3A2MA

Crystal structure of dbja (wild type type i)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
298
Chain Sequence
EIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 113
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2mA00
1ODTC 4N5HX 4ZXFA 4UBMA 4X97A 1XZFA 4H7KA 4HXGA 1F6WA 2ACKA 4G9GA 2HA5A 2ZSHA 4UHHA 3CN7A 5AM2A 4AXBA 2H1IA 5T4HA 3WQHA 5JZ9A 1CUWA 4FLFA 1SCQA 4ARBA 4CG2A 1ZJ4A 5BV7A 3FLBA 5FV4A 2WFLB 4GXNA 3RLIA 1E3QA 1XKLA 2G5TA 1CR6A 3WIBA 5DJ5A 1FJ2A 1LPSA 2QXTA 4BE9A 4QEKA 4UPDA 4RGYA 1XZEA 4J03A 2CJPA 3I6YA 1UT6A 4K6GA 3WZMA 4QLAA 3C45A 4BP9A 4KYVA 1YA8A 1ZD4A 2IITA 3PFBA 1CIJA 4BDTA 4ZRDA 1UWCA 2O2HA 3ZWQA 1Y7HA 3DEAA 3V1KA 2J3DA 5AKHA 2GBFA 1VJ5A 3PDCA 3Q8WA 4LHEA 4FOLA 5AM5A 2PUHA 3I6ZA 5CT5A 4AO6A 2XMBA 2WSLA 2DSNA 2PBLA 1ZGBA 2ORYA 3MVEA 1CUEA 5CW2A 4OD0A 4BVJA 2ZJFA 2X8BA 1MN6A 5ALWA 1DX6A 2AJ8A 2Z3WA 5AK5A 3STVA 5FLKA 2CKMA 2VEOA 2XUIA 2HRRA 1THGA 3VJLA 3WKEA 1CEXA 1O6GA 4GECA 4UBKA 2C5FA 5HCUA 2Z3ZA 1UKCA 1TK3A 3OTQA 3ANSA 1DX4A 4P92A 1QTRA 4HXEB 3AIMA 1EXWA 4UBNA 1FFEA 5EHQA 3O95A 1B6GA 3BIWA 4UHDA 1AKNA 1XQXA 1YA4A 3WYDA 2BGNA 3DL7A 1W52X 1XZJA 4AX4A 4BVKA 5T4BA 4AN0A 1CUSA 1CUHA 5DTIA 5CBKA 4DMHA 4CIAA 3TJMA 1AQLA 5DNUA 1XZKA 4X71A 5J3JA 3ZLVA 1C4XA 2H7YA 1W76A 3HI4A 2XUKA 3IUQA 1JFRA 3S2ZA 4B81A 2Z8ZA 4DM7A 3AIKA 4N8EA 1BE0A 5AKYA 3KDAA 5AK4A 1W1IA 4UBOA 1A8QA 1VXOA 1HL7A 4X7BA 1AMNA 2WM2A 3EBLA 4IH4A 2OQVA 1G5FA 3ANTA 4B83A 4BCCA 1ZIYA 5LLSA 1UOPA 4I3FA 1QZ3A 4IHAA 2QOEA 4X6YA 3E1GA 4KJXA 4MXDA 5BWBA 2JGMA 1CUXA 1GZ7A 1GPKA 1MAAA 3PUHA 5I8PA 4IH9A 3H2HA 3CCBA 5LIPA 1AZWA 1TQHA 5AI5A 4KE7A 1VE6A 3ESCA 4XX1A 3LIPA 2R8BA 2FX5A 1DT5A 4YASA 4CG1A 4BTVA 4KE6A 3NUZA 4LXGA 4BC0A 3FYUC 4AO8A 4DMFA 3DOHA 3DCNA 5AKZA 3G0BA 5HF5A 3WWOA 1GXSA 2PUJA 1XZMA 1XRNA 5FPQA 4DNPA 1IZ7A 1N5RA 2W6CX 4WDQA 2GYUA 3D2AA 5HFNA 3ED1A 4TPKA 4WY5A 5AI0A 1WB6A 4UFPA 3WI7A 1QLWA 2PSEA 1THTA 4L0CA 4BYMA 2C0QA 2HA0A 3A6ZA 2RAUA 5JADA 4F5ZA 1X70A 4Y2VA 2ES4A 3C6XA 3STYA 5JARA 1QIHA 5SYNA 2FJ0A 1LPMA 2WFMA 3W04A 4LXHA 1CUDA 3S8YA 5CXUA 2DCMA 1EH5A 4QZVA 4TVKA 5DNVA 1XQVA 5E4TA 3ZV7A 3BE8A 1C7IA 4PSCA 1GQRA 1G66A 3WK8A 2VTVA 5EHNA 2WIDA 1H2YA 3H04A 4C6HA 2Z8XA 5AOAA 4K2AA 5AK3A 1X2BA 4L72A 1Q84A 1E5TA 4EZIA 1H2XA 1CQWA 4MWTA 1CUAA 4OCZA 4YPVA 1H23A 4GW3A 4X6UA 3IULA 2BUAA 3U0VA 2JGKA 5FDFA 5C7YA 1P0MA 1Y7IA 1ZIXA 1UKAA 1PV1A 4JNCA 3HEAA 5AP9A 4OYYA 5DYTA 3TEJA 5AM0A 1JJIA 1MJ5A 4P9NA 1YAJA 4BCDA 4OU5A 4ZGBA 4HXFB 2BFNA 4KRYA 3G0GA 2Y6UA 3G0CA 1YB7A 4DGQA 5T4FA 1ZI9A 1MNQA 3OOSA 2DQZA 3BJRA 4ITVA 4DSAA 3IURA 1MU0A 2CMFA 4FTWA 4PO3X 1WHTA 1MT3A 1P0PA 3H2GA 4Y2XA 5K3FA 2H7XA 5AM1A 5CT8A 3R41A 3C5VA 5D3ZA 5LZ8A 3DQZA 2OAEA 1CPYA 1EX9A 2HFKA 1T2NA 2BCEA 2ECFA 3UUEA 2WG2A 2OPHA 1JU3A 3KOOA 1OCEA 3W9BA 3WKAA 3PF8A 1YASA 1XROA 3HC7A 2J3QA 5AI6A 5ALOA 3PFCA 5LZ7A 3GROA 4B82A 3WK6A 4CCYB 4BCBA 1TCCA 1HLGA 4DMCA 4QLOA 1NU8A 2OXEA 3FOBA 2WUDA 1QONA 1E8DA 1MX5A 5HF8A 2HHAA 4EB0A 1GKKA 1TAHA 1UK8A 1TIBA 2VAXA 1SOMA 1EB9A 3HXKA 4Z49A 4EA6A 4X85A 3CCCA 3YASA 2FUKA 3X3HA 5AI9A 3WL8A 5K3EA 2C7BA 4AB1A 2JGEA 4GDMA 1MTZA 4CCWA 3AFIA 2PSJA 2XUDA 2PM8A 1CQZA 4UHFA 1XLVA 2JF0A 3GZJA 5ALQA 4UBLA 5JAHA 3V1NA 2JEYA 3GBSA 3LP5A 3IBTA 1F0NA 5HK8A 1ZI8A 3I2KA 1EVEA 5LKAA 5D7BA 1QIDA 1UXOA 4IH1A 5E4YA 1R9MA 3WYNA 4X3CA 3VXKA 1UK9A 2P8SA 5C8VA 4FKBA 4G1FA 4M0FA 1QO7A 4FBMA 3T4UA 3B3QA 5ALUA 2HU7A 4IQ4A 2D5LA 1RWQA 1BEEA 5BWCA 4C88A 3O9MA 3AIOA 3TGLA 1ORWA 5AI4A 5AIBA 5FUMA 5YASA 5FPPA 1YS1X 2YXPX 5AKLA 2BJHA 3PUIA 3A2NA 4TGLA 3FAKA 1XRMA 1LPOA 3E3AA 4DLNA 2YH2A 1XQYA 3A2LA 1CLEA 4X91A 2IX9A 3N0TA 3D2CA 4DNFA 2D0DA 3FVTA 4Y2PA 5H3HA 5D6OA 2OCGA 4PSUA 2ZYSA 3R3VA 2HA3A 3D7RA 3H19A 3O4IA 4JUIA 3WZLA 3AZOA 4NZZA 2G4LA 4W1QA 3H2JA 2FJPA 1J1IA 5LZ2A 3STTA 2OGSA 2RONA 2DQYA 2QRUA 1WPXA 2WILA 3UMJA 4B7ZA 2GYVA 4J0HA 3PICA 4U2CA 2VATA 4KAJA 3FCYA 3VJMA 3DOIA 2AXEA 4O08A 1GGVA 4N5IX 1ORVA 4CIBA 2BKLA 4DIUA 5CT9A 2VJAA 4GHWA 1BN6A 3G7NA 4U2FA 3ICWA 3GUUA 4U2BA 4QWMA 3DKKA 2VAVA 3ZLUA 3BIXA 2XMRA 1GPNA 4DNQA 2QM0A 4UFOA 1LZKA 2XMDA 2J4FA 4WDRA 2DFPA 1AURA 3L1HA 1SC9A 1F8UA 4V2IA 5KREA 3W2TA 2EEPA 1ZD3A 3V1MA 1PJAA 3RARA 1WHSA 2AJCA 5AKKA 3H1BA 1UFOA 3RK4A 1A7UA 4GEGA 1JMKC 4J0CA 3EIOA 2WJ3A 1VA5A 1N8SA 5K3FB 3BDVA 3M83A 4QWWA 1YB6A 4NMWA 4OB8A 3PF9A 2O2IA 3VVLA 5ALJA 2ZYRA 3SC2A 5JD6A 5IH7A 2UZ0A 2CBGA 2HRQA 5AIAA 3I1YA 1B41A 4DYHA 3NGMA 1LZLA 1QIKA 4Y2YA 3DYVA 2C4HA 5EIHA 2XQGA 1XZHA 4KRXA 2XUFA 1QIIA 1XZAA 2XQJA 4KR0A 1UOOA 3C8DA 2ZSIA 2K2QB 3A70A 3C87A 4EY8A 3GA7A 4B85A 4QDOA 1BRTA 2JGJA 5FOQA 1BU8A 1YR2A 2OCKA 4Y9SA 4DTCA 1XZIA 2B61A 3G0IA 4ZV7A 2J4CA 5HKAA 2XMSA 1A8SA 1ISPA 1EHYA 2XLBA 2ACEA 2O7VA 3IVMA 4BBZA 1Q83A 4BB0A 2OGTA 4PF1A 5CRIA 1FSSA 4AQDA 4N8DA 4FFWA 5A71A 1EDEA 5EI5A 1XRLA 1MNAA 5KWIA 4WJLA 5DYWA 4QDUA 1Y37A 1WPRA 1HQDA 4P08A 4FBLA 3FLAA 3VKFA 4G4JA 1QOZA 2Y2VA 2V96A 4GWLA 5E4JA 4M0MA 5ALSA 1HBJA 2WUFA 5JIBA 4B0PA 1DWOA 4IO0A 1ACLA 4EUSA 3JWEA 3HYSA 4FLMA 1USWA 1T4MA 1MAHA 1KEZA 4AZ0A 3LIIA 1HKHA 1IUOA 5CT4A 