3A3KA

Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain: Possible allosteric regulation and a conserved structural motif for the chloride-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
molecule keywords Atrial natriuretic peptide receptor A
total genus 146
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a3kA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a3kA01
3NNNA 5DCLA 3O2QB 5FBKA 1E6KA 1NTRA 3H75A 3VNBA 4QYWA 5KWSA 1PUXA 3CNBA 3MQ4A 5TQJA 4TLLB 2PLNA 2PUFA 4EYKA 1NXOA 4G0OA 4O5AA 4MRMB 3OQNA 1SD5A 3OMWA 1EHCA 1JYEA 2R25B 3QEMA 4EY3A 5JNUA 5JNSA 1ZGGA 5JS1A 1DBPA 1JX6A 2F8TA 2JVJA 2PL9A 4IGAA 1W25A 5EWMA 4F06A 1VRVA 3HJFA 3LFTA 3FFWA 2PUGA 2FTKE 3RVLA 3LUHA 2QVCA 4KMRA 1Z26A 3DBIA 3F7NA 2FKAA 1MVOA 2P9HA 3JPWA 4LX8A 4LE1A 4MS4A 1SRRA 2F8SA 2FMHA 4YR7A 2WB4A 4XAQA 3TB6A 3N8IA 4JASB 5EWJB 4GPAA 4DQDA 3NHZA 5KC8A 1NXXA 2FLKA 3CZCA 1DBQA 4D6XA 4YLEA 2HSGA 4YS6A 4YV7A 2FMIA 1NXPA 2VYCA 1FFGA 1QO0A 2RJOA 2FMFA 3BILA 1E6MA 3OLXA 3A0UA 1CHNA 3QX9A 1L5ZA 2ID7A 4H60A 4RWEA 3CG4A 1USIA 2WJWA 5EWJA 3RVOA 5DLEA 3OQOA 3N0WA 4ETNA 3ILHA 3H5VA 3FMVA 4NQRA 2B4AA 4MQEB 2IOYA 1Z2EA 2QSJA 4Z9AA 5IUJC 4LZLA 2P4UA 3EQZA 3GBVA 3DLBA 3A0RB 2X7XA 3IDOA 4MAAA 1RXIA 1RZRD 3JS5A 4IRXA 1ABFA 5TPWA 1TVMA 3RVRA 3RVKA 3SM9A 4KV7A 3QLVC 4MGEA 1ZH2A 3HS3A 4KREA 1DZ3A 5FWXA 1LK0A 2E4YA 1GCAA 1YS7A 3CKMA 4RKQA 4N76A 4GNRA 3O1JC 3B2NA 4Q7EA 4Z9BA 1LBIA 4ML3A 3N75A 2QVGA 3RVSA 3GWGA 2Q5CA 3HUTA 1K68A 1NXSA 1NXTA 1ZY2A 2FQXA 4RSMA 2JK1A 1DCMA 3BRQA 3C6QA 2NT4A 1RNLA 5GQSA 5CNIA 2TMYA 3RVPA 1E2BA 3QLUA 1DCFA 4O1HA 4ZMSA 2LIVA 1LBHA 3H6HA 3LUGA 3LMKA 2LBPA 1XHFA 3LKBA 3KLNA 1DRJA 2FEPA 5E3JA 5KC9A 1KRWA 3P9YA 3KJXA 4M88A 1C4WA 5C5CA 1GUDA 2QXYA 1B00A 3FDFA 1EFAA 4QICA 4MYRA 2L17A 4RY8A 5CNMA 4EYQA 3O1HB 4UHKA 3HCWA 3KYIB 3QELB 4RK4A 3RVJA 4MR8A 1XHEA 1JFVA 1YS6A 1ZH4A 1EAYA 4MPTA 4LE0A 4YO7A 3CFYA 1LJLA 1PEAA 2WWVD 4QPJC 5D2CA 1U8TA 3OLZA 1MAVA 1VKRA 1Z15A 2GWRA 4Y9TA 1QP4A 3RVMA 1H9CA 3H5LA 3MIZA 1FFSA 3CS3A 1JBEA 5KQLA 2E4UA 3HDGA 3MMNA 1SXGA 4JP1A 2OENG 4MQFA 3DZDA 3HZHA 1M5TA 2FQYA 2HQRA 5ABPA 4N41A 2VUHB 3IP9A 1BDJA 4Z0NA 3S99A 1GLGA 3KG2A 2R48A 4RK1A 3TMYA 3OLVA 2QZJA 4MS1B 4KRFA 4YRZA 2FLWA 4OLAA 1URPA 1U04A 3IP6A 2W42A 2I6FA 5HQJA 3DLHA 4YGXB 4KPYA 1ZHHA 4PZ0A 1FQWA 4D74A 1RXEA 3CG0A 4DADA 9ABPA 2O20A 2A9OA 1BA2A 1APBA 1M2EA 4TLMB 2L18A 3H5IA 4MQFB 4Z4FA 3I09A 1ISRA 1S8NA 3QEMB 5KQPA 3UK0A 1SXIA 1JYFA 3HXMA 1QQBA 2DRIA 1YK0A 4H3KB 5IBQA 2KYRA 2L2QA 4ZPJA 3HV2A 3EODA 3I45A 3GYBA 3O1IC 1VPWA 4KVFA 4KK3A 2JB9A 3E61A 4LDZA 3QX8A 4N47A 3OO1A 2IPLA 3VNAA 4YWHA 1USKA 2J48A 1P6UA 4RKRA 3H5OA 3Q9SA 2WJAA 3TD9A 1ZESA 2ID9A 3O75A 4W5QA 2HQOA 4IF4A 3JTEA 3QK7A 5EWLB 4L85A 4NV3A 3OO0A 4HNSA 4L4UA 3UKJA 4MS3B 1UDRA 1Z12A 4IMIB 3OQMA 3EQ2A 5DGCA 2YHAA 3A3KA 4IMJB 5KQMA 3MYYA 3URMA 3SG0A 2IPMA 5FWYA 1Z25A 4F8JA 3QLTA 2JBAA 1DCKA 4N0PA 4Z4HA 3LUJA 2QV0A 3N6VA 3QELA 2RDMA 3SY8A 1NATA 1ZGZA 2NT3A 4RY9A 5CHYA 1JDPA 3SAJA 4KNYA 5IUKC 1D2AA 1F4VA 3N0RA 1NXVA 1A0OA 1EWTA 4XLTA 2M1ZA 1OXBB 1GUBA 3LUCA 2OQRA 1BDHA 1USGA 5CNKA 3QLVA 3CTPA 2HQBA 5FWXB 3GBPA 4JA2A 4B09A 5KI6A 3K9CA 4OBBA 4WXMA 2IYNA 3A10A 3RVQA 1YK1A 4FE4A 5HKOA 5FBHA 4UHJA 3L49A 1QKKA 4XARA 3H1FA 3LUAA 1JHZA 1QPZA 6ABPA 2JBAB 4RZSA 2IPNA 3H5TA 3F6CA 5TQ0A 4HYEA 1Z13A 4RS3A 2MSWA 2QW1A 2MSKA 2FN9A 3JY6A 5TQ0B 3DGFC 1R8JA 3EAFA 4E7OA 4RK6A 1ABEA 4KK4A 4ZMRA 1BDIA 3CHYA 3KTOA 2VUIB 3N53A 5C5EA 3D8UA 1JF8A 5JS2A 4G0YA 1BVHA 4MLCA 1DG9A 1TJYA 2JVIA 3NNSA 4WWHA 1Z16A 4NCBA 3EJWA 3CLKA 3NNDA 1ZAYA 3OM1A 1U0SY 3SQNA 1DP4A 1W9HA 2FXIA 5GOTA 3MM4A 4WZZA 4F3TA 1JFTA 4G0PA 2MSLA 2PUEA 1TM2A 2LP4Y 2ZWMA 