3A2MA

Crystal structure of dbja (wild type type i)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
298
Chain Sequence
EIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 113
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2mA00
4PSDA 4QDXA 4Y2JA 5CBKA 4CCYA 1X70A 1XFDA 4DTCA 4RGYA 1J1IA 1BE0A 3G0CA 3HEAA 3R3ZA 5ALNA 1GKLA 5CT9A 1MO2A 2WILA 3S2ZA 1UOPA 1H2ZA 1IUOA 3UMJA 1H23A 5FDFA 2ACEA 4BP8A 3WIBA 4B7ZA 3V1LA 1VOTA 3HJUA 5HQ3A 1AUOA 1XQYA 1GQSA 2RONA 4BP9A 3YASA 3QMWA 3BIXA 3WK7A 1ORWA 2O2HA 3FVRA 4B0OA 3WKCA 2OQIA 1LBTA 4KE6A 2B61A 1GPLA 2WJ4A 2YYSA 4UBNA 1JFRA 1JJFA 4AXBA 4QEKA 4JNCA 1TAHA 4PW0A 4CG2A 1VE6A 3DKRA 2CEKA 5A2GA 4FFVA 2WTMA 4AB1A 5FPPA 4GHWA 2HFJA 2HRQA 5ALTA 5C8VA 2Z8ZA 2XUKA 4EY4A 2WIJA 2PU7A 3ANSA 2WU3A 5E4JA 1E89A 4BCCA 4N5IX 3L1HA 4I3FA 4M0MA 4Y2QA 2O7RA 1R3DA 1H2YA 2C5FA 1YAJA 3BXPA 4QDUA 2WUEA 1E8MA 3EIOA 5K3BA 5LZ7A 1QTRA 3W2TA 1MU0A 2XI4A 1BEEA 1HPLA 2GBIA 4UFNA 2B9VA 4YASA 3D0KA 3W9BA 5ESRA 5BV7A 3HLKA 1XQXA 3STVA 3QBJA 4Y2VA 3T4UA 4BRSA 3FLEA 5HF9A 4KE7A 4EHBA 1CR6A 2GBCA 3ANTA 2HRRA 2VJCA 3QZUA 5IVIA 1UOOA 3LS2A 3BF8A 2XQGA 5JZ9A 5IVKA 1TKRA 3DJYA 5AI9A 1TRHA 2XMBA 5FRDA 4X85A 1UK9A 1YS1X 2BGNA 3NOXA 4HTAA 4BRZA 1A88A 4UUQA 3DOIA 4CIAA 5AKGA 2GZSA 2E3JA 3WWEA 2G5PA 5JADA 1CUWA 2QM0A 1VZ3A 2PVSA 2VTVA 5AKYA 1UT6A 2ORYA 5EIEA 4EY7A 3DEAA 5JARA 1R50A 5JAPA 3O4HA 4RNCA 4FLMA 2J3QA 3AIKA 4WFKA 3EF3A 2DHEA 5D3ZA 1E8NA 2WFLA 4ITVA 5AM2A 5K3FB 2P8SA 4Q82A 4AN0A 4QDZA 1XZGA 1FFDA 4RE6A 3OG9A 4MEAA 2PSHA 2HA7A 5A7HA 1XLUA 4X7BA 5JALA 5AM4A 2C0QA 4EBBA 1WB6A 4DMHA 1UKAA 4GECA 4BCBA 2AJBA 3M82A 5HF8A 2PX6A 1ZI8A 1N5MA 1KEZA 4ZREA 4F21A 3C6XA 4X91A 5EI5A 3C5VA 4AZ3A 4FBLA 4JEIA 2EEPA 3C8DA 4Y7DA 3CXUA 3WMRA 1QIEA 5A6VA 4G8DA 1VZ2A 4S0XA 2QVBA 3WWOA 4G1FA 4EY6A 4V2IA 5I9IA 2Y6VA 1WPRA 4PSUA 1LGYA 3ZWQA 3PUIA 3TEJA 2YASA 1FFCA 5DWDA 1CUUA 4EY8A 4D9JA 5IVDA 3DYIA 5CH5A 3G9ZA 4M0FA 4C88A 1ZGBA 4FLEA 4AO7A 4C4YA 4PNZA 5JZSA 5AK4A 2DHCA 1D07A 3O4IA 1WPXA 1TCAA 1LLFA 4BVLA 2CJPA 4H35A 2QJWA 1CIJA 4INZA 3FYTA 4K6GA 3X3HA 4QDTA 2QOEA 3C6BA 4L0CA 4WY5A 3JW8A 1AX9A 2ES4A 4P93A 1QTIA 2Q0XA 4IH4A 4A23A 2FJ0A 2YH2A 3AUKA 1W4LA 1P0IA 2JGMA 4H77A 3RK4A 1EB9A 3D7RA 4X6XA 1G66A 2YXPX 4HRYA 4Y2TA 4LKOA 2WJ3A 3G9UA 3BDVA 1CUEA 2XB6A 3CCBA 2RIPA 1CUFA 4OB7A 5FUMA 3IUQA 4NS4A 3CN9A 3A6ZA 2WKWA 2Y2VA 4IH9A 6YASA 1FSSA 3H1BA 4EUSA 4H7IA 1JJBA 5FXMA 3BDIA 3QPAA 1UOQA 4JUIA 3DNMA 4KE9A 3I2IA 1VA5A 1YR2A 1A8UA 1Y7IA 3D4LA 2D5LA 4QWMA 2IX9A 4FDMA 3E3AA 1DX6A 2WFLB 1TQHA 2QRUA 4DGQA 5DNVA 3WK5A 3MVEA 5AK3A 1GXSA 1TCCA 1F0NA 3WL7A 4Y2RA 2HIHA 4HS9A 1ZJ4A 3G0DA 4U2CA 1HQDA 1CUJA 5A71A 1B41A 4CFSA 1T2NA 2OAGA 3C8HA 5AO9A 4OB8A 3H2JA 3F96A 2AXEA 2XUOA 4O08A 4QLAA 1A8QA 2OCIA 4QA9A 3STXA 3ESBA 3AZQA 2GYVA 2WFZA 3WK4A 5ISMA 4UHBA 2Y6UA 3BWXA 4B81A 1XZKA 2XUPA 4I19A 3R3UA 4J7AA 4CG3A 5DJ5A 4FNMA 2O7VA 2OQVA 3HRHA 5ALLA 5IVHA 1QO7A 1BCRA 1EVEA 5AP9A 2UZ0A 4CIBA 1PFQA 4GW3A 1LZLA 3I2GA 4B9AA 1JMKC 1XRPA 1PJAA 3VXKA 5H3HA 4EZIA 1DX4A 3G0GA 5AI8A 2ZJFA 1F0PA 4UBJA 2BKLA 5CTAA 3LIIA 1USWA 3BE8A 2XUHA 4W1SA 4PF1A 3DD5A 5CH8A 4K2AA 2VEOA 4BZWA 5HFNA 3PICA 4K6HA 4U2DA 2V9ZA 4GLBA 2RHTA 2XT0A 3U0VA 1Z68A 1CVLA 2OAEA 1XZDA 3AZPA 3I1YA 4W63A 3WKAA 3GFFA 3M81A 2CB9A 4B9EA 2JEYA 4BAGA 2HA4A 4AQDA 1ZI9A 2PKYX 1HKHA 3A2MA 3Q8WA 3KDAA 2QJRA 3I28A 1B6GA 3G9XA 1YS2X 4PSCA 2XUDA 4IHAA 5ALZA 4MQMA 1P0MA 1UZAA 3F97A 3HC7A 4LYDA 2ONCA 4X71A 2HM7A 1XRNA 1QIGA 3HI4A 5LZ4A 1CRLA 3IVMA 1WOMA 1DTEA 1WB4A 5IH7A 3MGAA 1KU6A 5FLKA 5HF5A 5LLSA 2XQJA 1BCSA 1X2BA 1BRTA 4AZ0A 1MX1A 3DDUA 3TRDA 2HA5A 2VATA 4EB0A 2OLEA 1EK1A 2CUTA 2XE4A 2ZYRA 2ZSIA 4DLNA 4LXGA 2WG0A 1OXMA 5C8XA 2PBLA 1CUBA 5K5EA 3HYSA 3F67A 1CPYA 3PUHA 3WKEA 2JGEA 1YSCA 1WB5A 1FFEA 1IZ7A 1AKNA 3C5WP 3OC0A 4KRYA 3G02A 1VKHA 3R3VA 1ACLA 1VXRA 3RARA 1EVQA 4BAUA 1NU6A 3IUMA 5AKXA 5LZ8A 5BWCA 4FKBA 3DL7A 4P92A 1N8SA 3P2MA 3TJMA 5HKAA 4MXDA 3B12A 1DWPA 2G5TA 2VT7A 3WK8A 1CUAA 4FFWA 1P0QA 1XZAA 3QMMA 1XRMA 4ETWA 3DS8A 1YB7A 1XRQA 3K9BA 4BC0A 5YASA 1UKCA 5DTJA 2JGIA 3D2BA 4PO3X 1BS9A 2X8BA 5BOVA 5JD6A 5AM1A 2JIDA 1XZHA 4J0KA 4W1PA 3O9VA 2WM2A 3AILA 3LIPA 1G4HA 5IKXA 2XMCA 4FBMA 3JYHA 3FLBA 1BN7A 3ZI7A 2BJHA 3DCNA 2OCKA 4HXGA 5HK8A 1ODCA 5EHNA 4NMWA 2C0PA 1L7QA 1MNAA 1H2WA 2Z5GA 3I2FA 4H7KA 4CCWA 4BATA 4W9RA 4ZV7A 3G0BA 1F6WA 1U8EA 2IITA 1EDEA 2CBGA 3C45A 3WWCA 3C87A 3GROA 3WL6A 1R9MA 3O0DA 2HU5A 4U2EA 4UHFA 3N0TA 1ODSA 3PFBA 4BDSA 1MX9A 2FX5A 3PF8A 2Z3WA 3LLCA 3VJKA 2W22A 1LZKA 4C6HA 5ALEA 5AOAA 2BUBA 3RLIA 4Y2SA 3N2ZB 4HRXA 1XZBA 2PL5A 5CH3A 2XMQA 2GBGA 1QZ3A 1QIMA 4WJLA 1LPMA 1QOZA 4L3WA 4JYPA 4OSEA 1ZD3A 3T52A 3G7NA 1LPSA 3UUFA 1QIHA 4N8DA 4MQLA 3B3QA 4BBZA 1TCBA 3F98A 1QFSA 1C4XA 5FV4A 5LKAA 4H0CA 4FMPA 4H18A 5T4BA 5JZBA 1NU8A 3OPMA 5ALXA 4MJ3A 3CN7A 1R88A 4C87A 3STWA 4TGLA 3I6ZA 3B5EA 1FFBA 1GPNA 1I6WA 2JBWA 5AI5A 3BIWA 2OCLA 3VDXA 2DSNA 4I4CA 1YCDA 5K3AA 5AIBA 5K3FA 4N8EA 3STTA 3W04A 4E14A 3V1KA 5AI0A 1OCEA 3KWJA 3F9CA 4U2BA 2H7XA 1XZCA 5K3CA 1ZIXA 4DMFA 1K8QA 1G5FA 