2WFZA 4MQLA 1ZOIA 4H77A 3D2BA 4C89A 4LIPD 2O2GA 2RHWA 3WLAA 1A8UA 5AOBA 4X90A 1WCYA 1CUCA 2Z5GA 5FKJA 2O7RA 4C87A 3HZOA 2WIGA 2PX6A 3PI6A 4Q1VA 2C5GA 1Q0RA 1CV2A 3GELA 3MUNA 4E11A 1LLFA 2QMQA 4H7EA 3BXPA 5AM4A 1P0IA 5EFZA 3IA2A 5ISMA 4BRSA 1EA5A 2GBCA 3HSSA 1HDEA 1BEZA 2LIPA 1U2EA 3DJYA 5FXMA 3BDIA 1K5PA 4GLBA 1XRPA 1R88A 3B12A 3ZI7A 4J3JA 1FFDA 3WL6A 1CUYA 5AH0A 4Y2UA 2VJCA 1UK6A 2WG0A 1CFJA 4HRYA 3LLCA 4QA9A 4P93A 2GBGA 4Y2SA 1IVYA 1W6RA 1U4NA 5E2IA 5I7UA 3V1LA 3BF7A 2PPLA 2V9ZA 3DNMA 1JI3A 4RE5A 2X76A 4HS9A 1TKRA 3V9AA 2QVBA 3PE6A 1L7RA 1UZAA 5KBYA 3R40A 2PKYX 1X2EA 4W1RA 4BRZA 4INZA 2WHPA 3O4JA 1DWQA 4MYSA 4BC1A 3F96A 2DHEA 3D59A 5IVHA 2DHDA 5A7HA 3QPDA 3I2HA 4CI9A 3AILA 4OPMA 2C58A 3ZLTA 2JGFA 2V97A 3H2KA 4KAFA 1XZLA 5T4EA 4ZV9A 2OLEA 2PSDA 4OU4A 3I2JA 3BF8A 2JBWA 5HQ3A 2WG1A 3WJ2A 4CG3A 1N1MA 4AMZA 2XMCA 4QDZA 3QMMA 4BVLA 1E8MA 4OUKX 1RYYA 3IDAA 4UUQA 4H18A 4U2GA 4U2EA 3OC0A 4AMYA 2XMGA 4K6KA 2HA4A 3EF3A 3IB3A 1JJBA 3RM3A 5AK6A 2WTMA 5EHZA 1AGYA 1XZBA 3OM8A 3O9VA 5C8XA 4A16A 2PL5A 4BDSA 2XI4A 3FSGD 3KWJA 4E46A 4CCYA 1IZ8A 5CMLA 1TRHA 2AJLI 4WFKA 2ROQA 4G8CA 2NW6A 3DD5A 2VJDA 4XIIA 1SCKA 1QJ4A 1RP1A 1EVQA 4KE9A 4PNZA 4BAUA 4A5SA 2OGZA 4C4ZA 4E14A 4JYMA 4RE6A 3SWWA 1LPBB 4AO7A 4B84A 1IUNA 3WK9A 5I9IA 3K9BA 4UHCA 2WU4A 3KWFA 4MQMA 1XRRA 2PSFA 4J0GA 4W1SA 2I3ZA 5HF6A 2HU8A 1LPAB 3BL8A 3AZPA 2WQZA 3I6MA 2B4KA 3E0XA 5AKGA 5C81A 5BOVA 1W4LA 1XRQA 4PV7A 5ALNA 3G0DA 1JU4A 4FNMA 4BTLA 3ZPXA 4GI1A 4MEBA 3G9UA 3HRHA 4OSEA 4G8DA 1JJFA 3O4GA 3JYHA 3E4DA 1LPPA 2VF2A 3EQ7A 3IUMA 4EHBA 3I2IA 3CXUA 1QIMA 1GPLA 5IKXA 3F9CA 4Q3LA 2B9VA 4KACA 2I03A 2WHRA 3L1JA 3C6ZA 5ALYA 5ALTA 3H0CA 1CUZA 4G4IA 3DL4A 3WWCA 4OYLA 3M3DA 3D3NA 3V48A 5JALA 4HTAA 3W05A 1PFQA 1VOTA 2QUBA 1K6EA 3QPAA 4G5XA 2WIKA 1VZ2A 5F4ZA 4PSDA 4MJ3A 1YCDA 3I2FA 4EY7A 3LS2A 2AJDA 1YSCA 4H35A 1E8NA 1AX9A 3ICVA 3R3UA 5EIEA 4XJVA 3G8YA 1M33A 1NX9A 2HDWA 1XKTA 2WIJA 3T52A 5HFAA 2HM7A 2BUCA 1S8OA 3G9ZA 1R1DA 3FYTA 4BE4A 4FHZA 4W1PA 1FFAA 4Q34A 3TRDA 4G4GA 1DU4A 4N8SA 2CEKA 1VKHA 4A23A 3M81A 2XUHA 4BP8A 3STXA 3WA6A 5A62A 2WUGA 4H7IA 2XUQA 1QIFA 2B20A 2BGRA 3SX4A 2QXUA 1QTIA 3STUA 2XMZA 4CFSA 4J0IA 5ALRA 2PSHA 4Y2RA 3RKSA 2XQFA 5DWDA 1EDDA 4ZI5A 2XUJA 4LKOA 5AOCA 2ZYIA 4FWBA 1EINA 5HQ3B 3DS8A 4JYPA 3SK0A 4MEAA 2XMQA 1CUFA 5CH8A 2CUTA 3KSRA 1L7QA 3F98A 1ZGCA 1FFBA 4F21A 5ALXA 2QJWA 1D07A 5JD5A 3WK7A 3AUKA 3C6BA 3Q0TA 3R0VA 1DQYA 2OCLA 2AJBA 4NS4A 1ACJA 2YYSA 4B0OA 4UBIA 1AC5A 1DWPA 3R3XA 2EDCA 3O4HA 5JANA 3DKRA 5ALHA 1TCBA 2WLSA 3MGAA 1WM1A 5K3AA 3GFFA 1XZGA 2GBIA 2XUPA 4Q3OA 2QS9A 2GZRA 2XQIA 3R3ZA 5JYCA 4ZWNA 5AKEA 1QO9A 5A6VA 5DTJA 2EDAA 2Y2UA 4DSZA 3D0KA 1DINA 4E15A 2QZPA 2GZSA 3C70A 3WA7A 2QUAA 3FWHA 5ALKA 1UKBA 4W9RA 1E89A 2R11A 4B6GA 1CUIA 1W75A 2XB6A 2GYWA 1LGYA 1VXRA 3H18A 4QDXA 2PVSA 3AINA 4L3WA 2WFLA 3WK5A 2VA9A 1F0PA 1H22A 1GKLA 5ALFA 1NU6A 2YASA 4X00A 4JEIA 1I6WA 3H1AA 3DLTA 1UK7A 4J0JA 3OG9A 4Q05A 2ZVDA 4Y2QA 2HA2A 3C5WP 5LZ5A 3UUFA 3O0DA 1CUBA 2QKYA 1VA4A 3QPCA 7YASA 3R3WA 4JH0A 1J07A 3IIIA 3W9UA 3WJ1A 3BWXA 3WWPA 3C6YA 4AZ3A 5HKBA 2XUOA 2HU5A 3G02A 6YASA 1VZ3A 5C8ZA 3K6KA 3N2ZB 1CUGA 5LZ4A 4FMPA 1CUVA 2JGIA 1XZCA 3R3YA 1OILA 2XQKA 3FVRA 1YAHA 5FP0A 5IVIA 5JAPA 3WMRA 4OB6A 2C0PA 4H7FA 1EI9A 4PQEA 1EK2A 2HADA 3U1TA 3EQ8A 3QVMA 2X5XA 2E3JA 4RNCA 4UHEA 2Y1KA 5ALDA 1J06A 3HABA 3NOXA 2ONCA 1XLUA 3FYUB 4MWSA 4C4YA 1R3DA 3QH4A 3AJAA 5CTAA 3FCXA 5AM3A 3M82A 2CZQA 2Q0XA 4ARAA 2HFJA 4EBBA 5JATA 3IUNA 4B9EA 4ZREA 3I28A 3P2MA 1XFDA 1QE3A 1GQSA 4K6HA 4BAGA 4LXIA 2ZJ6A 1CVLA 2XE4A 1U65A 2WHPB 5DLPA 3OURA 2VJBA 3G9XA 5K3BA 4XVCA 3QYJA 3C43A 4X95A 4G9EA 1LPNA 1XZDA 3ESBA 3F67A 3VDXA 5AJHA 1IMJA 1TCAA 1WB4A 1N5MA 1YS2X 1ZI6A 5LYYA 1EB8A 3VISA 2XLCA 3QMWA 3WKCA 5EGNA 2JEZA 3HLKA 4HVTA 5LP1A 4EY6A 3A2MA 5JAOA 5K5EA 2QR5A 3STWA 1BROA 4EY5A 4BZZA 1FFCA 3QITA 1E66A 1KU6A 1SFRA 4KE8A 1P0QA 4HAIA 4QDTA 4FNGA 1CUUA 5ALZA 4D9JA 1U8EA 2PU5A 5A7FA 1WOMA 3OPMA 4H7JA 2ZJ7A 1ETHA 1K63A 5CURA 2VSQA 4OB7A 3CN9A 4H7HA 5HZGA 2G63A 3DDUA 4F0JA 4U2DA 4UFNA 1OXMA 4X93A 5HK9A 1ODCA 3K2IA 4J0KA 4KAAA 5ALEA 5JZSA 5LKRA 1BS9A 3VVMA 3BJMA 5LZ9A 3WWDA 4BATA 2WIFA 3LCRA 1IUPA 1MPXA 4H0CA 4BZWA 5EIAA 4RPCA 4UBJA 1QFMA 1JMYA 4EY4A 1QGED 5JAUA 5K3CA 3D5EA 1R50A 1LNSA 4G8BA 4WCVA 1BN7A 4MYDA 4HZGA 1J2EA 2XT0A 2DR0A 2ZYHA 1ZD5A 5AKXA 3L1IA 4ROTA 5JZBA 2WJ6A 2VT7A 1G4HA 4I4CA 1VLQA 2H9YA 4J0DA 1L7AA 3QZUA 3FBWA 3DYIA 5IVDA 2RGUA 4K5QA 2XDWA 4B9AA 4C01A 3QMVA 2HL6A 2RIPA 3WWEA 2XUGA 2OAGA 4L9AA 3ESDA 1QFSA 2OQIA 2WJ4A 4QNNA 4GBGA 1DT3A 3H17A 2DHCA 3HJUA 1C7JA 4HRXA 2HA6A 3NWOA 1LBSA 2Y6VA 3WK4A 4B80A 3MUOA 3W06A 3I1IA 4Y2JA 2QTBA 2RHTA 2I3DA 4LYDA 4FDMA 5HF9A 1EK1A 2WU3A 4H7DA 4PW0A 3WKDA 5SYMA 1QIEA 4X92A 4Y7DA 3C8HA 3FLEA 5DYYA 3I2GA 3WL5A 4YX9A 1CRLA 4J7AA 4M0EA 1DTEA 4ETWA 3FYUA 4WY8A 2BAGA 4Y2TA 1WB5A 2WTNA 5ALGA 5D3KA 2RI6A 1ZJ5A 1QIJA 3FSGA 5ALIA 1XQWA 1R9NA 1EDBA 1MX1A 1MO2A 4KEAA 5AKIA 3WIOA 1O6FA 3G9TA 1ZD2P 4FLEA 4XWGA 4DNOA 2JGLA 2QJRA 1JKMA 5CH5A 5K3DA 3FNBA 1K4YA 1A88A 3B5EA 3JW8A 3KXPA 4AN1A 3ESAA 2WUEA 1Z68A 3VJKA 4Q3KA 1Q0ZA 5CT6A 5AI8A 5AO9A 3H2IA 4F60A 1MX9A 1LBTA 2HA7A 1H2WA 1HPLA 5AICA 5ALVA 2VT6A 4C4XA 5A2GA 1CUJA 4UHBA 2HIHA 4BAZA 4DMKA 3QM1A 3ILSA 3F97A 1UOQA 2IIVA 2XUAA 3KD2A 3QBJA 1K8QA 2VQ6A 2JIDA 1AUOA 4S0XA 4WFJA 1G42A 3WL7A 5ALMA 2BUBA 3HACA 5ESRA 4WFIA 1BCSA 5ALPA 1VE7A 1QIGA 5JD4A 4LYEA 5CH3A 2CB9A 5EHXA 4NVRA 5AHXA 1R4ZA 1H2ZA 1JT2A 5ALLA 3EQ9A 3AZQA 2I78A 2H7CA 4X94A 1XLWA 1ODSA 3IUJA 2PU7A 1KU0A 2OCIA 3D4LA 4I19A 5JASA 3F8SA 1SCIA 2OG1A 2WKWA 1GT6A 5KWJA 2QT9A 2WHQA 1DQZA 4FFVA 4W63A 2V98A 5AKJA 1ZICA 3WKBA 4X6XA 5A7GA 2W22A 5IVKA 5FRDA 4Q82A 5CXXA 2G5PA 4YK7A 4QE3A 5DNWA 1BCRA
