3A2LA

Crystal structure of dbja (mutant dbja delta)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
291
Chain Sequence
IEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 105
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2lA00
4B9AA 4MYSA 1MPXA 1EX9A 3I1IA 1JFRA 5IVIA 3WLAA 1J07A 4ARBA 1ISPA 2OG1A 4OB7A 5ALOA 3FAKA 4BP8A 5JALA 4WDQA 2GBGA 2OXEA 1W76A 3B3QA 5JZBA 5DTJA 1DX4A 4PSCA 5ALTA 2AJBA 3R3VA 4DMKA 3IULA 3WJ2A 1F6WA 1XFDA 5EHNA 1XQWA 1E3QA 4C87A 4H77A 1ORWA 2DR0A 2XDWA 1T4MA 4W9RA 1JT2A 4WDRA 2HA4A 5AM5A 2BKLA 5ALJA 4L3WA 2OPHA 4XVCA 3E3AA 3CN9A 2JGMA 4AX4A 1TCCA 2X76A 2XLCA 4B7ZA 3BL8A 2H7XA 4KAAA 2XI4A 1VE6A 3Q0TA 2ZSIA 3C6ZA 2BUCA 4BCBA 5DJ5A 2QMQA 3C45A 5ISMA 4EY5A 5AOBA 5LLSA 5JASA 5FKJA 2J3QA 4N5HX 1YR2A 1KU0A 5K3BA 1XRQA 1XZFA 2Y2UA 3FNBA 1XROA 2VAVA 3ZLTA 5DNVA 1GQRA 2CUTA 1MO2A 5AKXA 3DCNA 3FYUC 1XZKA 3BF7A 4GDMA 1MT3A 4RGYA 4OYLA 3FYUB 5ESRA 1FFDA 3CN7A 1Q83A 1WM1A 4AXBA 3TRDA 2WG2A 3WWOA 2HA5A 5IH7A 5AJHA 1XZBA 1QZ3A 3AIOA 2ZJFA 4P08A 4AQDA 1QONA 3Q8WA 3C8HA 4E11A 5AK4A 3WK5A 4NVRA 1DWQA 1QOZA 2ZYIA 4QWWA 1QO9A 1KEZA 2JGIA 5I8PA 2LIPA 1YASA 4J0HA 4QZVA 3V1KA 1L7RA 4HRXA 2BCEA 4C01A 4H7HA 1GQSA 5JAHA 1MJ5A 4WCVA 4ZWNA 3F97A 3C6XA 5AKIA 3JYHA 1XZIA 5EIHA 1P0IA 4CG2A 1JMKC 4AMYA 2Z5GA 3V1LA 2P8SA 4YASA 4ZV7A 5LZ4A 2QJRA 4PNZA 2G63A 3EQ9A 3IBTA 3R41A 3C8DA 3EIOA 3WKAA 5IKXA 5YASA 4KACA 5CT4A 1K63A 4J0GA 5KREA 1XZJA 5I9IA 5CT5A 4ZV9A 1C7IA 1HQDA 3UUEA 2W6CX 4XJVA 2HADA 5CBKA 4X90A 1EVEA 3DNMA 4X95A 1XZLA 1CUWA 1UK6A 4Q3LA 2WUDA 2HFKA 2O2IA 1VJ5A 1TIBA 5EIAA 5JD5A 4MWSA 4YX9A 3VISA 5KWJA 5CRIA 1XZAA 4LYDA 4UBOA 2RI6A 5HF6A 3WZMA 5CW2A 5EGNA 2HU7A 3VVMA 2WFLA 1LPBB 3AIMA 1R4ZA 2WFMA 3M3DA 3HXKA 3FYTA 3W05A 1R1DA 2H1IA 5ALUA 1UZAA 3WQHA 5AH0A 4Q34A 5JADA 3OURA 1LBSA 1QE3A 2Z8XA 2XMDA 1XLUA 4OB6A 4QDTA 3V1MA 2ORYA 4HXGA 1C4XA 2ROQA 3HEAA 3WKEA 2O7RA 3STYA 3LCRA 2QKYA 1SFRA 3FLBA 3OM8A 4EY7A 1YSCA 5K3DA 4N8SA 2X8BA 5AM2A 3RKSA 1CQZA 1BRTA 4H7DA 5CH3A 4DSZA 1D07A 2QS9A 1LPNA 4B9EA 2RIPA 1SOMA 3W9UA 2WU4A 2XMCA 4MQMA 2R8BA 5DLPA 5JATA 5AKHA 2RAUA 4CIBA 4W63A 3LLCA 1EDBA 4ETWA 3ZWQA 4LXGA 3PICA 1Y7HA 1LPAB 4G4IA 1H2XA 4K6KA 5DYTA 2WM2A 1QIEA 4KE8A 2HA6A 4QDOA 2ZVDA 4KE7A 1NU8A 4HVTA 5ALLA 2V96A 4H7FA 3A2MA 3BIWA 3O9MA 5A62A 1W6RA 5ALHA 2HRRA 4P9NA 1CUXA 4KAJA 2WSLA 4ITVA 2VAXA 1IVYA 2HU5A 1ZGCA 2DFPA 1B41A 1WHSA 2WJ4A 5T4BA 5D7BA 1QIJA 4JYMA 1J2EA 3HRHA 2PU7A 2Y1KA 3R40A 2QJWA 5C8ZA 3X3HA 2XUKA 3F96A 4MQLA 3HSSA 1UOPA 4X97A 2ZJ6A 3HYSA 4PO3X 1MU0A 4OSEA 4BDSA 1GPNA 3HI4A 1CUVA 5BOVA 4J3JA 2QXUA 3O0DA 4J0DA 3WYNA 2ES4A 5JARA 2WILA 2XUGA 4XWGA 3C70A 5ALYA 1GZ7A 4BRZA 2VJCA 1BROA 4E14A 4J7AA 3T4UA 4HXEB 4HTAA 1MAAA 5EI5A 4X6YA 3D0KA 4ZI5A 3G9ZA 4MJ3A 4C4ZA 4DNPA 1DQZA 1WPRA 1IZ8A 3R3UA 4BVJA 5AKYA 2WU3A 4CCWA 3EF3A 3TJMA 5ALRA 2BGNA 5E4TA 3WJ1A 3SWWA 1W1IA 1Q0ZA 2WG0A 2HU8A 4LYEA 4UFNA 5C7YA 2RONA 2EDCA 4U2GA 5ALGA 1A8SA 4B85A 4L9AA 1G66A 1JU4A 4BAZA 1THTA 1LPMA 1GXSA 2WKWA 3QITA 2WIFA 1NX9A 3E1GA 2JF0A 1QIKA 1AKNA 4BE4A 1CUBA 1UKCA 2I03A 5A7HA 4Y7DA 4J0CA 1OXMA 1QIIA 5HF9A 1DWPA 3WKBA 1VXRA 2GBIA 1QIHA 1EI9A 3IA2A 3D4LA 1MX5A 2ECFA 2QZPA 3FLAA 4B83A 1HPLA 3H0CA 5CT6A 1MX1A 3FOBA 5ALMA 1K6EA 3FLEA 3OPMA 2WFLB 4BYMA 5BWCA 3IUMA 4X92A 1H2YA 4WFJA 3O95A 5JAPA 4Y2VA 2WFZA 3BJRA 4W1RA 5CTAA 5DTIA 4K6GA 1OILA 3QPAA 1RWQA 1CRLA 5CH8A 1MTZA 3D2AA 4UBLA 1DWOA 5ALWA 4BRSA 2PSEA 4BCCA 3STWA 4IH9A 4DIUA 4X94A 2QTBA 2Z3ZA 4BP9A 5HFAA 2OQVA 1UWCA 1QTIA 1X2EA 4B81A 3FCXA 1ETHA 3R0VA 1BU8A 3S2ZA 2WIDA 2DCMA 4AN0A 1LPSA 3WK7A 4KJXA 4G4GA 1XQVA 3L1IA 4UHCA 4FFWA 4G9GA 3K9BA 4J0JA 3RLIA 3DYVA 2H9YA 3U1TA 5K3AA 4FKBA 2YYSA 5H3HA 5DNUA 4FNGA 1IUNA 2VT6A 3CCCA 5DYYA 5CH5A 1X2BA 2JGJA 5T4HA 1DQYA 3D3NA 1E8NA 1TKRA 5LYYA 1U8EA 4G1FA 1GPKA 4ARAA 2GBCA 5AKGA 3ZV7A 4JUIA 5AOAA 3STXA 4J0KA 3I2HA 1KU6A 2XQJA 4M0EA 2JEZA 1AC5A 3WKDA 3A2LA 1YCDA 4GBGA 2QRUA 5AM3A 1XZEA 4H7KA 2R11A 3DDUA 1LBTA 4V2IA 4DMFA 5HF5A 3W9BA 3STTA 1UK8A 3KWJA 5CT9A 1N5MA 1J06A 1TK3A 5ALIA 2B4KA 2PX6A 2YXPX 4BB0A 1BCRA 3ZPXA 1CUDA 4RPCA 2QT9A 3M81A 4H7EA 3D7RA 5LZ5A 3RM3A 3B12A 1N8SA 4EZIA 1H23A 3IURA 1EK2A 4AZ3A 4QDZA 5A6VA 2C0QA 3CXUA 1MNAA 4Y2SA 4OB8A 2ACEA 4EHBA 1ZOIA 4MWTA 4CCYA 4Q1VA 3OOSA 4UHDA 5A71A 3D2CA 1FJ2A 1ZD5A 3GA7A 3WL6A 1JJIA 1UK9A 3C5WP 4J03A 1DINA 3G0CA 1BN6A 1XZMA 3FBWA 3I2KA 1ZJ4A 4BATA 5ALKA 3MUOA 3HC7A 4UUQA 3H2GA 4EA6A 4E15A 3BIXA 3C5VA 1G4HA 1GKKA 2DHDA 4G8DA 2WJ6A 3G9UA 1ZIXA 5J3JA 4X00A 3VDXA 1UOQA 4H18A 3LIPA 5C8VA 4C4YA 3GFFA 2HM7A 1ACLA 1JJFA 4H0CA 4GEGA 4JEIA 1QJ4A 3DD5A 3LP5A 5LZ8A 1RYYA 5FRDA 4GECA 5CURA 3MGAA 2Y6VA 3VJKA 2XUHA 3SK0A 2WIKA 1J1IA 3MVEA 4G8CA 4AO6A 5JANA 3WWPA 4ZRDA 2RHTA 2D5LA 3H2IA 3QM1A 4UBJA 2V98A 5C8XA 1K8QA 4PSDA 1YAHA 4DLNA 4DMCA 4FDMA 4ZGBA 2QM0A 5SYMA 3I2IA 5K3CA 3DL4A 2WHRA 2WJ3A 2PSDA 3IUNA 4OU5A 5AIBA 2XUQA 1HDEA 1VXOA 1FFEA 3KOOA 2AJCA 5AI4A 4BVLA 2PM8A 2OCLA 1XRRA 1A88A 5T4FA 5AI0A 7YASA 4UFPA 2PU5A 2B20A 3L1HA 3HABA 3F67A 3PUHA 2GYVA 4BCDA 3B5EA 1R50A 1ODCA 3RARA 4DNFA 