1DJMA 5BRAA 2NUBA 3N0XA 5BRJA 1BAPA 4P98A 5IX8A 3SNKA 1M5UA 5CNJA 4E7PA 5ED4A 4OLBA 1QQAA 3O74A 2IPAB 3TO5A 3HEBA 4NICA 1JLKA 5IULC 4TN5A 3GRCA 1C0EA 4G0QA 2FEKA 3RVNA 1T34A 3ILYA 4D6YA 5JNRA 4QYMA 3M6MD 1MIHA 1P8AA 2JCGA 2PMCA 1A04A 2JRLA 4JAVC 3LUFA 2CD7A 1M2FA 3NBMA 4G0MA 2NZUG 3KKEA 4KQCA 2LPMA 3I5AA 4W5RA 1DBWA 1IIBA 1YVUA 4ZJPA 1WETA 1MB0A 3KYJB 3T38A 3GV0A 3T8YA 5TPZA 4PEVA 4MS1A 1DC7A 3G85A 4DN6A 2QU7A 1D4ZA 4MR8B 4XASA 4EYGA 1JFSA 1TLFA 4PE5B 3KHTA 3KS9A 4MLDA 4RK7A 1EWVA 3RH0A 1QO0D 2FN8A 2H0AA 3C3KA 5T7BA 1A2OA 4RDCA 1SXHA 2E4VA 1U2QA 4OTZA 3BREA 3KSMA 2PE5A 1XWWA 3F6PA 4JB2A 3GT7A 2E4ZA 4EUKA 4Q6BA 1P2FA 4MQEA 3JVIA 3MA0A 1D1PA 1RZRA 4S04A 2WMYA 5EWMB 3GL9A 5PNTA 1RPJA 3EULA 4FE7A 4G0XA 3LOPA 1D5WA 3IPCA 2JVKA 2AYZA 3IP5A 3IP7A 4KFCA 5TPZD 6CHYA 5JNVA 4MR7A 1DC8A 1DRKA 1PEYA 3Q7RA 3T95A 4FB4A 1ZVVA 2YHBA 4WUTA 3LKVA 3FFTA 2NZVG 2H3HA 5TE9A 2BGGA 1FFWA 3HSYA 1I3CA 4LE2A 2PJUA 2B1JA 2A9RA 4N0QA 2FMKA 3M9XA 2IDMA 2WRZA 3DGEC 1PHRA 2HJ9A 4MR7B 4Z99A 2FEWB 3OLWA 3HDVA 4JOQA 4G0ZA 3C97A 3NHMA 4OATA 3L6UA 4P1ZA 3T6KA 5IEJA 2PUBA 1AB6A 5IEBA 4YCSA 1JL3A 8ABPA 4MRMA 3H1EA 2WY2D 3H1GA 4RK5A 2E4XA 2GKGA 1QNLA 1K66A 4NCAA 5JNTA 4WXEA 2PUAA 2E4WA 2PL1A 3LUDA 1MB3A 1KMIY 4WT7A 5T3YA 4EVSA 3CU5A 1VLZA 1Z18A 5KQGA 1KRXA 1JH9A 3RQIA 2MYPA 1YTUA 2GI4A 3ROFA 2A9PA 5B3JA 2PKXA 3BBLA 3W9SA 1ZN2A 4G86A 2ZAYA 1AB5A 2QR3A 1J56A 1U2PA 3D02A 3JPYA 4PYRA 4KQ9A 4MS3A 4RXTA 2GBPA 3OMXA 4JB0A 1JDNA 4ETMA 4F12A 3F73A 2RJNA 3E3MA 3EDCA 4MS4B 1LJUA 3G1WA 1QMPA 2FSPA 1OXKB 4H3HB 2PUCA 1YMUA 3BRSA 1TMYA 2M98A 1Z2DA 2L19A 3C3MA 4F11A 4MR9B 1KGSA 4S05A 3FFXA 2CWDA 3MF4A 1HEYA 2V0NA 4Z4GA 4TMYA 1GCGA 4RXUA 4MR9A 4W5TA 4O1IA 4XXHA 1CEYA 2MYNA 5FWYB 3EGCA 3O2SB 5TQ2B 3HM9A 1E6LA 3HUUA 3LTEA 3IPAA 2FQWA 4PICA 7ABPA 5B3JC 1PNTA 1JWLA 1Z17A 5HSGA 2PUDA 5TQ2A 3LUKA 1F51E 4EYOA 5I4CA 3QLUC 3KCNA 2CHEA 2FVYA 4KZKA 3R0JA 4LDAA 3TX6A 4Z4EA 3OM0A 4HNQA 5IC5A 1PNRA 4RU1A 3HO1A 1L5YA 1YMVA 3CRNA 2AYXA 4W5NA 5BQ3A 3Q41A 3C3WA 3FGZA 3O2JA 2IKSA 4Z4IA 5IUNC 2CHFA 4ZYLA 3KLOA 3H6GA 3O21A 1D1QA 3H5WA 2N9UA 3I42A 5BR1A 5DTEA 4W5OA 2PAFA 2R47A 1P6QA 3HVRA 1ISSA 4Z4CA 2FW0A 4Q6WA 5JNWA 2RGYA 4EVRA 1FSPA 3Q7SA 4ETIA 3QEKA 1QP7A 5HM6A 3OLYA 4OG2A 3ROTA 4RXMA 5F64A 1ZDMA 2A9QA 5DKFA 4RK0A 4XFKA 5TPWB 4EGSA 3JVDA 4RV5A 2MYUA 4HNRA 2R4QA 1CYEA 2XDYA 2LUOA 3GA5A 3CZ5A 2HPHA 4RY0A 4EVQA 4IILA 1ZITA 4N03A 5EWLA 2GX6A 2VK2A 1YIOA 3M9WA 4G97A 1EWKA 1NY5A 4YP9A 4CBVA 2MYTA 1NXWA 3Q7TA 3K4HA 3UUGA 1QP0A 1Y1LA 4LRQA 3HK2A 3Q15C
chains in the Genus database with same CATH superfamily
4B32A 3NNNA 2YV4A 4YECA 2F00A 3HJBA 2OSVA 4PZEA 3KKPA 4MUNA 2H1OA 1IHOA 2SNIE 2YIDA 3W2EA 5TB5A 2PLNA 3R7BA 3GFRA 3GMDA 1QTNA 4P4GA 3T5DA 4LJ4A 2NGRA 1KY5A 1Q0SA 1ZOPA 1EVIA 1G5PA 3HKDB 3N6XA 4LYDA 4C7VA 2Q5LA 3BDVA 3CF4A 4BFUA 1EWQA 4R1QA 1CR4A 1LPBB 3UB3A 1P4AA 3TGWA 1HX7A 4DM7A 3ZDDA 3F6RA 4DLBA 3BRWD 5A4DA 1QH1A 3HLYA 2M32A 2D5IA 4MPJA 1U5BA 4OP3A 2W2KB 3EVZA 3V34A 4DA6A 2B61A 5LUAA 1IZ8A 4QNRA 1IVYA 3F7NA 1CRZA 3RG2A 2Y66A 2DCUA 2P3SA 2VZLA 3G82C 1VHDA 4L22A 5C31A 3U80A 3N2IA 2R8XA 1QTQA 2MDTA 4JZYA 4BTVA 1TK2A 4NYMQ 3H2GA 3MTAA 3IE1A 1QIEA 3DV2A 3T5TA 1C1HA 4YV7A 3MTIA 2Q0SA 5LPNA 4LHSA 1T5TA 3DOJA 1QUEA 4UCXA 2C4MA 2ZPUA 4UBMA 4YJ3F 1GKYA 2YYYA 3EUAA 4YCAA 4ZVQA 3SC6A 3VZRA 4ETNA 3SSOA 1V3TA 4LYEA 4R1UA 4A6XA 1U2SA 4DT1A 5A4FS 2QJTA 1Z2EA 4NONA 4RE5A 5FTMA 1LI4A 3MLEA 1E9AA 4YUYA 1ZIPA 3ICEA 5HVNA 1JHUA 3LXUX 4PCVA 3FROA 4TWJA 2O1XA 2PGXA 1DDOA 4HB2A 4MPDA 4NCIA 5TPWA 4IDDA 1KXZA 3K35A 4NOMA 4OIFA 3RT7A 2VJKA 2Z1NA 4ID9A 4K0KB 2Z56A 3DDNA 2WD7A 1ZH2A 2MJLA 1ZBDA 3E9ZA 4LZOA 4E07A 2NPIA 3GYGA 4KXNA 