2IK8A 4S2EA 4ZVUA 5BVGB 2FWNA 5HJ5A 4QC2A 3A9VA 2H59A 2CF5A 2WTMA 4MGYR 2VPPA 4MLCA 4C3VA 1EZ1A 4BUJA 3AOEA 4PX5A 2YVLA 4RMHA 1Z6TA 2IKQA 1T9GS 3UV3A 2P8SA 3JQ9C 4X1KA 1QX4A 2VYVA 4ZVTA 2VXBA 1B0UA 1JFLA 2PUWA 1H8HA 4DV3B 4RDIA 4CDNA 5JDIC 3VHXB 1N6HA 1T9KA 5DDIP 1ZI6A 5JZBA 1XU7A 1KMHB 1Z5UA 3FWPA 3C6ZA 1DPFA 3WSWA 1BG6A 1QV7A 2HZ7A 1KI4A 3DZBA 4JWTA 4RA9B 4YS6A 2XQGA 4BO3A 3A4VA 1K7EB 3N8HA 3P71T 3VJKA 1LA2A 2R48A 3OA2A 5FA5A 5CLFA 2OLEA 1W5TA 4M9SA 3O94A 4B2IA 3AJ9A 4MV0A 2NTYC 5IJXA 1AN0A 1G7SA 4TYYA 4IGAA 2B2NA 3VC7A 3EY9A 2YINC 2AOVA 3I72A 3RIXA 4YT5A 3D6FA 3I04A 3OZUA 4RAQA 1WMEA 4AG3A 2ZJ3A 2QZJA 2JEOA 4J90A 1PWXA 1Z5ZA 3IAS1 4OAPA 4BX9A 2YDYA 5HP4A 1ZFNA 5FWXA 1W36D 1R6AA 2B4QA 2PANA 4HQFA 2R8PA 4MYTA 4BLPA 5BMVB 1WETA 4DF3A 3NHUA 1K89A 3WLSA 1JKJA 5JISA 1QZ3A 5GJBA 3UO8B 2FYTA 3KPWA 4GXQA 1JG4A 1JDBB 2A9FA 2EQ5A 3IJRA 1NW5A 4LIPD 3B7WA 4ZICA 1SUDA 3K9HA 1F7VA 1YHZA 3TDNA 3MEQA 4K81B 4DMFA 1ISFA 1NUHA 1DC5A 4M60A 1NVKA 3U3ZA 3FAKA 2GZ3A 1OX6A 4YBRA 5LUBA 5KYNA 1Z2EA 1N34B 1JH8A 2RFLA 2W0SA 3BGOS 3IEMA 2CNOA 2K6GA 1OI7A 3MELA 3LQQA 4GNRA 4NYIQ 1TJ4A 1YCGA 3QW2A 5KKAA 3CNQS 1RYFA 2L19A 3EGOA 3H86A 1JS1X 2AXNA 1R74A 3R41A 4WJZA 1JJ7A 4JUDX 3VYSB 2C57A 1KRHA 4DB4A 5CH5A 5AUQA 3D0RA 2G9UA 2AJ8A 4EJ0A 1N7HA 3CZQA 3OQNA 2ZRMA 4QDXA 1IUPA 1LZKA 3O0TA 2QMEA 3A3YA 3WNBA 2J0UB 2JHCA 2ZBEA 4GE0A 1RAFA 2WFLB 2IYZA 3FYUB 4BLUA 4A8TA 4D3DA 4HUQA 1HV8A 4LRUA 4LV5B 4NBNA 5ALMA 4UUOA 1G3QA 3DBVO 4R2JA 3UJAA 4BDTA 1FUYB 4NCAA 4UTOA 1P7VA 4D4IA 4OMCA 1EIZA 4ZVNA 3L1UA 1JTVA 1YRHA 2VP3A 2HWWA 2V1XA 2BKXA 3N2IA 5E3IA 3T7TA 1G41A 2JKYA 3DDHA 3HB0A 7YASA 4MEJA 4D74A 1LDEA 1EJ6A 1IHUA 3ZJ5A 1HM5A 4PNEA 3JATA 1NVVR 1WZ2A 5LBIA 1QO7A 1EHYA 2V7GA 1KVUA 1FTSA 2OV6A 4EW1A 5ALKA 1Y7HA 2J07A 2V97A 4H7FA 4CV3A 8OHMA 4ZI7B 1VPLA 4O2AF 1EWTA 5U4XA 2WTUA 2WD9A 3LXMA 1R64A 1U80A 4YCBA 2PCLA 4F4HA 2VF5X 4J0CA 1XZPA 4OXKA 1Z16A 2V3VA 5BSMA 4C4RA 1O94A 3NXKA 4QPPA 4EAQA 3GMTA 5KYVA 2JFFA 3UUWA 1EIWA 1AZSC 2JFOA 2NZYA 3H2HA 3I0ZA 1G20E 4WA8A 2R6HA 1BVUA 4Y2HA 3RJZA 3AVUA 3T9BA 3ZIUA 4KPUB 1XI2A 3K9WA 3RS5A 3C3MA 2GZMA 3PIDA 4R1PA 5JH7A 1GITA 2ILTA 2VI5A 4FUTA 4IXNA 4V0OA 1L5NA 3WGHA 1KSGA 4WDQA 4MS1A 5AIAA 4GU5A 1NHWA 3Q4GA 3ZQJA 1TZBA 4BO7A 1YE8A 1VMDA 2QZPA 3LNTA 3LQRA 2AK3A 2RBGA 4K26A 1XNRB 4ZJUA 2IQIA 3D1JA 3P9PA 2XT9A 5G1NA 2V7XA 4GR4A 3NQ41 1FFXA 5C7OO 4NC9A 2OHVA 1Z36A 1CVIA 4AL4A 1WABA 1XLTA 3LPAA 3AP3A 4XUEA 1ZD9A 1Y33E 2XRMA 5ELMA 1FPQA 2GN4A 3ZDQA 4B34A 3E23A 5EHQA 5JSHA 5KPJA 3BMXA 4ME6A 3KEQA 3IR7A 1ZCJA 3AUKA 3IP6A 4QBHA 3WDMA 2GZRA 3ND9A 3PR3A 5B7NA 1C1XB 3FG9A 2FQYA 4UVHA 3DZIA 2WLTA 1VXOA 3OJXA 3A2NA 1V95A 4BQQA 1BW9A 4FK8A 5TGDA 4WFIA 2WMNB 1HYBA 3MW8A 1X7XA 1L3BA 3NS7A 1T13A 4C7BA 2A67A 4MV9A 3Q3JB 3ZGXA 1F0NA 2BP7A 3O4IA 2Q3JA 3H0CA 3ONFA 2YYZA 3OKPA 1S8OA 4IFIA 1TK3A 2FG5A 1E2UA 3DE0X 3W9BA 1SXPA 1EBFA 1PYDA 5FF9A 1XDBA 2WYHA 2FVYA 1E8NA 5AH0A 5DHTA 3WL4A 1M6WA 1XZIA 1E94E 3GEDA 2IP2A 4DSOA 4TTRA 4WN9B 5FAXA 4PQRA 3A6LA 4C0BA 1ECJA 3ADPA 3FVQA 3ZH9B 2G6TA 1CYDA 4FS8A 2H9YA 1M6NA 4YBZA 4BVAA 5LVAA 2ZRIA 2ZJAA 