4ZXFA 4DM7A 4CG1A 4ROTA 5AKEA 3C6ZA 4GXNA 5K3EA 5ALHA 5AOCA 5LIPA 4UHCA 4LXHA 4Q34A 3STUA 3FOBA 1CUCA 2AJLI 3HZOA 2PSJA 2C7BA 3A70A 5CT8A 2QUAA 4K6KA 3M3DA 2GBFA 3WJ1A 1XRLA 2PSEA 2J3DA 5KREA 2WUDA 2QS9A 3V48A 4B85A 3Q0TA 3L1JA 3DQZA 3IBTA 2HL6A 3RM3A 2IIVA 2I78A 2Z3ZA 1WCYA 4F5ZA 1J07A 2HA6A 5JASA 1IZ8A 2FJPA 3GBSA 4L9AA 4YK7A 4RPCA 5AK5A 5EHXA 3IUJA 1QLWA 1DWOA 3ED1A 2WIGA 4ZGBA 2VF2A 2WIFA 2DFPA 3PE6A 4X95A 1ACJA 2XUFA 4KJXA 4B84A 3R3YA 3WLAA 5ALJA 1CQZA 4OB6A 5HFAA 1IUNA 2QUBA 4KAFA 4BYMA 4BTLA 4WFJA 4UFPA 3ESCA 3FSGA 2PSDA 5ALDA 3OTQA 3D3NA 5E2IA 3L1IA 1AC5A 4UBMA 1GQRA 4X90A 1LBSA 4QDOA 2XMSA 4HXEB 1HL7A 3W9UA 5DNUA 4HAIA 1L7RA 5ALPA 3O9MA 3FAKA 2HHAA 3AINA 3H18A 5LZ9A 2QXTA 1J06A 2XUAA 3ZPXA 3FLAA 3FYUA 5JAUA 5AM3A 5FP0A 4DYHA 1LPNA 3G8YA 2RI6A 2VJDA 4X3CA 4Q1VA 5FOQA 1KU0A 3QVMA 2JGJA 4BDTA 3W06A 4LIPD 5LP1A 1CLEA 1ZD4A 3FWHA 4XVCA 1THGA 3V1NA 3S8YA 2ZSHA 2BUCA 1EA5A 2DCMA 1W75A 1Q84A 4H7EA 4PV7A 5JD5A 1ISPA 5AKLA 1IMJA 1XZJA 1UXOA 3I2HA 2GYWA 1DT3A 1OILA 4QLOA 3IURA 2OG1A 3WYDA 1G42A 5ALGA 1Y37A 4JH0A 5AKHA 2WU4A 4UHEA 1XLWA 2WG1A 1AQLA 2LIPA 1C7IA 3H0CA 4DNOA 4KACA 1XKLA 2PUHA 5ALRA 2XQKA 4Q3LA 3E0XA 4H7HA 4OYYA 1CUZA 4GBGA 2I3DA 3ZV7A 3H04A 5ALFA 3SK0A 3PF9A 2QR5A 2NW6A 3PI6A 2RGUA 4E46A 1LPPA 3I6MA 1JJIA 4DNPA 1THTA 4GI1A 5EHZA 1QE3A 5AM5A 5CRIA 5D6OA 1ZOIA 1WM1A 3WWPA 3EQ7A 4M0EA 4AO8A 4Z49A 4X00A 2V97A 4P08A 2DR0A 5DYTA 3AJAA 4FNGA 4BC1A 4WY8A 5T4HA 1UK8A 1TIBA 1WHSA 2GZRA 3SX4A 3D5EA 2D0DA 3QITA 4JYMA 1CV2A 3BL8A 2PSFA 1ZIYA 2WIKA 4WFIA 4BVJA 3VVLA 4A5SA 2WTNA 5CT5A 2WLSA 2PPLA 3AIMA 2XUGA 3LP5A 4DIUA 4HXFB 4A16A 5LKRA 2Z8XA 1EH5A 3H2HA 3DL4A 4G9GA 2VAXA 5A62A 1MJ5A 1P0PA 4UFOA 1H22A 3WI7A 2XDWA 3KSRA 4X93A 5E4YA 2CKMA 2WUFA 2H9YA 2OCGA 2H1IA 3KWFA 2WUGA 1XQWA 1RYYA 4J0GA 3C43A 3WQHA 4AN1A 3V1MA 5AI6A 1E66A 3LCRA 2JGLA 3OM8A 4ZWNA 4LHEA 1SCKA 2XLBA 4KYVA 4B83A 1SOMA 4E11A 3QMVA 5F4ZA 1CUVA 5CT6A 4TPKA 5JAHA 5I8PA 3JWEA 3WZLA 4KE8A 4AO6A 3D2AA 3O4JA 2OPHA 5AHXA 2XUQA 2QT9A 1HBJA 3AFIA 4DNFA 5ALQA 4AMYA 4N5HX 1EDDA 2OGTA 4Q05A 4DMCA 1CFJA 2G4LA 4BAZA 2XMGA 3GUUA 1RWQA 2ACKA 3H17A 4UBLA 3A2NA 1LPOA 1QIJA 4KEAA 2K2QB 1H2XA 5DYWA 2WG2A 5SYNA 3IB3A 3A2LA 5CURA 5EIHA 2G63A 1UK6A 2HDWA 5CXXA 1CUDA 4L72A 4KAJA 4XWGA 2OGZA 1ZD5A 2Y1KA 3D59A 2HA3A 4K5QA 4J0CA 1CUHA 3H1AA 4AX4A 4KAAA 4X92A 4G4IA 4N8SA 5AJHA 1U4NA 1GKKA 3W05A 2XUIA 1C7JA 4UBIA 2VT6A 3BJMA 3HABA 4FTWA 1ODTC 3WL5A 2WSLA 1XLVA 5ALSA 2ECFA 5AOBA 1AURA 3IUNA 2AJCA 3KXPA 1Q83A 2OGSA 4GDMA 2X76A 1XZEA 1DQZA 1ZJ5A 3FYUB 1E8DA 1GGVA 2QXUA 2WQZA 1BN6A 2WIDA 4YX9A 5AIAA 5C7YA 5ALWA 3OOSA 3ESDA 2ROQA 4BE4A 4OUKX 1MT3A 1CUGA 4OD0A 5KBYA 1W1IA 5FKJA 3O4GA 1MNQA 2ZYHA 1ETHA 4BTVA 2CMFA 1VA4A 1HDEA 5DLPA 5ALUA 4EA6A 1XZMA 4UHDA 5CMLA 4C89A 1K6EA 2VJBA 5EFZA 1N1MA 2XQFA 3WWDA 2B4KA 2JGFA 4NZZA 5HQ3B 2ZYIA 5ALOA 1LPBB 2R11A 3GELA 4J0IA 3ICVA 4YPVA 3DYVA 4OU4A 3ZLVA 3QPDA 3WKBA 2HFKA 5I7UA 5E4TA 1T4MA 2B20A 1R1DA 4Y2UA 5K3DA 2C4HA 3I1IA 1J2EA 1MPXA 1R4ZA 1SCIA 4IQ4A 1AGYA 4QE3A 4UPDA 4UHHA 3WIOA 1UKBA 1MN6A 5JAOA 1YASA 2W6CX 1LNSA 1JKMA 1ZD2P 4OCZA 2C58A 5SYMA 1NX9A 1XZFA 2ZJ7A 4J3JA 2QKYA 3WKDA 4B0PA 1A7UA 3SC2A 1JI3A 1W52X 3F8SA 3VVMA 1QJ4A 4UBOA 5BWBA 2EDAA 4IH1A 4E15A 3DOHA 2XMDA 3RKSA 3ICWA 3E4DA 2RAUA 1EINA 3R0VA 1S8OA 4WCVA 5ALIA 2HU7A 4BCDA 4C4XA 5KWJA 1JU4A 2WHRA 2ZVDA 3VISA 2VQ6A 1EDBA 3FNBA 1AMNA 1U65A 2AJDA 1E3QA 5CT4A 3NWOA 1DQYA 3U1TA 3VJLA 1BEZA 4G5XA 3FCYA 3GZJA 1XKTA 4XJVA 2WJ6A 5D7BA 3QM1A 3HXKA 5AK6A 3C70A 4WDQA 2BCEA 4BB0A 3WL8A 2BUAA 5CXUA 3C6YA 2C5GA 1O6FA 2PUJA 2HU8A 4Y2PA 3I6YA 1LPAB 1EB8A 2VSQA 1ORVA 5D3KA 1AZWA 4ZV9A 1SFRA 4FHZA 5JYCA 4Y2XA 1EK2A 1ZI6A 4TVKA 3CCCA 5C81A 1QIKA 3IDAA 1X2EA 1SCQA 5JANA 1GZ7A 3H2GA 3ZLTA 4KR0A 2I03A 3K2IA 3KOOA 1Q0RA 5AH0A 1YA8A 4B6GA 1W76A 1CUIA 2DHDA 1EI9A 4FOLA 5CW2A 4MYDA 4J0DA 2EDCA 1VLQA 2WHPA 5T4EA 4U2FA 2QTBA 3ILSA 1XROA 3SWWA 4MEBA 3EQ8A 2BGRA 2ZYSA 2AJ8A 3R3WA 1K63A 4MWTA 1U2EA 5A7FA 2BAGA 4Y2YA 5FPQA 5AI4A 4G4JA 4UBKA 1MX5A 2DQYA 3BJRA 1Y7HA 1R9NA 1MAAA 4AMZA 4H7JA 1WHTA 4BVKA 1N5RA 4G8CA 3WZMA 2Y2UA 3R3XA 1K4YA 2XUJA 2RHWA 4WDRA 2O2IA 5AKZA 2CZQA 2OXEA 5J3JA 4ZRDA 1HLGA 1QONA 2HADA 1DWQA 2QMQA 4J0HA 3VKFA 4DNQA 2X5XA 5HK9A 3IA2A 1EXWA 3IULA 2WHPB 1CEXA 2XMRA 4G8BA 3AZOA 2JEZA 3NGMA 5JIBA 1XZIA 2H7YA 4Q3KA 4BE9A 1YAHA 4J0JA 4NVRA 5LZ2A 4J03A 4W1RA 2XLCA 1CUXA 4G4GA 5HF6A 1EHYA 1FJ2A 2O2GA 1QGED 3E1GA 1JMYA 5AICA 3FVTA 5ALMA 4H7DA 3AIOA 4X6YA 1BROA 4EY5A 3K6KA 1QO9A 5ALVA 5JD4A 1VE7A 4C01A 1GT6A 4F0JA 1W6RA 2WHQA 1QIFA 2HA0A 1FFAA 1QFMA 5A7GA 4BZZA 4QWWA 1TK3A 1DINA 3BF7A 4CI9A 4X6UA 3IIIA 1CUYA 1DU4A 3D2CA 1MTZA 3WYNA 4DSAA 1PV1A 3ESAA 4U2GA 3V9AA 3EQ9A 1GPKA 3NUZA 4B82A 1E5TA 3H2KA 3KD2A 5T4FA 2FUKA 4G9EA 2H7CA 2R8BA 3TGLA 3QPCA 3OURA 3ZLUA 5EGNA 1L7AA 4DSZA 5DNWA 3WK6A 5ALYA 4IO0A 4X97A 2I3ZA 4XIIA 4OPMA 5HKBA 2PU5A 3EBLA 3H19A 1Q0ZA 4Q3OA 1XRRA 5HZGA 4KRXA 4F60A 5KWIA 3PDCA 1VXOA 3DKKA 5LZ5A 3FCXA 1ZGCA 2HA2A 1YA4A 4X94A 5EIAA 2XQIA 1DT5A 2XMZA 5C8ZA 3O95A 1YB6A 1O6GA 4HZGA 3VJMA 3G9TA 3MUOA 5AM0A 4B80A 1MAHA 3GA7A 2VA9A 1F8UA 3UUEA 4OU5A 3WJ2A 2VAVA 3R40A 3I2JA 4XX1A 4QZVA 4ARAA 1SC9A 2J4CA 3HACA 3QH4A 3I2KA 5LYYA 4LXIA 3H2IA 4RE5A 3FYUC 3R41A 3PFCA 3QYJA 3M83A 5ALKA 1A8SA 1IUPA 3WK9A 2VJAA 1K5PA 4PQEA 1CUSA 7YASA 1JT2A 1XQVA 4ARBA 4GWLA 4QNNA 2BFNA 2DQZA 3WA6A 4C4ZA 4FWBA 1XZLA 4LYEA 3G0IA 4H7FA 4GEGA 3MUNA 1UFOA 1M33A 2JGKA 4FLFA 3DLTA 1UK7A 4HVTA 4ZI5A 5DTIA 2PM8A 1IVYA 2WFMA 4P9NA 4MYSA 1UWCA 2QZPA 1JU3A 2V96A 1QIDA 2GYUA 5AKKA 4DMKA 2ZJ6A 1CQWA 4MWSA 3HSSA 4OYLA 4Y9SA 3FBWA 5AKJA 3STYA 4CCYB 5JATA 3WA7A 4W1QA 5HCUA 2V98A 1VJ5A 1EX9A 1RP1A 1ZICA 1BU8A 3FSGD 5EHQA 5DYYA 5AKIA 1QIIA 2JF0A 2J4FA