5ALHA 4C29A 2I8CA 1WKCA 2BZ1A 2WA1A 4MP8A 4CM4A 3L18A 3L1UA 3BULA 3N9IA 4JHXA 3FZYA 3F9IA 4L5CA 1CG6A 1FUEA 3RF6A 3RC3A 1LXCA 2G0TA 1OLUB 4D2IA 4Q37A 1KBZA 3FRHA 3KSUA 4JJZA 1R12A 2O2IA 2VP2A 3AJEA 3ZJ5A 5C3MA 3DNFA 3P2MA 4QQKA 4Z3OA 3B6EA 3C6QA 1XJ5A 5AHRA 1P7ZA 3GJXC 4Y1RB 1D04A 4A5SA 1L4MA 2X0DA 4O1HA 1BHJA 4LJ5A 2G63A 5T67A 2NU9B 2B4YA 3OEHD 3WZLA 5HJ2A 4E46A 2PA3A 1UPBA 1MW9X 2GDJA 4LEIA 2GBIA 1WAMA 2V9CA 2BKXA 1Q50A 1S02A 2ABWA 2P4SA 4NDAA 1DEOA 2XT0A 3NGMA 3R8XA 4ZI3A 4PAGA 4DR6B 2ZUTA 5T6BA 2GYWA 2Q7XA 4EFDA 1JEAA 1NU6A 2GAOA 3H1PA 3WBJA 4FFVA 4V38A 3KZCA 2Z9DA 1G20A 2H5IA 4N9WA 4GLOA 3CZ9A 4EB3A 2JHFA 4U2DA 2CLMB 4EY5A 1A5TA 2CK3D 1U8TA 3OQIB 5JZOA 3OLZA 1P1FA 3G5AA 1L4HA 4OEHA 4DLAA 1W4LA 4BWVA 1L5FA 4MIOA 2ZEJA 4KDFA 4MO9A 4BLRA 1X42A 4KEAA 2R79A 1RHMA 1VJ5A 1ID8A 3EGVA 5IU6A 5KJEA 1N3BA 1V6SA 3G0HA 4BC0A 2LCFA 3K09A 3ZC3A 1NDQA 2G0AA 1Z2PX 2X8JA 1MO4A 1CQJB 4I4NA 5DXAA 4DAEA 1M5TA 2IF0A 3TTXA 3L7DA 5A0VA 1RWNA 3U3JA 5TGZA 3G9XA 1WBBA 1GLGA 2R48A 3IAHA 2NLOA 2ZYVX 3ZTYA 1T3GA 1FX0A 1XEAA 5DBHX 3ZR4B 2QGZA 4XVRA 2ILTA 4C7XA 1DEXA 3D59A 5BNWA 5ICCA 1XEXA 2NO6A 3LAWA 1WSDA 3SICE 4J0FA 4KPYA 1YB5A 3CO5A 1ZI8A 5AW5A 4O1MA 4WCVA 1H5UA 3AUJB 2L18A 4JA0A 5IDVA 1KTIA 3G5TA 3M1LA 3K9QO 1OILA 3MJTA 5B1YA 2POQX 3ZWMA 3GPLA 1CDEA 1Q19A 2FZEA 2XBLA 3CONA 5IT4A 5JI3E 4UU1A 2CE2X 1YB2A 2QTHA 3QEMB 2VJPA 3IBCA 1TUBB 4N49A 3RFUA 4L95C 2PZMA 5LLTA 3DONA 2VK1A 1YK0A 1G2OA 1TCVA 3EA4A 2A7QA 4K6HA 3V4SA 1DKRA 4ZPJA 5JS7A 3DT9A 3GYBA 3CNNA 4TTQA 2IEAA 2WEKA 4MV5A 4ZZ3A 4FCCA 3FMIA 2ZKLA 4WLOA 2X7HA 1W1IA 5EVJA 2I5PO 1S89A 5K0LA 4C43A 2XMBA 2ZYRA 4RWZA 2I2WA 3RANA 3KE9A 1E4EA 5IARA 4JJFA 4Q9AA 2C2OA 3CLSC 4FEEA 3CPHA 3FVWA 3L93A 3MSCA 4QBIA 4RCZA 2ZJ7A 4PZYA 3ZVKA 3O8OB 3S44A 1I2MA 1RHRA 3V4RA 3VZCA 2IEIA 5JCJA 1KVUA 4BQRA 1AMUA 1JXQA 2AMLA 1ISIA 1BMTA 1COWA 3OFNA 4RUKA 5F7XA 1SU8A 2FP3A 4MS3B 4BVGA 5F5NA 2II6A 4FHFA 3FWZA 1XRPA 1E9BA 1HH4A 1YONA 2OBNA 2PXHA 1EVEA 4BAZA 5LP6A 4FWTA 3DHNA 3ZQ6A 1Z25A 3C5WP 3SK0A 1QGZA 4DVGA 2ET6A 3PC2A 4OMUA 2HEGA 2V7GA 3LUJA 4U5XA 4L5YA 4WLVA 1WXEA 4ZEMA 4Q47A 4FX2A 4RL6A 5CHYA 5JECA 2DY0A 3JRWA 1U7DA 3GG9A 3EF1A 4QOIA 1PFGA 2RHDA 4RX1A 3SE7A 3ELWA 3ZU6A 3IEXA 1U8AA 2W0SA 1ZGCA 3WYAA 5CXQA 1DOAA 4GWLA 3NIWA 4M1SA 1IZZA 1NUAA 3HA7A 1E4VA 4M9ZA 2D1SA 4OH7A 4RNDB 4EGCB 1ZJWA 1G1MA 4WSOA 4Q9LA 3I04M 3NOXA 4B34A 3GBPA 4BCBA 2E5LB 5G1NA 5G4LA 3WKEA 4BLUA 2QXUA 1UMDA 3IAAA 1QLHA 4PRYA 3AW8A 5BSWA 3TNYA 4LJ9A 2CKMA 2D5CA 1AK9A 3DXZA 3PK0A 3SDSA 4UHJA 4ZIRA 1NR5A 3W6PA 5AVTA 3JQAB 1W46A 2QI9F 4TSFD 4NAHA 3T9AA 5TQ0A 4S24A 5J4KA 2WDZA 3T4EA 2K5UA 3KYCA 4L9RA 3T94A 5K6RA 1P9NA 4U2BA 4EFKA 5LN1A 2MSKA 3ZJUA 1RADA 2WU8A 3CZRA 4NZYA 4TKUA 1ORRA 1NW4A 1R8JA 1M34B 2I7XA 3KCQA 4QNNA 1E1MA 3PWKA 1YR8A 1NQTA 4L02A 3NBYC 3MFQA 3NR2A 4NV0A 3ES9A 1RIIA 3JXEA 4P3NA 1HQKA 5LKAA 1GADO 4CFSA 4IIJF 2F1IA 3RBXA 1X8LA 3MILA 4MLCA 2VDJA 5AI4A 5IT5A 2ZIZA 1OC4A 5D3QA 2BFAA 1E0KA 1SRQA 1U2EA 3K31A 4QYXA 1ZAYA 4Y6OA 2AUNA 3KSDO 5HIAA 4EKEA 1IEWA 2FXIA 1W75A 4DCVA 1KFBB 2C4KA 4WN9A 2QD1A 2C2YA 4EHDA 3BCSA 4V0NA 1BAPA 1D2CA 1N92A 3HLTA 3LBNA 4LZNA 2C57A 3VH2A 2QN7A 5DYIA 4E7PA 5ED4A 3TSZA 5AFSA 1JJ7A 1T0PA 1HZZA 5G3ZA 5A3JA 2CVPA 2E6KA 2NAFA 4I7EA 1ORVA 4OI1A 2BH9A 2HX1A 4MJ3A 1HYHA 1RPZA 4G0QA 1QHFA 3ILYA 5AICA 4NG5A 2JCGA 4M9SA 5BMOA 1OLUA 3NBMA 4G0MA 3REQA 3X1XA 4NU0A 3PHIA 1AO3A 2F3PA 3I5AA 4PC2A 3ZXUB 4OFZA 4D0LB 3ZKWA 3QJ5A 4FBMA 3QPUA 4P2GA 4Q3NA 1KQGA 1LB1B 1QZTA 5JROA 5SYNA 4KE9A 3X1KA 3AR2A 4IW3B 3NV7A 2XYPA 4TV9F 5IWCA 4H15A 4B6SA 1XDBA 2ZP1A 1FYWA 1LEHA 2WYOA 4MVCA 2Q3JA 4UASA 3ENQA 4BJ6A 2PTGA 2P2SA 1YE5A 4HUJA 2NW6A 2FPMA 4EMBA 