5L53A 3ESXA 1AUQA 4KN6A 2FDXA 3ICVA 2YRXA 4OB8A 1KY4A 4KAAA 4HNVA 1Y1TA 4H7JA 1IBKB 1RBYA 2XBLA 1NASA 3IPAA 4NWIA 4YMSA 3F47A 4TWJA 4F5EA 4G4GA 5BVGA 2IEGA 4UASA 4LBWA 5CW1A 1RVV1 1A8SA 1ZR2A 3KC2A 5JDCA 3WTCA 4J7XA 3VPDA 2O2YA 2BTQB 4IP0A 5B2EA 2B69A 3MD9A 4L5IA 2BBSA 1MMFB 2HT6A 4EY6A 1Y7LA 4HDAA 1GSIA 5CDSA 2CNNA 3KJFA 1T5HX 2J30A 4F93B 4GZ3A 3QEAZ 3WFJA 3WKDA 5LYYA 4B80A 1B41A 2I7VA 3NYIA 1C3VA 1IBSA 1JKXA 2HC9A 3ZXSA 3UUEA 1PZNA 1T2AA 3VKGA 2FEWB 2GAAA 2HQ1A 1FYEA 3P9IA 4C0KA 1XDZA 1LK5A 1R0LA 2XCIA 1E5DA 1ZISA 4B3SB 1JSCA 3L79A 4TS9A 1E1KA 1IOWA 2FOLA 3KWLA 4IPTA 1R6VA 1VLQA 3QKIA 5G0SA 3SIPA 4BMPB 3UMMA 4MMYB 1WMBA 4J3FA 1EDZA 2FZ5A 2PJZA 3L7JA 4UEKA 3R76A 2OCDA 4ZOLF 2VCYA 1X13A 4DYDA 1YRQA 2NPOA 4UE6A 4UHJA 4Y1FA 3LPLA 2ZRFA 1W96A 3R24A 4LSMA 3TTWA 1BXRB 4KITB 3RADC 1K6EA 1LQ2A 1UJ6A 4OHKA 2CDCA 3BEOA 2HWUA 1H2BA 1KK3A 3EISA 2WMOB 4HFJA 1DBQA 1VCOA 5DM0A 5T4HA 2PRKA 1KC1A 5DCLA 3P4YA 5GPBA 2C20A 1NDQA 2H1SA 4M87A 1M5RA 4QUGA 4UEOA 1O9BA 2GSWA 3SC2B 1X7HA 1R9NA 1SG0A 3H5LA 1S9HA 1Q83A 1GOTA 2BKEA 3HI6A 4MV7A 1PFVA 4L7QA 3QU5A 3M0EA 1AGXA 3DKPA 4YI5A 5LLSA 4KPFC 2JGRA 2IU0A 2CN1A 2XDWA 2R44A 4Q7MB 5REQA 1Z0DA 1JIJA 3L01A 1KH3A 4G84A 4PQYA 3H4VA 5K3DA 4NZPA 4R71A 2C84A 3QTBA 5ECDA 4URFA 3OY7A 4BMDA 3H2ZA 3LJKA 3A7DA 1R0YA 3ZBQA 3FYCA 1G2OA 3B1VA 3UCXA 2JHFA 3C6YA 3KLOA 4EB0A 1ISRA 2LZ0A 4UCXA 4D0RA 3F4BA 2FN9A 4MEAA 2ATCA 4FXPA 1AA9A 1QTRA 2VDLB 2XRYA 1GXSB 1NW7A 1XF9A 2GKSA 3LM8A 4BP8A 2GJ4A 1FMCA 3NP9A 3HSYA 3BMQB 4FZJA 1J2UA 2Q6OA 1SM4A 2C4VA 4H3SA 5LB2A 4YFVA 4HSGA 4YTEA 1K27A 3MJVA 3EIWA 3KQMA 4EB6A 3GH3A 2J0UA 3K6JA 4KLCA 4RQTA 2OBBA 4UTXA 1T24A 2O20A 3DVLA 4OL0A 4ECEA 3GLSA 1SU7A 1M1NB 2G1KA 1E18A 2HMSA 4LA4A 1GZ5A 4FCTA 1JBQA 5M7EA 1CNMA 1Y1KE 5AVYA 4GUAA 3K9GA 2M6LA 3EXHB 3RREA 4KRFA 1NN5A 1QXSA 2P5UA 5DYTA 3EZFA 4KWIA 5CT9A 1U2GA 1FYDA 1NW3A 1Y48E 2FRVA 1MJHA 2YIJA 3OOHA 4K9RA 3CWZA 3L8EA 4MDHA 3EIUA 4NESA 2YH2A 2A58A 3GUUA 4HQ6A 4ITRC 4UNRA 4HLUA 4JIGA 1T1SA 1V5EA 1VL0A 3LDFA 4LVNA 3X1JA 3AY7A 2IITA 3X44A 1RYMA 3JQQA 4IDHA 3G9UA 4MKGA 3U4IA 3PX3A 1SY7A 3QE4A 4OJQA 4EBBA 3U7FB 4C87A 4Q37A 3FNRA 4DMGA 4BC1A 2PGNA 1I9GA 5L6LB 2XE6A 4Q3NA 4CEIB 1GUZA 4YDHB 4OSEA 1EI9A 2IDJA 5HDBB 2XIJA 3QXCA 1KYWA 4ROTA 3QI2A 4CCAA 4YAWA 4IVNA 3RVDA 1JR4A 3D2LA 3D6JA 1MNQA 2AJDA 3M1YA 2AYYA 1BKDR 5AWFC 5B6IA 1I32A 4UVDA 2ZBGA 4PNHA 2BYTA 3HCCA 1T5SA 4ZGBA 3UJ7A 2ZXUA 4MRSA 1P5JA 1U5BA 5AW5A 4OBWA 2F90A 1I7PA 1GLGA 1U4SA 1VL8A 1CE8B 4GPTA 4LHEA 1A76A 2Z4TA 3V7WA 2D54A 4DFDA 5JYBA 4WFKA 5I7SA 2HHCA 4OUDA 3AERA 2WUDA 3HABA 1AK1A 2A88A 1MIHA 3OIGA 4PCAA 3PWTA 2OM6A 2B34A 4DS3A 3VDXA 4WLOA 2I6GA 3K4HA 4P31A 2C83A 1N2OA 1EVJA 2AOXA 3RFVA 2R8BA 2DXIA 4YMLA 2I2CA 1QDLB 2WVJA 2ATEA 4LMPA 2PZKA 1TCUA 4E7PA 3RRMA 2PMCA 4E13A 5CFQA 3GVXA 3NU1A 1RJFA 2Z4RA 5FL7A 4B3DA 2VK1A 3Q40A 1VPDA 2VDQB 3F1LA 3G9ZA 4JH0A 4K9LA 1KDZA 1E3WA 2R68A 3UCFA 5A4MS 2ZYIA 5BR8B 1DBIA 1Y1RA 2DFPA 3FY4A 3RT1A 1EE9A 3K0FA 5E6RA 1JDBC 1IULA 1DAMA 2CYBA 1E5LA 3K15A 1NXVA 3KTDA 3RFUA 3UOGA 3KJQA 4IIYA 1GEGA 3A04A 5JNTA 2WF7A 1OI3A 2NU8B 1SD5A 2XKKA 