chains in the Genus database with same CATH superfamily
4WOJA 4YCCA 1ODTC 4IWNA 1Z12A 3R75A 2B2CA 3P27A 4N5HX 4R1NA 4IDFA 1Q2UA 3U4HA 1E4OA 3GX1A 4X97A 1EWRA 3TRHA 4YRGA 2WINI 2HA5A 3LRXA 2ZSHA 2AZ4A 1LB1B 2O4UX 2J0EA 1ES9A 1JIXA 1P9OA 2VEDA 1P4JA 3BA1A 2ZLBA 2HY7A 3HU1A 3IPAA 2QX7A 4CHTA 1EXDA 4Y1RB 3RC8A 1Q7TA 2RMKA 3JX9A 4I9NA 3N8DA 3NYWA 1W87A 2YBDA 1W581 3AHCA 4JU8A 3U9LA 3UZUA 3HB5X 3M2TA 1KZ7B 3PGKA 3LHFA 1G5RA 1PI3A 5TR9A 3ZQJA 4UREA 1QG4A 4WLNA 2V7UA 2HJSA 4GXNA 3RLIA 1JPUA 1YV9A 2J59A 1GD1O 3COSA 3SU8A 4EBFA 4MI6A 3L5KA 1G64A 1IUKA 2DUMA 4MW7A 1P7WA 1LPSA 4EJFA 3CYFA 1P19A 3N75A 1RQGA 3ROEA 4BE9A 2J7PD 4BIMA 1XEAA 2RHHA 2XZDA 3QPWA 3TS1A 4JNKA 3L0SA 3N2GA 6CHYA 4DDVA 3DE1X 2DE0X 1PZNA 3UCFA 4DBLC 1XZEA 3AR9A 1PAUA 4J03A 3OTGA 4WUVA 2GARA 1N77A 1KEPA 2QP3A 2D4AA 1JTEA 2YHSA 4KPGA 3IDQA 3E5RA 4R8LA 2WFAA 5DGTA 4BFLA 3LGSA 1YA8A 4BP9A 1U0BB 3W6OA 4HDKA 1ATZA 2ID8A 3ZQUA 2X77A 1UKVY 2JVKA 1WQ3A 3PFBA 3PJRA 3LW7A 4ZRDA 5CFZA 4KB5A 2O2HA 2BM9A 3EX7C 5EP3A 3SN6A 4WY2A 1M6NA 1UBOS 5DOZA 4CLOA 4AKIA 3OEWA 4LI0A 1AHPA 4PYNA 3UBTA 3S5JA 4IYRA 3CLUD 2Q4DA 3GLHB 3MIZA 2V7PA 3S8MA 4O4IA 3IQXA 4DDKA 2BC9A 5H59A 3ZWKA 3PFHA 3BICA 3DE3X 5CM9C 4GNRA 3TIGA 4QOGA 3OLQA 5AKHA 3ANNA 1SZDA 2Y1FA 1KO8A 1RWMA 1VFNA 2YTZA 4PX9A 4MMYB 5CCEA 1RS0A 2B1GA 1VG9B 3MWFA 2Z2XA 1FNNA 1R12A 2F9MA 2RCYA 3VSAA 4RIFA 3OPQA 3RDPA 3WICA 1DQNA 1EXNA 1SUWA 2O3RA 5B3LA 4OJQA 4CQLB 2PBLA 2E1RA 1ZGBA 2ORYA 3MVEA 3EIXA 1H0RA 4OD0A 1AKTA 4NNJA 2GPAA 5EZYF 5KAMA 4TL8A 4BVJA 1D2CA 1ENZA 1K98A 3I6BA 3CONA 3UOAB 1VKNA 3ELWA 2AJ8A 2XODA 4XD7A 3STVA 2OCPA 4ONEA 4D96A 2R2GA 5TT0A 4OLAA 1IATA 3SVLA 1LLUA 1V9CA 1SURA 2JJYA 2Q9BA 1O0SA 1THGA 2IXDA 1CEXA 1O6GA 4MQFB 3RSSA 5EOVA 2H51A 3IEMA 2C5FA 1XBTA 2C3YA 2HWKA 2RH8A 1WCXA 2Z3ZA 2O9JA 2ZBFA 3KB6A 2WE8A 4H6VA 1T9DA 2ZE6A 1HE3A 3DMPA 4QG3A 2O8FA 2HSEA 1JV2B 3BDAA 2WHXA 1Z07A 2HCTA 3IEXA 2J3KA 3IKLA 4JT8A 2RJOA 1E7RA 3LDGA 1PDWA 5T8KA 3EGDB 1VYTA 2RIRA 1IONA 3HCBA 4FFRA 4XOUA 1SUIA 3TLGA 4HPJB 4D92A 2Q2WA 4RY2A 4JY7A 3F90A 4U0KA 1KSGA 2O8DB 2YY7A 2I2AA 3LLMA 4JYBA 1K6XA 5INTA 5JDCC 2CDCA 4LWQA 4AKHA 3RVMA 3JQCA 1A2KC 1UT5A 3RW9A 5DCLA 4QDKA 7AT1A 3DL7A 1BSVA 1ECPA 1R66A 2MYNA 1AJEA 5ADVA 2QEQA 3UK2A 1W52X 1XZJA 1QHEA 4JS0A 4NTZA 1E2EA 3RC7A 3WTCA 3L7CA 4AJEA 5ADWA 1OFGA 3LQKA 4AX4A 1NQXA 3MD0A 3P20A 3X1ZA 4BVKA 3DBIA 2ZIGA 3RBAA 4JAVC 4AN0A 3RS7A 2ZIFA 3TECE 5JBIA 3CT4A 3Q2OA 2V58A 1AD2A 1NPTO 3K6JA 2A4MA 2EOAA 5CBKA 2F3QA 2PD6A 1ZA2A 1RYFA 3B13B 3GDFA 3MNFA 3Q9LA 1Z8DA 4DILA 3RUDA 4IXMA 5DNUA 3UKDA 2H17A 4BNTA 1RRGA 1E2NA 1PNTA 1OA1A 2QM3A 2QRMA 1PG0A 3ILYA 4X71A 2R44A 3D2LA 4P5DA 2ON6A 2XUKA 3INGA 1RBYA 1YACA 3QQPA 4A03A 3BT7A 4M0CA 4ZFNA 4RHTA 5FLXA 2ZSKA 5HNKA 1DO8A 4CQNA 1M2OB 3H5LA 3HA7A 3QVKA 2FSGA 5EJMA 1OTYA 2Z8ZA 4MA0A 3HY4A 2F8TA 2I2CA 4B8ZA 3AIKA 4C3OB 3JVDA 1QC5A 1BE0A 5AKYA 3WDMA 1QP7A 1IXKA 1K9SA 2AMJA 3KDAA 3RI3A 4HKTA 3RANA 2IZ0A 3IIMA 4B2IA 2WYUA 2GHIA 2VYVD 3INNA 3WRXA 1G5IA 4TV8F 4C7OA 4LCJA 4K2HA 2B1JA 2FEPA 4I2VA 1JHMA 3CVJA 1UFQA 5AW5A 1F5SA 4X7BA 1U0NA 5HKKD 5HQJA 1AMNA 3KE8A 4BOYA 4ZJYA 4P0QB 2LBPA 2OXFA 2RHOA 3D5TA 3EBLA 3KHKA 4IH4A 4K26A 4M21A 5KYVA 1KPHA 3JVVA 4PVDA 4E7PA 5CFLA 2VJMA 2PUDA 2CXQA 1LW7A 1XKXA 2QG9A 5AVSA 4H60A 5LLSA 1GTRA 4MDFA 1VMDA 3T1NA 1NYTA 4IY1A 1JGTA 1K08A 1QZ3A 1FK8A 4DANA 5EVCA 3PHIA 2EX1A 2D0OB 1IE3A 4CI0B 4MXDA 5HRUA 2ZM5A 4B4VA 1UJNA 2P5SA 1A9XA 1KDZA 2R8RA 1XAIA 5EE1A 4LWZA 4CYMA 4ZZ3A 2LRHA 5C5IA 1GZ7A 2O2ZA 2WD7B 4GPZA 5AXCA 3G23A 3KD3A 4RA6A 4L4XA 2DWOA 2CWDA 4X20A 3NZEA 2Q21A 1AZWA 3OSZA 2WPDA 3PT9A 5DH9A 2J41A 4U6SA 3PKIA 1XMSA 4MVCA 1Z82A 2OHVA 1XHFA 4IF6A 5F33A 5BV1A 3H87A 2R8ZA 3NXSA 4KMOA 4WTOA 5E8RA 2BSAA 2R8BA 3ZX4A 2PJRA 4WJZA 4PQYA 1RQ7A 2VJLA 4Q48A 4LRXA 3L43A 1UBGA 4M0PA 2OB2A 3Q41A 4W8GA 2Y71A 3WGMA 1V6AA 1T0IA 1JIIA 3A28A 2DUJA 2GD1O 4NBNA 2JIMA 4PO9A 4BGIA 1CRWG 3QSGA 1DAIA 4UAUA 4HGNA 4LXGA 4MCJA 2QN9A 2YHBA 5A9SB 1E5DA 5KQPA 1GL9B 3F2IA 5K0CA 1GG5A 2DKNA 4POAA 1XMVA 3WHIA 5HA5A 4CEIA 1YB2A 1KAQA 2QYOA 3T41A 4G2NA 2G1PA 3SP1A 3VM6A 2OCDA 5HF5A 4EG5A 4MULA 2NAPA 4BFZA 5IYZA 1XZMA 4UVEA 1NVEA 2HJHA 5FPQA 1F6DA 2I2BA 1TVKB 3ORQA 4B2PA 1YQWA 4D4KA 1F2DA 3IIEA 2GLXA 3AK4A 4UE2A 4E5NA 1GAJA 1BFKA 3G2KA 2VDWA 1SXGA 1YS7A 3B6MA 4NBUA 1WPQA 3M1IA 3MJHA 2WWWA 4YRCA 2G6TA 1COWA 2CFSA 2CL7X 4N65A 5FAXA 