2PE5A 4ZAFA 3F6PA 1H2EA 4PHFA 4AG6A 2YQ5A 3QXXA 2XDWA 1BXKA 2JZOA 2A0UA 1N1GA 3C43A 3VKUA 3PUIA 3VVBA 2RK6A 4MGIR 3TOSA 2OB2A 3RKSA 2W0MA 1U4OA 4FHGA 4G1CA 1DTWB 4GICA 5PNTA 1C9KA 2YY7A 1M54A 4ZOLB 3AB3A 5DT2A 4ZHQB 1MGPA 5AJYA 2EEZA 2FSVA 4LNAA 5CFNA 1O8CA 2D5BA 2AB0A 3KRTA 3L9XA 5H68A 2H51A 5FI5A 2A6PA 1VCIA 3QVWA 2PX8A 4KFCA 1E3EA 6CHYA 4KR7A 1VKNA 5TXGA 3FOWA 1XZKA 2BFCA 3LKVA 5HF9A 5IVHA 5TQ0B 3L0BA 2DHQA 1WX1A 2ZI3A 4KWCA 1E1LA 4UD2A 4R2MA 3UUEA 1YCFA 2B2NA 4NDNE 4KR6A 1II0A 4N18A 3ZLVA 3BEOA 4P86A 2XGJA 3MGKA 1E5QA 4QBKA 5HEKA 4ADSG 4PBSA 3TG2A 5F77A 4RD4A 1GHTA 2W6NA 1SBCA 3AIIA 3LIIA 3LBFA 3MN1A 2HJ9A 5KOHB 3CF4G 3DZ8A 5LA6A 3K2EA 1TADA 4S1OA 4Y1RA 1K8YB 1SG0A 4R3NA 1T15A 4KXVA 2VTBB 1J1UA 3HP7A 3GB9A 3S5JA 3NIGB 1AB6A 1YKFA 4BZQA 3K1YA 1AE1A 2H4JA 1VI5A 2VF5X 3RQSA 1UBTS 3QXCA 1GXSA 4FZVA 2HF9A 1QHHA 2F2TA 3HKEB 3M83A 3O93A 4EW2A 1K66A 2NU6A 1VMAA 1WQ4A 4TV8F 2JLWA 1MH1A 1QFXA 3W4KA 1KY3A 1RMYA 1YNOA 1FDOA 3CU5A 5KYXB 3KQUA 4KFSA 4M1OA 4MKRA 4CM8A 2Z43A 2OP0A 1SKAA 2X0IA 4J16A 5TLSA 2GB4A 2PKXA 2BLLA 2OBXA 2XUPA 2H1VA 3TD6A 2DZDA 3IT1A 2V74B 1SH7A 3H5RA 4MHSA 3D64A 4UNSA 2HBQA 3TJRA 1I3OA 4L8FA 1CUSA 3VX4A 1J25A 3Q8MA 3QXJA 4NECA 1MABA 2Q3MA 4BGEA 1ZUD1 3L2OB 1FSGA 1KGDA 3DPIA 3Q9UA 5CBPA 1P8JA 3FVQA 4MO2A 1KRHA 3FSEA 1Y4AE 4QGHA 3U3DA 4ETWA 2VDWB 5K3BA 1QRAA 1JQ5A 2HFJA 2BFOA 2VTKA 3HFGA 3M5PA 4YN3A 1Z6XA 3SSAA 4NV1A 4OMDA 1XQ9A 3DZCA 3EIWA 1YHYA 1DLIA 2V0NA 5DRYA 2ZUFA 3HN6A 1W4CA 5B2ZA 3K9NA 1JTEA 2JJYA 4V0QA 3G8YA 1V41E 1Q0PA 4JT9A 1L5NA 4OXIA 3IR7A 1SIBE 1V7QA 2IDZA 3FMOB 2EJVA 3OY7A 3UJNA 2IS1A 4ACBA 4XRRA 1VL1A 5CIYA 4J4BA 2Q28A 2WZBA 4Q4DA 4QD3A 1JVSA 2XYVA 5J4VA 2RHGB 2RI6A 4JN6B 3UAGA 3AJAA 1Q1GA 3MT9A 3VPSA 1U9CA 1M0TA 1U9IA 2YJ6A 3CRNA 4HSEA 1ND5A 1GR0A 1HV8A 4K6FA 4PS1A 3MJSA 2QUZA 3V48A 2EYQA 4AN0A 1S7CA 2DR3A 2VSFA 4YUZA 1ULUA 4X60A 2FZKA 1TT7A 4RVFA 5A06A 3LY7A 1GU1A 2E1RA 2HA7A 1C3VA 1H22A 2REBA 1AD2A 4FHDA 4NI5A 2R47A 1PDOA 2QUAA 5T8KC 1KQOA 1YUMA 4JZKA 1BXGA 4FYMA 3ROGA 3U9LA 3T1HB 3S28A 5JANA 3NG1A 3GLIE 1G64A 2WHEA 4QOSA 3E27A 3QU4A 1PV1A 3ZHSA 3B1FA 2HFKA 1XLTA 2PXXA 2VPQA 3M6XA 1XMVA 4LBWA 4UFOA 2D06A 4UE6A 4YUWA 1EGVB 1GYPA 1OCEA 1J2UA 1X7GA 3E8SA 3PI6A 2AFIE 4F45A 2HY7A 4ENSA 1UT8A 4JXJA 1ECBA 2FFJA 2ZJOA 5DNVA 2CBZA 3WB2A 5HKAA 3CZ4A 1AHHA 1T6ZA 4N7JA 3UMSA 3LX6A 4AKSA 5L45A 1ZD9A 2HMVA 2R68A 2A59A 1GGFA 3EHDA 4C08A 3TOZA 4DGQA 2BJWA 2OXRA 3OPNA 4G65A 3U26A 2HMSA 4ZA2A 3VDNB 1VPVA 4G8CA 4WMLA 4EO9A 2CVOA 4CBVA 4DMFA 1UOQA 5AVVA 4E94A 4CMIA 1NAHA 1OFGA 2I6SA 3GH1A 3CLTD 5J59A 5CBKA 5IJ9A 3CVVA 4LISA 3B6ZA 3H2HA 1MPTA 2BJVA 3E9DA 2PD4A 1LVGA 3DMYA 5FBKA 5IF3A 1GZ6A 1L5VA 1P17A 4BEJA 3L82B 1PUXA 2IUEA 3A1SA 8OHMA 3F8WA 2ZRDA 2IS4A 2JLCA 4JJ8A 3DMRA 5DJ5A 1W76A 2PRSA 4BECA 2BP7B 1N8TA 1AUQA 1POXA 5KYUB 2FSGA 3NU1A 4HLUA 3NEPX 2QIPA 2FRDA 2GMWA 3CXRA 1SD5A 1K4YA 1SG6A 3C3AA 3DTNA 1AHPA 3KAPA 3SN6A 4KXUA 1GZ7A 3TZBA 4BZXA 3R5JA 5KKAA 5BWOA 4R01A 1VKZA 4NIMA 1R6AA 4P0QB 4IGAA 1SPBS 2Z04A 4US0R 4LOAA 1MEEA 3RT9A 4H7HA 3KZXA 2PV7A 4O8ZA 3RSHA 4F06A 3I5YA 2CV0A 3LSYA 2BR5A 3L0YA 3EXFA 3LFTA 3FFWA 1V71A 3RVLA 3MTGA 4FM9A 2WT4A 4QVIA 3KU4A 5EP2A 2XW6A 3E7XA 2VA9A 4HXFB 4N6GA 5EPEA 3T4UA 2FKAA 3AJ8A 3UT6A 2GN9A 4LX8A 3RTGA 1D1TA 2ZM5A 2FMHA 5MGBA 2COEA 3EMKA 4JP3A 5DBGA 5BNTA 1HETA 3T4XA 2FLKA 2UUBB 1NKTA 4UQPA 2YXEA 3D3WA 4PANA 2R5WA 4IXMA 5JR3A 1LK7A 1FC0A 5B37A 4FGLA 2FMIA 1ZGHA 3GDOA 3QF7A 3W3AH 2CLSA 2W4QA 2FMFA 4LHVA 3A0UA 3QX9A 1TT5A 3A3OA 2TECE 3I1YA 1WKBA 4KXMA 1XCJA 1J0DA 4BRSA 2IUTA 5FUXA 3NUGA 3OQOA 1DG1G 3K6SA 5BV1A 4PCAA 4WADA 4Q15A 2GM5A 4YJDA 4DM3A 4LZLA 1U28A 1YDFA 2WC1A 3H9UA 4X1OA 1N7HA 