4R3UC 1DBWA 1Z5PA 2WZCA 3K53A 3BZUA 1RJ9A 3GW8A 4IOMA 2FN7A 1BJTA 5COAA 4LWOA 1ZN7A 1NVBA 4R9UC 5AKHA 5ALDA 2IHVA 1MJ5A 1TO1E 2Z8XA 5DHQA 1QP7A 2O8EB 1Q0ZA 1NA5A 1KAQA 2E1PA 3N6VA 1FRQA 1QRAA 1BOOA 4X20A 2Y1LA 2UUOA 4EX6A 2GUGA 1G8MA 1OC4A 4JYBA 1W29A 1E1CB 1FC0A 2CNWD 2WRZA 4AYTA 1N0HA 3THYA 4CQMD 7MHTA 4UTZA 1QHEA 3CCBA 3K0EA 3OPYA 1YQTA 4MYRA 4Z7JA 2VNJA 2YASA 4G5FA 5IZCC 4DCTA 3KTAB 3QHAA 3PIRA 4S24A 4QM7A 4EHKA 5CK5A 1AKUA 5I9SA 1SCDA 1GU7A 1Y6ZA 1HG1A 1QP8A 5DI9A 1RWXA 3GGDA 4LS3A 1ZNWA 1IPFA 4Y9UA 4DWJA 4HWSA 3RFCA 5JHHB 4OBXA 2E5LB 3EWAA 1OLXA 3LX8A 1SBTA 4ZCRA 1NSYA 2BE7A 2FEKA 4Q19A 1BH2A 3VU8A 1RI2A 1D1SA 2HF8A 2FP4B 2VDWA 3E81A 2A86A 2DRIA 2RMKA 1IZ7A 1A2BA 2ZFUA 4MZXA 4B79A 4BO6A 3K0AB 3I6ZA 4HJXA 4LXQA 5DM2A 1MFZA 2JFBA 2QX8A 3ZK9A 7ADHA 1QGDA 1JA9A 2DBQA 4IDDA 1T9CA 2HCFA 2QPOA 1P6UA 1E9SA 2ZW9A 4UBOA 2WLSA 1GPJA 3KRTA 3L7LA 1BX3A 4UAUA 4LOIA 4CM4A 1VE1A 2ZJBA 1TQDA 1YD7A 5JXIA 1Y9AA 4ID3A 1ZUHA 3QVLA 2QI9F 2W43A 8ATCA 2IJGX 4RKQA 2Y8EA 3C6KA 4Z0TA 3U80A 1ODIA 1S8FA 4NZYA 4L8VA 1G8PA 4Q4HA 4RY8A 4ZOBA 4O4IA 5CTAA 2SKCA 3GVCA 1PHRA 4IDGA 2DGDA 2DC1A 3KOYA 5HM8A 5LYJF 4PHGA 5DNDA 5ECGC 2PWBA 3N0RA 1F9EA 1PQYA 5EG5A 2XMGA 4BMZA 4Y3UA 1HDOA 3WLHA 5ICEA 5JJLA 1M2EA 3CNNA 1XJ5A 4LRQA 3DLPX 2C7OA 3TCKA 2JGDB 5K4GA 4ND7A 2AG0A 4CM8B 3L7DA 5AM5A 5B7QA 1JU3A 4FNAA 2FSHA 4YCAA 3B6ZA 1XQVA 1NJ1A 3KZXA 3BA6A 3G6KA 1NBMD 4OIMA 3N0VA 2E55A 2WDPA 1NBME 4P7GA 4DIBA 5EKXA 5TPWB 4E7OA 3PICA 1NVDA 1XRLA 1AA6A 3R7NA 4DM7A 5EPUA 2VO1A 4QU8A 4AD8A 5CA0F 3KSBC 1TYZA 1M2FA 2OXIA 2O0JA 1YQ9A 4FLFA 4LQ4A 4GSLA 1OXVA 1DRJA 4Q9AA 1F6BA 4RF3A 5G02A 1DBRA 4MHSA 4RZQA 3HDYA 1DUIA 3FUCA 1UKYA 2G5GX 1IJBA 1G8GA 1W4CA 4F3TA 2JH3A 2RH4A 3BWYA 4C0SA 1CS4C 4REMA 1J5PA 1JE1A 1Z0IA 3QPWA 2Q50A 4KLRA 3HUTA 4WXYB 5TDHA 1KSJA 4YJ3B 4KMOA 4A6DA 1UDBA 2PUTA 2Q1XA 1R5BA 2IU4A 3KPUA 2Y76A 1OWPA 4ZT4A 1XJWA 4X64B 2O7RA 3S27A 1ZUNA 4GSKA 3QXGA 1BGVA 2BI7A 4EA9A 3ESRA 1N1GA 3GWGA 3P5BA 1MEJA 5D2CA 3UJ6A 3HZHA 3PA8A 1I6WA 1XZNA 4QQKA 4TTVA 2M98A 2WWYA 4IO0A 1A4IA 1A9QA 1N2EA 3BAFA 1ODTC 1ZZEA 1Q50A 2F1OA 4E31A 3QVGA 4Y2PA 3FDJA 4X1YA 4RZ2A 4DIKA 4MRNA 1NNI1 4J3JA 1GU0A 1IJEA 5MN5A 2ZR9A 4K1LA 1BDIA 1JNYA 1NNEA 1FDUA 1VB5A 2GPSA 3IMKA 4LZJA 2QV0A 1C7FA 1SZJG 2ECFA 1E1QA 3L93A 3R6WA 3WIUA 4M89A 3N70A 4QLOA 4IBOA 1QO9A 2WU1A 5K03A 3DFFA 1F20A 2PEZA 2EKBA 3IOCA 1XKXA 3SJUA 4ER7A 2O8BB 2H8KA 2VHUA 4M7OA 2Q2OA 1F5SA 2IXEA 3GNSA 3VR6H 3GRKA 5ALTA 1I24A 3L0SA 2LCIA 2VUUA 1YUBA 1NUUA 4LJKA 4BNFA 1PVDA 2EIXA 1EFKA 4MTLA 3TLBA 4Q66C 3PHCA 1UBMS 4RHCA 3PUZA 1JHQA 4BZPA 1SCQA 2IYVA 2XY4A 2DFLA 1ABFA 5BWMA 1LQUA 1VDZA 4Y2SA 5TE9A 4MKIA 1FRNA 1BSVA 1KEZA 2J32A 4AIRA 4KLZA 5L3SB 4RE5A 3R7AA 1JVSA 4GZLA 5DK4A 3GT7A 2OA0A 2FMHA 2E5WA 1CY8A 3NANA 5LNK1 1PKEA 3KOMA 2G80A 5FOSA 3BMNB 2PSDA 5B57C 3KQWA 5EINA 3BWBA 3WAGA 3UWPA 1H8ED 5BW6B 3CIFA 3ANXA 2VOEA 3DKKA 5F77A 2LUOA 4W1PA 2IHZA 2FMTA 3T9FA 4F6LA 2H54A 4LPSA 3QFFA 4D8UA 3KT6A 3EXIB 3QWIA 1H0RA 3NBUA 3ROGA 1EM8B 2Y0CA 3LQ2A 3G2NA 3RT7A 2IW3A 3DW3X 1PJBA 3RJTA 5HJ7A 1IHPA 5THXA 3RUAA 2ZETA 5TGTA 1C5KA 