3R3WA 5AM4A 2WIGA 3H1BA 3AZQA 5JD6A 4GW3A 4OUKX 3H2HA 1ORVA 1LZLA 4DNQA 1E8DA 5ALPA 4MXDA 5JD4A 1XKLA 1ZI8A 4Y2UA 4BBZA 3W06A 4Y2JA 4OPMA 3BXPA 4GLBA 2CB9A 4IO0A 1CQWA 4FLEA 5AHXA 3WK8A 3O4GA 3G0BA 1CUGA 5K3FB 3ED1A 1AQLA 5CMLA 1X70A 1E66A 1ZIYA 2JGFA 4K5QA 1AURA 2ZYHA 3WK4A 3KSRA 2XMGA 1HLGA 3STVA 5FXMA 2BFNA 2B9VA 3WKCA 2O7VA 1BEEA 4WJLA 1ODTC 5JAOA 4M0MA 1VKHA 4MEBA 2CBGA 1EVQA 3OC0A 3GROA 1ZD2P 2HFJA 5AKZA 1SC9A 1R3DA 3DJYA 2YASA 4FMPA 4M0FA 4WFIA 2OGZA 3I1YA 1B6GA 2XE4A 2OAGA 2OQIA 2IIVA 2O2HA 2QR5A 5BWBA 4EUSA 1WB5A 3V9AA 4XX1A 5E2IA 3IUJA 4FHZA 4CFSA 1LGYA 1GT6A 1VLQA 1CUAA 1PJAA 1YAJA 3NGMA 3KDAA 4A23A 3QMVA 1JMYA 2WIJA 2PKYX 4HXFB 5DYWA 4JNCA 2XQIA 2WTMA 1USWA 1R9MA 3WZLA 5AIAA 2I78A 4CCYB 1DTEA 1O6GA 3M83A 4F21A 1LPPA 3N0TA 4AB1A 4Q05A 2BJHA 2Q0XA 1A8UA 1CLEA 3GBSA 5ALZA 5A7GA 4MEAA 4Y2QA 4YK7A 5EHQA 3G02A 1OCEA 3BDVA 5ALQA 1QIFA 3QPDA 1L7AA 3O4IA 2DQZA 4PW0A 2X5XA 4BC0A 5AP9A 2FUKA 4ZREA 1CUCA 5IVHA 2C58A 4EBBA 3QH4A 2VJAA 1HBJA 1UXOA 2QUAA 1VOTA 5AKJA 2QUBA 4L72A 4XIIA 4Y2TA 5E4YA 1TQHA 4UBIA 5FV4A 4J0IA 1PFQA 4X6UA 2HIHA 3QYJA 5K5EA 1YS1X 4GXNA 1CPYA 1WHTA 3WWCA 4N8DA 2VT7A 3GELA 3QMMA 2I3ZA 3IVMA 1ZICA 1QFMA 3ESDA 1O6FA 3BWXA 3I2FA 3PE6A 3KXPA 2VTVA 2XT0A 3OG9A 2J4FA 3VVLA 2C5FA 1N1MA 1H22A 3K6KA 2Z3WA 3NUZA 2H7CA 1U4NA 1HL7A 1XLWA 2FX5A 5D3KA 3YASA 2HA3A 3D59A 1SCIA 3GZJA 2JGEA 3IIIA 3RK4A 4D9JA 3W2TA 5ALVA 2G4LA 1LLFA 5AK3A 3O9VA 3E0XA 3DOHA 4IH1A 1EDEA 3NOXA 4KRYA 5HZGA 3G8YA 1LZKA 3C87A 4B6GA 1ZGBA 2QXTA 4AO8A 1QLWA 2XUJA 3G9TA 4KYVA 3VKFA 2XUAA 4F0JA 2AJLI 4I19A 2ZJ7A 2GZSA 1XRMA 4B0OA 4BE9A 1JU3A 2WUEA 3H2JA 1L7QA 1CUIA 2HL6A 4FBMA 1XRNA 1TRHA 5BV7A 5JAUA 4IQ4A 2XUIA 1WCYA 2JGLA 3ZI7A 5JZSA 1TAHA 1MN6A 5KWIA 4DYHA 5JIBA 3E4DA 1M33A 3F9CA 2BUAA 3H1AA 2W22A 3LS2A 4EY4A 1EK1A 3QZUA 3PDCA 4Y2XA 4C4XA 3ESCA 3AZOA 4U2EA 1EB9A 5LKRA 4E46A 5HKBA 1DT3A 1FFAA 1XZHA 1BCSA 1CFJA 1XLVA 1CUUA 4NS4A 3JW8A 2HA7A 4U2CA 1W4LA 5AICA 1YA4A 3PI6A 2OCIA 5A7FA 3ESBA 4K6HA 1VE7A 4NMWA 4KR0A 1TCAA 4S0XA 2OGTA 4G4JA 4BDTA 1U65A 4LXHA 1QIDA 1AUOA 4YPVA 4DTCA 1CUFA 4PQEA 3HLKA 4FNMA 3R3YA 5D3ZA 2I3DA 1EH5A 5AO9A 3H04A 4FBLA 3VXKA 2HDWA 3ZLUA 4F5ZA 3OTQA 1H2WA 3H19A 3A2NA 1S8OA 5CXUA 3G0DA 2VF2A 2WUGA 1G5FA 3WA6A 5HQ3B 4QA9A 2QVBA 4C88A 2WUFA 2Y6UA 3NWOA 2PVSA 4H7IA 2FJ0A 4KRXA 4UHFA 5IVKA 1GKLA 2WQZA 1WOMA 3PF8A 4JH0A 5LZ2A 4Y2YA 2XMQA 2VQ6A 1XQYA 3DYIA 4U2FA 3FYUA 2Z8ZA 1HKHA 1G42A 4INZA 1JJBA 2C7BA 2XUDA 2G5TA 4QDUA 3IDAA 3WK9A 2BAGA 2PSFA 1DT5A 4QLAA 1UK7A 1H2ZA 3I2GA 5A2GA 2C5GA 3BDIA 3AUKA 1WB4A 3WWDA 2NW6A 2D0DA 5ALXA 5CT8A 5EHXA 1CUEA 3I28A 1FFCA 1WB6A 4BTVA 3K2IA 2RHWA 3HZOA 5LKAA 1EB8A 2ZSHA 4N5IX 3FVRA 3SX4A 3DS8A 4Q3OA 5FP0A 1VA4A 2OCGA 2J4CA 2V97A 1XZDA 4UPDA 4G9EA 3DKKA 3WL7A 4FLMA 1E8MA 1A7UA 2CEKA 1W75A 2GBFA 2VSQA 3FCYA 3S8YA 1UFOA 5LZ7A 2OCKA 4B82A 5HK9A 3O4JA 1XZGA 5D6OA 4C89A 4UHEA 4RE5A 4H35A 4CG1A 4KE6A 2EDAA 3D5EA 4QE3A 1F8UA 2XQKA 3AILA 2BGRA 1AZWA 3V48A 3WMRA 2PPLA 2XUPA 5T4EA 1ACJA 4AN1A 4IHAA 4F60A 5ALDA 2GYUA 1DX6A 1XRPA 3FSGA 5EHZA 3WL8A 2XUFA 3A70A 1EXWA 2XMBA 1RP1A 4G8BA 2XQGA 1QFSA 5ALEA 5HQ3A 2JEYA 2WLSA 4BZWA 4X85A 4X93A 4OCZA 5FUMA 5AM0A 4PV7A 5AI5A 3UMJA 1MX9A 1MAHA 2DHCA 2EEPA 2JIDA 3SC2A 3V1NA 3L1JA 5FLKA 4Y2PA 4RNCA 4OYYA 1ODSA 3FSGD 4I3FA 4QEKA 3C6BA 2CMFA 3ILSA 5K3FA 2OLEA 4QWMA 5E4JA 1CVLA 2JGKA 3LIIA 1EINA 2HRQA 2DSNA 4A5SA 4GWLA 1EA5A 5EIEA 3WIBA 3STUA 3DKRA 3C43A 3KWFA 1UKBA 4DNOA 1XZCA 2BUBA 5AK5A 3GUUA 1I6WA 4UHHA 4BAGA 5HF8A 1A8QA 3EQ8A 1YS2X 3G9XA 5F4ZA 5FOQA 5ALNA 4GI1A 1Q0RA 1E89A 4KAFA 2O2GA 2AXEA 2OGSA 1U2EA 2UZ0A 4TGLA 4BC1A 2K2QB 4FOLA 5AKKA 5K3EA 2WG1A 4HS9A 1QO7A 4CG3A 1AMNA 4X7BA 5JYCA 1ZJ5A 3F8SA 3ANTA 3A6ZA 4AZ0A 4RE6A 5LZ9A 5SYNA 2PSJA 3IUQA 1LNSA 4U2BA 1BE0A 4NZZA 4UBMA 2B61A 1IUPA 3WA7A 3AIKA 1Y7IA 1Y37A 4PSUA 3W04A 4DSAA 2IITA 1UT6A 1ZI6A 5DWDA 2XQFA 1ZI9A 2JBWA 2FJPA 1JI3A 3WI7A 4B84A 4CIAA 4PF1A 2HA0A 3F98A 4AO7A 2H7YA 3I2JA 5HKAA 3ICVA 3O4HA 2CJPA 4WFKA 4WY8A 1Q84A 1QIMA 3PFCA 4MYDA 4X6XA 1IZ7A 2VJDA 1QGED 3DOIA 3FVTA 2QOEA 3H2KA 2V9ZA 1WPXA 4CI9A 1E5TA 1NU6A 1R88A 2IX9A 4W1SA 3TEJA 5HCUA 4KEAA 3AJAA 4L0CA 1YB6A 3IB3A 3WWEA 2WHPA 2YH2A 4K2AA 5CXXA 3BJMA 4FLFA 1VA5A 5AI8A 4QLOA 4O08A 3WYDA 1K4YA 1CUJA 1F0PA 1Z68A 4JYPA 2AJ8A 1P0PA 3DL7A 1CUSA 3JWEA 1W52X 4GHWA 3AFIA 5HFNA 3EQ7A 1YA8A 1SCQA 3FWHA 6YASA 4LKOA 1VZ2A 3TGLA 3BE8A 4DMHA 3G0IA 1LPOA 2VJBA 1ZD3A 1GGVA 2PSHA 5IVDA 5EFZA 3BF8A 1UOOA 1UKAA 1T2NA 4FTWA 2XMRA 3T52A 1N5RA 3QPCA 2XLBA 2CKMA 4UFOA 1C7JA 2HHAA 2XUOA 4EY6A 1CIJA 2PBLA 4C6HA 2GZRA 4Y2RA 4WY5A 1AX9A 3R3XA 3UUFA 3EBLA 2ONCA 3DQZA 3AZPA 3H17A 3VJMA 4X3CA 5FDFA 4DGQA 5AK6A 4U2DA 4W1QA 5AOCA 5C81A 4Y9SA 3WIOA 2DHEA 1TCBA 1P0QA 4BVKA 3VJLA 1QTRA 5DNWA 3P2MA 4BTLA 2C4HA 2ZYRA 3ICWA 4Q3KA 4ROTA 5AM1A 2VEOA 1GPLA 4B80A 4X91A 4Q82A 1XKTA 5AKLA 2ACKA 2PL5A 2PUHA 3WK6A 5FPPA 4W1PA 3N2ZB 2AJDA 5AI9A 5JZ9A 5LIPA 2C0PA 2WHPB 4BAUA 1R9NA 4HAIA 4AMZA 4QNNA 2XB6A 1BEZA 1K5PA 4DM7A 3HJUA 4FWBA 3R3ZA 3M82A 4EY8A 3D2BA 4OU4A 3PF9A 4IH4A 3QMWA 4B0PA 3PUIA 2GYWA 2XMSA 1AGYA 4LHEA 4KE9A 1MNQA 4I4CA 3AINA 4N8EA 2VATA 3ESAA 2ZYSA 2J3DA 3PFBA 2XMZA 4UBNA 5LP1A 3QBJA 1EDDA 2Y2VA 1CV2A 1IUOA 1CUHA 1JKMA 5ALFA 1YB7A 1VZ3A 3KD2A 3WL5A 2WHQA 1F0NA 1BN7A 1CR6A 3ZLVA 3MUNA 4X71A 4HRYA 2WTNA 2CZQA 1SCKA 3G0GA 4QDXA 5FPQA 1CUZA 1XQXA 1FSSA 2RGUA 1EHYA 3I6ZA 1BS9A 4BZZA 3I6MA 4H7JA 4LXIA 4ZXFA 3G7NA 1IMJA 3DLTA 1QIGA 5KBYA 4UBKA 3H18A 5AI6A 4TVKA 1PV1A 2E3JA 4P93A 3HACA 5I7UA 3ANSA 5HK8A 1ZD4A 1P0MA 4TPKA 4G5XA 5ALSA 3QVMA 1CEXA 4LIPD 4OD0A 2HA2A 3U0VA 2PUJA 1XRLA 4FFVA 1DU4A 3DEAA 4Z49A 1CUYA 4UHBA 5AKEA 4P92A 3C6YA 4A16A 2OAEA 2VA9A 4EB0A 1FFBA 2DQYA 2G5PA 3CCBA 4HZGA 3I6YA 1THGA