4V0OA 5FL7A 5FAXA 4YRBA 3L0OA 1Z6YA 3JALB 1IJBA 1EK5A 2ZATA 3UY4A 3VUEA 1LS1A 3G6WA 1E63A 3JS5A 3FNEA 3MYRA 3SM3A 5EXXA 2QV7A 1DOZA 1U28C 4AO6A 3JZAA 4KV7A 4MGEA 3TLGB 3ZWDA 3HS3A 1G0OA 5MF6A 1IBMB 1EP3B 2PQMA 4NAVA 1G5FA 3L6RA 1MVNA 3IOMA 1RYZA 4FDAA 4EM6A 3JARB 3V2UA 3W2HA 1K7EB 1JU3A 2QPAA 4CKYA 2DUWA 4OSPA 2VF7A 5HKKA 4DMCA 2XEXA 1OIWA 1TE2A 4YNBA 1NV9A 3WB1A 1ZN9A 2SICE 4EWLA 1W0JD 1ZM7A 2J3LA 3BH7A 5JSQA 4YYZA 1S8OA 1ZPDA 2ESRA 2WAYA 3B5IA 3FETA 4K05A 2RGXA 3RVPA 4HDQB 4HDSA 4OK6A 2VH1A 1KYVA 1XXHA 4YQZA 3KK0A 3HGQA 1RE1A 3IA7A 4XEHA 4WY2A 3K4PA 3AF6A 1XO1A 1YU6A 2BMWA 4GIBA 4OHCA 4D42A 2PNFA 2ZITA 3H3XA 3ZOZA 5LQAA 2XJ9A 2C2WA 2EQ5A 3AB7A 4PS0A 3FYTA 3QEAZ 3FVRA 4BCDA 4Q16A 3N8HA 2CNOA 4TT3A 4DABA 2BBSA 5C3UA 2FZCA 3HB9A 5BORA 2P4EA 2B1RA 2ZT5A 3TPFA 1Z4LA 2AOXA 1O0SA 3K0CA 4IKEA 1B76A 3HPQA 1KVRA 1W34A 1SUPA 2VCEA 4IH4A 4MVJA 4UHKA 4A03A 4AXXA 4EF4A 2G5PA 2OCAA 1C1DA 2V59A 4AZ0A 1R9MA 3BBPA 4LE0A 4XM0A 2YOFA 1WXGA 1PEAA 3D3KA 5C81A 3LC2O 3GUVA 1KYTA 1OBVA 1MAVA 2J9YB 1FFYA 2H4XA 5C1OA 1M6VA 2FCRA 1KI9A 2Q3LA 3H5LA 4RD2A 3JZMA 4G1MB 5FBZA 2WKPA 1TCBA 1RJEA 5DLQC 2E4UA 3ODPA 4ECEA 5AJXA 5AW1A 1A5SB 5KREA 3IMGA 4Y0NA 4CGZA 1Y82A 2H5LA 3OE5A 5JC1A 1GZHB 2DXIA 3ABIA 1NMXA 2JIPA 1WJGA 4KU4A 5AJHA 4D41A 4UAVA 2OCPA 5TC4A 4N5IX 3NASA 4QJIA 2CFOA 5D7NA 1BG6A 3IBGA 4ZANA 1D0IA 4A82A 4EB6A 2E55A 4F7WA 1URPA 2H08A 3BHMA 3IP6A 1AQ6A 4RVGA 2NU6B 1J0CA 5FTJA 4I3HA 4EG7A 3DTVA 1RXEA 4DADA 4PVDA 2ZUDA 3ZVLA 1RTTA 1RTKA 521PA 2AXNA 5AOVA 1K88A 2GEBA 3GA7A 4MQFB 5EE5B 4PO1A 3EGXA 5HF6A 5K3FA 1A9PA 4WNCA 4COOA 1SXIA 1Z6QA 1LPPA 1QKIA 1FXUA 1EFHA 3HXMA 2A0XA 1JJFA 2OGWA 2HGSA 4WA7A 5E7JA 3UKDA 1K7YA 4H3KB 4HAOA 1YQGA 3ETDA 5IBQA 3T9EA 4UFPA 4OGLA 2GAJA 2Z6VA 2HIMA 3DR3A 1SZPA 2FOXA 3ESYA 3W2GA 1NRIA 4I1SA 1ULSA 2A58A 3GC6A 3ZV4A 1Z4IA 4BX0A 2JFNA 3H11B 3S2UA 4ZTBA 2COKA 2ZRJA 1PF7E 1RXWA 2UUOA 1JDVA 4HXEB 4PO9A 3V4VB 3H13A 5BN4B 3GD5A 3ER8A 4GYJA 4DMRA 3ASZA 2H2DA 2PEZA 1LRKA 3FYDA 3RRBA 4MAFA 1JFFA 3KQSA 1TU4A 3FCYA 4IGFA 2NYRA 1X8XA 1OH5A 2BEWB 4EPRA 2Y1KA 4PVCA 4FI3F 1ULAA 3FTCA 3FY4A 3OFND 4ITVA 3U4HA 5F7JA 4IIHA 3DE5X 2F9MA 1G7TA 3OQMA 1I94B 5AK3A 5KNBA 4OHYA 1C3JA 3F4LA 2VSYA 3AF3A 3AI1A 4UTXA 4CMCA 2GZRA 2O7SA 4EZIA 4MB2A 3KOYA 5AKIA 1J4AA 4MWCA 2ZCUA 4FQ8A 4RFLA 5GJCA 4U3JB 4Z4HA 3JATA 2PY6A 3TI9A 1OGIA 1T35A 2OMEA 4Y6LA 3IXLA 5A5VA 1H8ED 4TTTS 5BRNA 1M34E 3WA6A 1TM7E 2X77A 4IQ4A 2YN4A 2RGCA 2PX0A 3GQVA 3SNHA 4C03A 3WSVA 5BVGB 3IMEA 4DE5A 1HE2A 1YZTA 2DHEA 2W6CX 4YT5A 5LQNA 1PN3A 2ZJ4A 3I72A 4PPQA 3W7AA 3KQOA 4ER5A 2HQBA 3AWIA 3BWCA 4LA4A 5DYNA 3GLGB 5KOYA 3AUTA 3NIDB 3EIXA 3GPCA 1QR2A 2IW1A 5AI9A 5EPUA 4C6RA 2A33A 2A14A 4YAEA 4OLAA 3O9ZA 2R8PA 1X1QA 4L9WA 3GT4A 4X8HA 3RBAA 4O59O 5M29A 3WLPA 4QX6A 2BMDA 5HRAA 2RHMA 5A5EA 1QPZA 1G5QA 1IPFA 1P5HA 1XWFA 4PYNA 4YHBA 5AJTA 4CN9A 5HUHA 1IPHA 3Q3VA 2MSNA 3T3NA 1WV0A 1B23P 4RJJA 2BYTA 3RFTA 1J5PA 5E7IA 1XZHA 4H7JA 1X13A 4NJMA 1Q74A 4PHGA 5G1OA 4KB5A 3VHRA 3ZQJA 3P5BA 1EFPB 2EWMA 4E7OA 5A9TA 1QANA 2W37A 3WTCA 2IT1A 3FTNA 1TD9A 4R9UC 4PNEA 2XZPA 1VKHA 4IEEA 1NJ2A 1PSDA 1SELA 2Y9MB 3HJTA 1NF9A 5CK5A 3NWJA 1Z36A 4JI1B 1JIXA 3IKVA 3NJRA 2Q1UA 1V8BA 3LG2A 2ZT6A 2AFRA 1CY8A 2D1RA 1RZUA 3OCUA 1R2QA 3D7LA 3CSDA 2E49A 1AV7A 3OSZA 2QG9A 5TR9A 1VYUA 4RGBA 2MMCA 4GKBA 1J24A 2QN6A 3R20A 2B5VA 2RGEA 5FQNA 3AJDA 3N2LA 1FNBA 3MUNA 4QELA 4AMUA 1N0WA 1SWWA 4NYJR 4F6CA 4AS2A 1IZ9A 5K0FA 1LPNA 2JH3A 3GLHB 4E4TA 1X19A 2SECE 3NMUF 3SNKA 5CNJA 3RB8A 4OXKA 3FMFA 1EGAA 2ARKA 3DT6A 2ZBEA 3H4VA 2ZI5A 3L0CA 3QU2A 2FETA 2IPAB 3G0CA 2FE1A 4WTOA 1T5LA 1Z62A 2E21A 3HEBA 5FHQA 4TN5A 4WASA 3T41A 1GCOA 4CF5A 2HDNB 5JIBA 3RUAA 