chains in the Genus database with same CATH superfamily
1PYDA 3LYHA 1WD5A 3D64A 5IC6A 4F4UA 2WTUA 3I42A 4FJ2A 3UK7A 1JPJA 3DPSA 1QHHB 1XVUA 4PSDA 3AF1A 4QDXA 4ZV4A 5CBKA 4C0XA 4DUGD 1PN3A 4NARA 1OBCA 1DJPA 2ZOSA 4WINA 1HNWB 1UJ2A 3LP6A 5K20A 4RZ2A 4DTCA 1KMIY 1VSTA 4QM6A 1LKZA 4EFKA 1JLLA 5T41A 4PX9A 1BE0A 3VYWA 2IW3A 1CF4A 1JFTA 1M0SA 2V45A 3R3ZA 4RADA 2WP8J 4RL6A 5EQDA 5J5CA 1PJSA 3TLEA 2RHOA 2QTNA 1GKLA 2Y77A 3QE3A 4PPFA 4TS1A 4QFBA 3R8CA 5CT9A 3QVOA 1RAIA 4QT0A 5IWAB 4ZTZB 3MYRA 4YAWA 2MMGA 2FG6C 3GP5A 4R1OA 4P4TA 1HNZB 5COAA 8AT1A 1DKPA 3CZAA 3ESQA 2QRVA 1HT1E 4IF6A 1OJLA 1ZU5A 2D0PB 1KEUA 4UVEA 2TMYA 4C0WA 3EGCA 4PSAA 3SXJA 1MXHA 3ORSA 5G0TA 2PX3A 4C78A 4YHBA 1TD1A 1WNTA 3WIBA 3R4VA 1LDEA 1NVGA 1E60A 1SHJA 3RS4A 3WIVA 3HJUA 1TEXA 2KYRA 4IDHA 4U63A 5DX8A 5LR6A 4HN2A 4JHXA 4RA6B 4QPJC 4XJXA 1SIBE 4TROA 4YAOA 3U3MA 2VNSA 5K09A 2GTHA 4ARCA 2ZVPX 5JFOA 1P7PA 2P3LA 1PT9A 3IOYA 4EZEA 5ILQA 1GQSA 4OQ4A 3V8NA 4PPYA 3WGMA 1U6IA 3IIMA 4JJAA 1GGNA 2OO5A 1T2EA 2YTZA 2GFIA 3OQVA 2YHBA 3DVSX 4ID3A 1GILA 3LY7A 1M74A 3ZQ4A 4D3SA 5CB0A 2FWBA 3A2KA 2M2IA 3AHIA 4R8SA 1SKBA 4E30A 5K8CA 4URWR 5FIUA 3BFPA 4KQFA 4IHJF 1FUEA 4B0OA 5I45A 4L28A 3W7BA 5J23A 3OVMA 1LBTA 1KPGA 2A30A 3R0ZA 2WWIA 1ONNA 1AQ6A 1GPLA 1NQXA 2H18A 1YS9A 1QV7A 4UBNA 2NXJA 1E3DA 5EMMA 3UY4A 5COBA 4EARA 4CETA 1J00A 1XUOA 1TAHA 1TLLA 1NN5A 2CMHA 2DSTA 4XM0A 2CCJA 2DJ5A 2CEKA 2ZBPA 2C99A 4WLNA 5EIBC 4ZVOA 1N5OX 2K87A 4FFVA 5JTUA 2WTMA 1JDBC 2FE4A 5DWQA 1A8HA 5FUWA 4WNIA 4AB1A 2C96A 4C43A 1T6YA 1ZXXA 4GHWA 1BVYF 5DB4A 4A8TA 4CR8A 3LFTA 1Z34A 3OICA 1TJNA 2PXXA 2GETA 4G0NA 3ADDA 1D4ZA 2GHTA 2XWPA 1H3FA 3V32A 4BLWA 5LLTA 1QQ6A 2JLYA 4IXTA 3VPAA 4EFLA 1QTNA 2Q6LA 1NVKA 2O23A 1C7RA 2WU3A 2JK0A 2GK4A 1XD9A 4ZHQA 4WUVA 3UB4A 3FD8A 2QL9A 3DVLA 4YQZA 3TSWA 4YQEA 1XOIA 2ZYGA 3UMCA 4ER6A 1G8GA 2J30A 3ESRA 3TECE 2QSJA 4Y2QA 2LR0A 1T2DA 1VLHA 2O7RA 4A0RA 4YCMA 1JEOA 2P4EA 3GJ7A 2J3HA 3HLYA 4NYIQ 3LQQA 4U3JB 2F1IA 1R9GA 1Q12A 1LK7A 3UOGA 4GOOD 2YWHA 4HD8A 3F3MA 3NHMA 3K1AA 4K7JA 5THKA 2VTBB 5DYGA 4WESB 1YRBA 3KC2A 1KY4A 3UKJA 4BB6A 3EIOA 4DIFA 4HHEA 2R751 3RHZA 3OPYA 1G8JA 1SXGA 3UATA 1KBQA 2DMRA 3V5NA 1V25A 1DC6A 3KKOA 5EMNA 5K8TA 3FPHA 5D5PA 1V7CA 2XI4A 3PX3A 1FLNA 5D84A 2B3TA 5P21A 2C2XA 5FAXA 4IJMA 2QU7A 4ODIA 5EIFA 2DPHA 2P4SA 3GT0A 3EGWA 4MHOA 4Q4CA 2O59A 3KXDA 2LRHA 4TN1A 3FJ1A 3P4YA 4KDFA 2DTXA 1AHNA 4RH1A 4D9GA 4FI3C 4YCNA 4UFNA 1F60A 3PGXA 1OBVA 4JXKA 1GADO 1D2CA 2B21A 2OXFA 5ESRA 4RU1A 2ZWVA 3ETHA 3STVA 2FPIB 3QBJA 4R40A 3SKVA 4C3OB 3Q1LA 5T3YA 2XDQB 3JWIA 4MW2A 4D42A 5CDUA 3HKDA 3LG2A 4R9RA 4YJKA 4KE7A 4KDCA 5L6MB 2OXTA 2GBCA 2JLSA 2V7BA 5A0FA 1FF9A 2JLRA 5JWHA 3PYLA 4JL5A 5FNVA 4D8VA 1AD2A 3FAZA 3DWFA 2EARA 2AR7A 3LS2A 4EYQA 3BF8A 4R4JA 2IP4A 3PT9A 5LD2B 1GV0A 3Q15C 4UUOA 5HQJA 2EW2A 3O8QA 3RYCA 1XMOB 3EIHA 1K7CA 2DBZA 3LE8A 4PG7A 2ZZNA 1HRKA 1KS2A 4LJRA 2NXCA 3AR5A 1HMYA 4MJLA 3GG9A 1DRKA 1BS1A 2VEDA 4LTDA 2HAEA 2PKQP 5BQOA 3UWOA 4KO3S 4JC8A 3PX2A 2OWDA 3SC4A 5A3QA 3HXMA 2AH5A 1XXLA 3CNNA 4TZKA 1B6TA 3K0AA 5FRDA 2WWTA 3GZTB 3GRCA 4FWIB 1F2UA 1L7XA 1WCV1 4CF7A 4M4SA 1YS1X 3EXHC 2BGNA 3K16A 2J31A 2X8JA 1N2OA 3NOXA 3PC8A 4L6IA 4HTAA 1NPDA 3T5DA 3UJ9A 3DOIA 4BRZA 4XB6B 4HSEA 1GL6A 5AKGA 5BR7A 3SF0A 4ZJYA 2J0EA 4RFVA 3B3JA 1W5BA 2PVSA 3A11A 1E2MA 4NZNA 2VDOB 2G88A 4AY3A 4KN5A 2VJYA 3WHPA 1UT6A 2ORYA 3Q9UA 3L8MA 3R7LA 3JYQA 5FBHA 5EIEA 3T5MA 5KVAA 1NQTA 3DEAA 2C9DA 4ALIA 2R85A 3E3LA 5JARA 1KR2A 4CUZA 2W5UA 4DJDC 4E1BA 4KTTE 4OI1A 1PDVA 3IAM1 4LFCB 4WOKA 3U4QA 1ODIA 1HF3A 1Q14A 1XX6A 2PA3A 1Z88A 2YW2A 4JQYA 3BJEA 3A1WA 3UQZA 1QC5B 2PV7A 2ATIA 1QCCA 5EJ5A 4IUDS 4GNKA 2GN4A 1I13A 1RMYA 1M2EA 2GHRA 3AIKA 5BT9A 5A03A 1ZCBA 1OWNA 2VUTA 4WFKA 3EF3A 5HX7A 1S5PA 1NRXA 1T15A 3AHDA 3EVGA 1V43A 5FNVB 5JNWA 4P5EA 3QBTA 2ZSUA 4QHTA 3QKTA 4EGSA 4BLTA 5A3VA 1GQQA 1ONSA 4M2LA 1BVHA 2PXAA 2XA1A 4JQCA 3ABZA 1XU7A 3FGOA 4RW0A 2ZS7A 4B2IA 1UIMA 2GLTA 4G56A 2IOYA 5LPNA 3BZWA 2B2NA 4HMQA 5AMXA 3AU9A 1ZUHA 1CETA 4RE6A 4M1SA 2OD2A 4GRDA 3EGIA 1AZTA 4CG0A 3OG9A 5HKOA 1THZA 2NPFA 3GN1A 5M2QA 2HJSA 1U8ZA 3CRNA 1XLUA 1C0KA 3OZBA 3T7SA 1GSIA 1XHFA 5JALA 1CDDA 4C21A 1X7YB 4D5GA 3UANA 3GEIA 1FK8A 1H94A 1PS0A 3C4QA 5AM4A 4BNGA 1PR0A 2QD1A 3JX9A 4ISCA 4LJAA 3TOZA 1XCPA 2WAXA 1T8UA 1WDTA 4TXJA 3AVUA 1Z6PA 2X3UA 2V6IA 7REQA 2OYSA 3ZD8A 1BE8A 1DJMA 3E9DA 4WZAB 