chains in the Genus database with same CATH superfamily
4D43A 1RYMA 1MQSA 5I7EA 4GS5A 2EFDB 2NPIA 1UZUA 1RFLA 4KV7A 4DLWA 5I3ZA 3MRVA 4KO2S 4CLXA 1W5AA 3IO5A 4XGRA 4A8TA 4BNMA 4ARBA 4FHFA 1J0XO 2NO9A 3NHUA 3SZOA 1Y98A 1EDZA 2BM8A 4X41A 3M2TA 3KKMA 2BBWA 4OB7A 4CQMA 1UL1X 5FBZA 2AMVA 1PJ3A 1UZMA 3FAKA 1KDZA 3SHTA 3KIPA 2WF5A 4QLBA 5C7OO 4HDNB 1JHRA 4TSFA 3WFJA 1USIA 4O2BA 1TF5A 4WDQA 3T4XA 3GP5A 3WQSB 1EP1B 3E23A 2J4DA 1I4TD 2IHTA 4OHFA 4TT3D 4BKQA 1R2QA 1DC3A 4CM9A 1B3RA 3AXTA 1SKUA 3I4CA 2QRHA 5DTJA 5JZBA 5ALTA 1AKVA 4TWJA 3UHOA 2FEPA 1PSZA 3CEHA 1PFWA 1T5BA 1YR6A 2VDUE 3ZDCA 3MJEA 2ATIA 1F6WA 1XFDA 3CFYA 4EGAA 4FYIA 3CUKA 2IUYA 4BO3A 3Q3GE 2B4TO 4MW5A 1KHHA 3LYUA 1E3QA 4TMTA 2XWJI 2C8VA 3EZXA 4C87A 4ZZ1A 1CJVC 1TI7A 4WLNA 2OKGA 4BNHA 2HHCA 3AU8A 2GFIA 4WA7A 2NO1A 1XELA 3EJ6A 4LXQA 2WLTA 2IYXA 2VDNB 2DULA 4A8JC 4YXFA 5JSZA 3O84A 1UDAA 3V1UA 1DIRA 3CRRA 1JH8A 4X1YB 5LP6F 3PHGA 1Q1ZA 2O8NA 3ZW7A 3BULA 5LYJB 2FWPA 2CNWA 3RFFA 3V7UA 1ND6A 3E9DA 5A6SB 2G04A 2FF5A 2PFGA 2ZYAA 1EFAA 3CLVA 4J6FA 4REMA 3L40A 4ID3A 4XFDA 9GPBA 4UE2A 2LV8A 3HJCA 5CCEA 3ZGZA 5IPFA 2I33A 5DT2A 4AX4A 3LGAA 4J7UA 2H7XA 4KAAA 1NTRA 4EYEA 1NYTA 5IF3A 3EG9B 5GADl 1OYWA 3PGLA 4TRJA 1ADGA 3HJFA 1UIRA 4JXJA 4MA5A 1R0YA 2ZRDA 2BUCA 1IJBA 1D6JA 4LXXA 3VPDA 3WY9A 1XU4A 3AHFA 3ELDA 4BCBA 2IVZA 4TYMA 3RRZA 3ZI4A 4WT7A 5DIFA 3B3GA 3BYZA 2IH4A 1AQ6A 3FFTA 3V4SA 1W5SA 5DM60 1LBEA 1YTLA 1Z5WA 2B8TA 5C18A 4ZI2A 2PCJA 5E3IA 5LQUA 1OZFA 2ZIXA 4EY5A 4XFJA 1K9SA 5AOBA 4HB0A 1GNTA 4IBOA 2H4JA 1GJRA 5INTA 3FZYA 5CDFA 1AZTA 4EHKA 1TB4A 8LDHA 1W0CA 3ONFA 2QQGA 4PVDA 4AP5A 1GTMA 1ARZA 3IOBA 1NXQA 4P4GA 4B33A 1T3LA 2W2MA 5A04A 3Q10A 4QO8A 1U4SA 3BN3A 2B8WA 3EGCA 1IWPB 3ZY2A 3KQYA 1XROA 1IYZA 1XEFA 4MP3A 2HQBA 1E5QA 3A36A 3NLLA 1FP6A 1UPUA 4O63O 1GQRA 4HTFA 2PTHA 1WSWA 1EVLA 3BKWA 1MO2A 3IKJA 3QJGA 1XZKA 5EHIA 1Z4JA 2DF8A 3ADPA 4ZO4A 3UHAA 3AJRA 3DWGA 5KNCD 1UFQA 1SHZA 5BUSA 2FVYA 4MYTA 4Q4AA 4DMRA 1OXSC 4Q16A 4DLKA 2QORA 5SZKB 4GR9A 1KQOA 1N2CA 1RI4A 2SCUA 2VR1A 4IRMA 1XEXA 3OECA 1BNCA 2GDZA 3PE4A 4G0ZA 5ESRA 5H83A 5LOVF 1UBUS 3GV0A 4ZCPA 2AMLA 1JHOA 3CF0A 4HVLA 3V6LA 3FOCA 5HR5A 2CLMB 2AZMA 2DEUA 1SCUB 2HA5A 3DP9A 2J07A 2NT3A 2PH3A 1XZBA 5LBTA 2HK6A 3BPSA 1BWRA 3M6WA 4ZK6A 121PA 4G41A 1BG6A 4NOLA 5J58A 5FT9A 1CEYA 2EFGA 3SMVA 3Q8WA 4LZLA 1YVDA 4HWOA 5IEBA 1NQTA 3ND6A 3INNA 2V0NA 2WJIA 3EXAA 3NIDB 4P38A 4PR0A 5K51A 5FV7A 3MXOA 2CMHA 3VV3A 1GAEO 1SO8A 2QJOA 1VB3A 4DLAA 5B6JA 2Y1OA 3A4TA 4MMZB 3AVUA 1YB4A 4KFUA 4TS4A 2HTFA 5H1YA 1ZRSA 1KEZA 1RIIA 3OQ1A 3K7EA 3KUCA 1IBKB 4KMSA 3RUHA 2FZEA 2HCFA 3MTDA 4J0HA 1JU9A 4DQXA 4RD0A 2BMWA 5DNUA 1RVDA 2ZTVA 2VHXA 3E1KA 2JGRA 2EZ8A 2JBAB 1WNTA 2RBKA 3ORRA 4HCJA 4JGBA 4O4LB 2PJRA 2Y0PA 1DEKA 3F4KA 4TWZA 2H0AA 2BCEA 3IKMB 2I6TA 3C3CA 3MIZA 4NG4A 3TB4A 1RRVA 4CIVA 2OZPA 4E2FA 4EFMA 4YAFA 821PA 3GLTA 2VDVE 4I2VA 1RFGE 2LNDA 2C8JA 1PT8A 3HVJA 5ICMA 3W5BA 2HF9A 2MU1A 2XCOA 3DT8A 3IUSA 3MFQA 5EWMB 1YR7A 4MP8A 1IN4A 5CA1A 1CQXA 2DUNA 4GKAA 3GLHB 3T3HA 3BQNB 2B6NA 3LBYA 3V8PA 3DHWC 1UDXA 4FJ2A 3X2SA 4CF3A 2R00A 5JAHA 1N0HA 1P4HA 2G82A 2HLHA 2UZ1B 4U7JA 1TU4A 3G1TA 1D2RA 5MFZA 2Q3BA 2F8MA 1SUBA 4REQB 5AKIA 4Z7NB 4CKEA 3HK2A 1XTZA 1YDWA 4RA9B 3NTXA 3FMIA 3TQCA 3HUTA 2ZSEA 2AF4C 4DV3B 2JLBA 1I14A 1JMKC 5JH7B 4GVPA 1H8HD 1V5GA 2PMWB 2VK4A 4TUYF 5AJTA 2ZJ0A 3I12A 1TA0A 4V02A 5L3SB 5AUNB 5CLGA 2M32A 1QHSA 4XLZA 4Y9TA 5U4QA 5IVPA 1WDMA 4P5DA 4GZ5A 3M6IA 3F4LA 3OCCA 4QU0A 3SMQA 3WLMA 2OSVA 5EJGA 2HW8A 1GQOA 3MMSA 4NCHA 1IBLB 2P9BA 1QK4A 2QJRA 4PNZA 1PLJA 3AR6A 4YGYA 1QHGA 1A9RA 1RE1A 4N40A 4P54A 1TYZA 4UNQA 2KB0A 2P2LA 1BWPA 2O5VA 1WL8A 4ZT6A 4KXWA 2ICAA 3EQ9A 1T0UA 4ANFA 2IC5A 4EUFA 3R41A 1G6HA 3OF5A 3HVIA 1QGAA 3KKLA 1W25A 4DR6B 1YB1A 1ZM2A 3KX2A 4IHJA 1X86B 2JKVA 4IDOA 4TLBA 5AWFC 3O75A 8ATCA 1LDEA 2A9FA 2C54A 1JSCA 2GFQA 2XNHA 3HCAA 2XGSA 1K63A 3PHLA 3GUCA 1BX3A 2QF7A 3GFVA 1DELA 1E99A 1USKA 2XPCA 4P33A 1U0OC 4PBRA 2CVPA 2D0IA 4N82A 1XZJA 2VL7A 4DJDC 2WJGA 4NMLA 1MABB 5CX4A 2PUAA 4FDLA 1F48A 2HT1A 3HGTA 4UM9B 3QP9A 2OXTA 4IIHA 3BMOA 3I01M 2ISSD 2O8FA 1C7IA 5HQJA 3GVIA 4OQQA 3UUEA 2JIZA 2ZSJA 2UYHA 1X39A 5CD1A 1VPTA 4G1BA 3RVLA 1FTSA 4BVEA 5KJFA 1HGXA 4M3NA 3P71T 1D7OA 2EJBA 1JHDA 1OBOA 2JD0A 2V7GA 4FOOA 2ERXA 4ZAXA 4BWVA 3VO9A 2XECA 2QN1A 4EG1A 2J0SA 2FEXA 1V11B 3QXHA 2H0QA 1AD2A 1Y4DE 1MA3A 