2FR8C 2BJWA 4F97A 3UB4A 3UKDA 2HM7A 5C8VA 4LNUA 5DXJA 1N9ZA 1XLVA 1ZJYA 2QX7A 3OOYA 4I50F 3CUTA 5IABA 4JYCA 1GNPA 2H2IA 3NDJA 3UAXA 3WMGA 1XPJA 2DSNA 3C74A 4EW3A 4LF9B 3OCWA 3LXXA 1JGTA 5DRTA 5DXAA 4RTRA 4BHTA 3U7RA 1SG6A 5ALUA 2NO4A 1UMDB 4JI7B 3HBNA 1RYZA 5K0GA 4LF7B 1W59A 1Y3DE 1P9RA 5DWDA 1FUEA 1T6NA 4J2OA 4RL6A 2GZAA 1D04A 1F4VA 1R8SA 4Y6OA 5BV8A 3A1SA 2RHJA 3EHEA 4L5JA 4QJ3A 2XCRB 4Z9YA 1PV1A 3L8YA 1M33A 2JIZD 3LLCA 5FYQA 5JBNA 3HZRA 1MORA 1OV6A 1YL7A 2RGGA 3GJSA 5H3HA 1JG2A 1KQFA 3JARA 4DCCA 1VP9A 3C3AA 2ZCJA 1UFOA 4HUQB 1IN7A 1BCRA 1FMLA 3HKEA 4BE4A 3P5SA 3A58B 4JLMA 2C00A 3FUTA 3I28A 1Z75A 2ODAA 1KO8A 1A69A 1KDPA 1P0QA 1A2KC 4EVIA 4F7WA 3FTDA 1VA4A 3PWZA 3OA0A 3D5EA 3GY0A 1NFFA 3BORA 3GXOA 2PHZA 4NG4A 2HRQA 4WUTA 2NU8A 4DQUA 4ALIA 4CJXA 4F38A 4K9OA 3I9FA 4I4LA 4CPDA 4H1VA 5CFNA 1Z5OA 1N2CE 3BHJA 3T95A 4B5KA 4ER3A 3DWEX 5FOVA 5CNIA 5K3AA 2I65A 3S1LA 1NI5A 5AK3A 4WCFA 1R8JA 2O8EA 4LCBA 4KBGA 5KOHA 1C7IA 3CBQA 3WL7A 2J9RA 3K0AA 2B35A 4X20B 4F2DA 1OW3B 1AHNA 3VOAA 1Q11A 1R6UA 1W88B 3KCQA 4KC0A 4KMRA 3STTA 3ECCA 4NYMQ 2AMYA 1YRYE 2X8AA 4H77A 1W5BA 3C5VA 5E1MA 1TXGA 3F9CA 2RGAA 5EXXA 4MULA 1TYBE 1PR2A 1RI1A 3NWOA 4BMXA 5JD4A 2PUVA 2BMVA 4IIDA 1NUSA 3ZV7A 3HNOA 4GLLA 2FZVA 2WHEA 2Z04A 3SNKA 1THMA 1GUYA 3PQ8A 3PITA 2FXVA 3TRKA 3V34A 2V7QD 3ZN2A 1FSFA 1XWIA 4HZGA 4BZXA 4DCVA 1SUCA 2VBFA 3HWWA 3AF3A 2WD8A 3PRYA 2PGJA 4E30A 5KQSA 1PNVA 4XDYA 3GJ6A 3U6KA 3A3PA 4UFOA 1GLVA 4J4TA 4BFCA 5I7OA 4V02A 1N8SA 2ZT8A 1Q6ZA 2EBHX 4GQBA 2H3HA 2VJYA 1Q1ZA 4XDZA 2G1JA 3L4JA 3H9BA 5F2OA 1D1QA 4YLEA 1UBOS 4TSFA 1E8DA 1PQUA 3JQAD 5FWYB 5A7FA 1EJ2A 2WY2D 1CZKA 5TT1A 4QRIA 3N8NA 4A92A 4MR9B 1R1DA 4WINA 4CKBB 3ZV3A 2VQDA 2VT3A 2NO0A 3FWHA 3WL5A 5LU9A 2QAJA 1WSBA 1JBKA 1OJ7A 3ZUPA 5CU7A 5JCJD 1V6AA 1JHYA 2NACA 5EZQA 3K16A 5JTUA 2YYSA 2H7CA 4FN5A 5HJ2A 2GBLC 2JLAA 3AG5A 4IEIA 4FFWA 3T9DA 4IDCA 1P77A 4BX0A 1U8TA 3TI7A 4RIIA 7AT1A 3SOPA 3HVUA 4JLJA 3OPYI 3TLKA 3AI1A 1U8UA 1PNQA 1Q1EA 4FGLA 4RMGA 2DAPA 4YJDA 3W2FA 5HQ3B 5IXSA 2IPAB 2BFAA 2O2ZA 4QUIA 2GAFA 1WQ1R 3VC1A 1Q95A 2BFPA 4I19A 1RRPA 2ZJ0A 1KJJA 1IN1A 5IARA 4EI8A 3VR4H 1AHIA 5D01A 1KK2A 3WGTA 1YTLA 4Y2GA 2SECE 4MDFA 3OMXA 4FKMA 4E3WA 3DEKA 3OIWA 2XQVA 4EZEA 1TA9A 1FNMA 2ZRLA 3DV9A 4HY3A 5CH3A 5D5HA 3U81A 4E21A 5KNDH 4AO8A 4KIGA 1XEWY 4H7DA 4MVJH 4UM7A 4DNXA 4CIBA 2AVDA 3GP3A 4Q6WA 1FX0B 1KEKA 2DCMA 4WVFA 3IQEA 3WGUA 3HJHA 3Q3CA 4N6NA 3UH0A 1GCIA 4CKWB 1TQHA 3QLUA 4LYYA 2F3SA 4XFJA 3MWKA 1ISHA 2HNBA 3B8EA 4B2LA 2BDUA 3EYAA 1LLQA 3JQGA 2AQIA 3V4FA 2Q49A 4DMMA 2CLIB 1KOLA 1H3FA 3FNFA 3SCZA 3L4BC 4QVGA 3RNLA 2WSBA 2QVXX 2V55B 1JG1A 1EB9A 1QBKC 2JEYA 2NU7B 3ABOB 2DPMA 3FUUA 3QPDA 4W1SA 3I5AA 4B5LA 2GN1A 4CT4B 4DCSA 3BOSA 4DMUB 3LT1A 3EVTA 3MD0A 4ZK2A 2RG7A 1P81A 2Z83A 1YOVB 3BX1A 4HDSB 1OVGA 4OLBA 4WE3A 4Q7LA 2ID7A 2WI8A 1BMFA 1SA0A 2AEEA 3THYB 1CG6A 3D81A 3GDWA 3C15C 2YWXA 1VHDA 1Z5WA 4GPZA 4NSNA 4RFSB 3TQHA 3O8RA 2PYDA 2IYTA 1GXSA 3GBVA 2ICAA 2WUFA 4UXIA 5EKTA 2UZ1B 2C0CA 3OLCX 4I5IA 5E2AA 1MV8A 2G88A 4YV7A 4R2LA 3V8VA 4RD6A 1G8KA 3CZ4A 3OG9A 4OGFA 1DWOA 3WNZA 2AFIA 4GBED 2DQKA 