4CMEA 4PTLA 4IDGA 4WKOA 1UEIA 4CEJA 3A1VA 2DT8A 2PV0A 5DU2A 4JJ7A 1R8YA 4NLLA 5AW5A 2IUUA 3HRKA 4HUQB 5C3UA 3L7AA 4EMUA 4MVJE 3IMGA 3JALB 3ORHA 1FU4A 2BFOA 2P3QA 1QZXA 1YOVB 2YWRA 1DARA 3ABIA 3I0NA 1I2ZA 1E9SA 1HT0A 2XDAA 3MLEA 4UZFA 2UUOA 4GPIB 3C6XA 4G9BA 2B1RA 1B3BA 1JDPA 2NNWB 3IHLA 3C5VA 4KZPA 3ZE1B 1HLPA 4F1WA 3C8DA 1K88A 3GH1A 4ER7A 2EGGA 4HY3A 1KI6B 1Q7RA 1K98A 2CCKA 2XTMA 2B37A 3WMRA 1TZBA 1QIEA 4EG8A 1J9ZA 1JHZA 1NDUA 5A6VA 5IM4A 2F67A 3PDWA 2UU9B 1NW3A 5ICGA 2QTTA 5JISA 1NXQA 3DP7A 2VLIA 4P58A 3QSYA 3KQYA 1UJMA 4JU9A 4OQPA 4EKNB 2C00A 3O83A 4I66A 3BHMA 4DBLC 1QVVA 1X7YA 2DWQA 3K5PA 2PUVA 1KDZA 1VLJA 4N5DA 5DIZA 3BTSA 2UYYA 3O47A 9LDBA 5FAKA 2H29A 4M0UA 4EB8A 3R9WA 1JVSA 1NXOA 1QXSA 1R0WA 1WXXA 4N5LA 3LLSA 3RC1A 2W8ZA 5IYZA 1K6XA 1QKJA 4F6RB 3R24A 3B48A 2F1OA 1TZ2A 2ZRNA 1N9KA 1NBIA 4J90A 4PYNA 4X84A 4NCIA 5BW6B 4D44A 4D8WA 1KI4A 5SZHB 2A35A 3G9ZA 4C88A 1PJ3A 5L3QA 4NQZA 5CG1A 1XVAA 2IBTA 5KOHB 2ZR9A 4TRNA 4V2UA 3O2JA 4LOKA 2NUTA 3R8XA 1E7WA 2OBFA 1QGAA 3CLKA 2IZ1A 5AK4A 2PUDA 5H80A 1D07A 3BXFA 4DW8A 1YU6A 1VTKA 4QYWA 5KJ6A 1R4MA 4BO9A 5LXTA 5IG2A 4YP1A 4ZO6A 1DGQA 3E5NA 1HQCA 1TCAA 1K2VN 3SFVA 4WFQA 4BVLA 3CSDA 4IEFB 1VCMA 3NHLA 4M55A 4ZVRA 5TPZA 1CIJA 4MVJH 1Y4AE 3ZGYA 1N6IA 3A14A 1WEKA 2JDIA 2CVOA 2WPDD 1N2XA 2HSJA 3Q5EA 5DBEX 4ZMBA 1SQ0A 3COWA 1JPVA 2X9GA 3VYVA 3MTGA 3ZEAA 5JSZB 4P7BA 1UODA 1HGXA 2GXQA 5B64A 3IMFA 4R54A 1KFJB 1TM4E 4NCAA 1D04A 2W6QA 1E0DA 1YCFA 1SXIA 3DOFA 1T4GA 4KVAA 1N7JA 5AT1A 5DASA 1B8VA 4NEGA 4B3DA 2TSYB 1AX9A 1NUAA 4RK7A 4CQLA 2ES4A 1D6JA 5E6UA 2EL7A 4FE7A 4CEHB 2DG2A 1T5DX 2C4UA 1DIAA 2QLFA 2QAGC 4ZAFA 3JATB 2BSAA 4EA8A 1UQUA 3W7AA 3EULA 8ATCA 5KWSA 3AUKA 1GZUA 1SBHA 4H77A 4DANA 4EG1A 3NFRA 5HIIA 5LQJA 4ZYXA 1VKNA 3SGLA 4RMHA 5F2OA 3I0ZA 1A9TA 1BD4A 1YO6A 1EB9A 2VP5A 5BSKA 1U3FA 1I7QB 2WKRA 1T13A 2J5XA 4ZKDA 1JKXA 3LW8A 4Y2TA 1ZAYA 3BAZA 1OE0A 1ULUA 4YRJA 4CF3A 1BA3A 1FJGB 4UUMA 1J24A 3G9UA 3BDVA 1SVOA 1AV6A 4EKGA 1RYZA 2IYYA 1C7QA 3Q2KA 3AQ4A 3PJFA 3ZKWA 3UMRA 5K6TA 2WV7A 4WL0A 1YMUA 2WIAA 3H87A 4W5WA 3UV3A 4F9FA 4C2TA 1I80A 2I29A 2QVYX 1NW9B 1D4AA 4FYVA 2CEAA 1KYXA 4EHKA 3WLSA 3JASB 4U1RA 2G83A 1PL7A 2IYQA 2FW7A 4ZQEA 3RWOA 1KH2A 2SECE 1GIAA 3A36A 2B83A 2R8PA 2CV0A 5JW6A 3I32A 3T7TA 4WGFA 3CH4B 4OHWA 5EPEA 3TGPA 3T1YB 3O8OB 3LXRA 1YIDA 1U8FO 4D8YA 1NMXA 1NQWA 2JA2A 2O9JA 4E0BA 1OB5A 1Q1NA 2FFAA 3IAAA 4V0NA 5AJZA 1HYBA 5THQA 5JEDA 4IH9A 4DR3B 4EA9A 4Y0AA 1IPEA 4H7IA 1ZCFA 2IXDA 1N3YA 3AR3A 2HH9A 4PQRA 3G13A 1QF9A 1E5VA 5AUOB 5EJGA 4TV8B 4JBLA 3U16A 4FU0A 3VU9A 2C1ZA 2R68A 2RBEA 1MH1A 1Z16A 2GEBA 1P9WA 1G3QA 2RGWA 2C7PA 3EQ6A 1UOQA 2GSDA 3L7DA 5IDXA 3HU2A 1V8BA 3OX1A 5UKDA 2PLFA 3L92A 4GLFA 4V1CA 4JEUA 1CZUA 5F52A 1JHQA 2C95A 2PMCA 2XA2A 3VAYA 2DPXA 1VA5A 3PQ3A 5BUQA 3K94A 1A8UA 1Z2NX 4FFDA 1STOA 3NAZA 4ZAWA 4L27A 4GXTA 4WBNB 1O0BA 3N6XA 4HGNA 3R7NA 5JRJA 1UZMA 3P9XA 1IHOA 1XTZA 1D7AA 1E6LA 1HSZA 1VKZA 4FDMA 4Q37A 5J4KA 2ZB8A 1PT8A 3I9MA 4Z86A 2JEOA 2ZTHA 5TQ0A 1AZLA 3U4QB 1ZVJA 2IPMA 2W2TA 2DBRA 3LC0A 4F3RA 4XPZA 1V1RB 5CFZA 2O8EA 3WK5A 5HW0A 4HC4A 2P0AA 3TK1A 1QANA 1QZUA 1TCCA 4PHGA 4PQYA 2Y71A 3FNIA 5K8IA 1U1CA 4N41A 5HS4A 4ZOLF 2OAP1 3G0DA 4RLHA 1J8QA 3AKYA 5CNJA 1NM5C 2BBTA 2QY9A 4YR9A 3H5IA 4CFSA 5D5QA 5A5FA 2DUWA 2IE0A 3IEVA 1RPAA 4Z53A 3ECSA 1RWKA 4L9WA 5DX1A 5K6RA 3IE0A 5KQGA 4OB8A 3U80A 4DQKA 3FKSD 1FUIA 2WF8A 3WAGA 4GZLA 5TPWA 1XTJA 3F96A 3MLBA 4O08A 1QM5A 2OCIA 4XUGB 4U8GA 3TNFA 4DEXA 2XA9A 2Y1EA 2VPPA 3ESBA 1MP0A 1RJDA 3OTWA 2WFZA 5ABPA 1N78A 4UHBA 3ZE7A 1ZISA 3KKEA 4W6QA 4V03A 3MJHA 1DZ3A 2CXOA 2VRCA 4Z9BA 4ZZ1A 4LFAB 1Y3BE 2I6UA 4I19A 3GL9A 3OJ0A 5BR1A 5K6AC 4C07A 3DLCA 1EUYA 2G4VA 3EYWA 4CG3A 5BQ5A 5DJ5A 3G2MA 5E7MA 1U63A 4TOIA 1Y5NA 4L50A 2C9CA 2YVKA 2O7VA 1AS2A 4N7RA 2XOXA 1Q50A 1DV2A 1QC5A 4L1KA 1MFPA 3I1JA 3UH0A 2W4QA 4M1KA 4A9AA 1YQ9A 1F17A 5IVHA 1JFLA 5AW2A 1GNQA 1Z13A 3FMIA 3L1UA 3OFSA 3GPBA 3CR7A 1X1TA 2W4MA 3LY5A 2LCFA 3EIXA 3QKWA 3WB1A 5FH9A 4RV5A 4YLGA 2RGNC 4CIBA 1PFQA 4H3HB 3PEYA 4C06A 1XWWA 4NNOA 3I3OA 4RTKA 10MHA 1G5IA 1PJAA 1QHHA 2QN1A 4LYFA 1SC4A 3KTDA 4EZIA 1DX4A 2CHEA 3AV0B 5AI8A 3KNZA 4NJEA 1U2DC 3THOA 1DIGA 2ZJFA 3QLVC 1F0PA 1JQEA 2RGEA 1LA2A 2QI9C 4UBJA 4ZQCB 5FBLB 1RVDA 2JHFA 2OYRA 3KKPA 5K8LA 5WRFA 1USWA 3BE8A 2VZ0A 3PFGA 1VBKA 1K7EB 5D1HA 1TC1A 2OZEA 4PR0A 2VRBA 5G3ZA 1BYIA 4QYTA 4ZVQA 4AYWA 3VNRA 2VCHA 1JH9A 3DD5A 4G2TA 1P75A 1JBQA 2A0YA 1XTRA 2LPMA 3WBBA 1Z5OA 3T1TA 1ZYUA 3RAFC 5M04A 4K0KB 3PICA 2E55A 4CMEC 3M70A 2XTAA 4KQHA 3OJOA 2AR9A 2HV9A 2RHTA 3DZFA 4JKYA 3R9IA 3OPXA 2AE1A 1SBZA 5LUBA 1Z68A 1ZRSA 3BULA 5EWMB 5BV0A 3THWA 2I6TA 3JQ6A 5I7HA 2RGXA 1XZDA 2HSZA 3WGHA 3C1UA 1Z5NA 4W63A 4WOBA 2JJ2A 5C18A 2CVPA 2OILA 4ZVUA 4EGCB 4ES6A 1N77A 4CR7A 2CHUA 4CXMA 4GYJA 5LFAA 1N9GB 2E85A 4ESVA 4RXTA 4MKRA 4XXHA 2BH9A 4AJPA 3VBCA 1WJGA 4YA6A 1Z2EA 5FPYA 3UB3A 4EENA 3AUAA 1NG9A 3L7NA 1WXDA 4MYCA 2PKYX 3AFGA 3FNHA 4GGOA 3PEWA 3E5RA 3ADCA 2A14A 3KQUA 2ECOA 2FMUA 4LCBA 3GLGE 4H6VA 5L6LB 3A2MA 3VR4A 2AOVA 3HJGA 3QEAZ 3GGPA 