1GAWA 1M6VB 3ROZA 3CT4A 5ERGB 1FUKA 2FPWA 1O0BA 2QV0A 1OC4A 1M2GA 1SVUA 1Z06A 3INRA 1NLUA 2JLXA 1M2VB 3H9JA 2QNIA 3Q7QA 4AMVA 1EVEA 2EZUA 4WV3A 4H3HB 3U0BA 1PGOA 3IBYA 3TNDA 2EKQA 2J3IA 2JFUA 2VP2A 2FSPA 3SKXA 2ZS7A 2PRKA 3UATA 5P21A 1QOQB 1U7TA 3UW1A 3RC3A 3V4FA 4DQVA 4HZUA 4OI2A 3V4VB 4Q9JA 5C80A 5AOVA 3QNWA 1JQ3A 1NYQA 1NVVQ 2PWYA 2A2ZA 3NTVA 4OXIA 3JQ7A 2HCTA 1TIBA 4I4TB 4J07A 4YNBA 2JCBA 1D09A 4DY4A 4IJQA 5CPBA 2X0JA 4MK4A 1WV1A 3ZKAA 4FGKA 1X15A 4RW0A 3E5NA 4GWGA 2G4CA 4O4IB 1IHUA 4F4JA 4LY6A 5G41A 3C6MA 3GDFA 3WYCA 3OCJA 2OCDA 2BKVA 4FSHA 1MOPA 1ADFA 1XG5A 4O4LF 5E2BA 1J2TA 3VISA 1P3JA 1YDHA 1ZC3A 3ET4A 3GN1A 2EKBA 1TEVA 2FEWB 3OZSA 5K8JB 3JD0A 3T7RA 1QF6A 3RJMA 3R3JA 5K9ZA 5A1JA 2ZRBA 4IILA 4XASA 3P9YA 2HU7A 5EGNA 3U7QA 1D2HA 4ENUA 5H59A 3VAZA 6LDHA 4RTNA 1ZLXA 1SRQA 3WBKA 3AIMA 3X1ZA 1IY8A 4CL3A 4QULA 1YQEA 3I1FA 3JD3A 3W05A 2WWRA 5A4AA 3DBHA 1GEGA 2Q8NA 3D4BA 2P3SA 1JFFA 4E4TA 3U7HB 2FWIA 3O2JA 2WPDA 3FMGA 2WYHA 5JADA 1E9VA 1C3OB 1B42A 2YQ5A 4FSXA 1D3AA 2UXCB 4BJ6A 1R6XA 1OAAA 1K1EA 3IEKA 4RUKA 1BXRA 1YS7A 1ZIOA 1F2UA 2Z8XA 2ZB7A 2IDMA 1E6UA 1XCPA 4PFKA 1XLUA 2GM3A 1N2XA 4OB6A 4RS3A 2PS3A 2CF6A 3PV0A 1DFHA 3TLCA 4D3FA 1PVVA 4TQUS 4DV2B 4MSUA 3P9SA 1R3UA 5DXAA 1UPFA 1N33B 2GPWA 1UBGA 2YMPA 1YJAA 3A1NA 1C4XA 2JDIA 221PA 4PNEA 1UC5B 3P2JA 1P1KA 5PGMA 2J87A 2AR9A 2NUAA 3TIVA 1LJUA 3E2PA 3G1UA 3GRAA 3OZTA 3STYA 3DLIA 2X9GA 1PJBA 2QKYA 3AB8A 3L49A 3LCRA 5FOXA 4RFSA 5HMMA 5TQ0A 3CVOA 2VWHA 3OM8A 3H0KA 4LOIA 5L7TA 2ZE5A 4NFYA 1SH7A 3ETEA 4OL9A 5AM2A 3MPUA 4B3JA 2ZU0C 1OMOA 3T1QA 1XMSA 2V5VA 4LHYA 5B3AA 2J31A 3D4OA 2C3PA 5KNBD 3EASA 2OILA 4DR4B 1DKUA 1BRTA 2C03A 3ICPA 4EPTA 3LC7O 3THSA 1KPHA 4BLOA 1DJNA 4DGSA 2J9XB 4HAXA 2IL1A 1S3IA 1Z2EA 2R6CA 2V7XA 2W2QA 4B9EA 1NQUA 1NV9A 2EWWA 3BXXA 3UENA 4AJEA 1ENPA 2IPXA 1Q1GA 4EJSC 5AKHA 3KQQA 1D2GA 2DJIA 1GLNA 4ETWA 4RX1A 4LXGA 3KELA 5IAEA 2BFOA 3HJAA 1LPAB 1RC1A 3RU2A 3UV7A 4L8LA 3BGSA 2ESRA 2IHNA 3REQA 1GL7A 3GPDG 4L73A 1PGQA 5EE3A 4NU5A 5HP4A 2I6UA 3DEFA 1YGPA 2V7BA 3EGXB 4CG0A 5IS2A 5TSDA 1TUGA 1NVEA 3B1KA 1RRPA 4KLAA 2NU8A 3G85A 1IM5A 1CDDA 1P5JA 5ALLA 1VI2A 4TQGA 3W3AH 3A2MA 1Y3DE 4QL3A 4FZJA 4CMCA 5BOSB 2F67A 1ONSA 5ALHA 3LQYA 3HR4A 3PA8A 2OC9A 3Q7TA 2XZLA 2W6IA 3NEYA 5ENVA 2P9CA 4GICA 3M4XA 4YJGA 3WP0A 1KR5A 3L1UA 1ULSA 4GMGA 2QLNA 1OSNA 4HQOA 1CEQA 3RS7A 1A1VA 1F9EA 1ZC4A 3HYNA 4Q6WA 4DT1B 4L08A 4DWJA 4YJ2B 1VL6A 1VHLA 1PTJA 5EA2A 3GI1A 4AW9A 5T4BA 1R5BA 4K9MA 5D7BA 4EF6A 3PXXA 4I50A 2H1CA 2PU7A 5LA6A 2EFEB 4HGOA 4YMWA 4G6ZA 3MS4A 5BSFA 5DIZA 1A71A 3A6GA 4B6PA 2MMCA 4JBYA 3IDOA 3FF4A 3ILYA 4LXYA 4CIXA 4GX0A 5CM2Z 4YQFA 5C8ZA 1KZ6A 4YRMA 4CV0A 3NR2A 5EXEA 1IQRA 1A98A 5K0NA 2X6RA 3I9V1 4G8JA 4ID9A 4KQ6A 4ZYLA 3B1FA 3GPBA 1HRDA 3HSSA 3VR4H 4IOJA 2VPZA 3NH6A 2VK2A 3OF3A 1SU4A 1NQ5A 1S3FA 1UOPA 1WG8A 2OP0A 2ZJ6A 2F00A 3HYSA 4MRPA 4GI3A 3ZJTA 5FWYA 2BW0A 3SOPA 3FNQA 4K9NA 1KVRA 4ZRNA 2J08A 3NZEA 4P4SB 1CUVA 4UEJA 2X58A 4C0WA 1RWPA 1IEVA 4JUAA 3K3PA 5FPSA 3P0HA 2FPMA 5CNKA 3LQ1A 3W8EA 2CBXA 1WMFA 2MDTA 4MTLA 4F46A 4NCAA 3CNOA 3CH6A 4JJAA 3ND8A 4TWBA 1HF3A 5JARA 5IM4A 3NETA 4ZQBA 4YUVA 5HUHA 1EWKA 1C4WA 3OIVA 4ZAGA 4XWGA 3W6ZA 3K9WA 4ALNA 1QRUA 4ZVOA 4LDAA 3D9QX 2J9RA 1EWYA 2Q41A 1Z47A 3Q7EA 1XYVA 1GNQA 5G3YA 2I4OA 1Z4OA 2DC1A 3HDJA 5DNDA 3WB1A 4E14A 4X0EA 4F1WA 1GUDA 3T4UA 4TL9A 5CIYA 2CZCA 2OBNA 5TB5A 4Y9UA 2GPNA 3EGVA 4E4RA 4ADSG 3UA3A 2WWHA 3E9EA 1GZUA 4MVJP 2ADOA 1ZM9A 4QQ8A 3THWB 1KRWA 1V4BA 4AZWA 4O2BF 1Q0TA 3TSYA 1JL3A 4RDCA 4YJFB 1ULHA 1VJCA 3B53X 4JYBA 2C9DA 2ZVPX 4EHNA 1T0BA 2O3RA 4Z9FA 3UYLA 3QE9Y 1SZCA 5AW1A 3PJGA 3FI9A 1KO5A 5GOZA 1PIWA 2QUJA 1MKYA 2CHFA 1J21A 3EDQA 1SBTA 1QVAA 5AKYA 5ANRB 1QM5A 1YFLA 1R00A 4PBTA 1SVKA 1DJLA 1KY3A 3BFXA 3RK1A 5FI0B 1Z33A 3V42A 1CG6A 2GMWA 3EF3A 2ZI3A 3TJMA 3V7YA 5CG2A 3QU2A 3NIWA 2BGNA 4TWIA 3LDGA 5LDDC 1UAGA 1IJKA 2YHIA 1KA9H 1RHKA 2QAGA 1ZRMA 4GLLA 3SWWA 4H3SA 3VO1A 2OV1A 3I6QA 3U3OA 3TECE 3KSUA 1XEWX 3KXLA 2EU8A 6GPBA 1TO2E 1VL8A 1W1IA 3SY8A 3H4MA 2R2AA 1Q3HA 1YDFA 1RNLA 2QTGA 3SCZA 4IUBS 1IXYA 4TSFD 5C7YA 1TVKA 3JZFA 3DPUA 2PV0A 2B8EA 2DWPA 4AG5A 1LSSA 4W8HA 3ZV4A 4BGIA 5LVAA 4FE7A 4DQUA 3BTVA 3DOCA 4BQFA 3RAEC 4FCCA 3MJDA 3QXCA 3OUTA 4IIDA 3NX4A 4B6FA 2XAAA 4MW4A 4EITA 4L9AA 3A1DA 1G66A 4AT1A 3LUHA 4YJHB 4ESOA 1LRKA 4IW3B 1U2DA 3D6MA 2WAXA 1LPMA 2JA1A 3C5HA 4BFXA 4M53A 1FYWA 2A0KA 1SCNE 3AONB 4QRDA 3QKIA 2C7GA 1NX9A 2RGYA 2YWHA 1S1MA 4LVUA 3B36A 3BG5A 5EQJB 4BKMA 4YJ2F 2RCNA 4JGIA 1Y3HA 3H2YA 2OQRA 3MMNA 4K9SA 4XD7D 4Y7DA 1FTYA 4GSYA 5KNDH 4HC4A 1IM8A 4OXYA 4YCLA 1QIIA 2H4XA 3C39A 1PD0A 3NYRA 4OJMX 2Q4OA 3BOSA 1DWPA 1QWSA 4RMHA 3WKBA 3PEUA 5DBIA 3WMFA 3BD8A 2GK7A 3HN2A 1J24A 4OGFA 1FSGA 5DBFA 5C1BA 5LLTA 3D4LA 4BNVA 3IUEA 5EUMA 1D5CA 4OP2A 1MX5A 2DHQA 4X3PA 2RKBA 4Z4EA 3TVDA 3FLAA 4B83A 3WJ7A 1HPLA 1YKSA 3E3OA 3ZIDA 3MRSA 5CT6A 2VDWA 3FOBA 3OJXA 1IXZA 1FRQA 2AEJA 3U7JA 4X24A 2XOKD 4F86A 2E49A 3OPMA 1I4OA 3CZAA 3LBIA 4BYMA 3AOEA 4QELA 1FDTA 4PYKA 3AUJB 3IUMA 4QAJA 4X92A 2RG7A 3WOHA 1PT9A 2WF7A 3QFTA 