5TJHA 4OXXA 5AVOA 5LDHA 4CMIA 3QY0A 2H1IA 2X7HA 3P2OA 3K0KA 3H11B 4LGCA 2O2XA 3KKNA 3AILA 3GT0A 4JDPA 4NFSA 1MR3F 4JB8A 3ZLTA 2XGJA 4U2FA 4BNKA 1WW3A 1DUVG 1Z45A 3DD1A 2SKDA 4XYMA 4RPKA 3FI0A 1B42A 1P73A 4CHTA 3JQ7A 2EHDA 4EEZA 2FSPA 2F43A 1F2DA 4WNYA 4N3GA 5LXTB 3Q7TA 4IEEA 3DE2X 4QDTA 2IX9A 4DC0A 2ATVA 4W6ZA 1TVMA 1W44A 3IBYA 2XUQA 1B6RA 1IQPA 4GD3Q 4PZUA 4EIWA 3IDQA 3LXUX 4WFJA 1GAXA 3EHDA 1GZ4A 3LZDA 5LOVF 1AXEA 2JLWA 1XZGA 2AR0A 1OOEA 3NGLA 2KI5A 1JEQB 2QTHA 2XYQA 1KR2A 2I80A 3DT8A 5JS8A 1GM5A 1D7OA 3H5RA 2I4RA 2K87A 5FOTA 4D6YA 2FPLA 3DZDA 4ESOA 3DDOA 4C89A 3ZWAA 3S5JA 4ZXFA 4Q18A 4BNLA 1QCCA 4LNHA 4N7RA 1T6BY 3IS3A 1GCUA 3LHSA 3NORA 3PQ2A 5D3MB 3OAAD 5IKPA 4DTIA 1VJGA 2V98A 3EGCA 3TZ6A 1YS6A 1D2NA 4Z54A 3MJ4A 1YDEA 3PHIA 3IESA 1H2XA 1NFRA 2ZB3A 3BMCA 2WUWE 4JC8A 4WOKA 2Z2XA 3DMGA 3IQIX 3M3DA 2F55A 4L9AA 2QMOA 1VZ3A 4QUEA 3V2GA 5JO9A 5CDHA 1DELA 2ZSUA 4NJMA 4RXTA 4C07A 2IVFA 2P69A 3DAFA 2OVFA 3LD9A 5KQLA 1UL1X 4BAGA 4K6MA 2FZCA 3HYRA 1JLHA 1C1DB 1L7PA 1J1ZA 1XLTC 4E1BA 1SKQA 4AU1A 2AOUB 2A6PA 4BU1A 4EABA 1DIOB 3EUAA 2YFQA 3EQ6A 1ODFA 1U3VA 2POCA 4UM5A 5BW4A 3T06B 1LNZA 1Q0PA 3ITEA 3KR2A 3I2IA 1DRKA 4NJEA 4B4WA 1XN4A 2GYUA 3QYFA 4PAOA 4ASUA 2V6FA 1K5DA 2PT9A 1CX9B 5CVCA 1KE1A 3ZXYA 4C7OA 4TT3D 3UJDA 3KL2A 2E21A 3T5CA 2Z6AA 4TMZA 3ETDA 1KWKA 1OV4A 1OT5A 2NSJA 3WLEA 5JY6A 1E1LA 4FJ0A 3SX0A 1U0TA 1XN1A 2VHTA 2XE4A 2ZYWX 3BBLA 4MW0A 5C5DA 4ZDIA 4JELA 5K8VA 2FRDC 1H0HA 2VNHA 4KQ1A 2V6MA 4QYTA 4W5NA 3DVRX 3CX6A 4HXGA 4YAGA 4TV9A 4P4TA 1FTQA 4RJLA 4EJ2A 5JRZA 5KYXB 1Q20A 3RS0A 2NUPA 1S96A 2VP0A 2VWGA 4KQMA 3RVBA 2ZGVA 4ESHA 2VJDA 5HK9A 4IDAA 4BGIA 4DV0B 3AFGA 3CNLA 1R4MB 2O57A 1Q92A 1L4MA 3RUPA 2J87A 5KOIA 2CFRA 1EFRA 4LHSA 4D4LA 3HM2A 3RHTA 4NOJA 3UF0A 1GQFA 3RW9A 4CQMB 2ZI3A 3AG6A 1SURA 4K3VA 4D0SA 3UT6A 4BIIA 2DHCA 4B9EA 3N76A 4CMBA 5I4CA 3EZYA 1DARA 3JWGA 4KQ2A 3LCMA 4G0QA 1DC4A 2ZIAA 2RGRA 4DGSA 1JSRA 2PBZA 1T5BA 5F2KA 3G7SA 4LVCA 4ETIA 1M2JA 3TX6A 5AVWA 4U6NA 4TKUA 1O6ZA 3JALA 3VVBA 1LSOA 1RYDA 4GPBA 4YAFA 3QV2A 4YAUA 5KWVA 4AN4A 3V4VB 2HU2A 2L17A 3CVVA 1KARA 5A6SA 3H9GA 3AM3A 1TD9A 4JENA 3UTDA 4PC3A 3L7BA 2D0DA 1E59A 3WWOA 2C03A 3FPJA 1BO6A 2ILVA 3GJRA 3PXUA 1H0SA 2RC6A 1W2HA 4ND4A 3KPJA 4KHZA 4O59O 2POQX 3EXEB 4PGFA 3TDMA 4MQ4A 1HEIA 2LRHA 3EBOA 5KTSA 1WS6A 1OWOA 1OA1A 2ADFA 3K1ZA 2PR7A 3DE7X 5AICA 3EGEA 3NI2A 1YBFA 3RC9A 3D54D 2HTEA 5EIXA 1F4LA 1FDIA 1DJQA 1U1IA 3DBRB 3UJHA 4PE5B 5BRJA 1AZWA 3A6JA 4DIDA 3I37X 4W5HA 2VT6A 3OX2A 3GFGA 4GI2A 4HXFB 4ZOCA 2OKGA 1CUIA 3GD5A 1SOVA 3AUUA 1E9FA 4FFBA 4LY6A 4ZOLA 1RYBA 5EJ5A 4QYMA 1NPTO 3Q98A 1C1HA 2F1HA 3UFBA 4N41A 3C3EA 4CBVA 2G07A 4IHAA 2QLLA 4P53A 5DPMA 4AMVA 4R2WA 1JLLB 1ZINA 3NEPX 1JEEA 2IU6A 3CH7A 3M1LA 1B8NA 1M2WA 4FFRA 4JA2A 3ZJTA 2BN4A 4BGVA 3D3WA 5ICMA 3AF0A 3GFSA 4MX8A 1SQSA 4GMDA 3BM5A 4TLDA 3T3IA 3DFIA 4RCZA 1H1DA 1JV2B 1NTOA 3AUJB 1AKVA 1TI7A 3RAEC 3NFYA 1Z2NX 2EC5A 4WJKB 4KR3A 2IYOA 2YXPX 3WLNA 1WP4A 2NVOA 1UQTA 1F0PA 2B2XA 2SKEA 3SMVA 3UMGA 3EPKA 2JI7A 5IN4A 4Q3OA 1H4QA 2A9VA 1XCPA 1XVLA 1IN5A 4KO2S 2XCOA 5CURA 2WC1A 4DB2A 3ZY4A 4BB0A 