3OQPA 4D4KA 2G9NA 1ESMA 2BM9A 1A04A 3W0LB 1ISMA 2QRHA 3C1OA 3EC1A 3S6JA 3AI2A 2JFPA 3AKEA 1R74A 2F9FA 1WCXA 1YVUA 5FUYA 4XR9A 2CXSA 4HC4A 5TMDA 2Z2XA 1T8YA 3KT8A 4RHTA 5EE1A 3UW3A 2QU7A 3R0QA 4GDMA 1ETUA 2E5FA 1GG9A 1FTQA 2X9NA 5DB4A 5IHPA 3VBCA 4PX5A 3O3MB 3P2JA 4RK7A 3L0SA 1J23A 5B7GA 2H0AA 1DAEA 4N82A 3QA9A 1XL1A 2J7PA 4XTRA 3CW8X 4FXPA 3WB0A 2UAGA 4IJ6A 5DGXA 2OV4A 2OBYA 5C4IA 2IXAA 4UM8B 1M34A 4LXUA 1Y9ZA 1N1EA 2PD6A 3MA0A 1D1PA 1IHPA 1R0WA 1U3GA 4NXMB 2GAIA 4URVR 1Z4PX 3CLHA 4GR4A 2R1VA 4PQFA 4UAGA 1WPRA 4AAYA 1A77A 1BE6A 3HFJA 4ZV7A 4F2DA 4ZYVA 1FNCA 2I3DA 3B36A 1OVGA 4CCWA 2GN6A 1DX4A 1ODLA 2BCEA 2G17A 2GJ4A 2MMGA 3TM5A 4XI9A 1C1DB 4JUAA 1W73A 2HRBA 3E15A 4QUIA 5FBQB 2X9VA 4GZ5A 4JLDA 2QRMA 1OROA 2HLHA 2XUDA 4PYQA 5CYFA 3MWFA 1G7SA 1IFXA 1NE7A 1YSCA 2R6R1 4WH0A 5KU1A 4I5GA 2BGGA 1U3TA 3WL4A 3EGEA 4NCXA 3D3JA 1SC4A 3NJ8A 2J8ZA 1HOXA 1Z7YA 2EV9A 3NQ41 1U3WA 4JJAA 3SIRA 1NV8A 4NMLA 3RTBA 2J3EA 2AVDA 2I78A 2O3RA 2WPDA 3FKQA 3GRYA 4R2KA 2H2WA 5EZYF 2CF6A 5K0TA 1RYBA 2YZKA 2XVAA 3L7YA 4ESHA 1TEHA 4D3YA 2WF9A 5L3ZA 2HSEA 2WYUA 3KKZA 4G0ZA 4BBPA 4I55A 1TM3E 3KD3A 3B13B 2OFFA 1UBLS 3GJTA 1CJSA 3JYHA 3TSWA 2Z5GA 2ZJBA 5ICSA 1IQPA 4MRMA 5IMSA 1QYDA 2YVLA 4H7DA 3WDSA 1T5DX 3SSMA 4JENA 3QMWA 3SQXA 1M6EX 1NUUA 3UZUA 3OLCX 4L0MA 2HU2A 3IKLA 1Y6ZA 2Z4RA 1E1QA 3RFVA 4EY4A 1FSPA 5AM5A 3INGA 1T1IA 4LF5B 4UPDA 3QOFA 2PX5A 3HUDA 3DFFA 2D4AA 3OX3A 1R50A 4FJ0A 1F5SA 3ZS9A 1C7IA 3BMNB 4IXDA 2D5AA 3EXG2 4PGAA 3PXGA 1M2HA 1C7JA 4XYMA 1JGTA 3VMFA 3U6KA 1UBFA 4N3BA 2XITA 4LHWA 3PYXA 1GL7A 4PYRA 3DW1X 4JI4B 4ALLA 4GGPA 2C9ZA 4NWIA 4RXTA 1DIOB 2PJDA 4BQEA 4M1YA 2PMEA 2DQKA 2O2ZA 2WTXA 4LRTB 2A5LA 4YT8A 2DBYA 3CKYA 1GG8A 2ENWA 3WNCA 2GXUA 3IP8A 4HTFB 1QMPA 3NHYA 4OU5A 4HUQB 2G83A 4WKBA 5BN4A 1YFLA 2WG0A 2OXCA 4O4IA 3AESA 2ZR7A 2LW7A 1QYRA 5LD2C 2RIRA 2RHJA 4TMYA 2V0GA 2WV9A 2PH7A 1HMYA 4UHFA 4IIUA 3DKPA 3F7TA 3TJZA 2DFKB 1GQYA 1H4QA 5ALEA 1P9OA 5FCDA 1A5BB 3FCSB 4K9NA 2WYWA 4D3ZA 4D4LA 2CXOA 2VZ8A 3T1VA 3IEKA 4O4LF 3C6KA 3L41A 4IFEA 3T7RA 4P58A 3HNPA 3QLUC 5BO5A 3BTSA 3P0FA 4FR0A 1QTRA 3LQKA 5AVJA 2IHZA 4K9QA 3ITDA 1HK7A 3OX2A 3DMNA 2Y27A 1GPBA 4H59A 4TV8B 3CR8A 4C2BA 4JYPA 1THZA 5CJJA 3R7WB 3BGIA 3TXYA 2XNJA 2GR9A 3FGZA 1U1GA 4IKPA 4J1TA 1NAIA 1WZIA 2I80A 3LPLA 4Q1BA 2E48A 4WW0A 4XCXA 2NWQA 3R5HA 4BS9A 3GP3A 2OBFA 3GVHA 1NT4A 2IDJA 1P6QA 3LPCA 4C1NA 4KXXA 4HNTA 2GETA 4G26A 1GGNA 4ND3A 2QL5A 1ZKDA 4GECA 3KQNA 1T2UA 2ZJ3A 5I6DA 2P78A 3FPLA 4QPNA 3JQAA 3ZGOA 1QRRA 2H2HA 1H6DA 4GZ3A 4DLYA 2V0CA 4O2AF 1JI3A 4KBYA 1NFFA 4QXQA 2EHDA 4IHJB 4KLRA 4BMSA 5CFZA 3PGLA 1W35A 4I4TF 1PR2A 3NANA 2ETXA 2GJSA 2GCEA 3DOHA 3KWFA 1K8QA 4G2NA 2LUOA 3BSFA 1J97A 2IYWA 4C2UA 1T0BA 1ZITA 2BGLA 4WOCA 3VJKA 5LM3A 2ZM6B 4QUBA 2B21A 1NLMA 2AEJA 2X4GA 5AI0A 3V7UA 5K01A 3V3KA 3D3QA 1CIPA 1FDWA 2ZW9A 3KQWA 4G97A 1NY5A 1PT9A 3OIYA 3O26A 1H94A 1LBSA 1OJ7A 1CQIA 2BTOA 1OWMA 2QP9X 3LQYA 5HF8A 2C5AA 4GC5A 3T9FA 3R1IA 5AVZA 1XRLA 4YP5A 3WJ2A 3EDQA 3RYFA 3UOWA 1B2LA 2X6TA 3LF1A 2IYRA 5CFQA 4OKNA 2JK0A 4W9NA 2AHOA 3P9CA 2C7BA 4I4IA 3MQ4A 1KEEA 3BIWA 4BKUA 1T1JA 4F1JA 4FFWA 1T3SA 1SKMA 1ZINA 1NQOA 2GF2A 3L84A 4WXYB 3Q98A 3TOCA 3A6EA 2AKEA 3K5WA 3L1KA 4E14A 2VNJA 1EHCA 1HLDA 4P0PB 2W6MA 1JHQA 1TUGA 3Q0EA 3PGJA 2RH8A 1U90A 3QYPA 3SQWA 2RGBA 2X0EA 4ZJYA 1WCIA 5AIAA 1IY9A 3L8YA 4UVGA 3SHVA 5IFKA 4MIYA 3AOGA 3ZEIA 2WJZB 3EXHC 1KAQA 2O7RA 2ECFA 3FLAA 4JQOA 4DMUB 1OBOA 3W9UA 3WC4A 5JBQA 1P61B 1U8YA 4L7VA 5JVDF 4BZWA 2P91A 4O4JA 5B4VA 3WYDA 3U44A 1O6BA 1OR8A 2ECKA 4O33A 4REOA 3RYTC 1CVRA 4ZCMA 4TTIA 5KHOC 3EXHA 1EJ2A 1JU4A 2EL9A 4PWYA 3TZEA 3BWEA 2BF4A 4G0WA 2IEYA 2QX7A 2RK3A 4XAQA 3TB6A 3FCXA 4TV9A 