4FCVA 4YY3B 3GJ0A 4QHSA 3ETJA 4R1TA 5FL3A 3A10A 2X4LA 4PRKA 2K7ZA 2JFUA 1J9EA 4L0CA 5IWCA 4XCQA 4GM0A 2D5IA 2C0QA 1CYDA 5ER9A 1CZUA 5IXYA 1HYQA 1O08A 4HEA6 3ZCTA 5K09A 2BP7A 4LOAA 4CKBA 3AEQA 4W5OA 4AS1A 2DGDA 1Y63A 5I7WA 1M7BA 1P1KA 2CL0X 2RAUA 5EJ8A 1OFTA 4F5ZA 1Z6PA 1KDTA 4F5DA 5A4DA 3CZAA 3H11B 1FDVA 2A59A 2V5AA 3CA8A 2ES4A 4II7A 4WA7A 3C6XA 3G0OA 4C3VA 3NRCA 3KQNA 3P71T 5CLLA 1AO0A 1QIHA 2XEXA 1KR5A 1A82A 1DOAA 3DR5A 4EW2A 4Z4GA 4CM8B 2RK3A 1CEQA 5SYNA 2FJ0A 3RBXA 3DB1A 4LYGA 3M70A 1NXOA 2IQIA 5AT1A 5ITZA 2J5BA 4K9NA 3Q5GA 3NP7A 4WADA 3DLHA 1CUDA 1Z0AA 3NTUA 1IHPA 3HXLA 3ETLA 4ZC8A 4Z4QA 1EH5A 4MR7A 4GX5A 5AUOB 2OXRA 2Z5FA 3LXUX 4WV3A 1UF9A 5A06A 1MFZA 2D4HA 2QL6A 4XR4A 4BQRA 3KKEA 3AWIA 2O2JA 3GP5A 5CEFA 3T7EA 3SQXA 5E4TA 2Q4EA 3DWEX 4KVAA 2ZTSA 3N58A 3ZV7A 4BYGA 5HM8A 1E6MA 4P98A 1JWAB 1YR9A 4UHJA 1XTIA 1IAQA 2IC5A 1C7IA 4LDZA 3VHRA 1GQRA 1G16A 3A9RA 1G66A 1YL5A 1E9CA 4U7HA 5EHNA 1JIQA 4ND6A 4EO7A 3HJNA 4V24A 4ZCSA 2Y0BA 3A32A 1SCDA 4ZVVA 2B37A 2YIVX 3F6BX 3N2KB 4IWYA 2BGUA 1UM9B 2OGUA 3EIHA 1JBQA 1JHVA 1Z74A 3ADOA 3A9VA 4K2AA 4MEJA 4M60A 3VVCA 2A1IA 5IS2A 4MV9A 5KQMA 1MT0A 4KDEA 2QW1A 1E77A 4YRQA 5E38A 4OHFA 5G2OA 4UNSA 2VAMA 4TVSA 3PVZA 1KEEA 3ZN2A 4CMCA 5EIOA 1SKAA 1MH9A 3RRJA 1PVOA 5DNEA 1CG6A 2DWPA 1Q20A 2IHZA 1Q22A 3RS0A 4KN5A 3WYAA 3GHYA 5IM4F 1H23A 4Z9FA 4IIDA 3OQIA 4DBLE 4JI2B 3RBVA 1G21E 5L45A 4O4LA 2BEWA 1ZLXA 2Q5OA 3NHPA 4GVLA 4K3UA 2SECE 5AMXA 3H1FA 2Y1GA 1WR8A 1FTWA 1E63A 4K6CA 2ZW9A 3EVFA 5FDFA 3AVWA 1U7PA 1VGQA 3F9RA 2RGNC 5C7YA 1P0MA 2WJIA 2HJRA 3DUFA 1NSYA 1PV1A 1QSGA 2OD9A 2HRBA 1LVHA 3HEAA 1PS0A 5IC5A 3L4EA 4LYJA 3W2GA 3K5IA 2ILVA 1VE9A 3SC3A 5CCDA 5AM0A 1XE3A 5DXJA 2AC7A 2FE4A 3ZBTA 2VNIA 2H3HA 2V03A 4BX8A 1R10A 5T7BA 1PWXA 2BFNA 2GHRA 5HUHA 3VZBA 3E9DA 2RAVA 3G0CA 3SBDA 5G0SA 3LQ4A 2LCIA 3BIFA 3U31A 4HY3A 1DMRA 1ZKDA 1CWUA 3K4HA 4Y18A 1D7OA 4QNRA 2FZVA 3Q9UA 2MINB 4QOEA 3OOSA 4S04A 2DQZA 1TRKA 1OWLA 2BMWA 4K1LA 5TMPA 5IDYA 4DSAA 1KSJA 4BFUA 5A0TA 1E6WA 2CLOB 4K9MA 1H3EA 1N2OA 4CT0A 4WNYA 2HLDD 3NAQA 4FE4A 5AHOA 2Q0HA 1YJBA 3R0IA 1CIPA 4LHVA 1THMA 2HK9A 3IUBA 3U6BA 2ZUEA 3GXBA 2D5CA 3PGLA 2NUAA 3W6PA 1QE5A 3PC8A 2HPAA 2ZJYA 4O2AF 4XM1A 5LP6C 1M6VB 5DB4A 4XCVA 4YMSA 1C8LA 1MQ9A 3QKSB 5D3ZA 4JJEA 5EJAA 1RPNA 5FNVF 5IDXA 2PTHA 4NK5A 3IOMA 1NKVA 5CYPA 4RF4A 2F1HA 3MT0A 3T3DA 2Y77A 1L5GB 1FF9A 1L4YA 3ADCA 2JAWA 1Z33A 4ERXA 3MQ4A 4F3NA 2AV6A 3PU6A 3QFFA 4L85A 3WKAA 5F2OA 5KQSA 5JMOA 1R7RA 1DC3A 4PICA 2JJ2D 2OMKA 4C2BA 4F2DA 2BWJA 4BWFB 4CEHB 3HXTA 3IC5A 5TMEA 5TE9A 3PJFA 2E5LB 2O0MA 1YASA 3LUGA 4EPYA 3I61A 4FNOA 4KN9S 3HC7A 2BKAA 4TRJA 2CFTA 5AI6A 3MFYA 5LZ7A 1HY3A 4I1IA 1KYYA 1MP0A 1RLTA 2C2OA 2TYSB 3GROA 5LQKA 4I1YA 3RFVA 1CJMA 1NU8A 4O1IA 4CW7A 2OXEA 4CL2A 5IT9A 3QE4A 4FILA 5LOVA 4O6VA 5JECA 4IVPA 1QONA 1GYPA 3MYYA 2JKZA 2D7DA 3T6KA 4UU8A 1AF7A 3LUAA 3J7TA 2RFLA 4LYHA 4MS1B 2B3TA 1R5NA 2BFOA 4FFLA 2NTEA 3JQ7A 1U5BA 3TAXA 4YMTA 3U3JA 1TAHA 1RR6A 1RIFA 1UK8A 4QICA 5E0KB 2QX9A 1JSZA 1UAGA 2VAXA 2X41A 2CD7A 3I45A 4BQQA 4YUXA 1UEIA 5K99A 5KJ1A 4XM0A 2C84A 2IYTA 4FEYA 1SOMA 5ABPA 4B3JA 3ZXYA 2EJBA 3WSVA 4G0WA 1RAFA 1DEHA 1IM2A 1S2DA 2CEAA 3WQSB 4COOA 2JFOA 2P35A 2WJZB 5H70A 5BNWA 1JA1A 2A0WA 4HEJA 4X64B 4D3XA 3OEYA 3FD8A 5K3EA 3DC2A 4U7GA 1IJKA 3D8SA 3EWNA 3FPGA 4RZIA 2CLDX 5EKUA 5F77A 2AKAB 1EVYA 2QSUA 1R0ZA 5CXSA 1T0JB 1H3FA 5COAA 4I5DA 3SEZA 3VDNB 4CCWA 4BQFA 3O74A 2VH2A 3SXUA 5SV2A 3AHJA 4HAYA 5F52A 5HP4A 1QYDA 5KVVA 3EUAA 1JX6A 4DV4B 1RXVA 4UXHA 4JX9A 4OHBA 4UD2A 3TEFA 4M9SA 1XLVA 2GJKA 3HVIA 2R6GA 3NRJA 3TRJA 5J2TA 4NYMQ 2JF0A 3SZLA 1SOAA 2ZE5A 1EK0A 1XAGA 1JDZA 1XK7A 3R5FA 3AB3A 5KYTA 4LTNA 4ZVRA 3GBSA 5FUWA 2F6RA 1EFDN 5A5FA 1C1DB 1V1MA 4Q37A 3TTWA 1PGQA 3VU9B 1ULSA 2VDOB 4DHEA 1U7HA 5JW6A 4KMMA 4DLXA 4QUJA 3U1BA 2EU8A 4DSUA 1TGYA 5JSKA 4A6XA 3OA2A 4PS1A 2QZJA 2PD3A 3MW8A 2RDMA 5LKAA 3CUSA 3LPCA 1UXOA 5IRCD 4MV4A 1YQDA 2R6HA 3NHMA 3TMYA 5E4YA 4OQPA 3SJ7A 2VUUA 4X3CA 5IMBA 1ONOA 3VXKA 5C8VA 3CO5A 3RT7A 4EOGA 1EFKA 2PD4A 1UWVA 1VGVA 4FKBA 4LX0A 3HBNA 4PWYA 5GTDA 5HOEA 1N57A 3WLMA 2ZYDA 3B3QA 5DI9A 3RREA 1C3VA 2AIRA 2HU7A 2PGAA 4IQ4A 2C29D 5DBEX 2YDXA 4N6OA 4RK4A 5HOQA 3S40A 2O0JA 3EXHA 4AG3A 4L4YA 3NVKI 1U8AA 1V71A 2D5LA 1RWQA 1H2RS 1BEEA 3I39X 1T1GA 3QPUA 2ZRBA 4C88A 2FOIA 2IS4A 4CEIB 1G20A 1EGMB 1L9XA 3V32A 1Z29A 1XF9A 2C4KA 4Y6RA 1ISRA 3VX3A 1Q1QA 1YCHA 3FJ1A 1JHOA 1T10A 1PHPA 2V7QA 3SKVA 4UTOA 2QP4A 4RK0A 5C3UA 4Q6BA 5AI4A 2BFDB 3R9WA 1E6EA 1FFXA 4OHWA 3WIVA 3RGWS 5KS2A 5FPPA 1V3UA 5DK6A 5DW3A 1X74A 2HI0A 1WB9A 4LBYA 2AUNA 2H2DA 1QCZA 3QVSA 4I36A 4DCGA 3B1YA 2O0LA 1BOOA 3A2NA 1MG0A 4RQTA 1CQIA 2O07A 3UAWA 5B30A 4X44A 1G7SA 1YE3A 3B8HA 1KH2A 5P21A 4ISBA 1B8NA 3OQPA 4AIIA 3ZHSA 2BEUA 4FYHA 3AIIA 5LU9A 1ZM3A 1NVVQ 3T12A 4LI3X 3PZBA 3AEQB 2ASEA 3CR7A 1O9BA 4X91A 1KDVA 1UFVA 1VHLA 2D0DA 2Y1DA 3DZBA 4RNDB 3T0GA 3FVTA 3TX2A 1WCWA 2FMKA 3H11A 5F2NA 4Y2PA 2HUPA 4XFKA 1RCFA 1VIDA 4H0NA 3EDOA 1Z73A 2ZYAA 4TLEA 4DABA 5H3HA 2HYDA 4D3DA 2OCGA 4EMUA 4PSUA 4Y98A 2AD5A 2FHPA 