2H4FA 2G76A 4KTTE 4QXQA 2BM0A 3RTBA 5HOQA 3VO9A 5LWHA 3A70A 3N2GA 1ZCFA 3PG5A 2OLJA 3A14A 1SHJA 1SD2A 4PZAA 4BJ6A 2IELA 4EG8A 1PQWA 1DJPA 4PGGA 4BVFA 3U5ZB 1SVIA 4KIWA 1KEUA 1WTCA 4YR9A 1A2QA 1UOOA 2JZCA 3K8YA 3QLVC 4JB2A 1N2IA 3VX4A 4HNHA 3W5VA 2PQMA 1EWYA 3TNJA 3ZLVA 3ZU4A 4CLRA 2J3HA 1HK7A 1YUMA 2C8KA 2Q7XA 2XNDA 3UVEA 1UKBA 2VNIA 3ABZA 5A7HA 2P9BA 3VUEA 5CD9A 2P91A 4UCWA 2YMMA 5HF9A 3HKDA 4R16A 4S2UA 3QKTA 1P0MA 4NPCA 5FTMA 2RKWA 4OJKA 4F7DA 1J23A 1Z83A 4K6KA 2OAP1 2GI4A 5JMTA 5DM70 4RTPA 3DZHA 1QE3A 2FJ0A 3NGMA 4E2FA 5JFGA 3UK0A 3JSAA 1R8XA 3G88A 3VI4B 4COOA 5LZ5A 3RYFB 2HEIA 2GYYA 3ZVLA 1ZM9A 2ODNA 2PVSA 2QQGA 1H2EA 4PO9A 3BIWA 3ORQA 2AQ8A 2C2KA 4K87A 5DIZA 2FZ4A 2W8BA 3WMFA 3ZJYA 4YHHB 4FILA 3SZLA 1CUZA 1CY7A 1YVRA 1M74A 1APBA 1XNGA 3F73A 2WWXA 1WMSA 1RXWA 3EIEA 1DTSA 4B47A 1A82A 4S1PA 4D82A 3LO5A 2CLFB 1RBQA 3FZYA 3PWSA 4GZ6A 2VTDA 1DV2A 1N0IA 1VCMA 1MO4A 1ZK2A 2VEOA 3CW9A 3K6RA 3KJHA 3T7AA 3R20A 5A4DA 1ILEA 3ETCA 1RLTA 2JLRA 4DR4B 2BEUA 3K94A 3S68A 2VDRB 2QN3A 1OPXA 2JB9A 4AKHA 2JS7A 4W9NC 1GZDA 1S2GA 2DEUA 1R9JA 1ISGA 1KJQA 3WI7A 2F9LA 3W6ZA 1UFKA 4HNAB 4PC7A 4HQOA 2XSZD 1AX9A 1T2EA 1Q6YA 4R9VA 3OQMA 4US1R 2B8NA 3QU7A 4O08A 3UMRA 3AB8A 2H63A 4ND8B 3HJTA 4BUZA 3ICCA 1GCGA 2CUZA 2HXSA 1DJLA 2Q4EA 4J03A 1JKJB 3IQHX 3QPAA 4PXYA 4RHXA 2O1WA 1KDYA 1MO2A 3LBHA 3AHEA 5K3BA 1ZL2A 2B61A 4DRXA 3NB0A 2CFCA 5AKEA 1KI7A 4FDAA 1KEWA 3NBKA 4CEHA 2VP6A 3UJ8A 2PGIA 4OFWA 1WULS 4C7XA 5B4UA 4HEQA 5IYZB 1W8IA 4LFCB 2I9KA 4KXYA 4O8CA 2H2WA 1G5FA 3BFVA 2NZUG 3FFXA 4MUBA 4WY2A 1VKJA 1WOYA 5I47A 4MINA 2XUOA 2CE7A 1YOBA 4X9XA 5ABPA 3H4MA 1ITZA 1CB7A 1XP5A 5KB3A 3O84A 3G59A 1SOUA 2QD4A 4DCMA 1SXIA 5HKBA 2FNAA 3W5UA 1XOIA 2BY4A 3AR3A 4PAMA 4TVKA 1IAVA 3JVEA 4EAAA 3CUWA 4FFDA 3WK4A 4CV1A 3IAXA 1VMEA 3PEWA 2HGZA 1TU0A 2J7PA 5FXMA 5I51A 1T8TA 4TKMA 4RF2A 4ZPJA 5G3YA 5T64A 3ENZA 4HNSA 3OFND 2UXDB 4IFBA 1NI4B 2IWRA 3OPXA 4QTZA 4YRRA 4MQEA 1S2DA 2JBAA 4FYHA 1S6YA 4UOZA 1XTJA 4DUZB 3NBYC 4BYMA 5AJZA 1BQ4A 2HJRA 2P2GA 4FDMA 2PCJA 3RUFA 1GPBA 3EQ7A 3JY6A 4BGEA 3SBDA 1U8CB 5CJJA 3VGPA 1TIPA 1D3AA 2Q99A 3WB2A 3IXLA 1Z4LA 1XPUA 1P4RA 3OE4A 3WYGA 1AKQA 3HC7A 4ROSA 2E2WA 1VLHA 3B9RA 4W5OA 1I6MA 1RRKA 4GPAA 1R7RA 2OHIA 4TWZA 5TB5A 4BJ1A 1H4VB 5T4FA 4O2BB 4JI8B 3WLPA 1L7DA 1I7NA 4YMTA 3K1YA 2PRZA 1I4LD 3AWIA 1N78A 2Y9PB 4B1FA 1MLDA 4C0QC 3Q8MA 2ORYA 2XX3A 3UAGA 3E18A 4NI5A 3EUFA 5H3LA 3GRYA 3MJHA 3MCTA 2NADA 2PKEA 3HUEA 4Z4FA 5A6SB 3MUEA 3R6LA 3VOTA 2OHXA 1SZDA 1E6LA 3KVNA 4XSHA 2WKWA 1MIOA 5E4FA 4HH3C 4F71A 5B5SA 4FINA 3TJRA 1U3TA 1YQXA 3ONVA 4FEGA 2FW7A 1JP7A 1OBVA 2AVNA 2CB9A 1LH0A 2GASA 2J3EA 2VSFA 3KR0A 3EGDB 3GO4A 1GTRA 3K5WA 3L0BA 1IH8A 3ICQB 4OBEA 3TR0A 1TZ2A 3KYCB 4BLWA 1YQGA 3DT6A 3H5TA 1Z4MA 1D2MA 4FEAA 3KZMA 3AQ4A 4BN0A 4YCMA 1ECFA 5LQUA 3KAJA 2PX0A 1GDTA 3AVXA 4L3VA 1KMCA 4BLVA 5IXJA 3V4RA 2H18A 2XEXA 3LPCA 1KZHA 1U9IC 5KOYA 1SUWA 3VVCA 1LRJA 3CG4A 1N7JA 3FDXA 4Z8XA 4DLVA 1KY5A 2AUMA 1GARA 1MAHA 1I51A 3AESB 4RH0A 4TQUS 4EF5A 1BJRE 4GR5A 4K28A 4M8SA 4GLJA 1E96A 2EATA 4O4JF 1PL7A 2C07A 2NYRA 4FGWA 1UC9A 1N2ZA 3IUQA 4H3KB 3TEFA 