3B2EA 1CS0A 2VG8A 1IL0A 3DL4A 3IVGA 4F5DA 1AKWA 1U63A 2A1TS 4WBNF 3FAZA 4GG1A 3I6ZA 3LCMA 4LE1A 3I2FA 1J1IA 4GPBA 4BGIA 3SVLA 2ID7A 2YFHA 5FB3A 4NH0A 4DY6A 4JL5A 1DTWA 1PL8A 1QGYA 4QWWA 2G76A 4ZHQA 3N0WA 1LQTA 4X63A 1L7VC 4MVJM 3DL7A 2AR0A 2J9ZB 3LX4A 3ZIAA 2I34A 1V7PC 3CB4A 2Y6VA 4V24A 1TT5B 2WUWE 5CFRA 3OLQA 3S3TA 4PC7A 1F3OA 1Y3BE 4OKSA 1TO1E 5THXA 5FNZA 1G55A 1FJ2A 2Z58A 3PRKE 5CXXA 2IPXA 3HB1A 5FI3A 3IUBA 1A4RA 4L5AA 4WZBA 3ND8A 3VR1A 4F86A 4KH0A 4WCFA 4UOQA 1AC5A 1KK2A 2OYCA 3REGA 3HCDA 4OJNA 1TGVA 1K3UB 4Y2GA 5BY2A 5K8VA 1O0BA 1NM5A 2NAPA 4MPRA 3O9VA 3P2EA 1V43A 2ADOA 3SJCA 3JZIA 2IY8A 2CFCA 2OCKA 4GNRA 4WFKA 1U2GA 4DW8A 5DNYB 4H1UA 1E1NA 5IDWA 3W78A 1EHIA 2YNMC 1GAWA 3GWGA 4LJKA 3MB5A 1Q0RA 4CG1A 1AZLA 3L77A 2EIHA 3NAGA 2BVNA 3E1GA 3O31A 5DCYA 3BRQA 1QH8B 2XUZA 3OU6A 5FUBA 4B1FA 1I0LA 2YJ3A 4ZQEA 3T7AA 1YZLA 2IBTA 3NLLA 1MT3A 3T7DA 4M7OA 3FPAA 4HNGA 4OHPA 3AQIA 3C41J 1C1XB 5KJCA 1FZQA 1IEVA 4ZOCA 2GPNA 1EVQA 2LIVA 1KZ7B 3E3NA 3IUMA 3LGXA 5J5AA 2O52A 3I6BA 4G9BA 4X20A 1OPRA 3UGKA 5D00A 3VOTA 3Q72A 4QEZA 2AZMA 4EMUA 3MOGA 4FFSA 7MHTA 4EYKA 3U3KA 1N6PA 1KPHA 1SC1A 5AVUA 4QE3A 4DMGA 1UT5A 4PSAA 3V6LA 4DPMA 4XR4A 1AUXA 5EJ2A 1JXMA 1UJ6A 3BGWA 4FGZA 1WQ1R 3ZBPA 1WF3A 3R0XA 2MR6A 3B9BA 4RY8A 2Q9CA 4LWOA 5MN5A 2V5UA 4Q1AA 4J4HA 3A9UA 1JIVA 2DTEA 3PCRB 1XZ8A 3Q3HA 2ISQA 1ZH4A 4ME6A 1E6WA 1WBJB 5LUBA 4Q9IA 2ZTLA 4LG1A 1GPNA 4Q1VA 5B4UA 3DEYX 2WWVD 4QPJC 3WR5A 4U7PB 1UK7A 4E33A 2B5WA 3Q87B 4JBIA 4OLJA 4LMPA 2J9XB 4Y2YA 2Q7DA 1QP4A 2IXEA 5KWIA 3DUFB 3CH6A 3FUCA 2G04A 1OI7A 1U9YA 3C6BA 3KB8A 1OX4A 1ZCZA 2VJMB 2EU8A 3R4VA 1SCJA 3AL3A 3UKOA 4YMGA 1W4BA 3ASUA 1DRVA 2ZVJA 3H7IA 3MMNA 3UNXA 3ZHQA 1OFIA 4DARA 4ER7A 1HR0B 2WSSD 2QX8A 3SHWA 4FK8A 1VIAA 1ZW6A 2ZSJA 3QFFA 4X90A 4N41A 1LDGA 3WL3A 3UGTA 2NVUA 1OE0A 3CE6A 1GTVA 5G4KA 3UHOA 1Z4OA 3KIPA 4XD2A 3S99A 1GLVA 4CCYA 5DNAA 2OZLA 1Q15A 4KRFA 2FLWA 4TOIA 1ST3A 5JSUA 1HGXA 1U0HC 1TMGE 3S1LA 3WOVA 1XZCA 4OAOA 2G1JA 4EEXA 3OMLA 4D74A 1QVWA 2A9KA 3CLRC 2O20A 5SICE 1X80A 3EQ7A 1ZUNA 4ZN6A 3F4KA 1COZA 3R7WA 4YP0A 3NT5A 2NVUB 2D1QA 2Q1YA 2EG5A 5FA6A 4EDFA 3JYPA 1OZHA 1N6RA 4D7AA 3IQGX 1ISRA 4YAWA 2IIPA 5DHTA 1ZH8A 3V1LA 3K6KA 2IGTA 2QYSA 3ID6C 4B4DA 3VUFA 2JRCA 2R4UA 4FSHA 2ZRCA 3DAYA 5BW6B 3RC2A 5IM4F 5FXMA 2Q8PA 2UZ0A 3HV2A 2WHPA 2VHCA 4IR7A 1LRJA 4E32A 1H4SA 4YRQA 2OILA 1SWVA 4KRXA 3OO1A 2IPLA 4LYJA 4N5LA 4PXYA 2QN1A 2X86A 4UBNA 1CNMA 3TRFA 4TX1A 2X2OA 1CJBA 2PKQO 3OWOA 3L6OO 1EU1A 1SUBA 1E1RD 3PR3A 3I0ZA 1NUQA 1U0GA 2QPOA 2GNOA 2J3MA 3R23A 4ICIA 1NBMD 4FKBA 1I5EA 1NULA 4FQ5A 2EJTA 4XJTA 5FLYA 4E6PA 2VCYA 4DAOA 2FQQA 5K8JB 2AEFA 1RRGA 3MCAA 3L6DA 3L7OA 3EJ6A 4NE7A 4MH0R 3A6PC 1XT6A 5DGCA 3DKRA 4ZRDA 2YOHA 3RK1A 1E98A 4IJKA 1UXJA 1HDYA 2Z0MA 2PDAA 3HBLA 4HLNA 4CEHB 4OLHA 4C76A 2FR8C 3DTYA 2G25A 1EXMA 2BE7A 3ABSB 3NAMA 2JLXA 4GAEA 2IYTA 1R0BA 1CUFA 1N6NA 2UVQA 1A9SA 1ADFA 1D2AA 1DKNA 1GZDA 1KYXA 3DVQX 1J99A 4G4SO 2GPBA 2OHOA 1RXYA 2AV6A 4GWGA 1N2IA 3OFVA 3USES 1TDJA 3PJDA 5JO0A 4GE3A 4BVBA 2YZMA 4UOZA 4WXMA 5KNLA 2W22A 5LYYA 3KLMX 5KJFA 2RC5A 4NE9A 2RHBA 3D8BA 5JCOC 3LUAA 4HDNA 4Q00A 3BXEA 5LWHA 3SCZA 3SJ7A 1E61A 3F49S 1G59A 4RQUA 4F2GA 4H7IA 2P8SA 2CXXA 5JCOA 1ADCA 3KKKA 3PDUA 2DMRA 5HE8A 2AZDA 2IUYA 3DA8A 2NMVA 5J4LA 2X41A 1U1DA 1NMEA 3DGFC 1MZVA 3GU3A 1EA5A 3JQ8A 4YALA 1TTQB 5ECDA 3SHQA 4D79A 2QRVA 4ZMRA 1OIXA 1W5SA 3CHYA 1ZD4A 1N6LA 1P9WA 3KTOA 4HDNB 4HDAA 3O4JA 4XJXA 2V7QA 1VG9B 4S12A 3IS3A 4JVNA 3M81A 4G0YA 1YHNA 1XZDA 2JLRA 3U61B 5JQGF 4IO0A 4R1NA 3U3ZA 4LBZA 3GY0A 5KKNB 1DU4A 3QVOA 1U0SY 1WULS 2V7XA 3E05A 3SC2A 4C14A 2G80A 3Q2KA 4ZQIA 4QFCA 4WZZA 1SB9A 2DPYA 4W8OA 2PUEA 1UM9A 1C3OB 1XI2A 