2N46A 6REQA 4G01B 4TKLA 4MARA 1K6IA 2PL1A 4QTZA 1AQIA 4WK6A 4XDZA 4I55A 5I4IA 2DYKA 2H2WA 3AZOA 3H1TA 3I9KA 4M46A 1RKQA 4MR7B 2WTAA 2J85A 3AFHA 2QUHA 3GHHA 5BSWA 1IXSB 5JI2E 1EX1A 3KUCA 4LQ4A 3VBEA 3OD1A 1SCBA 4M87A 4U7JA 5C2JB 2VHUA 1Q3KA 2G17A 4J7UA 4WVLA 3COPA 3TCXB 1LS1A 2A0FA 3DD1A 3WP0A 1GGMA 4EW1A 4DIEA 1RCUA 2WUVA 1V7CA 1AQJA 4NAUA 1GTG1 2WILA 3CX3A 3UMJA 3UWPA 3CRNA 3NFRA 4AJNA 2ZYVX 1ZVMA 2Z4RA 4Q4HA 4D6PA 1V3QE 3H2BA 2PS0A 4KH0A 3FCYA 4PZEA 3CLTD 5D1HA 1ADBA 3PPYA 1JR3E 4CCAA 3CV3A 4DW8A 2HJGA 4IRXA 3VKVA 4EK9A 1ORVA 1R0CA 2YXBA 3IT1A 1R6AA 4G24A 5G0VA 4ZZ2A 4YJGB 4DIUA 4D41A 2FOLA 2DU8A 1M3SA 3G7NA 4G0OA 4PY2A 4BPRA 2IEZA 3FTQA 3ICWA 4D3ZA 1PWEA 4KAXA 5T57A 1ZXLA 3PC8C 3V7FA 4QWMA 121PA 4MUXA 4LK3A 3H3JA 1CY2A 1DAGA 3BIJA 3RLFA 4IO1A 1LC3A 2YMLA 4EY3A 4P5EA 2DFDA 2GZ2A 4XB1A 4IL5A 2FUNB 1QV9A 2FPIB 1PQWA 4GX2A 1M2NA 4DNQA 4IM7A 2QM0A 1V1RA 2KX7A 2HK6A 4UFOA 3UHPA 4WKNA 1UCFA 3SZUA 5CPFA 3WAGA 2Y68A 3FZQA 1F20A 1SB9A 4O4LB 5I7OA 1BD4A 4AJHA 1XKQA 2W4IA 3FCCA 3MJTA 2OYCA 3JRXA 1R0XA 5KUTA 2QR3A 3ZEIA 1FMLA 1YDEA 1ECFA 2C5BA 2H1CA 2J5RA 2QLJA 4PHTA 4NENB 3UM9A 4KXQA 1VCIA 1E9EA 3HA3A 4YDSA 5JSQA 3C5EA 4M37A 3W2TA 4OFWA 4LYYA 1TCUA 5E6RA 3K4PA 5H3LA 4YCDA 2EKBA 2JI4A 2W6OA 4OQLA 3B70A 4UUPA 3KYJB 2CJWA 5JXWA 3U5TA 2GJ8A 2ZJAA 3G2QA 4P22A 3V1MA 2CLHB 1BMDA 1NLZA 3L1UA 1QU2A 3RARA 4H4EA 2AJCA 1KI9A 1E2JA 5K0EA 2G40A 1HURA 2GERA 3EVGA 4K3VA 1W0CA 4UHKA 4U9HS 4A8HA 4KGVA 4ETNA 1A7UA 3ENZA 4BXOB 3H9QA 4NBKA 4JLUA 4B3SB 1XMPA 3KSBC 1W36B 4I46A 4JLJA 1O9GA 4UE6A 1JMKC 4ECAA 4RSGA 4URYR 1FDSA 3OQJA 1XXHE 3ICQB 1P5HA 4J0CA 3NTLA 1BWSA 3AKYA 1C0LA 2HMUA 1TL7C 4Q1EA 3IAM6 3GEIA 3HCCA 2TS1A 3OMLA 3W5UA 1GU1A 2W48A 4PLFA 4CIWA 1N2EA 1NMQA 5E2BA 2NUAB 2Z8YM 4XCXA 5B7QA 2NTJA 1WXEA 4NMWA 4HQNA 2Q6VA 1E6KA 4QYSA 1ZK2A 4QODA 2A57A 4ZRMA 1L7XA 2OV6A 1G8GA 2PS1A 3F6CA 2AN5A 2QJOA 1V5GA 2WSYB 3IELA 3DE6X 1Z7GA 3KOWA 3L1VA 1JVNA 5B1IA 1S1CA 1WUIS 1TO6A 1Z62A 2VHWA 1P4GA 3I1YA 4DYHA 2KLHA 1LI5A 5U4QA 5C32A 3IOYA 4IV8A 4Y2YA 2FRDA 4HTFB 1A1VA 2VSFA 2IELA 4WINA 3H2SA 3GGSA 1IHOA 4FC7A 4ZVNA 1SVOA 1GAQA 1EWQA 4IMIB 1PD0A 3FGOA 4E4TA 4KRXA 3VO9A 2BEVA 3RSQA 3UYLA 3NVDA 2GB4A 3FCUB 3B2QA 4N7RA 3COVA 1SVUA 3LUJA 4NRDA 3M4NA 2ZTLA 1NNEA 1YBMA 1AK9A 4G5FA 3DSRA 1ZZGA 5I7FA 1DFGA 3JD0A 5ESXA 3C8DA 4IIYA 4JI3B 1J1ZA 1B74A 1N0WA 3FRHA 4KPFC 4DPMA 1C8BA 3B3FA 9LDBA 1OXVA 3IDZA 1AK2A 2BBSA 3LF1A 3SZGA 3BXFA 4ACAA 2HX1A 3QYPA 4KODA 1E62A 1MA0A 4RORA 4QDOA 4GKJB 2I8AA 1JEAA 2V74B 5TQVA 2BFFB 4F45A 3TKAA 3R4CA 4Y9SA 1X0VA 4HUQA 4MW1A 1XZIA 1QVWA 4IDBA 2X3YA 5B6IA 1U5BB 2QLMA 4TRNA 1ZSNA 2OZEA 4BBPA 4ZV7A 5JMTA 2FEMA 4ZI2A 4PCUA 4GPBA 2QVXX 2J08A 2YYYA 4U9UA 3SDZA 5IX8A 1ISJA 1EHYA 1QRSA 2O7VA 3H3XA 5JEEA 3CY6A 5KAPA 2IYAA 4EVQA 3GVXA 3ZY4A 4Z1MD 1FSSA 3B6EA 4N41A 5EINA 2DXIA 4N8DA 3WIDA 2IIBA 4MHOA 5CX1A 3DW1X 3PD7A 3BL5A 2ZRQA 1USVA 3ND5A 1O95A 3CUWA 4KBGA 1N8NA 1WZIA 1ZVJA 1PT7A 2MJLA 3ET4A 4WBXC 2AFRA 4AN4A 3ZCVA 5KWIA 4R8KA 3A3KA 1SXIA 1JBKA 3C3JA 4CM5A 4WERA 3FG9A 1B3BA 4CE6A 2DLCX 4O4JA 2XE6A 4ZVPA 4ZZ0A 2BCGY 3FHTA 1HQDA 2OOKA 1S1MA 2OV3A 3FLAA 1LV7A 3VKFA 3ECSA 1T8WA 3RK1A 3TG8A 1ZYUA 3ZWPA 2FWIA 2VRWA 3LD9A 3QEKA 4G65A 5DWQA 2CCKA 1W1WA 1T0HB 2OCYC 1Z5UA 4AMBA 1JWBB 1KVTA 5IUJC 5BMVF 3AC0A 2FGKA 4LUCA 3UHFA 3WB1A 5L6LB 5DK4A 4BMNA 1C1DA 3S1SA 1IB6A 5ES3A 2DECA 4YAFA 3IAFA 4HYEA 4IQ8A 4CM3A 1DWOA 4REQA 5JAZA 3U56A 3ZVMA 2VTEA 1EG7A 4GLJA 1Z6ZA 5DBHX 2B6HA 3HYSA 3WFJA 4JOQA 1T9HA 2Q5LA 2QLFA 4JIMA 4Z9XA 1KOGA 1KEZA 4IDGA 4JVSB 3LIIA 1X7ZA 3Q15C 3BN3A 1R0WA 1XJCA 3ND7A 4R9NA 3WQBA 5IHXA 3VHXB 3WHKA 4PNEA 1OGIA 3OJ0A 5CA0F 2VS1A 2Q7OE 3SI7A 4KQGA 3TAHA 3GMTA 4NQZA 4AZTA 3ITKA 5LMUB 2Y1LA 4HB2A 4ZPJA 2ZKIA 5C18A 4HMPA 4LVCA 1IOZA 3GIDA 4PGAA 5FTJA 2WVGA 4AJJA 1N7HA 2EBWA 1GHTA 4MVJA 4H77A 3VH3A 4DRZA 1KXZA 5JT1A 4LKRA 3VR2D 4JI8B 3T1YB 2NZ8A 4UTXA 4TWZA 1JG4A 1E2KA 2YJTD 4O59O 5B7NA 1MF7A 1AHHA 3D3EA 1SCAA 1M6YA 3K9LA 1JHZA 4B2LA 4X1YB 2Z5GA 4HPXB 6GPBA 2GOYA 2KI5A 3GOHA 1GVNB 4G85A 4C87A 3DVLA 4MMXB 2PH7A 1TKBA 2WIGA 2PX6A 3PI6A 2HCBA 2XXBA 1A1SA 1RAHA 2RGRA 4UZSA 4D9FA 4B40A 1CV2A 1YRQA 3GELA 2YIDA 3B1VA 2FK8A 1LLFA 2OWDA 1U28C 4WLVA 3AESB 4PBRA 1HT3A 2DVMA 2IBMA 3K8OE 3OO1A 1EP9A 5DP1A 3TQOA 5CXQA 3TR5A 3V80A 1ULAA 3H9EO 4PCLA 5JPCA 2FHSA 3EGCA 3IA2A 4WPGA 3VTFA 3EPJA 1EA5A 1SVSA 1UBKS 1E1QD 2FQ1A 3F7OA 4PZPA 2C2GA 2AKEA 1POXA 1DJOA 4AC9A 2QY6A 2PCJA 1PX0A 1U2TA 2AKYA 3BMOB 4O8CA 2KBEA 3SHOA 1IPEA 2C9OA 1JUDA 2I67A 5GZ6A 4UVIA 4FC6A 4C7BA 4F92B 4CU2A 3KQVA 3SLKA 4G97A 2XVYA 1XU7A 3LKDA 2JAUA 3LPMA 2X22A 3BDIA 1K5PA 3ZNQA 1DBWA 4JENA 1XRPA 3OAAA 2ICAA 3B12A 4W4TA 2C3UA 3WL6A 1GT91 1K66A 1V2GA 3Q5EA 4KQ6A 1BGXT 2OKCA 4URZR 5AVKA 3MS7A 4FDAA 4YONB 5A0VA 3MEQA 4X41A 4R81A 1AK1A 2FDCA 4ND3A 1AY0A 2HF2A 2I1LA 1LX6A 3TSCA 1NWCA 5E3HA 4QA9A 4F9TA 5IKPA 5F3WB 1E1RD 1G20E 5BW5A 3MB8A 4P0TA 4F85A 3BD8A 4JI4B 4KV9A 4UNQA 3GFQA 4R2LA 2QROA 1EHCA 3ETCA 3BX1A 1I36A 3HA5A 1IVYA 1Y6ZA 4Y2SA 5IBRA 3SM3A 1W6RA 1U4NA 2HEIA 4NU6A 