5JPCA 5K0ZA 3NDBB 3NJRA 2WJZB 2Q5OA 4V0MA 2I4OA 1YRBA 1A8UA 1MBZA 3CF6R 5DBFA 2CL5A 1UZAA 3AFMA 2ZXEA 3K6KA 4E70A 4ZAVA 3RJMA 2BFBB 4OK3A 3R7SA 4KU4A 3ST7A 4DDHA 2X0RA 2X2PA 621PA 1PSDA 4RQAA 5B6PA 1X9HA 2P6RA 3NP7A 3K71B 3KZ1E 3TD6A 3PIIA 4YVFA 5KTYA 2BP7B 4ZCTA 3RUHA 3RVMA 2XCLA 2K4MA 3FSGD 5C0OE 3VISA 1K6JA 1GQSA 1ZN9A 4LXUA 1LJUA 1W0JA 4JI2B 1PRYA 1EFTA 3S2FA 4A0GA 4AMYA 4MLDA 4JD5A 4PFJA 521PA 2F3TA 3DUFA 1O6FA 2L42A 2Q2NA 4UVIA 4C1BA 2ECQA 3BSSA 3V3TA 1G8HA 1WCIA 1BDJA 2X77A 5JO0A 1JVBA 5ISMA 3KEOA 3A2MA 3D0KA 1GUAA 2VRCA 3MJTA 1PR0A 3D64A 3FFAA 1IDOA 4JZYA 2VATA 4YMWA 2HBQA 5ADWA 4M0MA 4OX9B 3R3WA 1YNSA 2B8EA 3K09C 2NO5A 1QDUA 3CG0A 3PX7A 1B3RA 4PICA 4Y2VA 1EFAA 1ULSA 3OCCA 3QI7A 4YJ2B 2HW8A 1KMNA 3KSDO 3FDIA 4OO3A 2FSIA 5T67A 3TQOA 5JCJA 1H2YA 2LIPA 4M22A 4NEHB 1C4XA 1Q3HA 2W6OA 5JNVA 1B6TA 1F0YA 2P8JA 5TV2A 5IBRA 4E5NA 4FQ5A 3E9NA 1DBVO 2ZJ6A 1TUBA 2CVOA 3KFLA 4M9ZA 4PTLA 1QF9A 2I99A 4Q1BA 3G2KA 1XPOA 1SB8A 3IPRA 5DCYA 5CLLA 1GFSA 1TM7E 4AUKA 3TVDA 3RT9A 4IX9A 1GEEA 4Y7DA 4LRXA 1E1NA 4MR9A 3EIHA 3NTXA 4E11A 5KNCA 3RUDA 1C3JA 2XQFA 4Y2XA 2WJ6A 2RGCA 5DHUA 4U4AA 4EY5A 3PYLA 2WT9A 3ZGZA 1S2NA 4XWTA 5JLAA 2KBEA 5FPPA 3BK2A 3UA3A 4E5VA 1IC6A 4LECA 2AL7A 1KFBB 4R5HA 5F33A 5TMDA 3RTCA 3ROTA 1V9SA 2BEUB 3P27A 5E9AA 2ACWA 2DE0X 3ENQA 4YV0A 1ZS9A 3FB4A 5CDTA 3FOEC 4UU0A 3O9MA 4ZXPA 3FKSD 1C3OB 3PKJA 3JATB 3L40A 4AVYA 2B0JA 3DC7A 3ETNA 3M6VA 4XB6B 4AJ4A 4E33A 2CT8A 2QUAA 1L4GA 2UU9B 2F2TA 5FUQA 4RH1A 5D6OA 4MUJA 3D6TB 5K01A 2H2AA 4FE7A 1U5BB 4N01A 2DUNA 1YO6A 3HQ4O 4QA9A 5DNCA 1XAHA 2WJJA 2IUEA 3NHFA 3ZHZA 2PV7A 2WPDA 3P9SA 4YA6A 2BE9A 3C3KA 3NW9A 1Z17A 2Q7OE 3O4RA 4PX2A 4RLFA 4I5DA 1W0JD 3WIEA 5JHGB 1QIGA 2JNWA 3OSZA 3D8SA 4YAJA 1WXXA 1KAOA 3TL3A 3UXMA 5KYYA 6CHYA 3ASZA 4LF6B 3AF1A 5JQGA 4JBIA 4OOEA 4WX2B 4G5RA 1VP3A 1U3CA 1SWWA 4MQFB 4KK4A 2EJTA 1OBCA 1RE0A 3SXJA 3V1YA 2FHSA 4XDGA 3AWDA 4D9GA 1TUGA 5JZMA 1TTHA 3KHKA 4MKXA 4ARZA 1EUCB 2QY9A 1TYEB 4TLLB 2VPTA 5DBHX 3WO0A 2I6UA 5H8WA 3F6CA 4IR7A 5JNRA 2UYCA 2I1VB 4O2RA 5JEDA 1J33A 4FOPA 4Y6SA 5A0VA 2XHEA 3GAZA 4M98A 3ZU2A 1AKNA 2H1WA 3Q0IA 4QJIA 3IO5A 4QOJA 3ASUA 1HFJA 2HH9A 4NU0A 2ZDHA 1LQTA 3E7DA 4BGUA 3LKZA 5IC6A 5T3YA 3UMBA 4J1QA 1YA8A 4JMLA 4N7BA 5ER9A 3TRDA 4BZQA 1PLLA 2H4WA 1DWQA 2JD0A 4AQDA 1KBQA 2QR2A 1TMGE 1NI4A 3UXYA 4P93A 1WG8A 2PL5A 1LPPA 3HP1A 4X3PA 2PX3A 4C76A 1J2EA 5K9ZA 1Q3KA 4LOJA 1MO6A 3M8KA 4OHVA 4F91B 1YZLA 1DKOA 2UYQA 1JFRA 4ZVSA 2VL7A 1XA0A 2NVUA 2C5LA 3WISA 3ZHCA 4N65A 4E09A 2Y92A 4JIMA 3U3RA 3UICA 1WB9A 1GPH1 1Q15A 2HRZA 1QHSA 1EMDA 1JAXA 1UPXA 1MG5A 2A4KA 1VPVA 4PLCA 3EUEA 4K3UA 4M76B 1EUZA 4RTNA 3P45A 4X1OA 4TS1A 1NBHA 4YREA 5EWLA 4MB6A 4RKEA 2FRDA 4NJOA 4QGAA 3EPLA 2XH8A 1W75A 3HCEA 3RSGA 4M9UA 5NULA 2O2DA 2ZIZA 4FMDF 4R7TA 3WLQA 1BXGB 3E15A 1ZD4A 2P6PA 4PINA 4TKVB 2OD2A 3IAS6 3HCRA 4B6EA 3DXYA 4MV1A 5IVKA 4AQ7A 3D2CA 4ZYUA 1HR0B 3AU8A 1C8KA 1XRNA 2G5PA 5AQEA 5LQCA 5BN5A 3AUXA 3R6DA 4Q9JA 4G0VA 4C7OB 1K66A 1P6XA 3LMKA 4WCFC 4N3AA 4WMLA 1YXMA 1L4KA 1VLZA 1E2QA 1JDZA 2RK6A 2CY0A 3QUQA 4OM8A 1B3BA 5KDLA 2XMCA 3NH6A 2PO5A 4FD2A 