4Z53A 1LNZA 3OLCX 3IEMA 5JAPA 5EKUA 3RTEA 2WFZA 1V1RA 3KYJB 4W1RA 5CTAA 4RPHA 5IT4A 1B1AA 1OILA 4K6GA 3N8KA 4NPCA 4BFYA 5A9SA 1AV6A 3LY8A 2R7LA 3PQ8A 1TZJA 2JLQA 3R44A 5FJIA 2EZTA 3GW8A 4UPVA 2FZVA 3AV0B 1DX9A 4FJ1A 1DC8A 1VL5A 5ALWA 3T35A 4C2AA 4DV7B 5E6UB 1JR3D 1KAEA 2PSEA 3VNBA 4LFCB 4BCCA 2WABA 5B7GA 5FD8A 4X94A 2H2IA 1W0KD 4K1LA 2EF1A 4K9LA 4OKNA 5H9WA 2QTBA 5LLDA 2O2JA 3BRSA 1RZ3A 3L8YA 3AUTA 5FA8A 5HPYB 4E31A 3QLUC 4JB3A 3SLGA 1SXJA 2DT5A 1LFAA 1BMFA 4GLJA 3QUSA 5LMUB 3QSYA 4E6EA 1KXZA 2PMKA 1BH2A 4D0RA 1DIHA 1NW4A 3R0VA 3SOZA 3OE7D 3S2ZA 1RWWA 5JR3A 4DANA 2DLCX 2DCMA 3K70D 4AN0A 2AC4A 1OI3A 1N6OA 3NV7A 1LPSA 2HBQA 4J4BA 5KC8A 5JSFA 2DSTA 2ZR9A 4I1SA 1WU8A 3EWSA 5F21A 3EG9A 3L7CA 1GFWA 1OH7A 4BQNA 1T5HX 3V8NA 4G4GA 1YL5A 2WDZA 2GNPA 2EYQA 1XQVA 1MLDA 1Z0DA 5BPFA 1EBBA 2XH8A 4MARA 3AL0C 1SQFA 3PDJA 1M83A 1J0BA 2AX4A 2QAGC 1U2RA 2WTAA 4EA9A 5J1SB 3KPYA 2GGSA 3BJEA 4P53A 1M2KA 4CMGA 4LDNA 4ENSA 3DYVA 2QBYA 1OUMA 3U1TA 1NN3A 3QX7A 4US0R 4IF4A 1AB6A 1A4IA 4MV8A 1NG9A 2H2DA 1VG9B 4FKBA 3S4YA 3TDNA 1G4UR 1N6HA 1PEKE 2JI9A 5DW0A 4KGDA 1HETA 1S9DA 2WOOA 1QYIA 1UWLA 3L0DA 3UGQA 1MVOA 3PXCX 1ATIA 2NWQA 3UG7A 2VT6A 3WMWA 3K4HA 1Z2AA 4UMDA 3RVOA 1M1NB 421PA 1C2YA 2ASVA 3HA3A 1NJFA 2R9VA 1K88A 2QM3A 4BKOA 2GKGA 1LY1A 1WO8A 4DXAA 3RADC 1ZOOA 5FOSA 4F04A 1T4BA 2L82A 1TKRA 2EFHB 4WACA 2ZCUA 2ZRMA 3IIEA 4KB5A 5CVJA 4B3HA 3RLFA 2QRVB 4G1FA 3FDIA 4XM2A 4ME6A 3TAHA 3VHLB 4BFSA 4A0HA 3QFSA 1ODLA 2SCUB 5AOAA 1SNYA 3G2IA 3ICOA 1K8RA 5TLSA 3DFUA 3LYHA 3NDIA 3E53A 4LVNA 1AC5A 4ZO6A 4ZALA 4BFTA 1R8XA 4IHJF 1LLCA 3OQIA 3RSQA 1YCDA 3BEOA 4WBNA 1LS6A 2OXFA 2QRUA 4IJVA 3VKGA 4ML3A 3ZXXA 2R11A 3DDUA 3PUWA 1WP9A 5KEIA 4OAPA 4V2IA 4QUKA 1HRKA 3SU8A 1Z7GA 2IV2X 4K9QA 2J0QA 1JGTA 3W9BA 2Y9MB 3BA6A 4R2XA 5C35A 1T24A 1UK8A 2Q2OA 3KWJA 4H3VA 5EJ5A 5ALIA 2I54A 2OE2A 3NVKI 2PX6A 3NYWA 4GFDA 1N5IA 4WASA 3KYBA 3NUQA 4OJNA 5A5FA 4GL2A 1RHQA 1A9XA 3PJRA 3QXGA 4YPOA 2FQ1A 5GY7A 3TRJA 3UJAA 3I5AA 2G1KA 4G0NA 2EW1A 4A1OA 1BJTA 4QOJA 4GQAA 3P97A 4H7EA 3D7RA 4TYYA 3SS9X 3TIIA 3H0EA 1C1XB 4ZT2A 1RQGA 1P19A 5KOYA 2RGAA 2RH8A 3EXEA 5DSZA 3UWMA 1LH0A 1AB5A 2IEZA 2PKWA 3C7TA 3MPOA 3SLRA 4P35A 2LD4A 3AR3A 4Q4DA 1GADO 1TAQA 3UK2A 2XGGA 1N8SA 1C1YA 3DB1A 5DBOA 2ZXFA 3CEPB 4JXKA 3DMPA 1WE2A 3LV8A 3H4VA 3UMGA 2C2GA 2IX3A 1ZK1A 5K20A 4Z7OB 3OJLA 2UZ1A 1RMYA 1WW2A 1L4NA 2HF8A 2HSZA 3L9WA 3U9TA 3ZWYA 1I2MA 3PC8C 1MW8X 4ZEOA 1IQ0A 2PKQO 1QMPA 2WSIA 3RHSA 1NMXA 4E1AA 3TLGB 3PB3A 3OCZA 2H2HA 4D46A 1I0LA 2DT8A 3ZBUA 4MKFA 5JH7A 3AVYA 3G5LA 4JI5B 1IHDA 5FF9A 2HCBA 2NZWA 1A69A 3K9NA 4UCXA 1WXDA 3JVVA 4TS9A 5FX2A 1WMBA 1OYOA 1AKQA 1ZW6A 2HDOA 4IICA 4KXFB 3U3XA 3Q40A 2ECOA 4CF4A 2B4RO 4QBGB 1PHPA 1HEIA 1VE1A 5I9BA 4ZI7F 5KMGB 3LXUX 1CQJB 2HXYA 2H31A 4PQRA 1QF9A 1YIAA 1IXRC 2ZSAA 5FTJA 1S2IA 2QSUA 4EYGA 2PUFA 3BVPA 2GDJA 2AEMA 4URXR 1JSLA 4AF7A 1XZMA 1P1CA 1WDKA 1CB7A 2GXSA 5CLLA 1TL7C 1QH0A 4M1MA 4Y0VA 4NZMA 1J0AA 3JWHA 3MS7A 2IS2A 1UJ4A 2XAUA 1W4RA 3GRYA 1PSDA 2I67A 2JI4A 5GONF 1OFVA 2DG2A 4H1HA 3KEGA 4UNRA 2ILVA 5KYNA 4KXYA 1OGJA 4AUNA 1WPQA 3QVKA 2IRWA 3HSYA 5FBHA 4C06A 4FPXA 1P5ZB 3I5YA 1ZIXA 1PAUA 1G3UA 4L8GA 2GEJA 1L3BA 4AS1A 4HRAA 3T12A 1L4YA 2ID7A 4YRNA 3N8IA 3LIPA 4Q02A 1SCJA 4C4YA 1FJHA 3EIWA 5JVDA 1JZSA 1Z26A 3ZNPA 1KMIY 4V0OA 2XYPA 3LCCA 3OCXA 1IH8A 3K6RA 3R6LA 2UYGA 1JJFA 4HDKB 3RYCB 1NATA 2JARA 3A4VA 4ALMA 4D99A 1QJ4A 1TD1A 2I4LA 3HL0A 3HVHA 3UANA 3OMLA 1Y82A 4ZOLB 4RHCA 4BB5A 4YMHA 2CSXA 5BO5A 4BNIA 4LPKA 2Q62A 2VSFA 3CS3A 2R66A 5K01A 3E9YA 3E7WA 4S1NA 3NHWA 2Z04A 5EG5A 2UZIR 3IOEA 3MGAA 3R6WA 1T9AA 4F5WA 1ES9A 3VDNB 2PBZA 3L7LA 3TSWA 3IIMA 4DLBA 4ZDKA 2A30A 4QXMA 5IUJC 1U5BB 5I48A 4JBHA 1IY0A 4MJLA 4BNJA 2H11A 1G3MA 4AO6A 1XJCA 3C7CB 3WDSA 3DV0B 2I22A 2G36A 2QTHA 1EGHA 1WHTB 3DDZX 3FOWA 4BN4A 1ILWA 5J4LA 3GJ5A 2GCGA 3QF4B 1DJPA 3AFMA 2D5LA 3SVLA 4QPDA 1J9ZA 1KIMA 2C57A 3I45A 1KO8A 4FWTA 2ZBPA 3N8GA 1NUPA 1MRNA 1RYDA 3H9QA 4YBRA 3BQ9A 5LBIA 1V5WA 1PWZA 3EMKA 3VYUB 2Y0EA 1IG3A 1SVOA 4PSDA 4KAXA 1EWRA 3RR2A 1KEKA 1NDUA 5LQDA 4FDVA 4PINA 4RM3A 4WINA 4AJ1A 5A03A 1XMPA 2AR7A 3G8BA 4F96A 2OLJA 5DHPA 4MROA 2TECE 5IN5A 2BZGA 5JMWA 4FDMA 1RU3A 3H5OA 3R9XB 1LD3A 1OPXA 1CNFA 4MYUA 4P80A 4JA2A 2QM0A 4CCSA 3EH2A 1GRRA 4P3KA 3NXSA 4GC9A 3I2IA 3B8EA 1GLGA 4WXPA 1RAFA 4FFPA 4GMDA 5K3CA 2FWAA 3PGJA 3DL4A 1Q2UA 5LOVB 4BO0A 2PSDA 1KBOA 2K7ZA 5AIBA 1HDCA 2P67A 3NOVA 2C3OA 5AI4A 4Q03A 3ECCA 3ORYA 1TTPB 3PC8A 4ZMRA 1C3OA 2M2IA 4AZ0B 5AESA 1WEKA 1J09A 3JAKA 5B3KA 2H4FA 1H93A 3E3NA 4LTMA 1L5OA 2MINB 3O91A 5B1YA 5I7VA 3RBZA 3RAPR 2XTJA 1T9KA 4R4JA 2VUUA 3CINA 4ZZ2A 1RRGA 3DVLA 3MTGA 1U81A 2G0TA 4U5XA 2JVIA 2GYVA 3DBRB 3D0RA 1N8TA 1G21E 3B5EA 3QUBA 3UJ9A 1MH9A 2Q5LA 3S2UA 2VPXA 2FFQA 4P5PA 3ZE8A 2C5AA 3B1ZA 3I6IA 4RULA 3I0MA 2WIGA 1TO1E 3A1FA 2XJ9A 3MJVA 4MPPA 3IT3A 1CIVA 1E59A 1TJNA 3DGFC 4L5JA 5E7JA 3BSYA 3GRVA 4GW3A 3H2HA 4WLVA 4HAVA 1YI0A 4E2YA 2WT8A 1KE2A 1E8DA 2HXSA 3JQPA 4U9IS 4IIVA 4JEHA 1L4FA 2JJ2D 1WCXA 3WYGA 3J7TA 1PFGA 1LDNA 3PKIA 4RV4A 2DUJA 3RHTA 