3CURA 1GSOA 1SC6A 3I28A 1NSFA 4N03A 2FN9A 3DL0A 1P4RA 2CDBA 1YQGA 4BHTA 1YRHA 2H2GA 2WOJA 1CRZA 4IXDA 1C0LA 3SKYA 3DE2X 1N2CB 2XUDA 3GUHA 2EGUA 5DHQA 1UJBA 1Q7EA 1L6RA 1UZAA 3HC7A 3S40A 4YH1A 1M2OA 5JVDF 4ZOLA 1G60A 2ONCA 4LYDA 3C7CB 5DN6D 2FEPA 4B32A 2ODEA 4DLPA 4X71A 2YJ4A 3F2IA 4UNPA 2FP3A 4ECAA 2JJ2D 1SCNE 2Q4OA 3D81A 1PGNA 4FGLA 4PLYA 4Z8YA 4W9NC 3X1KA 2R1TB 5LZ4A 1YQQA 2ZBVA 5KKCA 1ODKA 4LDPA 4LHYA 4JJ6A 1KU6A 1OH5A 1C5KA 5SYAA 1MZVA 2UUPA 2BMWA 3SC3A 3UA3A 4DRZA 4P4LA 2E5WA 5DDIP 3KKQA 2ZXEA 2BMFA 3CR8A 2QW1A 5LLSA 1PVVA 3OJWA 3OZCA 1XGKA 3ITKA 1G8YA 1BCSA 3OCUA 3EF0A 1BRTA 4AZ0A 3NVKI 4EMBA 2O4CA 5BP7A 3GC6A 4MS1A 2DY0A 3NDRA 3TRDA 3UYLA 3TW8B 1ST3A 4UD6A 7ADHA 8MHTA 3UGKA 2H1WA 3HJHA 3HR4A 3OOJA 1N9GA 4FILA 4IJ5A 2WPNA 1EK1A 4Q93A 4UAGA 3S29A 5GM2A 5BV2P 4RACA 5JXWA 1E1NA 1FLVA 3OZIA 1DJNA 3KAKA 4G1MB 3FXAA 4JBGA 2ZSIA 2I3BA 2WG0A 2QVGA 3QTLA 3THWB 4KPGA 3T9DA 2GPSA 3B6KA 5BN3B 1O5TA 3TW6A 2PA0A 3BAFA 3MB5A 1UPXA 5GIPE 3BRWA 1JF8A 4H0NA 1G291 3T3MB 3D7MA 4CKBB 1MV5A 4N4AA 3NM4A 1CPYA 2Y0CA 5I7SA 4JC4A 5M7EA 2AB0A 3V3TA 2CLEB 1PUXA 5GAJA 2VQDA 2WW8A 4IM7A 3RUFA 3TM5A 2C07A 1A04A 2Y76A 3WKEA 4YRDA 1DTSA 1WB9A 3CE9A 1AKYA 1THMA 3LRPA 4KQMA 4RVDA 2NZUG 2NSLA 3L1VA 4DR5B 4EFMA 5JXHA 3C5WP 3G2QA 5L4NA 1J1UA 3C5HA 3PC4A 2ZE7A 4D6YA 4DDKA 4D4IA 3CT6A 3VRHA 3OLQA 4TYYA 2B1GA 2AOUA 2OFWA 4ZT2A 4X7RA 5G40A 5AVUA 2B69A 4HH0A 2ZSBA 3DSRA 2OCPA 4AWBA 4WIAA 5AKXA 3K0EA 3A9VA 1YDWA 1P74A 3TI7A 4LF6B 1YB2A 5FBKA 3S2SA 3IQEA 3DL7A 4IVQA 3TW0A 1E9BA 3LV8A 5BWCA 5I7VA 1L4FA 1XMIA 1X8XA 2W42A 3TJMA 5HKAA 1V9CA 2I67A 3B12A 3O7MA 1D6NA 3NP7A 3GPDG 6Q21A 2ZPUA 3OLXA 2IZ7A 5E6RB 3VX4A 5JRZA 1XZAA 4AJ4A 5LYJB 4HVAA 3EVAA 1NPYA 3LY8A 3QKSB 4BQFA 3DS8A 5BQXA 3NHPA 2QXYA 3K9BA 1I4OA 1KI9A 1WDWB 3AP1A 3GA5A 4N3BA 1FY2A 4BNZA 2OAQ1 5BV1A 1TO2E 4LRQA 4XJTA 4WNYA 3BE6A 5JVDB 1B26A 4JVOA 5HVNA 4H4DA 3RYTC 3HCNA 1ZCAA 3D2BA 1ZL2A 4BIMA 4ZAXA 2D06A 1M54A 1ZM9A 2UVPB 4MR7A 1EP1B 1V3TA 5JD6A 2JIDA 2YZNA 1C50A 3PT5A 3RD5A 4BVAA 3KQVA 4GKBA 1AKUA 4RENA 1Y80A 1JDUA 3IJPA 1EZ1A 1G64A 2C98A 3IAEA 2CFOA 4CTKA 2BDTA 3INYA 2WAAA 5FYQA 1SZPA 1O4VA 1EFKA 3DR5A 3WOHA 2PYZA 3PD0A 3ZHOA 1C9MA 4Q9AA 5CP8A 2EG9A 2MIIA 3AHGA 4IAOA 4PZ0A 4W8HA 2J9ZB 5DGXA 5FB3A 3IQHX 1BN7A 4DV1B 2DTDA 4R68A 2CNWA 2JJMA 2IPNA 4OUDA 3CVJA 1U98A 4Q16A 1N7IA 2PWPA 3RYFA 3TDKA 2FCRA 2LUOA 1H85A 2W8BA 5AW0A 5L7TA 3ZHVA 5A02A 3CA8A 1TYEB 5DSXA 2RJNA 2R97A 3L5KA 3M6LA 4K87A 4L0QA 3RRFA 4BO8A 4ESHA 5BMVA 3HCWA 3WWZA 1C3VA 3RTAA 1KO5A 1AKVA 3I01M 4LX0A 2X1MA 1UMCA 2AYYA 4QYMA 2XNCA 4DPMA 2A9JA 1YMVA 2A6PA 4CMAA 4W9MC 4JLNA 4DNXA 3AF3A 2XJ9A 4F2GA 4D3ZA 3PHCA 3KJIA 2VPIA 2J3KA 2D7JA 1U0OC 2WF7A 3HY3A 3KPUA 3CO5A 3LQ4A 4W9RA 1N32B 1P33A 5HE9A 1QX3A 3ZHXA 1E2BA 1I4LD 3DQQA 1F6WA 1QV9A 1YB1A 1R5NA 1P6XA 4K86A 2IITA 1GVHA 5MF6A 1O96A 3AEZA 2CBGA 3ER6A 4KR7A 2WNIA 4DBZA 3ZYZA 3GLFB 1E0SA 2HJWA 4RABA 3LXUX 1WCIB 1IJFA 3EEBA 4HPJB 3A32A 4CT4B 1K08A 4CM4A 4KUEA 4HZUA 3K72B 4PONA 4FQ7A 3N0TA 2P4UA 3SHOA 3AI1A 3RSGA 1UM9B 1EJBA 3BXXA 1MX9A 3HKBA 2FX5A 1G7SA 1W2HA 1YS4A 5EQJB 3ZXYA 1GR1A 2EQAA 1P1FA 1HG1A 4PC1A 3H5AA 1ISSA 5ER6A 4G5FA 3SVTA 3LLCA 2GH1A 4FX5A 5F33A 3VJKA 1OGYA 5DHFA 4D0RA 4UVDA 5T6BA 4MW5A 2L19A 3ICQB 4JYZA 1ORIA 3RLIA 4JLDA 4S2UA 1U6KA 4JP3A 1XZBA 4UQPA 2PL5A 5CH3A 2R8OA 5TE9A 4CM6A 1G3UA 2XMQA 4J7CA 4I5IA 3KB8A 1I2CA 5CB4A 3R5FA 1NXTA 1E0KA 1W47A 1Z73A 2E5FA 3QUSA 2O48X 3WDKA 3PL1A 5DNYB 1EWVA 4NBWA 4L3WA 5KQMA 1L7NA 3AHCA 2BTQA 4TQGA 1X7GA 4XX0B 3MCWA 4OHFA 1ZD3A 2QN7A 3RKRA 3ZVLA 4BQSA 2NUPA 5JWRA 4OXKA 3T52A 5L53A 3G7NA 2X7XA 3TLXA 1G6Q1 4IGKA 2P6RA 3P0IA 1C0IA 5FEMA 1KORA 3OQNA 3V4RA 2W83A 1TPZA 3B3QA 1G4UR 1VI2A 3WGTA 1J0BA 3KR9A 2BFDB 3LPLA 4GM0A 2EGHA 4FYHA 3T4PA 3EXFB 3NBYC 2GUWA 3QY0A 4BX8A 3RJ5A 4Q9DA 1QP7A 1OU4A 1QFSA 4MEJA 1FNCA 3MG9A 1KP9A 2CV2A 1VPLA 4E2XA 4Q1EA 4TTSA 4CQNA 5LKAA 4H0CA 1OI7A 4DUPA 3B1JA 2BEWB 1WZIA 4GGMX 3MPUA 2YHAA 5CPBA 2A0WA 2VCYA 5T4BA 3T61A 3N07A 3FUUA 3SIPA 4LF7B 3FTDA 1HDOA 3L0DA 3OF2A 4M49A 1CQIA 4AURA 5FL7D 3LT4A 2L2QA 5CFMA 3IMKA 4EMTA 5DNAA 1XPUA 2P30A 2RC6A 5FULA 4C87A 4LNUB 4F72A 2VR1A 3STWA 5JH7F 3EPLA 1SXJC 2QG9A 3FVWA 1X94A 3R5SA 1Z8DA 1ENZA 2GMWA 3K0CA 5EKXA 2DQ4A 4IHKA 1DADA 4TRJA 2DKNA 3ZY5A 3QG5A 2RE8A 1IM8A 2J7KA 2REQB 3FX2A 3QF4B 1I6WA 1QSGA 1QHXA 1M6VA 2TYSB 1QWOA 3QQPA 2DR3A 1CSEE 3WGYA 3EH1A 3D43A 3B9QA 3VDXA 3WQRA 4XFJA 1S9HA 1U7TA 1GZ6A 1DP4A 2NU9A 3KQTA 3MWLA 4BN0A 4RA9B 3K32A 3ZY4A 5KQLA 4E4YA 2WYIA 1J8FA 1YKGA 4UTNA 4YP0A 5F98A 2FQYA 3OJFA 1E4OA 1MG0A 1XPOA 2LDBA 4MQUA 4E14A 5AI0A 1OCEA 1VB5A 3T95A 4ZICA 3F9CA 4RULA 1VQ1A 3T12A 1M5TA 4J1NA 3LTNC 2H7XA 2V9CA 4XEUA 1KNQA 4EO7A 3A4MA 3CNEA 2OHXA 4ARUA 5K3CA 3R6LA 3HBFA 5K2MA 3K53A 1K8QA 3BWEA 4LYAA 1ORDA 4DMFA 4QU8A 2I6GA 1SQGA 1TJ3A 3GLGA 1WTCA 1L5OA 1XI2A 3HYLA 4DM7A 3IP7A 4A2CA 1UDWA 3GNSA 3UA4A 4CG1A 1PP4A 3LVRE 4I9FA 1EUDA 4II2A 1M2NA 2QLNA 3L0PA 3VKUA 4UTVA 2GLXA 3H4VA 3CRRA 3QUTA 3LDHA 4BV8A 2HT6A 2VK2A 1BVRA 5AOCA 2R65A 1D2AA 2VYFA 4KRFA 