4HDRB 5I7UA 3C4QA 3ST7A 1NUUA 3LC1O 1ZMTA 5EYPA 3EXIB 1HGXA 2NV6A 3F5SA 3QFHA 2G8NA 4HX2A 3TLXA 4DA9A 2CHVA 2V9ZA 2JCGA 2QJFA 2BVNA 1G3RA 3RJ9A 5LJLA 4HNUA 3MK31 2FTKE 1AQYA 1SKUA 1HQCA 4LE2A 1TECE 1I3NA 4WGGA 3U4QB 4HN4B 1L7EA 2FZCA 3QA3E 4MPTA 4RVGA 5BP7A 4KLRA 4DNXA 2ILTA 2FB9A 1XXHB 1KI1A 3H4TA 1GZ4A 4B3CA 1BS1A 1LQUA 3ADBA 2PZMA 2QV7A 1E2DA 4IZIA 1FRFS 4ML3A 3WIEA 1S2LA 5T67A 2QUZA 4BRZA 1RRPA 4JHXA 1PWYE 3FUUA 3O4JA 4INZA 2H5LA 2IV7A 1YJ8A 3S2YA 4BVGA 1IN4A 1FNDA 4YACA 5PNTA 4LRQA 4CKCA 1WCIB 1GA4A 4REOA 3RH0A 4BC1A 4N03A 3IEKA 4GDFA 1JDNA 3GD5A 4YJKA 1EESA 1NNLA 5CDGA 1VJRA 5L6MB 1U7ZA 3F96A 4FN4A 4WX2B 5ENVA 2DF8A 5MFZA 1J90A 3D59A 1Z6QA 2P9TA 4AIRA 5A4MS 2XT6A 3DBRA 3DPSA 5A7HA 3AY0A 3WGYA 4L5BA 3WWYA 4DJJA 5KYUB 1C3OA 3PZRA 1TT5B 3AOEA 1BG6A 3I3SR 3P7MA 4Z54A 1I2DA 3AILA 2C58A 1AS0A 3ZLTA 3ZHUA 3D4OA 3H2KA 4UNPA 1TYCA 2WRZA 3EOAI 1UEJA 1H65A 3M34A 4PCVA 2G09A 2OLEA 3AHDA 4OU4A 4D4JA 2UXBB 3D6FA 4IDOA 3BF8A 1NXVA 3EA0A 1UKEA 2GQ0A 5HWSA 1U4SA 3DV0A 1QH0A 3CIOA 1WMBA 1XRJA 2FW7A 2WYOA 5FFFA 1UMDB 4NU5A 4KKXB 2VTBA 5EGSA 4FGWA 1NBIA 2FMHA 3K05A 3EGXA 3HJRA 1X8JA 1OGJA 4KQ9A 1RC1A 5FUYA 2ORVA 4EF6A 3B38A 4NONA 3HZHA 1J0AA 4OUKX 3W2EA 2IYRA 3E15A 5A03A 2ZXUA 3GJ3A 3UK6A 3MPOA 5JCJA 1X87A 3GARA 1PCXA 4U2EA 2JAQA 3BWEA 2NYVA 2P5YA 5TIIA 1BFUA 1GNQA 1JJBA 1Z5ZA 2CLIB 3IQHX 3RM3A 5AK6A 5B12A 3EODA 4O4JF 3W1EA 2QIOA 5IEJA 2OZLA 3CS3A 3PXUA 4RK1A 3U1VA 5M04A 1XVUA 1TLFA 3RIYA 1SHJA 3DMFA 1L8OA 1FMCA 1WUJS 3ICPA 4MAAA 4FFMA 2IE8A 2XYQA 4ZT2A 4YP5A 5BN4B 1U3WA 5KI6A 3RTGA 4W9NA 5FO1A 3QTTA 4Q4JB 2CSXA 1X1QA 2WNHA 4B4KA 3EA4A 2B0JA 3UNXA 2V3CC 3AVYA 4OQXA 1ENPA 4GSYA 5DGCA 4M0KA 4RTMA 1IJBA 2UYGA 5F5XA 1IZ8A 5CMLA 3OFKA 3Q11A 1QCYA 1N6PA 2E4VA 3BWBA 4MGIR 1SK9A 2ROQA 3PR3A 3C14C 3K1AA 2A33A 5T41A 3IGFA 4G8CA 4EI9A 3DD5A 1H4TA 1YIOA 2HDNB 1O95D 3GDWA 1F1JA 4URVR 1WTCA 4L3VA 2YY6A 3ZKWB 2MSNA 1MEEA 5BN1A 2DJIA 4Z9BA 1VKRA 5ARCA 3CZRA 5E3IA 4C4ZA 5IASA 5JJKA 4UMDA 3UAXA 4E14A 2C4WA 1E0SA 4A8JC 3HXPA 2Y1CA 1A97A 4JYMA 4RE6A 2JARA 2MYPA 5FBRB 5TQ2A 5JJLA 4GE3A 4D6YA 4ESEA 3SWWA 3DDOA 3PEFA 3AVPA 4J4BA 3ZDZB 1XZPA 2C82A 4R1SA 4AO7A 1UAYA 2OP0A 3OJFA 3DP7A 4G07A 4YI5A 3GGDA 4FFSA 4JYZA 5CYGA 4EJ2A 1ODJA 2WU4A 2EW2A 2QL5A 2CNBA 5JMPA 4I5GA 2NVUB 5D3QA 1WETA 3HADA 1E1CB 1A04A 1P61B 4MQMA 1CNMA 1XRRA 4AY2A 1TEVA 1WXGA 2GFQA 5TARA 4AYTA 5G41A 5EIFA 5BO5A 4JUFA 3W5CA 2Q5IA 2FQXA 3BPSA 2I3ZA 3TBHA 1RHMA 4DZRA 1W5FA 1J99A 1MMFB 5HF6A 1BYIA 2BHNA 3HYLA 2FWBA 2PRZA 2J48A 1X7YB 5BPFA 2UXDB 3V4OA 4D3YA 2QTGA 3QHPA 1P3DA 2WQZA 3ZR4B 4K81B 2ZVQX 1QO0A 1PT5A 3KAKA 3R8XA 2JH8A 3PYXA 5C81A 2V1XA 4RTJA 3I4CA 1LFAA 1XRQA 2NM0A 3CPSA 3EMKA 4NBTA 4PV7A 4F7WA 3QQ5A 3TZKA 3NX4A 1JYFA 1RMQA 2YRFA 5ALNA 3G0DA 2AFHB 1KIAA 2C2KA 2YWHA 4FNMA 3ZQ4A 1G63A 1TE2A 2EL9A 3DT9A 4CWAA 5CDUA 2XW6A 3ZPXA 2ALJA 3BXEA 2Z08A 2X6RA 2B6NA 3AQIA 2EG5A 1E1YA 1XRSB 2D0PB 2G1UA 2ZS8A 3EW9A 1I0IA 3R5TA 2ONYA 2FN3A 3G9UA 3T3OA 2QE7A 3DWIA 1P7CA 3HRHA 4MQ5A 5JALA 4G8DA 3O4GA 3JYHA 1SCJA 3E4DA 3BWMA 3UG6A 3DOCA 2CB0A 3AFGA 4O4HF 5EC8A 4DQVA 1Z0IA 3VBCA 3TLJA 3EUWA 1UXGA 3BD6A 4LF4B 1YCGA 2FRDC 3EPKA 4UOEA 1Z08A 1X7WA 4U6NA 5EKDA 4F6LA 3I2IA 4IQ0A 4AF6A 4B3DA 3AUUA 1GPLA 4B3FX 4I1SA 2ZRCA 3N7TA 2B9VA 3OX4A 5IKXA 4F4JA 2R1UA 2WHRA 1JR3A 3L1JA 4NPCA 3C6ZA 3MMXA 2PXXA 1M2FA 1D9ZA 4ALIA 4UDOA 1L4MA 1QFXA 4EHDA 4EB8A 3HUEA 4QGHA 4L74A 1NWHA 1HLPA 3D3NA 2ZYUX 3V48A 4CM4B 3HDVA 2CUKA 3H1GA 4I1RA 4KXVA 4U02A 5EP2A 2JLWA 4F1JA 4RBNA 3ZE7A 3W05A 1PFQA 2CD9A 4XQ9A 4GOND 3QTBA 2I6TA 2A35A 1ADFA 4M0UA 3NB0A 4EG4A 1II9A 5D5QA 4E5KA 2QUBA 2R1TB 4YIKA 3MSXA 1AKMA 4G0XA 2EFCB 2GI4A 2JIBA 3RPEA 3IILA 1NAIA 2AD1A 1Q15A 5BMVA 4P32A 4A3SA 4JB2A 4CNQA 1D5CA 3I9FA 4KQEA 5B3AA 3SGLA 1ODFA 2BFBA 2WIKA 4FCWA 2ODTX 5AHWA 4LXTA 4QVKA 1FDWA 1IHDA 1A77A 4PSDA 2AR0A 2C7QA 4YRBA 5FR2A 1V16A 2BBWA 2FPWA 1J8MF 2D7JA 3ACCA 3K2BA 4RH1A 3N86A 5FD8A 5GZ1A 5TPZD 2RKOA 4AKTA 2XTNA 5AW7A 4JT2A 4YGXB 3U7GA 3QU4A 3UW1A 4RVNA 2VDPB 3GJXC 3QVVA 1FC0A 5JCPA 4G2TA 2H3EA 2WWGA 4HBGA 3PEUA 1B43A 1G6Q1 2B5OA 4O1HA 4KMRA 2FMXA 3TQSA 3ICVA 1QP0A 5EIEA 1MO5A 4IPTA 5CJPA 4XJVA 4PRZA 1P2UA 3G8YA 2G9RA 1V26A 5HIKA 5J4KA 4I9FA 2VNSA 2LDXA 4DG8A 1NX9A 5K3OA 1DC5A 3K20A 2HDWA 1XKTA 3JS5A 3HN7A 4FS3A 4GMGA 4MWZA 1VJCA 4PPQA 5TGDA 4N47A 3TWOA 1VPWA 2HM7A 1W4AA 1O03A 2Z56A 4IDPA 5IG2A 5F9HA 3U4MA 4JV5B 2F4VB 1JFLA 2NUTA 1CR0A 3O8QA 1R1DA 5JPDA 2Y9MB 3FYTA 4CN8A 1IJEA 3L8CA 1CTQA 2PT5A 1HDIA 5DCUA 4UEWA 3WMWA 1YR7A 4FHZA 3EZNA 4W1PA 4L75A 4KG7A 1JTFA 3FPCA 1YUBA 1OLSB 3TRDA 4UVHA 4BNWA 3LVBA 1U8UA 3AHFA 3ZWBA 2J7PA 1F12A 1VHDA 5KZMB 3N8IA 4CKEA 3KV1A 2X4GA 4E12A 2SKDA 1QZZA 2AOUA 1OAOA 2DM6A 1VBKA 3M81A 4R3UC 1JSRA 3L0ZA 3U4AA 4OTZA 4IR7A 1HDOA 1I14A 4N0DA 3ASZA 1QS0A 2WYIA 4B71A 2A4KA 1MD9A 3MLBA 1QRAA 5HZHA 4IGFA 1L1FA 1Z0ZA 3P1JA 1RBQA 2ZJ2A 5GJBA 3NEPX 3OU6A 4A73A 2QD5A 4WA8A 2BGRA 4Q9AA 3A06A 1A98A 1FVOA 2ADMA 3PNLA 4NU8X 2HV8A 3Q2KA 1GPAA 2FPXA 3KLMX 4S1OA 4B44A 2JHGA 4R2KA 1YF3A 2XMZA 2XTMA 3FI0A 4JQZA 1Z38A 