3MWLA 3U39A 1QQ6A 1E1RA 3V8MA 5IU6A 1OFTA 4ZOQI 1T2UA 3KQMA 3ZHZA 1MB4A 1U2DC 4Y2UA 1RRKA 1XB2A 1OX4B 4CL2A 3GZTB 4N6OA 5L9AA 4OPMA 3GT3A 4U4AA 2RC5A 1Y3BE 2BFFA 4LX8A 1L0BA 1G20B 3R1IA 4U39A 2BH2A 1U3UA 1Z18A 2Q5IA 1G8SA 2VPTA 4XGKA 2BM1A 4OI4A 2P6OA 4L4RA 2D00A 3TLYA 3CVXA 4YLGA 1CUGA 2J3HA 2X6TA 3AXSA 3K8YA 6PFKA 2CJWA 4FT4A 3OPXA 1II9A 2BHTA 2GCIA 2BBOA 1E66A 2RHHA 1ZIYA 3K1TA 2O3SA 1RJEA 2O3JA 3EVNA 2IE8A 1NJSA 1RLUA 3DAHA 3D64A 1GG9A 1AURA 2OBMA 2A9QA 4TTVA 3QU7A 1G1AA 4WD3A 3P5BA 3UMFA 5JRZA 2W7TA 2BKUA 2QN3A 2OOSA 3KSRA 4PG6A 4UPEA 4B3DA 7GPBA 2JAWA 3STVA 3MB8A 4BRWA 1R0LA 5CHEA 5JCPA 5FXMA 3GFSA 2Y3IA 3IMGA 4CZ2A 2WAYA 5JWOA 2CV1A 4AIRA 2F1IA 4QFCA 1M6HA 5CNMA 3GT7A 2I62A 1KJ9A 3NV9A 1ZSNA 1GHTA 2WKQA 4WJLA 1BEEA 7REQA 2J6BA 2G9UA 3KCNA 2IDKA 5KX5B 1WQ4A 3WWZA 3C8MA 1DKRA 2PXAA 4H9GA 4YJGB 3CVYA 4MI3A 2O8DB 3B6MA 1P9WA 3MMPA 3TCNA 5KOHA 2GQ0A 2BPOA 3ABZA 1VMIA 1NBME 1XU7A 1UWKA 3KVOA 1R15A 3D8NA 4N6NA 1HLPA 2BWJA 4F84A 1DV2A 1NIJA 2NADA 2QHXA 1J0CA 4UDOA 4I50B 5E1DA 2QJTA 1SUAA 2YASA 3PR2B 4FE3A 4WFIA 1IHYA 2OGZA 3CJTA 3EZ7A 3TYXA 1O94A 2FR8A 2X3UA 4QREA 1BZYA 1B6GA 4C20A 2OQIA 2ZBFA 3KTOA 4KR2A 1F2TB 1FVXA 1U8TA 2O2HA 2P11A 5KNDA 1C7FA 3UAYA 2C94A 4DBVO 1E2HA 3O31A 1NY5A 4L3OA 3S2YA 1YKFA 5IMBA 3QLUA 4QOGA 3T7IA 5EXTA 1K0UA 4BJ3A 2QMUA 1MHTA 3OZ7A 3R23A 3IUJA 4YAWA 2XA1A 1GGHA 1JYSA 1VLQA 3VBCA 1BDJA 5BSMA 2O5EA 2X41A 4CKBA 2V3CC 3NGMA 2IYPA 3RBAA 1RHMA 2G06A 4B1FA 4AL4A 1NFFA 3TIGA 1UPCA 1M7GA 5AQ1A 3IE2A 4NAUA 3DZJA 3B48A 2CD7A 4MZXA 3Q8LA 3QWIA 4NE9A 1R9MA 4YQYA 4IDGA 2CMKA 1D1QA 1T43A 3WZLA 5FUQA 1YIDA 1BC5A 5C3UA 4ZCMA 3R0QA 3GH3A 4EO9A 4GPAA 1T2FA 1R0KA 1T9BA 2J09A 1P2GA 5LP6C 1LPPA 3N0TA 2YZNA 3DAYA 4F21A 3KTFA 5JQGA 3OUZA 2Q0XA 4M38A 2BGKA 4DV1B 1NLZA 3R77A 1P2VA 4LUCA 4Z1MA 2NMVA 2YWCA 3F46A 2IIPA 1TK9A 2HT6A 3GBSA 2OBFA 3JR7A 3ONWA 1I3LA 1SUDA 4MEAA 1JB1A 5HS6A 1ZVMA 2FXVA 2Y68A 4B17A 4ZDJA 2V8BA 3ET5A 4Z1MD 1T25A 4EG7A 1OCEA 3FTPA 4YY3B 1II0A 2R6GA 2PRIA 3VPBA 1QV9A 2H9AA 5H02A 4IUDS 3GC6A 5F33A 1BXZA 2OWDA 4L15A 3GNSA 4FC6A 5ALQA 4G0MA 1COZA 1RWMA 1E63A 3KPJA 4FC7A 3TFWA 5C53B 1EWTA 4PW0A 2AGVA 2FWNA 1KJJA 1XD8A 4LYYA 4RGQA 3L7DA 5AP9A 5BQXA 5BURA 5L40A 3ABRB 4ZREA 3FCSB 1J2JA 1EFCA 3NHPA 1QQ5A 1SBIA 4KI0A 3N0WA 1LK7A 2VJAA 5J63A 4W6ZA 4JP8A 1FTGA 2VRWA 1HNXB 1U2QA 1NWHA 1NXSA 4PQYA 2QUBA 4WN9B 2QNRA 2XZOA 1UM8A 2ZWMA 1SXPA 1JV2B 2DH6A 2JFFA 4L72A 4XIIA 4Y2TA 2J32A 3W7BA 4BX9A 4KNYA 3G2JA 5FV4A 4M99A 2QTNA 1I94B 1VM6A 3KT3A 1NM5C 3UF0A 4UATA 4MR8B 4CMIB 3GIWA 4MQ6A 3NVMB 4B43A 4D9BA 3L8MA 1M1YA 4D74A 3PEVA 4ER5A 2ODBA 2GK3A 2V1XA 4O0MA 2R87A 4X6UA 4EYQA 4ZI7A 2B1JA 1FU4A 4P7JA 4WCFA 4BJ1A 4LMRA 3W0LB 4UXHA 4MRRA 4NRDA 1IUKA 4WAUA 4WOKA 3ZHUA 1E9AA 3WGGA 4JB2A 1XTRA 1VFPA 3I9NA 2FH5B 4BV8A 4G5GA 3G89A 2NQTA 4WGGA 4O4HF 4MOWA 1U02A 3HDVA 2NZJA 3I23A 1FF9A 3OZRA 3N59A 4L9SA 1JPVA 4GPD1 5E9AA 4YCMA 2I3ZA 3IVMA 4YECA 1ZICA 2NQ8A 4R1SA 1Y8ZA 5KYXB 3EPPA 4I4TF 1J8FA 3ESDA 4BPRA 1PJ8A 1JEYB 2XUZA 1T0IA 1SN7A 1O6FA 3GEEA 1XMIA 3GRFA 3I2FA 1L5LA 2QGZA 4FZRA 4ZCIA 2OUIA 2WWYA 1XIVA 3BD7A 1XWFA 3W6UA 2FF7A 2VTVA 4NHOA 4Z7JA 1I7DA 2O4CA 1A7AA 2FQQA 1DAOA 2J4FA 3QI7A 3TQOA 2QMZA 1N1MA 3PQ2A 3VVLA 5TVKA 1H22A 3N2IA 5IKEA 4L5AA 1UPTA 1FJGB 1ISJA 3NUZA 3TQRA 3Q41A 2WJPA 4YT5A 3L0ZA 2X6QA 5D3KA 1FMFA 3MT8A 1SCIA 6ADHA 2E1RA 1QUFA 4CKWB 1WKVA 4M49A 4D8XA 2P4UA 2W98A 1YMVA 4P3XA 1NXXA 1AGXA 3P9KA 4R84A 4OHZA 3WGYA 3FGNA 3B9BA 9MHTA 3F9IA 3WS7A 3DH0A 3I62A 4HDRB 3EXHB 3CNHA 3MTEA 2IHJA 1T4GA 3CBGA 3C1TA 2XNKA 1O95D 2ATCA 1Q7RA 5ED0A 1PYDA 3L6CA 4F7WA 1ND5A 1NXTA 2Q3CA 1IK4A 2FN4A 3D3KA 4KNWA 3A10A 3ZIAD 3ZHBA 4IAOA 1ZNWA 3AJDA 1ONNA 4H1TA 2AT1A 2BFEA 3H5WA 4L07A 4WXHA 4DM3A 2FE1A 3DQPA 1SBCA 1YR9A 1Z5NA 1ZQ1A 3AHCA 3C87A 4MWCA 5DHSA 4F8JA 2BDUA 4FR2A 3IOCA 3N28A 2IPMA 4AWAA 4C14A 2ZI9A 1JIVA 4AO8A 2QXTA 1FDWA 4YAEA 4S0ZA 2YUTA 3ABOB 2EOAA 4D98A 4TSKA 1ZMRA 2JS7A 3SQXA 4HL6A 2AK3A 2KBEA 2J5RA 4RKFA 1ORHA 4Z0HO 3VKFA 1GFSA 2IK8A 2PZAA 2YS6A 3BEDA 4UUBA 4D8VA 2YVUA 4MR9B 1Y48E 3ZJ5A 1NNSA 5AW0A 2YBDA 5IC6A 5A3RA 1M34A 4YAGA 3CT6A 1QR6A 2QNBA 1W0JA 4Q24A 2B6HA 4QRIA 4IEIA 2ZJ7A 2GZSA 4LPSA 2B0CA 4X3OA 3HZHA 4IQ8A 1C30A 4P86A 3HJGA 2FA9A 1N7GA 1DLJA 4KQCA 1NGSA 1PK8A 1SXJD 2GZ3A 2IXAA 1L7QA 2R4UA 1RCUA 3M4YA 3VR0A 2ZRHA 4KNVA 3VPHA 4DDUA 2FK7A 1ZQ9A 1ZCZA 1HOXA 2FYTA 4DY6A 1F6BA 4ENPA 4I9FA 2GR9A 5JAUA 1QGUA 1SVIA 4IQ4A 2C9YA 4PGGA 3ODGA 1W5BA 1QG4A 2Q5CA 3EVCA 1NHGA 2UYOA 4PLFA 3ZI7A 3PXGA 3LBHA 1GPJA 1KJWA 1F0YA 2I6XA 2ZJBA 2R97A 3ACBA 1YQ9A 4E88A 1OBHA 2PX4A 5FTKA 2W70A 4DWOA 3U44A 1Y89A 1A9QA 4HLUA 2QRKA 5DM0A 3PT9A 1FJXA 4PZAA 3KKOA 3DV2A 3HEMA 1DUVG 3P9QA 2LZ0A 2GAIA 2DR2A 2EEZA 2ZB8A 3L8ZA 3KUKA 4MS4A 3RASA 3BT7A 1BKSB 3OTHA 2BC9A 4S1VA 5KSYA 4G26A 2NYUA 4RQBA 4HDNA 4Y2XA 2B1IA 4O2BB 5C4IA 4F4DA 4UMEA 3QUAA 3ESCA 1T5OA 2DPMA 4JLBA 3SC3A 3ZU3A 1QBGA 1PK7A 3IUBA 2A1UB 3T3IA 2K4MA 4L4YA 3IPLA 4UM7A 5LC1A 2B21A 3L84A 3RSHA 4A8PA 4Z4FA 5HKBA 5LNK1 2VJYA 1BXGA 1YQTA 2CNOA 2QM8A 1BCSA 2IZ7A 1E4YA 