4PPNA 3R4CA 4LHWA 3HCOA 1SHLA 4KN9S 4LXHA 3QLUA 2BMAA 2UVDA 1M1NA 1HK7A 1TE2A 1CUCA 4CMIA 4Z4QA 1EWTA 4GO1A 3UN1A 2ZYVX 3TEMA 5IWCA 2O19A 2YMLA 2AJLI 3KOZA 2WZBA 2Q29A 3QFTA 4IS2A 3A1NA 4RO0A 3C3YA 3VR4H 2EZ4A 3A70A 2QBYA 2OK8A 3GRRA 2QUAA 4CR6A 1T9GR 1VJ1A 2FYTA 1SUSA 1XLTC 2BHTA 3JQFC 2C5HA 4FKMA 1QGYA 5D3QA 4UJ3A 3P9IA 1KI3A 1R00A 4OHBA 2O05A 3WFJA 1GAWA 3FA2A 2QQGA 2F2TA 4B6FA 1JJ7A 1L3CA 3A6HA 3RRZA 4I1VA 1MC4A 1CEEA 1KJ9A 3G7SA 1DAEA 3B20A 3FG9A 3H3XA 5CDGA 3A1SA 3P9QA 4RVSA 4A8HA 4BNYA 4B85A 4IIYA 4TSKA 3RVMA 1CY2A 5JJLA 1TUGA 3CNHA 3NOOA 1L5QA 3QU5A 1U5AA 1OX5A 3RM3A 2IIVA 5C4MA 2OZKA 3N0RA 2CFRA 2H59A 5KSOA 4LVCA 4QQKA 4U7JA 4WXEA 5DCYA 3E9RA 4HH1A 4A3SA 4C4RA 3O8BA 2OV4A 1ZZGA 3PC8C 4JP1A 3UJ7A 1KEPA 2YV1A 1E63A 5A4KA 2NU9B 3UWMA 4GZMA 1R12A 2M98A 3TD6A 1IZ8A 1TI7A 2FOXA 1RCFA 2GTPA 2O2YA 1PL6A 1XCMA 3AV3A 3EC7A 5F5LA 4L9AA 4BO7A 4NX2A 3TR0A 4UTPA 3Q41A 1WVGA 2OV2A 2VZ9A 5AK5A 5IJ9A 1M6YA 1VGVA 3N0XA 1ZIOA 2N42A 5C37A 4FC6A 3GJ0A 2I54A 4LGCA 3DBHB 1MD9A 4W99A 4HVLA 1RZRA 4BMCA 1T2AA 2H5IA 2P75A 3TZLA 3P2JA 3SF8A 3NVDA 1Z22A 2Q4EA 8GPBA 3PRYA 3AUXA 4QXMA 3WS7A 2XB4A 3MT8A 4PO1A 1T4CB 3VYTB 2C5BA 1JAHA 2K7ZA 3VU8A 2FSPA 2NVBA 3RC3A 4FFBB 5CW1A 2J87A 3GLHE 3S27A 2FPOA 3H42B 2EZTA 4K6CA 4O3FA 1SKYE 2W6IA 4P1ZA 1V5FA 4G41A 3ZE9A 2GN2A 1ONBA 4B3BA 5JNTA 4PGAA 1JHOA 1RYHA 4FGJA 1PKXA 1KJYA 4MAMA 4CIYA 1L4LA 4DB2A 3ICCA 4JBYA 1MQ9A 4W5JA 4X62B 1QU2A 3GF4A 3DFUA 4N47A 1GUAA 1D0IA 3C4JA 2PUAA 1K5HA 3FSGA 3QRWA 4ZYLA 1GFSA 3O3CA 4J6EA 1LC0A 3AJDA 3CX4A 1LI5A 4EG5A 1US8B 5ALDA 1N36B 2RKWA 3H7AA 4BO5A 4HO1X 4JVLA 4DYVA 4HFMA 5JHHB 3OTQA 2UDPA 3AFMA 2G9UA 4RIFA 4UBMA 3PRKE 3GRUA 3DBRB 4X90A 5D01A 5C4GB 2IXGA 3GNLA 4QDOA 2NN3C 3KLBA 1COZA 1FTGA 3HGMA 2ZWMA 1NBMD 2PZBA 4Q4HB 1HL7A 2YFHA 1DAHA 3L0SA 4OHZA 5JXGA 4ENTA 3R20A 3DNFA 1SD5A 1MB3A 1RXYA 2PFGA 1E98A 2L17A 2GM9A 2PFKA 3N7TA 4RVCA 4WZZA 2UVPA 4MR7B 1OW3B 1Y7PA 2IYEA 2A9QA 2HHAA 4K81B 2C2BA 2RK3A 2QXTA 4TV9B 1XHLA 3OQHA 2IXEA 3VAAA 3AHEA 1AJEA 2D2XA 4WQMA 1YJQA 4B74A 4RA9A 2AOXA 1F12A 4XZ3A 4HB3A 2OV3A 1HA3A 4WK0B 3UAXA 5ICSA 5IRCD 1QRAA 1AO3A 4TWAA 4GRIA 3CUWA 1OXXK 2JLQA 3KB6A 4NHOA 4X3CA 3G8DA 2YHIA 2Q3EA 3FRIA 4Q1VA 1CJSA 4MQ6A 5J1TB 3TL3A 2ZBGA 1K66A 1JSLA 3G88A 3AIIA 1W96A 5KINB 4C6RA 1KU0A 2JGJA 4KMSA 4BDTA 4Z4HA 3FF1A 3GG2A 4AS3A 4N3GA 3KQNA 3ZR4B 2IQIA 3JTEA 4WECA 2WJPA 1UBMS 5FFMA 5LQRA 3SZUA 1C8LA 1EEHA 2PL9A 1EK0A 1QWSA 2X2OA 4OJNA 1WY7A 4P4NA 3FI0A 4BFXA 1DAKA 4E7OA 2IHZA 1HZJA 4RANA 4AY2A 4MICA 1DMRA 1F4VA 2OE2A 2LZ0A 5DBFA 4EKYA 3SJCA 9MHTA 2BUCA 3DPIA 4KWEA 1TXGA 4BYGA 1A9XA 2XV1A 1DFGA 1RKXA 1NT4A 3A9RA 4EHAA 1UDCA 3GRVA 1RJWA 2KM1A 1ISPA 4QNMA 1GPDG 1JU9A 1UBOS 2A9PA 4RSRA 4FOSA 3LT1A 3U5TA 2ODNA 2ZB2A 3ML1A 3RSQA 4ETMA 1U5BB 1UXOA 3C97A 3IYLW 3CW9A 2DCUA 4ZVLA 1SG9A 2PMWB 2VQSA 4OXXA 1BHSA 2PAFA 2GYWA 4N48A 4L8YA 4A73A 4CKEA 1GA1A 1BX3A 3TKAA 4ZPXA 4PWZA 3K5WA 3HB5X 5EWLA 1FSGA 3SX2A 1U0JA 2KW5A 4MV0A 4S1OA 2Q6IA 1UBCA 3WYAA 4QLOA 4CM5A 5JDCA 1J9EA 3WYFA 2H9IA 1JEJA 4CT5A 1RPJA 1U3DA 5I7AA 3RS5A 4CCAA 1XJ0A 2CY0A 4MGEA 3ZLBA 4R1TA 2VC2B 3BIOA 3CT4A 3ZUGA 2ZWPA 1CJCA 5C80A 1NGSA 3SMQA 1NY5A 4UHEA 4D5EA 2N9UA 3BIJA 2V5UA 4EF6A 4F12A 1UC8A 5CNKA 4AD8A 4ZI2A 1M0EA 1KVSA 3VYSB 2WG1A 4CQMB 1II8A 1W34A 3WDSA 1FX0A 5HJ5A 3AF6A 5BORA 2G3YA 2JZCA 5MDHA 1V5GA 3F7NA 1EJ0A 1PGQA 3ELBA 3QBEA 4QLBA 5HIKA 4KGXA 4X54A 3MIIA 2C5AA 4X44A 4P35A 4DNOA 2O5CA 2CDNA 3F73A 4XLZA 2WB4A 1YJAA 1YQTA 2ACVA 4FR0A 1USKA 1RMQA 4M37A 1INLA 5KJFA 1KGSA 2PH5A 4CVNA 4Q3LA 3E0XA 3F8TA 3OQIA 2BP7B 3VPCA 3HN6A 3L82B 4OYYA 4BO2A 1SRRA 3F6PA 4GBGA 1T9HA 3BHIA 1N3IA 3U44B 2CNKA 5BPFA 2VPYA 3H04A 3SS8A 2YZKA 3IMEA 3KU1A 3EWNA 5B58T 3ZGLA 1RWNA 4IV0A 4ND8B 2IOFA 3CV3A 4K9QA 3QP9A 1SD2A 1U11A 1X3SA 1CG6A 1YI0A 2X0EA 4CZ2A 4ZCTA 5A5EA 1J42A 2HF2A 2C94A 3D7LA 1KDTA 3RKUA 1LPPA 4R69A 1O08A 4BJ3A 1MTOA 4POAA 4JUBA 3DHVA 4H4CA 1H0SA 3TUZC 4EHLA 5EHZA 2MYNA 2VPZA 3QELA 2XMPA 1P1JA 3TBKA 1OC4A 3GLHA 2H31A 3S2UA 1Z5ZA 1QAMA 4FINA 3Q72A 1LI7A 1YDMA 1GJRA 4LVUA 5TDHA 2XT9A 1E1MA 2PMBA 1C4KA 4OL9A 3WLPA 1YFLA 1ULHA 2UKDA 3MTDA 4IS3A 1NPTO 1FLAA 3BL6A 1FYEA 3DFZA 1HNNA 4P08A 4F04A 5DYTA 5MHTA 3AJAA 4W7HA 1X15A 5T4HA 2B36A 2G1JA 1IJEA 2V65A 2HUNA 4UW9A 3A1UA 3X2FA 4EW6A 1K5DA 1C9YA 2GSWA 1Q95A 3DMGA 3EG5A 3V2UA 2A0XA 4FNOA 5IJWA 1G0NA 1TIBA 1UWKA 2MSCB 3PPIA 4P3YA 1ECJA 2PKEA 5AJUA 2WDPA 3G0OA 1E1DA 2VSXA 4B5KA 4BBJA 1PS8A 2D0DA 1U7HA 1WSAA 4IGAA 3P9RA 1CV2A 2H2AA 2WY2D 4MW6A 4S3MA 5FWYA 1ZXBA 1XE3A 3KPJA 4YXWD 3LX4A 1E96A 5HIMA 5GVRA 4YVFA 3JD4A 1MB4A 3RBXA 3PSAA 2CNBA 2FWMX 1XL1A 3ZGNA 4CMKA 1A69A 4X1KB 4F8YA 3DMDA 5CT5A 5C53B 1U0BB 2R25B 2AN3A 2WLSA 4MS3B 1AB5A 1TAQA 2A0KA 2PPLA 2QD4A 3CUEF 4DG9A 3GVHA 2X9QA 1PD1A 4RPHA 2MT9A 3A25A 3LP5A 4DIUA 1EVYA 3ZEIA 2WM8A 4HXFB 2IUFA 1EK5A 1T3GA 4I0WB 1O95C 1ABFA 1AKQA 1GZDA 3CIFA 4AECA 9GPBA 1NDQA 2P2NA 5B7NA 1T6BY 3MCTA 2FSGA 1FNSA 1LF0A 2VDMB 4DSUA 1G7TA 2DFTA 2VAXA 5BSWA 5A62A 1MJ5A 2PT9A 2OMEA 5D3MB 1XMQB 2KLHA 3EN0A 2G0TA 1ZUNA 2RMKA 