4XZ3A 4GLFA 4CFSA 3VX4A 3EUEA 3CKKA 4ZVQA 1RVDA 1I3OA 3L0CA 2AFIB 4J0IA 2F55A 3IRUA 2OBNA 4FD2A 5ALRA 2PSHA 2NP7A 4UXIA 5DWDA 3TNJA 4EO9A 2YCLA 4HI0E 3WLKX 2C4VA 4DOMA 3CRMA 1UM8A 3T38A 3T3PB 1C9KA 1WXFA 4HT3B 1N75A 4ZU1X 3UJDA 4BB9A 4PO1A 2V1UA 3C3EA 2OORC 1J39A 1T0BA 2UZIR 2YV2A 1KKLA 1RHKA 1CF9A 2ZWAA 3O5AA 5I9BA 2FFHA 4CDRA 4JYPA 5BR8B 2JI9A 4IEIA 4MEAA 4KWIA 3T7DA 1M2VB 2VNHA 3DZFA 4IV5A 2X6TA 4MRRA 4P4LA 5CH8A 3DEYX 4P3XA 3SIRA 3FWNA 3KSRA 1B8VA 2VPWA 5BT9A 1SXJE 4PX2A 3R20A 1EUDB 2UUPA 3NC0C 1WBDA 3WR5A 1E3LA 2O8CA 4GRAA 1GARA 3OJXA 4K86A 4NNOA 4ZDKA 3AX6A 2ZCJA 3WLPA 1LBHA 5IC6A 1BFDA 3F98A 1T6YA 3KJQA 3NW9A 1ZGCA 4O63O 5K20A 3OLYA 2GNOA 2P2ZA 4G5HA 2NIPA 4FXPA 1H1DA 5DM1A 5ALXA 1JZTA 1Z2AA 2B0CA 3OIDA 3VYRB 4EQ6A 3LXMA 4G26A 4TYMA 1HQKA 2G7MC 4OAPA 5K8CA 3NHLA 1SHLA 5E7IA 4BWGA 3U13A 4YCSA 3AEUB 3NO4A 4TXHA 1XWWA 4WD3A 3DCIA 4CG0A 3I34X 4HG2A 4KSYA 1OX4B 3RSLA 1Y6GA 5A0FA 3W77A 3ZGZA 3THOA 3G2LA 4KXFB 3DLIA 5KHAA 2BP7B 2XYHA 2OCLA 3PLNA 3TO5A 2ZJ3A 3DAOA 1VJGA 2AJBA 4XUGB 4F2HA 2V0NA 4NS4A 2VP4A 1DL5A 5FUBA 3OT1B 5EWMA 5JUWA 5J2UA 4B0OA 1M74A 2J3LA 1PV4A 3PA6A 2W58A 4NBLA 1ZQ1A 2YFYA 4HNHA 2NT4A 3OP4A 1WV1A 4ZQGA 2ZJOA 3HI6A 3O03A 3TDKA 5H68A 1VIAA 3O4HA 2R65A 3DKRA 1TCBA 2B8JA 1QHYA 1WM1A 2ZI3A 4JP1A 3EB9A 1P2BA 3GFFA 1XZGA 1BJKA 2ZS9A 2JIQA 3ZS9A 2YN0A 4MUYA 3T3GA 4MVJI 1DEKA 2AVDA 4Q3OA 2FXVA 5A9TA 3A6HA 4KPUA 3MPUA 5EE5B 3K8ZA 2PWZA 4MQEB 4CF4A 3NKVA 4DC1A 1XC7A 2QS9A 1B8OA 3BERA 3GO4A 1F6BA 1Z63A 3A8TA 4R98A 4MQBA 2IHJA 1M54A 2XQIA 2ZTMA 2WF8A 3TZEA 1Q7GA 5TVGA 3CWZA 3IP3A 5AKEA 2EJVA 1OI2A 1KY5A 1NYQA 4OSPA 4CG3A 4YUZA 2W6ZA 3D0KA 4HD8A 1VBMA 4LECA 5DHRA 3LL4A 3OHMA 4DUPA 5AQEA 3ZEAA 1NVVR 4X1IA 4ZQFA 2GVZC 4FGKA 5LYJB 1CDEA 4MVXA 1UM9A 3UIEA 4OFXA 6LDHA 4MCIA 2R11A 3O91A 4W9RA 1RD4A 2OFPA 1EDOA 2DTDA 3BXZA 1YQ9A 1QAMA 3QI7A 4OOFA 2X0NA 3KR0A 1MRNA 3O4RA 1W75A 4EKNB 2Z1MA 2IHUA 2VYVA 2XB6A 3QYFA 2WIBA 2XA1A 4JHLA 1BE1A 1LGYA 5JXGA 2FZGA 2F1JA 2I4NA 2RKWA 3DZ8A 3JYQA 3LAWA 3A1NA 5GOTA 1TPYA 2J46A 1GZ3A 1F17A 3AHGA 1R16A 4M6WB 1EGHA 2O5RA 3IEUA 2W9XA 3FKSA 4GM4A 2VA9A 4HN2A 4I5EA 3WK5A 1F0PA 1YHYA 1U3TA 3W6ZA 4CF5A 4D74A 1JB9A 1Y3FE 5JOQA 4J90A 2GYYA 1R0RE 1E2HA 2GAIA 4Y1EA 4Y9RA 3I62A 1PKXA 1MIHA 1DG3A 2ZSDA 4LJ5A 2H0QA 4NC9A 4TWAA 5DSZA 3O3NB 3PGJA 3PNBA 3GLGB 2YHUA 2D74A 3GVIA 1GCGA 3BGWA 4JEIA 1GNRA 3WLNA 5LD2C 3U0BA 5FADA 2NXWA 1I6WA 2P41A 3QW4B 4LJ9A 2HT1A 3IOEA 4XRRA 3EXHC 5DXAA 2GCOA 1IB0A 2JFWA 5ULLA 2VSNA 5L4SA 3IBSA 3R7LA 1LK5A 4N7BA 3CLTC 4FNAA 4RU1A 3OESA 2DUUA 5LZ5A 4UMEA 3WGZA 2AFHA 3UUFA 1M34A 4EW3A 3REGA 4OVKA 1CUBA 3T3IA 1VA4A 4L2IA 4L4ZA 2XF2A 4JH0A 3ZZ1A 1J8VA 3A1DA 5LOVF 5I7EA 5KOHA 2EFDB 3TIFA 4LHSA 1TF7A 1GR1A 5J1SB 2DOKA 1SC3A 2WZQA 4AXXA 3WJ1A 4MHSA 1N5KA 4FVTA 1O3YA 1P4SA 1RDFA 1AUQA 2I55A 4NFHA 2GF0A 3WRYA 2HU5A 1U8YA 2OHFA 3E2MA 3EIFA 1P1HA 4U4AA 5B36A 2VP0A 1QVRA 1FMJA 1L6IA 1VZ3A 5LA6B 5CDYA 5FTKA 2C4UA 3Q40A 1OV6A 2BJWA 1VG8A 4L8VA 4WMLA 2X0DA 3OZBA 2FFRA 5ANRB 3QLUC 4C7XA 2C92A 2GMWA 1C30B 3KHUA 2AN1A 4GH5A 1G8YA 5FBKA 4EELA 3K9WA 1SD2A 3DE4X 1CP3A 1CNFA 1XTQA 4MWCA 4HHEA 3ZWOA 1FFYA 4I3GA 1CUVA 2IP4A 3K0HA 1M0WA 4HJRA 3SNKA 2C8JA 1XNJA 2HNKA 3AETA 3BD9A 1RLIA 4PZ9A 1JDVA 3HH8A 1YGYA 2RGNA 2BHTA 4DLZA 4NZOA 5EHGA 3AERA 3T1QA 1A9PA 1T5DX 1XZCA 4WBSA 4JBNA 1NBEA 2PXAA 3I04M 3R3YA 4GR4A 5AXDA 3RIXA 4ZGWA 1JFTA 1FJHA 1OILA 1MO3A 2VUTA 4MJXA 2YVQA 1NBHA 3EWIA 2EJWA 3H9UA 4Y9UA 3WO1A 3IKTA 3AM3A 4CM6A 1YAHA 3D02A 4BV2A 4AQYB 3WMRA 1NP7A 1R6TA 2BZ1A 2C0PA 2G67A 4C0JA 5BSKA 3OZRA 3MJRA 1ULZA 3DTNA 3MMZA 2D6FA 1BX1A 4UU1A 4HATA 5IJZA 3DB2A 2ZCUA 4PFJA 4BX3A 2FPSA 5EQFA 2E3JA 4CR6A 3NDPA 4O2BA 4EHJA 3GLIE 2JIPA 1P5JA 3N70A 1WUTA 2Z6QA 1XMQB 3A26A 1J06A 3TLYA 1J2JA 1DSSG 4JP8A 4E3ZA 4DJEC 1L5HB 3C1AA 2P9GA 3O8LA 1T5TA 5FL7A 3L04A 4RMGA 5H16A 3GNQA 4ZVKA 4HEQA 5DT9A 1GTZA 2I6SA 4GQBA 1QH8B 4IFIA 5CAEA 3DAGA 4RJKA 5J4YA 4U3JB 3ZV4A 3AY6A 2ZJ5A 4KWEA 2H5IA 3QEOA 4LE0A 4RFLA 1BW9B 3D6NB 5FNZA 4FMDB 1GY8A 4ZIRB 5CTAA 3LP8A 4DV2B 3ZHZA 4ZYTA 2V3VA 5D7NA 1ZDMA 5ILOA 1LEHA 2YWCA 2XKKA 1RTKA 1P2GA 2JGDA 5F35A 4ARAA 2FG5A 5H1YA 5JATA 4TQ9A 2R97A 3FJOA 4Q9LA 3WGHA 4BY9E 2DETA 5DW0A 4FJ0A 2G25A 3DO6A 3PQEA 1WSDA 4GT1A 4OAQA 3AM5A 3OE7A 3AR7A 4W8HA 5DCWA 4ZREA 4A5OA 1KXJA 1PYDA 4ER6A 4Z2AA 1ZKMA 2JCXA 3AUFA 2CYBA 4X7PA 1KYWA 1NPYA 4IXTA 3V2HA 3P19A 4AYWA 2F1RA 4HDMB 2B1IA 3O3CA 4LVUA 4E2WA 4ZRNA 5JG7A 1GILA 3DO8A 4UPVA 4JUCA 4HMQA 3AP1A 4MUFA 2Q9UA 4B3BA 4CKEB 4MRPA 3QW2A 4W7SA 1ECLA 2NO0A 3N0XA 2CW5A 3USES 4LXIA 3CRQA 5J2TB 2Q1TA 3U19A 1F0YA 2XE4A 1BXGB 2V7WA 3U81A 1U3FA 3EWAA 3T3EA 3KLBA 5EJEA 4UASA 5BR7A 3DCYA 1N33B 3TMKA 3HQ4O 5CIYA 2PEYA 2HR1A 2RGAA 3U62A 3W79A 1PGPA 3UGJA 5K2OA 3OPYI 1JDPA 4MIOA 3VAYA 1R15A 2Q0SA 4KRGA 4O5AA 3AR5A 3OCCA 3LYHA 2PZ8A 4PZDA 4QFMA 3FF4A 4XVCA 2PUGA 1K5HA 1F4LA 1ZISA 2IOFA 3C43A 3MT9A 3FZYA 5CVVA 4ADSG 4CIYA 1CY4A 4N7MA 4ZP1A 3KVYA 2ZR7A 5B4VA 3RBZA 1OFHA 1UJMA 3V8QA 3VDXA 5AJHA 4R69A 5EQDA 2P77A 4DM4A 3DFKA 2HPVA 3ABSB 2FN7A 3FPKA 