1CFJA 1S2LA 2EFCB 1I1QB 2YXDA 1CUUA 4QT0A 4P58A 3OT1B 3W77A 2HA7A 3CRMA 1JHPA 3H2ZA 2RMKA 3FUVA 3LRXA 4FI3F 1JKIA 1YA4A 5JJCA 1PHRA 2VLIA 4P82A 4R1LA 3W6PA 5IYZF 1F7VA 5A7FA 3D8HA 4G0PA 3M5WA 4MIEA 3RC1A 4K6HA 4A10A 2FX2A 4WJKB 1NNI1 2UUBB 1TCAA 1ZKDA 2C2XA 2WIBA 1SY7A 3GUVA 2OGTA 3R5JA 3DPSA 1U65A 4LXHA 1QIDA 1GA6A 3BSSA 4FONA 3X1YA 1BD4A 4CMBA 1KGDA 3G6KA 1H6CA 4HAOA 1ESEA 2H2WA 4CHGA 1RC0A 2J67A 2NV2B 4PQEA 5DGHA 2B3DA 2W8BB 3HCBA 3QKSB 4QGGA 5JO9A 4F3KA 4JYCA 3Q2KA 2G28A 4IGFA 3A2KA 1M2NA 1JDPA 4ZMBA 1NG1A 4HWGA 5CA1B 2IYTA 3JVDA 3PEEA 5LQMA 2AC7A 4TLLB 4QAQA 3IELA 4ND4A 1HY3A 2HDWA 3VXKA 1AOXA 3L18A 3OM0A 3HA2A 4F5ZA 4J1TA 1L4HA 3RRJA 3IV9A 4F1JA 4XX0A 4A91A 2P4EA 3WE7A 4CKEB 3MYRA 4B3SB 5CXUA 1U2GC 2QX8A 4N65A 4UULA 1EFKA 2WKPA 3PJFA 2WUGA 3WMGA 1P6UA 1HDOA 2PUWA 2Y9PB 3WA6A 2WHEA 3F7MA 2UYCA 3W2HA 3SN6A 3UWSA 4C88A 3ZU6A 4KDFA 4Q6BA 3RANA 4DDMA 1S8AA 2Y6UA 2XVMA 2O14A 1CZOA 4I1VA 3QUQA 3T1NA 3I4FA 4M0PA 2PVSA 4H7IA 3AUSA 2O8FB 2FJ0A 4KRXA 4CIDA 2PT6A 1ONPA 1CKEA 2Z3VA 3DHYA 3DLAA 1X38A 3L6DA 3P4YA 4FU0A 1VMDA 2WQZA 5FNVB 3EISA 3HHEA 3SEAA 1N25A 3CNQS 3GLVA 4A0FA 5LZ2A 1NVTA 3NWJA 4Y2YA 4D9NA 3EX7C 4WXYB 1AO3A 1V5EA 2XMQA 3ONDA 1SBNE 4DCGA 2VQ6A 1V11A 1ZUNB 2LCFA 4PPGA 3U4MA 4KMMA 3TN7A 2RGNC 1PJCA 4B7AA 2JC3A 3S1LA 2D62A 2FB9A 4H15A 3KOXA 3U7RA 3IAS1 3CLHA 1XEXB 3C15C 1JJBA 7ABPA 2AN4A 2C7BA 2XUDA 3WLSA 2W4IA 1JG4A 2G5TA 1HR0B 1U8XX 4MUJA 3KTAB 1EFTA 1NKTA 3R6DA 2HGSA 1OBCA 2E37A 1DT5A 4MMXB 4WLOA 4CDMA 1Y9EA 3VO8A 3H6GA 1BX1A 5CFZA 3R9WA 1IONA 4HH0A 4RHFA 1K92A 1Z74A 1VP9A 1RYEA 1GZ6A 4M8NE 3FCCA 2C2KA 2VXOA 5FNVF 3VHRA 1UJ2A 2Q5QA 1GA4A 2NU6B 3AUKA 1WB4A 5MGNA 3PBKA 5CLQA 3ERCA 3RGWS 5AHOA 2P35A 4JSRA 5DK4A 3EGWA 4JEUA 1OU4A 1CJKC 2K6GA 3C6QA 3I28A 3QKTA 4JENA 3OWHA 4MIKA 4JROA 2YHAA 3OJCA 4YRPA 3SSMA 4QBFA 2NXWA 1XRJA 3LFTA 3ER6A 1ZBQA 4K3VA 4BTVA 2PZMA 2VNJA 4Q9HA 2AYZA 1X1BA 1R6VA 3K2IA 3ZCRA 5LKAA 1S0UA 2YOHA 2GVDC 2NNLD 1YULA 3G2MA 3NBQA 4N5IX 5J4VA 3T5PA 1HZZA 3HNOA 2JVKA 1V9CA 2A8YA 2MIIA 3O3OB 4LNAA 5E6RB 1YJXA 3AHIA 4JJEA 4B75A 4JR1A 3COSA 3FH0A 2V97A 1JFFB 1XZDA 3WIEA 2JIZD 2H3HA 2FU5C 2AF3C 1ILEA 3FHTA 3DKKA 3AM5A 2AJTA 4OK6A 4EJSB 1UIMA 5JNLA 1QV7A 1WUKS 3QF4A 3BM5A 3ISJA 3MCWA 3USCS 4HBGA 4HNVA 1XFAA 1XC7A 3I8SA 3S8MA 3Q3IA 1CR1A 4QJ3A 2GFHA 4W9NC 3WRYC 4ZFNA 1B93A 3WLFA 3S8YA 3V32A 1UFOA 2WJHA 3EZ6A 4TM7A 5EKXA 1W94A 2X2OA 2OCKA 2DPHA 2C97A 3OTIA 4EI8A 5HK9A 3UW3A 2VQSA 2I7CA 3P1JA 1ZGGA 3IDFA 4RHUA 5ADHA 4OOFA 2EZ9A 3JPWA 4LJ6A 4KVAA 1X0XA 2C82A 5FLYA 1FBNA 2FSHA 4H35A 1KH3A 4PPNA 4CG1A 4Z2AA 2H00A 1FTNA 1XRSB 5EESA 4GAEA 3RUEA 4DRXB 3IEPA 2HO5A 1OGYA 4FGSA 2ZSBA 2IPLA 1LV8A 4HB3A 1ZU5A 2I1WA 3GAZA 5GGYA 4JB0A 3VPSA 1H2AS 2W6QA 4IEEA 3ZCXA 1P7CA 4II2A 1MC4A 1PWHA 2LWIA 4IIFA 4L57A 4HJXA 5TR9A 4RADA 1NUQA 2AOWA 2C29D 2G80A 3LHIA 4IHJB 1T26A 5BMOA 1P73A 5CA0A 2HX1A 3KXIA 3PC6A 4TKZA 3UXEA 1USUA 3WB0A 5DLQC 5BW4A 2PPLA 3TSCA 2QN9A 4RZQA 3V1YA 2DXIA 1QRDA 3RSZA 2VJOA 3ZE0B 4ZMSA 5AJXA 4AN1A 3KE8A 4YJ3B 4ALKA 4F60A 5KOJB 2P5TB 2GYUA 1DX6A 3ZHOA 1POXA 3DFIA 2R8YA 2SNIE 3F7OA 4HYTA 2B1QA 4V0ME 4B46A 1WMSA 3A25A 1XK6A 3NVAA 3PS9A 5IXSA 4B3XA 1UZLA 3F2IA 4ZIRB 5EIXA 4NJMA 4G1UC 3WLOA 1RP1A 3C74A 4HN9A 5HW0A 5JZVA 2XQGA 4E12A 1K7EB 4ARUA 4WY2A 3MBIA 4QG3A 3WBFA 2Q28A 4L8VA 5A5DA 4XSGA 1NBIA 2HBZA 2PK3A 2BZSA 4AMUA 3W1EA 2BRUC 1JQ5A 2B3TA 3G59A 1ZESA 5AM0A 4PV7A 2XA2A 5GWXA 5LIRA 3OFNA 5FEUA 1AT1A 1H2BA 5U9CA 1V0JA 3UMJA 3KOWA 1OROA 3X1DA 2N0SA 1JA9A 4OTZA 5LWQA 3LNTA 3RIYA 2JIDA 4JJGA 3MW8A 4IVRA 1ZNXA 3UGTA 4R3NA 1OU0A 3T7JA 3ZBQA 2YICA 1LBHA 4DE5A 3S2EA 5J2UA 2XNSA 4RNCA 4TUYB 2JH3A 4OYYA 1L7NA 4ZAYA 4ZA2A 1AA9A 1M0WA 3C6BA 3DUWA 4DT1A 3PTZA 1E0JA 1GZ4A 1QYWA 5GAJA 1WSDA 1A8HA 5DCYA 2GZ2A 3A06A 2DUMA 3V7WA 1TC2A 1CFZA 4U00A 2OLEA 2PG3A 4G1CA 5E4JA 4CE6A 1CVLA 5BWLA 3QVUA 1JN0A 3B60A 3GNTA 2YCBA 2LDBA 1RBYA 1SC6A 1V1MA 4O5OA 1SKAA 3VVCA 2RGBA 1GNLA 5MF6A 4ETIA 1A5BB 1ZCFA 3PZRA 4CR7A 2HEIA 2BE7A 2IYOA 3K5IA 3PUVA 5JUWA 4A5SA 1PZHA 1M7BA 1SB9A 1X9HA 3F1LA 1T1GA 3HB0A 5FBKA 1EVZA 1EFHA 4CNQA 4D2IA 4MKIA 4A0SA 4TZTA 2JJQA 4WEOA 4TYQA 1UKBA 3LT0A 1S3SA 1NBEA 4Q21A 2FR0A 3NIBA 1KMMA 2CCGA 3B13B 3GJYA 4WQMA 4M55A 5EWJB 5EINA 2CYBA 3ESQA 5ADVA 2RD2A 5AK5A 4DLXA 4KFCA 1P1JA 1P5FA 3GUUA 1I6WA 3I32A 4EMSA 2FSFA 2RJNA 4HYQA 4PTLA 1XEAA 4UXJA 2QYOA 1HI9A 2XDQA 1ELOA 5LA6B 4MVYA 2QGFA 5IYZA 2FOXA 1E89A 4Y6GB 4QDKA 3FAZA 1INLA 1C0LA 4QC2A 4RGVA 4RY0A 1LI5A 2VTBB 1U2EA 2HWXA 1S89A 1YMQA 1ZD8A 4M1QA 2BMDA 3DG9A 5JCOC 4IDCA 3GJ6A 1HC7A 2H48A 5SY4A 4KR7A 4TGLA 1O9GA 2DCUA 4RVFA 1QVVA 4FYPA 4F6LA 4PRYA 5K3EA 3CU5A 5AKKA 4PYMA 1MF7A 1R8JA 1CRQA 2IPOA 4BV9A 1O5IA 3UT5B 1YRBA 2VDJA 3NB0A 4GP6A 1AMNA 3E8SA 2F9LA 3KJIA 5HDBB 1O0CA 3Q5GA 3N58A 1HO3A 2O8VA 1F2DA 1PJLA 2Y05A 4KYTA 1O3YA 5CVVA 1ST2A 4DCJA 4RE6A 5LQCA 2G0AA 3AC0A 2C88A 1JS1X 1YE8A 3KOYA 4MH0R 4NK5A 1LNSA 1IQUA 4RFSB 5EIBC 1YFKA 4I50F 5DN6A 5KDOA 3KQTA 1GGNA 3QY0A 4MLZA 5TQVA 1EJBA 3EC7A 3NDJA 2P9TA 2HJHA 2QUIA 3CZRA 3FDJA 4FCWA 4EHHA 