2G0AA 3KFLA 3R6GA 4IPTA 4YV2A 2XDWA 2BMEA 3MWYW 4OYHA 2XGSA 5J58A 2IHUA 4JC5A 5EZYF 3DZHA 2WUFA 5F1OA 2RAPA 4H31A 2QV0A 1P5ZB 1RQGA 2ZP1A 4XYEA 1AN0A 1FQWA 2HCRA 2APJA 2VHEA 3DM9B 4MVJF 4ETIA 5MN5A 4ICIA 4ECEA 3BRQA 1QH1A 5LP6C 3B7GA 4D97A 4OHYA 2JAUA 1VL6A 2AOWA 3ZV3A 2CV1A 1TO1E 1XQWA 5LBIA 3LKDA 3RVQA 2DE0X 1RYYA 1Z35A 5F4BA 2GD0A 1CBUA 5JI3E 4PZDA 2COEA 3PXUA 4XOIA 2I4NA 3DVAA 1AE1A 2QAJA 4Q12A 1FRVA 1PHPA 1B2RA 1HDCA 3ZZ0A 5AI6A 2O1EA 3JVVA 4HATA 1P2BA 3FOFC 3AL0C 3Q8XB 1EQUA 2YWFA 3OM8A 5JSHA 4LHEA 4KQ2A 4ND4A 2R6AA 4YJFB 1RXUA 1EESA 4IOMA 1JL3A 1ZN9A 2Z6VA 3BL5A 5F4ZA 3WFZA 4ZDIA 5GZ1A 2D0IA 4TPKA 2OZLA 3WZ2A 1CY7A 1DX9A 1IDN1 1T5IA 3R5JA 4CIXA 2JFNA 3LOPA 1OZGA 2VDWA 3R5TA 4KXLA 4PY2A 1GWNA 3E9MA 4PANA 2PWYA 3KPWA 4U7TB 5E6SB 3DMFA 5KNCD 4HGPA 4QOSA 2JFYA 2BDUA 1G5HA 1TAGA 5T6MA 4AJIA 2QTLA 1PTKA 4TS9A 4TTAA 2X4LA 4ZCSA 4TWIA 4AVYA 5FQNA 3MT7A 4M60A 5AHXA 2JFZA 2VIIA 4ZI7F 2E82A 2QT9A 4XD7A 3I8OA 2IPLA 1C7FA 2EWMA 2PZAA 3E0QA 3I30X 3A1TA 4IKOA 4X1YB 4YONB 1KBZA 5ALQA 1XD2A 1GLGA 4RZ3A 2RHDA 4TQAA 4QBTA 3WQQA 4PGMA 1YJBA 1X8JA 4MB6A 4RKFA 2X6RA 4A0HA 2OGTA 3A58B 2A59A 4C5CA 4DMCA 4S24A 1TW3A 3F7MA 3O1JC 4CL0A 3F4LA 3WYGA 4KNWA 4U9UA 4QAQA 1ZOSA 2JFWA 1RWQA 3GUUA 4MKFA 5DHTA 1G19A 1YFKA 3AFHA 3AY3A 2NQ2C 1XTBA 1XNHA 1LPOA 1W29A 1ZRNA 3LECA 1E4EA 2HJGA 2V6JA 3SEQA 2ZCVA 2J0QA 1H2XA 3ET5A 1D0SA 2VK4A 1P1IA 1LV7A 2PSSA 4MPJA 4CKYA 4J16A 3A2LA 5CURA 1H66A 1COWA 2X77A 3OOYA 2B2CA 2C3MA 2IGBA 4KAJA 2OUKA 2LCIA 3WYCA 4WADA 1VGQA 1KJZA 1U9YA 1EYZA 1S8FA 1QGZA 1ZMRA 1RR6A 3B52X 3BMXA 3AP3A 3FHOA 2YIDA 2PZMA 3LQ2A 5IKEA 4DIDA 2JI9A 5BQFA 4DLTA 3TG8A 3H5NA 2ZUFA 2NQ8A 2FP4A 2NO6A 2P6UA 1IPFA 3HE3A 3U4DA 5FPTA 1IBMB 1VL2A 3K9QO 5EXXA 1GUDA 1MZPA 1NOJA 1YI8A 4Z0HO 2I4IA 3H1AA 3RTCA 4V0QA 4L0MA 4AX4A 5AJVB 1UQRA 2JATA 3DBLB 4L02A 1G9SA 3I83A 4LZNA 3PQ8A 1LQUA 4I8IA 1RYEA 4PIVA 4XH9B 5AJHA 5TEWA 2IVZA 1GKKA 4GX5A 1LX6A 4IILA 1JIQA 1B16A 2XUIA 1C7JA 3MEQA 5FTKA 1IHPA 1MDFA 1EIZA 3AM4A 1OA0A 1YHYA 1JR3D 2YMMA 4LBZA 5LDGA 4DA6A 1RBMA 2IX3A 3BJMA 3QPBA 2IU6A 1BAPA 3RLFA 4C0QC 3ZHBA 1XG5A 4KXFB 3BTVA 1CXZA 1JHUA 1NLZA 2G17A 3OF3A 2WSLA 4XA8A 4B31A 5KSPA 3TZ6A 5IARA 1XSEA 4BUJA 4ZK6A 3CE6A 3KEOA 2MMCA 2CVHA 2HY7A 2P4HX 1CIPA 2VJNA 3IUNA 5AOBA 4TXMA 1GUFA 4MW0A 1NXPA 2OGSA 3E9QA 5LDDC 1NAHA 2W37A 2Q07A 2WYHA 1PQPA 1T6ZA 3AI7A 4GI7A 2Z57A 4H3KB 4LQCA 5DRYA 4ZVNA 3NC4A 5H83A 1MVLA 5IZCC 3OZFA 4C2UA 3MJTA 3P2EA 1E8DA 2DXIA 3OEED 1SVMA 1QCDA 4LQ4A 1W4CA 1KYYA 5GP1A 5A6SB 2QXUA 2WQZA 1BN6A 2CVQA 2GLUA 2WIDA 2Z95A 1Z2DA 3KR1A 3LCJA 3WI7A 2F64A 3K2QA 4NZYA 1ZP6A 1K3UB 1ICIA 1X8LA 2AVNA 4MQ4A 1Z8NA 4C5BA 4CF4A 3O9ZA 1R0ZA 2VL7A 4LZWA 2FJUA 3KFXA 4A0SA 2JGDB 1F8XA 1PJRA 4Z0TA 5DHPA 5J5VA 3W3AH 4BVGA 3WAJA 4GS5A 5ENZA 2VPWA 5FX2A 1UM8A 2B8JA 4IOLA 1NDHA 3OWOA 4CNBA 1A77A 4WCFB 1WV1A 1Y82A 4OP3A 5FKJA 4RJJA 4YRSA 2ZYHA 3NGXA 5DWVA 5JSQA 5LJLA 1T5HX 5FD8A 3BGOS 4L8GA 4EJMA 4DLBA 3LT5A 4CDNA 4O63O 1ZGAA 3II6X 4YUXA 2OV1A 1NF8A 3L4KA 4YI3A 3T41A 1LSUA 1ZJJA 4QOIA 1LW6E 4IFEA 5IMBA 1DV1A 1EGQA 3AT1A 3IKVA 4EG4A 3F6EX 5T57A 1XZMA 4UHDA 4WZAE 4RM2A 4YT2A 4L07A 3ZVRA 5ANRB 3T3OA 1X1DA 1AH2A 1W88B 3MS7A 2JCVA 2VJBA 5EFZA 1N1MA 3WWDA 4EABA 4HK4A 4NV0A 1UMDB 4FEGA 2JL1A 2B30A 1R6BX 1RRMA 1QG0A 1X7ZA 3EGDA 2H8KA 3HP7A 4JODA 2XIQA 3X2SA 5HQ3B 2I91A 1GNRA 3K05A 1C7EA 1ZKDA 4MV3A 3SQMA 2NTYC 2QQEA 1ZQ9A 3PQ2A 4MIYA 4OKIA 3ICVA 4OQEA 4YPVA 3HADA 3PQDA 4OU4A 3ZLVA 2PO5A 3QPDA 3PQ4A 5CVVA 5KTPA 3PEFA 3GLIA 4JKIA 3WKBA 1JG6A 3FYDA 4JJFA 5ERXA 3UXYA 2GNOA 3UUWA 2GHQA 2ZDHA 3F7TA 3V2GA 4KU4A 3H9GA 3SKXA 2F4VB 2Q3HA 5ADVA 2E4YA 5EXPA 1ECBA 2O2EA 3OTOB 3TYXA 3FPBA 3SXPA 2C4HA 4BX3A 2RI1A 1JHYA 2POCA 1YH3A 3M7IA 3GUVA 5JNRA 4A0FA 2X8LA 3RG8A 2ZIGA 1SCIA 4LJ9A 2QGNA 1AGYA 3OOHA 4UPDA 4UHHA 2PTHA 3WIOA 2P1DA 3KJZA 2ZI3A 4QC2A 5PNTA 2QLMA 1RWOA 4ILEA 1MN6A 1C4WA 1BE6A 1L9KA 3VH3A 2GCGA 4UCFA 3H5RA 4EKDA 3PPWA 3VI4B 1H9AA 5FOSA 3H4TA 1N2JA 1SXQA 3GRKA 5CHYA 1E1CB 2JFBA 4OCZA 4HDRA 1DELA 1U31A 3KYCB 1O54A 1HDZA 3BQ9A 2ZJ7A 1HLFA 2O5RA 1T1SA 2G7ZA 3NEJA 3O92A 1T2VA 4TVBA 1U0TA 3UKDA 4D9CA 1C1DB 2JCXA 2QKYA 4KHZA 4Q7KA 4E3WA 1B73A 4NY1A 5CX1B 2F3RA 1Y1TA 1XPJA 3QKIA 3WRWA 3GLTA 2TMGA 3SC2A 1JI3A 1TYZA 3P9ZA 4C7OA 5CFQA 1C9KA 2P11A 4QQ8A 4J9UE 4H1UA 4UBOA 5G53C 4DWVA 2FXVA 3ERCA 4B8ZA 4CKCB 4E15A 1TVKA 3DOHA 1MLDA 3RKSA 1NQVA 2PQ6A 1Z4IA 3J7AC 2BEVB 4AG5A 1XEAA 3FVQA 3B9PA 3SHQA 4YJDA 1NMQA 2C04A 2VAWA 3HFJA 3UK6A 4LE2A 1T36A 3UMFA 3QV2A 2VHWA 3S2FA 3O74A 3JWHA 3UOAB 2PZEA 3E4DA 3EH2A 3PVSA 3QJYA 3W2EA 2GAAA 1YR8A 2VHQA 3ACBA 2Z56A 2RAUA 4FDUA 4XLLA 4AK9A 4D1YA 2WC1A 3HP1A 4KQKA 2HLDA 2AWNA 1LTHR 2B35A 3IBGA 4ZQHA 4WCVA 5ENDA 1VPDA 3N53A 3KUDA 4BCDA 3LLUA 2YQ5A 4QUKA 3EG9B 1LEHA 2Q0QA 1T2FA 3MCUA 2HMAA 3VISA 3OZWA 4H4EA 1GQYA 1AUQA 4QDKA 2J9FA 2VQ6A 3BD6A 2FEOA 3O6VA 1AMNA 1K0FA 2I0FA 2C20A 4O4HF 4RZHA 4PBTA 3IFSA 1ZBQA 3NWOA 3WB0A 3LBAA 3P32A 4C0JA 4QUHA 4LV6A 1JJAA 1GP2A 2VHUA 2AFVA 1ZSNA 1YZFA 2AFIB 3K31A 1EUCA 1OLXA 1RTTA 2C2ZA 1L4YA 4XJVA 