1S2OA 4TWRA 5ERYA 4RBNA 4GT1A 4FYVA 5JCPA 3EC1A 4ZTBA 4X3CA 1M2HA 1ZN2A 3Q0TA 4XB1A 2EYUA 1GDHA 3IPLA 5KPDA 3KSZO 4WXEA 1BVHA 5DXFA 4ZJZA 2FWIA 3EX7C 1CCWA 2Q6KA 1ISIA 3QTTA 5EP2A 4B6SA 1U4NA 1JZSA 2OFPA 2F4VB 1QU3A 1SXGA 2QRKA 1RAGA 1XC7A 1ODLA 1E5XA 4P84A 3ADBA 5BP7A 4TTIA 5JWOA 1DE0A 2FKAA 1F3LA 4Q03A 4MSUA 4D42A 3K35A 4OHZA 3RF6A 4C0HA 5C3MA 3V8EA 5ALFA 1Y8ZA 2Q3BA 1NUPA 2Z95A 4CW7A 2O52A 1V6SA 3KOUA 4MP8A 5KNBD 3N3BC 3MPOA 3LWBA 2PN1A 2FE1A 5LXTF 4HO1X 5F4BA 1XDUA 1BCSA 3IULA 3CLUC 2FX2A 3K92A 4NNPA 4PTZA 2YXBA 4TMKA 4JXZA 5EIBC 4B4KA 1GIAA 3M4ZA 1GZ6A 2YS7A 3M3HA 4EY4A 1I6LA 4MI3A 3VYUB 4IMIB 3N9IA 2OQ2A 4TZ0A 1GUBA 3QXSA 5LQMA 4L9WA 5AVKA 1NJGA 4G37A 4DWOA 3QP9A 3B9PA 2NNLD 2WU3A 5LZ8A 3IB3A 2J9ZB 2MYUA 2H2FA 4O2LA 4P4LA 2PXXA 3OF2A 1RDFA 2A94A 3HYSA 3MB5A 3ILVA 1NT2A 2ZBRA 1N3IA 1T10A 1V3QE 2IA5A 3EF3A 3GPDG 1VRCA 4M3NA 3FOBA 1OFUA 1Z38A 2YBDA 4Q3BA 4C7MA 4WBNA 1T3LA 3NWJA 1JPJA 4BRSA 1JT9A 1PNTA 3GLIA 1EFUA 4P7BA 4RD0A 1JQEA 2YFYA 3VPFA 3SOZA 3KU4A 2RAUA 3GVPA 4L4XA 4DBLE 2B8WA 5T8KC 2ROQA 3DBLA 2QTNA 1IN6A 4LWZA 2R97A 2WAXA 4Q12A 1N4AA 2DTXA 1AURA 1U6JA 4B3HA 3QKRB 1XKLA 2ZJ1A 1WHSB 3BCHA 1BKSB 1JB9A 1ODKA 4QDZA 4TSRA 5EXDA 2XNHA 1ADYA 2HRRA 3JCZA 1V7QA 4XXHA 3EGXA 4AJOA 3B7PA 1Q5PA 4KCGA 3CLRD 5I7HA 1ZSVA 3B1JA 5E0OA 1L4EA 1EHIA 1BAPA 3GGGA 1B16A 1UAGA 2Q3HA 4N8SA 4EUSA 4E0BA 3TNFA 5F51A 1MZVA 1M2OB 2GZHA 1TZCA 2GBPA 3PFCA 4FS3A 4MA5A 5CNKA 4CCSA 3D02A 2GPNA 2O14A 4PHTA 4PPQA 2YXEA 4CYMA 1JEDA 2X0IA 4IJ5A 1JUDA 4A26A 1U0BB 2Y1DA 2HF2A 4JY7A 1G38A 1H66A 3O8LA 4RK7A 4XGRA 3ITDA 4KFCA 1J0DA 3KWJA 1O0BA 4CG3A 5CPBA 1TECE 1R4NA 1J8YF 5D3KA 3DLBA 4EPVA 4BRWA 1W9MA 5AVJA 1Z2DA 1E2PA 3QITA 3AKYA 1UZLA 3FVRA 2PT6A 3I39X 1E20A 3K2QA 3KM0A 1ZGAA 1A5BB 4HGQA 4XLTA 3Q41A 3RVPA 1M34A 1OZHA 2IRWA 4B84A 5IAAA 1AS2A 5EZ6B 3SJBA 4DMRA 2BMDA 2EFHB 2GCIA 1E63A 4JNKA 3CWCA 4RK0A 1Y1QA 4HXEB 2BGKA 5A3SA 4BEVA 5A0TA 4GC9A 4DKJA 3BD6A 1YFKA 1UM8A 2YZ7A 2MYPA 1PR6A 3E58A 3FYDA 4O2AB 4WKNA 5CLIA 3NT2A 3U26A 3V2HA 3WAKA 4EDFA 1I0IA 2NM0A 1GNTA 1JZTA 2OQRA 1L4FA 6REQB 2XRZA 2FMUA 1NQVA 2HA6A 2DBYA 1GV1A 2XITA 2EKQA 2J0VA 3EODA 5DJ5A 5DWQA 3EDCA 2CHVA 3FE2A 2HSGA 1YKGA 4CDRA 2IZ1A 1M8GA 4LE2A 4GLFA 4HG2A 1T4DA 3V2UA 1OXBB 1Z2AA 1P2TA 3G2PA 4AAYA 2DFDA 3K8ZA 2B92A 4X84A 4N9WA 4UREA 1E1DA 2JD2A 3ROQA 1ZXLA 4V0ME 4RF5A 2IWHA 3E35A 1L1RA 3MSCA 4CGYA 3M4JA 4FT2A 4MPDA 4QL3A 1NE2A 3IBCA 1J9ZA 5JJ5A 1YC5A 3LUDA 4LN1A 1QFXA 2AA3A 3U9LA 3VDQA 2PT7A 4A2PA 2V74B 4Q4JB 3Q5DA 5IWAB 4A5SA 2G9QA 4G1MB 1NY6A 4C4OA 4R8SA 1ODCA 5AOCA 4ZU3A 1N3LA 3RF7A 3B38A 1QV6A 2JLUA 1HDEA 5KBYA 4YQZA 2GZ1A 3RRBA 1PFUA 4Z9BA 1H6BA 5HS6A 1CZOA 4HLCA 3K31A 3ORFA 3DP7A 5G41A 2BGRA 5AM2A 1E2JA 2R1TA 1M1UA 1PT5A 3A4IA 3WMXA 1FUIA 3NHPA 4MGZR 1SCNE 3DOCA 3MCVA 1UJ4A 3VVLA 1XL0A 1J8QA 2C94A 2V7VA 1MC4A 5CK4A 4I0WB 2BTOA 1QC5B 3AUFA 1R16A 1Z26A 1GLNA 5KYYB 3HLYA 1L9XA 3PLNA 4HWKA 4YX9A 5AO9A 2R4UA 1M6HA 4QU5A 4TTTS 2VQEB 3CH4B 3QRWA 3MYYA 4GEKA 4BQEA 4IIFA 4J0QA 3DFKA 4I2VA 3PEVA 4AULA 4CDMA 3DZCA 1PGJA 1QH8B 1T0IA 4O3MA 2H07A 4XM2A 3THRA 2BMFA 1J0BA 1NP7A 1Q2XA