1O58A 1T1SA 1X94A 1VC2A 5IG2A 2ZBGA 2BSQA 4MVWA 2JH8A 2WICA 3S7ZA 4DSAA 2IITA 1ZI6A 4O4IF 1T3SA 5BN1A 1U2GA 3A9VA 3PDIA 4TKMA 3GCGA 1ZN2A 2O2CA 4I55A 3WMXA 1UFKA 1JI3A 4MVJH 5K7SA 4B84A 1J20A 2AZ4A 4BFWA 2VKTA 5DLEA 5A4DA 1TZMA 4FOTA 3U3JA 2R8EA 5BRAA 2FQWA 3GGOA 5H3CA 2G9NA 1CP2A 4OH7A 4AO7A 1U0SY 2H7YA 1KYWA 2VNIA 3CLSC 3D43A 3I9LA 3V7FA 1A96A 5TC4A 4IMPA 3IBSA 4A1FA 4HNGA 1K7SN 2VG8A 4FMCB 4AU1A 5A1TA 5JSQA 1UAYA 2V45A 1A4RA 2FMXA 3DFKA 3G82C 1L5MA 5F73A 1L2TA 3SR0A 3CRZA 1PCXA 4K2AA 5G4KB 4BE7B 1JZTA 5LYJF 2BLNA 3E5HA 3P9NA 4GLOA 3EGXA 1E3WB 4XQ9A 3D02A 3JYNA 3GOQA 4RPKA 5B7QA 1RLOA 2IW1A 2OHOA 2BEKA 1K97A 3IDZA 4X5OA 4EFDA 3T3PB 2QPOA 2I71A 3L0CA 5LWHA 4NY1A 1DRUA 2YFQA 2GN2A 1ZM3A 4II7A 2FPPA 3OOHA 4HK4A 3RREA 1ZAYA 4CTOA 1VYTA 2QOEA 3H2KA 4X7RA 2Q2VA 2V9ZA 3ZG6A 1V6SA 2F3QA 1CF4A 1IB0A 2GN0A 1E5TA 2CFRA 2PKEA 3DWEX 3FWPA 5F3DA 3U26A 4EHFA 1ZCJA 2Z58A 1R88A 5EMNA 3E61A 2BHNA 5DYNA 3WRXA 1OT5A 5CXQA 1N2BA 1C5KA 1W1WA 1ESNA 5LQKA 3REOA 3RRMA 5KCZA 1TAUA 1NONA 1E2MA 1Z5VA 2JZCA 3IB3A 2WHPA 4RNDB 3GLFA 4JASB 2KYRA 1B8NA 1DEOA 3MWEB 1WWKA 4J9VA 1HLDA 1PI3A 3O74A 3SQMA 3W4IA 1PFUA 4BFLA 5JECA 1MDFA 3AWDA 4LC0A 3NBMA 1EHCA 5ER9A 5FR1A 1ZN9A 4PZEA 4AKEA 3Q4GA 2ZAOA 3RAFC 2X5KO 3LM8A 4JELA 3WYDA 1Q95A 2GXUA 2Q8PA 3SJ7A 2WWGA 3PNMA 4QSMA 3VTZA 1U0BB 1Z68A 2GD2A 4JYPA 2OYRA 1E1KA 4WEQA 3R0IA 3H5TA 2YFYA 4FQ7A 3PENA 1UCFA 2E0IA 4QYXA 4YDRA 5EVCA 3JQQA 3K6JA 3R9KA 1W52X 4DC1A 1YA8A 1XMOB 3S70A 3UJ6A 2L17A 4L02A 3AG5A 4RVDA 3SX2A 3C5CA 4DTCA 1FPMA 3ADBA 1F60A 3QFFA 1KTVA 1FS5A 1VYVA 3GCWA 2VP0A 2JL1A 3RRBA 3UUGA 1IBSA 2MSCB 5DM4A 5KTPA 2VHEA 1TW2A 3CCFA 3IAEA 3V2GA 4DWWA 3TGLA 1EUYA 1Z6PA 3JQRA 1P4AA 2IQ5A 1UMKA 2VJBA 2W48A 3TXXA 4XGNA 4GBJA 2P41A 3CX8A 4PAQA 1SKMA 4U7WA 2J3JA 3LUAA 3OZUA 3D1JA 2R8XA 4NCKA 4OM7A 2ADMA 2N1BA 1EP3B 1U0NA 5K0BA 2OESA 1JTEA 4KHPB 2GRUA 3FMOB 2YMMA 1BYIA 4CCAA 1X3LA 2QTRA 3CKMA 3LHDA 4DYVA 4RTLA 2F8SA 3HN7A 1V37A 2BTOA 3E05A 1MIOB 1V35A 4B74A 2HY7A 4O1MA 3NMUF 3ECAA 4UFOA 3KUXA 4ZQCB 3SFVA 5JV5A 1PEDA 4MQEB 2C99A 3I8OA 4N7RA 3THWA 4HEA1 1LJLA 2XV1A 2XUOA 3THOA 5BVHB 4L5IA 1ESMA 1Y3CE 3OFND 4MS1A 4YJFA 1ORRA 1BDHA 4OQPA 2GF2A 1CIJA 2QP4A 3I34X 2Q21A 3NH9A 3JTEA 5H4GA 4A82A 2GZRA 1EE2A 3KZKA 4QRHA 5D86A 4Y2RA 4WY5A 3SZUA 3GT4A 4K6MA 1Q7TA 3TLMA 3ZE6A 1W9MA 4EGFA 4J3FA 3AZPA 5K1ZA 5CLFA 5IUNC 1CR4A 4JODA 3NP7A 4OUDA 3PQDA 1M6YA 3UTDA 2QVCA 2IXBA 3MINA 4DGQA 2G67A 4DLSA 1V41E 4P7KA 4RGBA 4LJRA 2IYUA 4BWFB 4IQFA 1ICEA 1SQGA 2EJTA 3PGVA 1FQKA 4NEQA 4O6VA 4W1QA 5AMXA 5AUQA 1K6XA 2FCAA 1MD9A 2LKDA 3DQQA 3KO8A 1TTHA 2AG8A 3H1FA 4FINA 2RK6A 1FNSA 3TZLA 1E1NA 5B1DA 1E6LA 4JLVA 1T8PA 1XXHE 3IAXA 3NU1A 3V7NA 1QTRA 3ZLBA 1C7QA 4AYWA 1HEYA 1Q3TA 3PUYA 1R0SA 4HNHA 1PS9A 2C4HA 2BFCA 5FWDA 3RU7A 1ZOPA 4L6IA 4DL9A 1M1NA 2ZYRA 4LWQA 2EQBA 4CUZA 4ROTA 3PNKA 3S6JA 1WOYA 5AM1A 2G8NA 2VEOA 1VHDA 2XWBF 5F1KA 2IYAA 1GPLA 2ZEJA 1G9SA 3GAAA 4IINA 4ARZA 4B80A 3FKQA 4Q82A 1XGKA 1Z4IA 4JITA 2F8TA 2XKBA 3ZWOA 1PT6A 1SU7A 3QK7A 9LDBA 2AMJA 2PUHA 4ZEWA 1IOLA 3RS8A 5AJZA 1YL6A 3IALA 4LHXA 5D5HA 3AMVA 2FFJA 4LQDA 1C14A 2WSMA 4N5NA 2AJDA 5LD2C 3DKIA 5LIPA 1K89A 1BMFD 1OX5A 2QD4A 1ODKA 3OF2A 1R9NA 1FRVA 1TVMA 3V8EA 3EBPA 4G2TA 5CVEA 9ATCA 5BPHA 1C9DB 2NVUB 4QNNA 3SJBA 1U28C 1BEZA 1U6JA 4E4YA 3BORA 4RIEA 1K5PA 5F3RA 4TOIA 1ECFA 3WLTA 4O4HB 3DWFA 3U44B 3JS5A 2R6DA 3PWKA 4PC7A 4FWBA 1K6JA 2QRVA 1UQTA 2WA2A 1RAEA 3LY7A 4OBEA 5LMCA 5J9FA 4D5EA 3NW9A 4INPA 3TL3A 3P96A 3SLKA 2MTBA 3PF9A 4IH4A 4BMYA 1E3EA 5JLAA 2X8LA 3U3RA 3QMWA 3TQFA 3U4QB 3ZTYA 4B0PA 2XMSA 5C1OA 1BW9B 3CURA 3ZS8A 3A4MA 3NTOA 3OQIB 4DJ5X 1V3VA 1MNQA 3L8DA 3O90A 4I4CA 1J2RA 3IVGA 3GVCA 4BZPA 1QHEA 5B30A 2GNAA 5I9MA 3FSEA 4H1VA 5E9WA 3G2HA 4YRAA 3PFBA 1D8TA 4WERA 2GO7A 5FHRA 5IT9A 3SPXA 3OOWA 1VJ0A 2C31A 2XOXA 3SVZA 5K8IA 3M1IA 4O3FA 1EDDA 4B35A 1CQPA 4LK3A 1G41A 4XWAA 1YDGA 2IY7A 5ALFA 4G0OA 1KNXA 1TYCA 1QCDA 2IW3A 1U9CA 2PJUA 1IZ9A 5A6SA 3TW0A 2YIMA 4F3NA 1T9GR 4NCXA 4IV5A 2C4MA 4TL8A 1GNVA 2AYXA 1CR6A 2QYSA 3ZLVA 5ADUS 4DLZA 3OE5A 1R5OA 5AW4A 3DZDA 4JBNA 1SXJB 1P77A 4LHZA 3CTMA 4GKJB 2FKNA 4C0XA 3TG2A 2WTNA 3D3JA 3LZDA 4PN7A 4QDXA 2OZVA 1BMQA 3C3YA 3TVTA 4ERNA 1Q3KA 1UPXA 1PZEA 1W5TA 4TSRA 3WIUA 1Y5MA 1I3MA 3LSTA 4R8VA 2MR5A 3ND7A 5K8CA 1PFVA 4K2HA 4KQEA 3RRFA 4NF2A 3NWPA 2QUHA 5M5BA 4PEVA 1Q0LA 1Y34E 2ZIWB 4WK0B 5BNIA 4E6PA 3OT5A 4IS2A 3GUHA 3G7NA 4W5WA 1ZU4A 3DLTA 2C5BA 3F90A 2RKWA 5BV1A 3KZNA 3BJIC 3LT5A 5EJ8A 1YR1A 4MO2A 4ZYYA 1HYGA 3OU2A 4OKIA 4RDIA 3FKSA 4BMXA 1DAEA 2XBLA 2G70A 5IEJA 3UJPA 4KN5A 2QD5A 4UBKA 1T9CA 1MGPA 4B47A 2JIPA 1OV4A 4XARA 5I9SA 1BTOA 5JNSA 4ND8A 2I4MA 2QBYB 3HB9A 1BFUA 1PNOA 3UOGA 1ZD4A 3AY6A 4GZMA 5JNVA 3T5GA 4TPKA 1GTVA 1Z39A 1P2UA 3LDAA 1V2HE 3LQ2A 4MS3A 3I73A 5J2TA 5DI9A 4URHA 1DKLA 2O0LA 1CEXA 1Z6QA 4OD0A 2P9QA 3EIXA 4PZ0A 3TOXA 2AKAB 3DEAA 3LXRA 4I4LA 1N2CB 4TROA 1O7JA 4NYMQ 4Z49A 5GTDA 2QTAA 3B1XA 4UHBA 1EK6A 4P92A 4U7PB 1Y7PA 3OTGA 5DLYA 1N6PA 1FQJA 2J5KA 3BWEA 4WNAA 4I3HA 1Z88A 2IOHA 2H3EA 3FNGA 3T0IA 2F48A 3UJ7A