5D7BA 3PSHA 2DH5A 1V47A 1DRVA 2Y4NA 3CLSC 4TUYA 1I5EA 4YJGB 1YRWA 2Q0SA 3EA4A 4MLZA 3UT6A 1I4WA 3VOTA 5CA0F 4DA4A 5B7PA 1KQGA 1Y8AA 3TB4A 1D8TA 3C70A 4IG9A 1I51A 1NYQA 2Z2JA 4IZIA 2K6GA 2BUAA 2OCXA 3MAAC 3LBNA 3VX3A 2QX7A 3C6YA 3VH2A 2XRYA 3BFJA 4HKTA 1A3CA 1FOEB 1LFDB 1Y4ZA 1VIAA 4J6FA 2PYDA 4BGUA 1OXKB 1MC8A 1PFGA 3IHKA 1ILEA 2VSQA 1TGYA 1ORVA 1QFZA 2OLJA 4LG1A 1T1RA 5D3KA 5EEHA 1E1RD 4ZV9A 1U3GA 5I7RA 2BFPA 2ZROA 3KQMA 4BV2A 3SHFA 5JYCA 1KNXA 1IY9A 3MRVA 3RF6A 5JYBA 4LQDA 1ZI6A 4H7PA 5DXFA 2DAPA 2GRUA 2BKEA 1P19A 1SWVA 1NJFA 1DEKA 1VI5A 1AXEA 4TLBA 1JQLB 2RKBA 4UUNA 5FOXA 5J5AA 5AVYA 1UH5A 2GZMA 3V4PB 3LBIA 1J6UA 5BWLA 2IYNA 4EDHA 5GWXA 5JANA 3INGA 3BIFA 2D3WA 2VUUA 5K3OA 3P2IA 4IZOA 3TE7A 1LVHA 4KR0A 2VNKA 1S01A 2W43A 2A86A 3KEGA 1KVUA 2O8NA 1QFXA 2VK8A 2OPBA 3NJ8A 3KZOA 4LZOA 1ECFA 3I04M 3NHJA 4FCCA 3BZBA 4JB0A 2G9QA 5K0FA 1LCIA 3EDRA 1AS0A 1CUIA 4QGFA 1OFUX 4ZQBA 5L3ZA 5A3SA 1NJGA 1S2LA 1TA4A 1W4ZA 3H4MA 3A6LA 4R8VA 4RWEA 1Z4LA 1NRIA 2IZ6A 3E23A 1B7GO 3VR2A 1XVLA 2XUZA 4LJ5A 4RD1A 1VLQA 3NDBB 5DBIA 4U2FA 2QTBA 2DBYA 5B6JA 3VR3D 1BXKA 5DFAA 2IYZA 3TIIA 2DFVA 3GEPA 3MOIA 4A0GA 1GNTA 2E18A 3ZXIA 1QZZA 3I4CA 2BEWA 3P9YA 3HXQA 4DVGA 4QBHA 3OZVA 2Q3BA 3ZBPA 4Q4AA 3T1HB 2JNWA 1PK8A 3OETA 1U2EA 3VDNB 4IZ6A 4DBLE 1SBTA 1JLMA 4XD7D 4BNDA 3OCVA 4JASB 4HG2A 1ISMA 1U0GA 2WKPA 3PS9A 4LWPA 2AI3A 4JN6B 4Q3BA 5F9MA 1TJPB 2HMVA 1GV1A 2LGJA 4OHRA 4BO3A 3BA6A 5LXTB 2WTEA 1O5OA 1Q1EA 3PXBA 5C8YA 5TVKA 1AHPA 4WVLA 3JQBC 3NHBA 3P4XA 5JNLA 5L9AA 4QASA 5JQGB 3K09A 3GPLA 1E79D 1SUAA 2IK8A 2PG3A 1GARA 2XOKA 3DCIA 2GAFA 3T5BA 2IYWA 3KR0A 3OIYA 1L5FA 3B6MA 4G8CA 4M1TA 5TQJA 3CUUA 3WC4A 2Y2UA 1DBPA 4C4OA 4C4PA 1WABA 4BVHA 4BLPA 1D4OA 1Y3IA 3FI9A 1AUPA 1OGIA 1H1LA 5T5QA 2FNAA 2WWVD 1WP9A 4M9XA 1GAJA 3IE2A 2XUJA 3BMQB 3CEPB 1JEQA 4G86A 5A4MS 5KOIA 3VR1A 3PDJA 3WR5A 1P9RA 2H57A 1HFKA 3PE4A 4IIFA 4EZBA 4F3TA 4PIPA 3HFRA 4PZPA 1GR0A 1WIWA 2QRPA 2HEGA 1C9NA 2HPZA 2WD8A 3DMTA 4MVJP 2CZQA 3EXHA 3CWZA 5CJPA 5EP2A 4KQ1A 3KTFA 3THXA 4X24A 2QE7D 3HKDB 5EZQA 2R7MA 1GL3A 3AUJB 1V9SA 4G97A 5DV9A 2CYCA 4PYLA 2MSWA 3UJ8A 1Z6YA 2Q2QA 2IKSA 1MG5A 2WSMA 1OLSB 2EBUA 2PD4A 3L7BA 4ALNA 2X5XA 4TTVA 4GKAA 2HN9A 2RBKA 1BSVA 2I2DA 5DW3A 3TDMA 2B7CA 3DMRA 3AXSA 1NBAA 2K2WA 3IULA 1HEUA 1JIXA 1YZHA 3U3OA 4Z0PA 4HDMB 3WLIA 2WHPB 1CEXA 3DONA 4BBAA 4C08A 2CW5A 3TLCA 4P81A 4WH0A 5CGZA 4B3IA 4D8UA 4L9RA 1GGKA 3FUWA 1V1JA 5JIBA 1PQYA 4GOMD 4ZHQF 1L0BA 2BCGY 4IV5A 1AO0A 1H2FA 1PDOA 5E1DA 1H0RA 2C83A 2O2ZA 3EWAA 1XNQB 3TVTA 4JSYA 1KR5A 1EDZA 1RM0A 5ADUS 2WQ6A 3HGTA 3P20A 3B9RA 2VZLA 3O0TA 4URXR 2E4VA 2QE7A 5JHGB 3ROKA 1CUXA 3OFVA 4G4GA 5HBGA 1KFKB 1LDBA 5LCXA 3ZCPA 3NMUF 4RDCA 4KXQA 1XCOA 1VFNA 4AZWA 1P29A 3VA7A 1F8GA 2P2ZA 2GEVA 4RVUA 3C1AA 2A33A 2BZ0A 2SHKA 3X2EA 1RCTE 1YQXA 3EGVA 4P33A 1NKVA 3IVRA 3HL4A 4OQNA 4O4IB 4X6YA 1BROA 1FXSA 1CQJA 4HSGA 1Z47A 3FCEA 3OOEA 2JD2A 4NDAA 1UUFA 2VP0A 4D4GA 4EY5A 3K0FA 3H1GA 1X86B 3BUSA 4BU1A 5ALVA 4Y8VA 5P8WA 3MRTA 1KZ7B 4G0MA 4C01A 5BY2A 4HN9A 3ZIUA 2XBMA 4IX9A 4TWJA 1GZ3A 4LI3X 4Y1GA 2VFAA 4KSYA 1I9CA 3SR0A 1NI3A 4XYLA 1HQKA 1QFMA 2HA0A 2NAFA 3QIAA 4NL4H 4PRYA 4G4SO 2W6ID 4UUAA 3ZHSA 4BZZA 1BX1A 2A5GA 1CU1A 2BGKA 4QWWA 2C4KA 1R18A 4M8LA 2HRZA 2P65A 1CT9A 4X7PA 3D7KA 2QT0A 4O29A 1X74A 3I92A 6REQA 3D2CA 5H7XA 4IMRA 5F3RA 5JC8A 2JFXA 1CP3A 2MR6A 1U3WA 2Y1WA 3HL0A 2WINI 3LUDA 1PV1A 3ESAA 3N87A 4U9HS 4WOCA 1KKUA 1LLCA 2O3TA 2VP4A 3DDHA 1EWRA 4BB9A 1JLRA 1F38A 1SBYA 2WF6A 2R7KA 2ZW9A 1KTVA 1R0BA 3OSZA 1IU9A 1P9LA 5AUNB 2G82A 2I4MA 1GPKA 2OG2A 4H0FA 1KQFA 4G65A 2Z9DA 3IO3A 1VRWA 1CZOA 2QJOA 2VT2A 4R1NA 3AR2A 2WYUA 2RFLA 3NHWA 5I9BA 4EBFA 4EX6A 4GKKB 1O8CA 2QD3A 1KFCB 3EE6A 4KXXA 4R2KA 4BFTA 2H7CA 4UD2A 5EVJA 1KGDA 2R8BA 2OB2A 5F9FA 1QS0B 3DW3X 3KVRA 2VUHB 3QPCA 4GD3Q 4BUCA 3AVYA 1IQUA 5ECGC 3AHHA 2KQUA 3ZLUA 1W59A 2PUGA 5JNUA 1KO4A 1L7AA 4DR6B 1SUBA 5FOVA 4J0FA 2VNHA 1BEUB 2R1ZA 3VZPA 4FT2A 2G8NA 2PL3A 3RI3A 2CHGA 3AX6A 5DE3A 3RSFA 4CCSA 4HT3B 4JCOA 1QYVA 3LZDA 1F20A 5DKFA 3RSSA 4RHXA 4RCYA 3HP4A 3EBLA 4YAFA 2EOAA 4PLFA 2NACA 2X86A 1T43A 2YW9A 3D5QA 4Q3OA 3W1EA 4B5LA 4DILA 1XRRA 5HZGA 4Z4CA 3I9OA 1PEYA 5KWIA 1PE0A 3CRW1 5CYFA 3VV3A 4TSFA 1SH7A 3DW1X 1ZC3A 1YA4A 3PE3A 4X94A 1GUZA 2L0XA 2XQIA 2ZIAA 3CCFA 3QBDA 5EJ9A 3K30A 1QF7A 5LQAA 2OKGA 3FTNA 3DE6X 2ESRA 3DGEC 3O95A 2G25A 3GGDA 3NTXA 3U37A 3VJMA 2PFSA 2YWXA 1Y81A 4HWTA 4R2WA 2H0AA 1SQFA 3MUOA 4IRXA 4B80A 3AVVA 3ILHA 3NOVA 1MAHA 3GFOA 5TMBA 4TZ0A 3QVJA 3U6BA 2W11A 4JDPA 3H0KA 4TRRA 3FIJA 2DKOA 3IP8A 2OP1A 2VF5X 5DK6A 1DIBA 3BZUA 3S1AB 5EP1A 4XX1A 5F1PA 1ZFNA 2XBLA 3KPYA 4IKPA 5CIQA 2FWAA 4PTZA 3QEMB 1W85A 4DQXA 2QUIA 1JEAA 1VJTA 4JNKA 5EWJA 3QH4A 1H8ED 1UDXA 4S1WA 5LYYA 4LXIA 5K9ZA 3UCEA 4XRRA 4RE5A 1W36C 1CHNA 1E99A 1W0JA 4DF3A 1RQ2A 1DAIA 3H8VA 5EXDA 2GQ0A 1NFQA 3BT7A 1CJBA 1PJCA 2OVFA 2V7GA 3B2QA 3F4KA 2Y0PA 4I4LA 4GP9A 1M2VB 4DXDA 4OMFG 4ZO7A 1Z0FA 1ZNQO 3FPJA 4YT8A 1D1PA 1PW5A 4ZXPA 1TFUA 3PDIA 1VBMA 3OI7A 2VJAA 4M9ZA 4RL4A 1M34B 1RJ9A 3OTGA 4RHCA 1GN9A 1TYAE 5TY0A