5LMZA 1L4LA 1N5MA 2Z4TA 5DTEA 3FOAA 1T26A 1ARZA 3CPEA 3T9BA 4YO8A 1U8ZA 1ZI6A 4BECA 8ATCA 1ECGA 4W6QA 4M55A 1ODLA 1WJGA 1SMKA 3KXIA 2E4UA 1M1YE 1MVLA 1R5JA 4DLAA 3OZUA 1Y4SA 1KI4A 2XCOA 2O2CA 3GJSA 1VE3A 4E5PA 3I5XA 4NEHB 5D85A 3WLFA 2X15A 5GONB 5K1ZA 3OC6A 4WK0B 5GVRA 4HVTA 3KV3O 2EHJA 2JLCA 3ZX5A 1ADGA 2ZTVA 1EVJA 3H6KA 1M2VA 4I4LA 4J7CA 5FB3A 5LBTA 5IT4A 1H05A 3A2MA 1OAAA 5JAOA 5K5EA 5CW1A 1QFJA 2COKA 3HCFA 3RD5A 1XD2A 4QYIA 1YRHA 5KNBA 2QVYX 1KMCA 2AG6A 3GZ4A 4QOJA 4XJTA 5IXSA 3FHLA 2J9YB 4JKIA 3X44A 2FQWA 3W6NA 2VWGA 4WCDA 1EWVA 1P45A 4E21A 1E66A 5KCMA 1JYSA 1MEOA 1TW2A 2Q3LA 3EQ6A 1P3Y1 3NGXA 3PV0A 4INJA 4JQCA 5TY0A 4DQXA 1FW6A 4HAIA 4QDTA 4D9JA 1T24A 5ALZA 2XGOA 1XP5A 1J2UA 2ONKA 2J9FB 2ZB4A 2GM4A 3S44A 1SXPA 2EFEB 2Y1OA 4BLOA 5KYNA 1WOMA 2XGGA 4PZAA 1J70A 3KZVA 5KHOC 2O8DA 4R54A 4QUGA 4C1NA 4FHFA 5IULC 4LVNA 3ZCRA 5U4XA 2H8GA 3OPMA 1DKQA 2IRWA 4H7JA 3TLEA 4N3GA 4C4RA 3IR5A 5DN6A 4EG3A 1Z88A 3JVUA 4OB7A 4Y30A 4OHOA 4RKYA 4H6XA 3CN9A 5DF1A 3R0JA 1PLKA 5C1PA 3DDUA 1YRBA 2ZWOA 4P33A 4F0JA 3U40A 3BK7A 3OT5A 1GSHA 5JYDA 1WEKA 3LT0A 4JFAA 1OXMA 4M83A 4MMZB 2OFWA 2E87A 1JL3A 3TRFA 3KAJA 2EL7A 3W8DA 5HK9A 1XD8A 2JBAB 1DIOB 1U2QA 3W9YA 3HSKA 1QR6A 4BVAA 4M4SA 1B93A 2QPLA 4QHYA 5KJEA 4MS4B 3T5DA 4RJ2A 2GJ4A 16PKA 3CB4A 3DMRA 5EJ5A 3VVMA 3HSYA 5LKRA 4KCGA 1QRUA 1WSWA 3AR4A 2OM6A 4A8TA 1IWPB 4G3XA 2A0KA 1RC8A 3VSEA 4X1KA 4RTKA 3OIGA 3S2SA 1SUEA 2BTQA 3K94A 1WMSA 5F78A 4BBAA 3P2KA 5AW6A 1H3NA 5LZ9A 3VC7A 2WIFA 3DVAA 3LCRA 1IUPA 1V35A 4MKHA 4MICA 3K15A 1X1DA 3ROTA 3ZDFA 5IZ4A 1XZ8A 2IZ5A 3EZYA 4NJMB 2D2FA 4XM2A 4P4UA 3SJAA 5BW6B 4FONA 1YI0A 4NFYA 5K3CA 5JAUA 1ILWA 4YQEA 4IDAA 5DDIP 1YNSA 1R50A 2EFJA 2ZK7A 1K27A 3C3BA 4Q66C 2A67A 2VQEB 4Q16A 4LJ8A 3CEAA 3VTAA 1BN7A 1XVVA 3KVVA 5M7EA 3T5PA 1PZFA 1WOYA 3HKDA 2WAAA 3WMXA 5DBGA 3N2LA 2HDHA 5DXFA 1VI2A 1KDPA 1PK8A 1BXRA 5AKXA 3L77A 3UMMA 3OM9A 1KEKA 3QWIA 3KTFA 5JFTA 5JZBA 3PL5A 1PFGA 3CZQA 4TV8A 3U3DA 1ZVVA 2QTZA 2WSSD 4IGKA 4I4CA 3G68A 3OZVA 1KTIA 5CK4A 1KTVA 3MTGA 1FLAA 2JC3A 2J9GA 3P32A 3P9IA 4KHZA 3UC5A 2IK8A 3W5BA 1L5RA 5EMLA 5CB4F 3HGQA 4BLQA 5IVDA 4H6PA 2RGUA 1YI1A 1RPJA 4MAFA 4ZCLA 1O5OA 3EAFA 2AI3A 4GU5A 5C8YA 3EG9A 1NVWQ 2IDZA 2ZAIA 1X15A 3IT3A 2BZGA 3QMVA 4LVOA 4QVGA 2H1RA 4G41A 3T5MA 2QZSA 1BWQA 2V9CA 1KS2A 1F8XA 1U4OA 2PQ6A 4EJMA 2ERXA 1N7IA 2W7TA 2GK6A 4B3TB 2GWRA 3V1TC 3RG8A 5J1TB 2E9SA 1WW8A 1NXWA 3PEEA 1HETA 4L9AA 4PHGA 1YHNA 4FYIA 4TKVB 1EGQA 4RY9A 4WACA 1JHDA 4GVXA 1Y34E 1QFSA 4YMWA 4V0NA 2I33A 2X1VA 1FQOA 3L7JA 2OESA 1SBIA 2GSWA 1MXFA 3LY5A 4URXR 3I9MA 3F5FA 2DHCA 1DCFA 2H1FA 4CUKA 3BCRA 1BTOA 1QWOA 4HRXA 3KSZO 2HA6A 4ZV4A 4JC8A 4XWOA 2Y6VA 2VOJA 2QGNA 1B2LA 3WK4A 4UEJA 3RNOA 3BG5A 3E5NA 3L05A 2NU9B 4B80A 1EU1A 3E05A 5IAOA 2PUBA 4PEVA 1T1SA 2NO6A 1EZ1A 3QRWA 1MB3A 1Z34A 5L40A 1BO6A 1B1CA 1SQ0A 7MDHA 1HA3A 2ZAYA 1Y4ZA 4B6FA 4TN5A 2CXSA 1KFCB 2QN1A 1YFZA 3FZEA 3P26A 3DYBA 3VNBA 3ZBUA 1W9HA 2JCBA 2FUEA 2RHTA 1W5SA 4AT1A 3KKZA 4PZCA 3ZCUA 3AEYA 1N2HA 4P6VF 4JR2A 4L4UA 3AETB 4H7DA 4FWIB 1GSOA 1T3TA 2PQMA 1E9RA 4HPWA 2HF7A 4P7FA 4PW0A 5G1NA 3SR3A 3IUEA 3GJ5A 2E48A 2OVFA 4BUCA 1IPFA 3HNPA 1V8OA 4CL3A 3NPMA 2ACVA 3ILXA 3M6WA 2I4OA 3PE4A 2NU7A 2EERA 3RYCA 1HNWB 1DTEA 1OTXA 2JGRA 2O4CA 1E3WB 4DV5B 4RVFA 1FA9A 1LF5A 3ETEA 4OLFA 2BAGA 3BXGA 4NFLA 1GIAA 2WTNA 4AP5A 1XTZA 5A6SB 3CLRD 3FDJA 3U7EB 3FOCA 4A2QA 5B58C 1J0EA 1V4NA 2I8LA 3D3KA 3ND9A 1XQWA 2IPXA 3MD9A 1NI4A 2Q8PA 1KYXA 1CVRA 1H6DA 1R9NA 3R3JA 4L6IA 3QKRA 5DHFA 3EPPA 2XE7A 1LY1A 2VZ0A 4K40A 1PNQA 1R4MA 2H06A 4BFYA 3CSSA 1MO2A 4QFDA 5I51A 3DBHB 2XE8A 3L8HA 2QTRA 2P9BA 3H0KA 2PYIA 1KNQA 1P2SA 4Q9JA 3S27A 2UZ1B 2CLFB 3KO8A 1TIKA 4H4CA 5IKOA 2CV1A 1BW9A 1U1DA 2X9GA 2XH8A 6NULA 5DM2A 4LRSB 1CW2B 1ZD2P 4XWGA 1CJKC 2FSUA 3O90A 3HLTA 5FBZA 3V2IA 2WTBA 4V39A 3G2OA 4YMGA 2ZYWX 1XZNA 3SF0A 2XA9A 5CITA 1Z13A 1JEQA 3D4IA 7ABPA 3QVGB 1A88A 2CNWA 2GBPA 1R74A 2VPZA 1HORA 4OXKA 1XMIA 3JW8A 5DYGA 4EA8A 3V2GA 4ES6A 1CERA 5BNFA 1TYEB 3AGQA 1ORIA 2WUEA 3H99A 3OCYA 3V55A 1PT8A 3BH0A 4Q3KA 3MTDA 5TC4A 1Q0ZA 5I47A 3GOQA 4A8JB 1CVIA 2ZR9A 5AO9A 4F60A 4ZU6X 1AS2A 3TD6A 4O4JB 5AW2A 1O87A 4FX5A 1I5OA 2BKUA 3VPXA 4HWTA 3GPIA 4QFBA 5AICA 3IXLA 2V6BA 3CF6R 1KK3A 2C4NA 1LBEA 3W1VA 1NDUA 3M1YA 3N28A 4C4XA 2VT2A 3GLGE 4O2BF 1DQRA 3JASB 4UHBA 1H9AA 2VJKA 1WF6A 4BNYA 3AONB 3B3JA 3L8FA 1N5DA 3OKFA 3W4IA 4QBKA 1N9GA 2OECA 3WQQA 4WEOA 3VKHA 3NYIA 1KSFX 4NCXA 3CU5A 1QYXA 5CVJA 4RETA 2IIVA 3E22A 1VHWA 1Z5NA 3M3HA 3OIFA 3ONWA 1K8QA 4ZCMA 1E3IA 3THXA 3INYA 1JFSA 3QE2A 5E6UA 3UG7A 2VQ6A 2ZKLA 1AUOA 3SSOA 4BNIA 1P2DA 4GUDA 3VZRA 3CVXA 1NNSA 2I54A 4X8OA 5U9CA 3TSAA 3U09A 1SBZA 4PE5B 1Y8QA 3HACA 2C97A 2QVZX 5EERA 3UGKA 1PJRA 3BH7A 2CV2A 1G2IA 2W8BB 2FCRA 3T3HA 1QIGA 2R9VA 3NHJA 3THYB 4TWBA 2XDAA 3NC4A 2IUUA 1ZJWA 1RWWA 2PKWA 1NVTA 3KPWA 2BGJA 3PCTA 5EHXA 1UH5A 5AHXA 3D0RA 4AVYA 2IDMA 1H2ZA 1C4OA 2Q5CA 1QDEA 2P65A 3ABOB 3A0RB 2GN2A 3AQ4A 3AZQA 2F8SA 2H7CA 3PIDA 3NC1C 4X94A 3L6RA 1XD2B 4QYIB 4XVUA 3IUJA 4JEHA 4XGIA 4Z86A 4ENVA 3KX2A 5EN4A