3QX7A 4Q9NA 4QOJA 5KWVA 3CH4B 4PGHA 2PCJA 1X7ZA 2XBMA 2EKBA 2V3CC 3PGMA 4BFLA 4QUDA 3A7DA 3NGXA 3WLMA 2M6RA 1P31A 5E2IA 3A2NA 3K8QA 2YDYA 3ZYZA 1Y6FA 2IH5A 4G01B 1W47A 4F92B 5I9BA 5FOUA 3OFKA 4QYMA 4E1AA 5AW2A 2GAAA 1UM9B 3B8HA 3QE4A 3THSA 4WHMA 3WGQA 3ZHYA 4DCGA 4KYUA 1NSYA 3BQMB 1AGNA 3FNQA 1G18A 5DP2A 1L3BA 1T5SA 4AJPA 1C9JA 4RH1A 4D5GA 4M9XA 1D4ZA 2J3HA 4NR0A 4NZ9A 3K71B 1TLFA 4QUGA 3DC7A 1E3QA 3T7EA 5AM1A 3B20A 2O3TA 2AFIA 3RH0A 4GMDA 5JSYA 2PGIA 3UQYS 1TKBA 4GBMA 1T8TA 3CUWA 4O2LA 3A58B 3KSMA 1IY8A 3P0HA 4KDRA 3U7FB 2FFQA 2VBGA 4MWDA 3PJGA 2AMFA 1DKMA 3L1JA 4RFSA 2C7PA 5A6SA 3C39A 2F64A 3GJRA 4NZZA 1XAIA 4X45A 1Q21A 1UBOS 2H7YA 3EULA 5BT9A 4BBJA 5FFFA 5IKOA 3PPIA 2JVKA 3HWWA 1WY7A 4LDJA 3OJFA 1RFLA 3U9SA 3VX3A 1KDTA 4JVOA 1C9EA 1XMSA 4FR5A 4EKGA 2VYND 2A35A 4DVJA 5HOEA 2B83A 3S70A 1J39A 1G6Q1 5E0KB 1R1DA 3AM1A 1MX9A 4B9EA 1CTQA 2E82A 1THMA 3NRJA 3FNHA 2FP4B 3LA6A 4OGWA 2H1RA 4NBRA 5B55A 5I9TA 2N1MA 3KPJA 5JC8A 3PEWA 3UMRA 2CV2A 1YZUA 1N2CA 4AM8A 1TJNA 2Y71A 5LMUB 2XMQA 1X1DA 3IALA 2A7XA 1LBTA 4N8DA 4Q4HA 4A1FA 4JOQA 1YOBA 4INOA 3VDRA 5EMLA 1UKYA 2PUBA 1E2EA 1PJSA 3OWHA 1AUOA 2WSMA 3A1NA 4JQSA 1EAMA 4TTJA 1ACMA 2RH9B 3FNRA 5CH3A 4MKGA 3W8FA 2VPPA 1K7FB 2B82A 4N5NA 1XYVA 4AF6A 5KYWA 2CUKA 4RTKA 2QYTA 1WM1A 3T0FA 4DG9A 3PTAA 2Y0BA 5ITZB 5IABA 3MRSA 3D0QA 4L74A 1ZOOA 5GTDA 1C8BA 3CIFA 3OZEA 1JH9A 3OJLA 5P21A 2R1TA 4HY3A 2B0CA 2HD4A 2I9PA 4HS4A 4X7PA 5JS6A 3DE6X 3KQKA 2QLBA 1HT3A 5FO0A 1R00A 4OD0A 1HUQA 3WRVA 4O4IF 4DQVA 4P9NA 3G2QA 2A5FA 2IWHA 2FPGB 4B7CA 1A4UA 3EVGA 1RMQA 4MVYA 5AKXA 3SFZA 5ITZA 3TGPA 4TUYA 2DLDA 3ZKWB 1R8SA 5ALZA 5CEFA 2WHQA 1BN6A 1QG4A 1T36B 1Q7GA 4WUVA 1SIWA 2AJDA 1MB4A 3CUSA 3UXYA 2V6FA 4F4UA 1KPGA 1Y48E 4ZI7A 1T3LA 4Z5XA 2QIOA 1INLA 3SQLA 1POWA 1L4UA 3PXCX 1I2AA 1A8UA 2WJIA 3DWEX 1N6HA 3U09A 3SX0A 1WZ2A 3IVXA 3WMGA 3L46A 4EA8A 1S4QA 3FNFA 4AG3A 1CUHA 1UJ5A 2VYVA 5JT1A 2GJAA 2Z4SA 3B6KA 4XXHA 1YJQA 1L4YA 1YRWA 4QPPA 4Y2XA 1DHTA 4HDRB 1TRHA 1P1BA 1CIJA 1G20E 4MRVA 4AX4A 4I9FA 3R09A 1BFDA 1QIIA 2V7PA 2JAHA 5EOVA 3C7AA 4M1EA 4EKYA 4BN0A 1M1YB 3MMZA 1SCBA 1J8FA 2KLBA 2HSDA 2P68A 1XLUA 3JVVA 3R0JA 4ZT4A 3WHIA 4EHBA 7AT1A 1WF6A 3FPKA 1HQDA 3HO1A 1HE3A 2A86A 4JI8B 1UXGA 5EXPA 3C4QA 3UHJA 1PFKA 4WFIA 3ONFA 5EEGA 4DWOA 5BQ3A 1XCPA 3PFBA 5JCXA 4NE2A 1MQ9A 1I1HA 1ZGAA 2P9JA 1NGSA 1OVMA 2TMGA 2OWEA 3DLCA 4H0NA 5IUNC 5KYXA 4D3XA 1NLZA 1M2GA 3HM2A 4NPHA 5JSZA 1GPLA 1EX1A 1ZICA 1AGPA 2XKAA 1HNWB 4FEGA 2AFVA 1IDN1 3H2ZA 3D54D 1N2HA 1X70A 3OT5A 1C41A 5JNWA 4JJ7A 4EIWA 1CY1A 5DNWA 4AN4A 4Y2TA 1T2VA 4LCBA 4Q01A 2QTRA 5L7YA 1RP7A 4ETIA 3BHJA 3GFSA 2NSDA 3RROA 4ZAWA 3O83A 2QMYA 3WIUA 4ABTA 5IBPA 4KDEA 3NEYA 3JAMA 4YJKA 2W2OA 3ROTA 1ZDMA 3TWOA 5HQ3A 4IDFA 5FWAA 2C8JA 2PWYA 3HXTA 3WLFA 4LTNA 2VDWA 4HNRA 1OTHA 2BDUA 4DL9A 4LYFA 1MC1A 1PJ3A 3CZ5A 2HPHA 4N5MA 1IOVA 4N03A 2VRCA 1SUEA 1VLQA 1AKTA 5HJ5A 1WSWA 4LF7B 4DZTA 3IE0A 4E5NA 2J67A 2ZT8A 3BF8A 1UQTA 3MCWA 2FN4A 3V32A 2G82A 3II6X 4ZYYA 1VB3A 4J0CA 5EFOA 2JIQA 1NVGA 5JMPA 3CSSA 3EPRA 3UUGA 2VPXA 1QP0A 3SSNA 4LRQA 4P5DA 3WYGA 1VJRA 2AEMA 4BOYA 4OH1A 3R3XA 4TVBA 3RI3A 3WRYA 4ATNA 1OBCA 2Y1WA 2ZUBA 4B4KA 4BMXA 4JYMA 3C70A 1ZO8A 3PQ7A 5FPTA 4EJSC 3CNBA 4MWEA 1JDJA 2C61A 3KJZA 4TLLB 3WRYC 3DVSX 3R3ZA 2BI4A 1N8NA 4NABA 5EQFA 1ZA2A 2O2GA 4O29A 3EY4A 1AN0A 4K6KA 2QT9A 4OYRA 2WAXA 3KR9A 3NBKA 3PDWA 4B2PA 1KEUA 4YAGA 1TCUA 3CZMA 4L3OA 4KYTA 4EJSA 5J4YA 1P39A 4TMFA 4MEBA 1ZGGA 1Y1TA 3CE9A 5CA1B 4DANA 5KTPA 3AU8A 3WLLA 5F23A 5ITWA 1YVDA 1U3CA 4OOEA 5KYGA 1ULHA 3AY6A 2H9IA 5LR6A 1UMCA 2IX3A 4TZ6A 1K5GA 1OHHA 1PI3A 4QDOA 1QB8A 1S2DA 1J8QA 3O94A 4MICA 5BSEA 3LUHA 4UUNA 4KMRA 3SFVA 4LNUB 4WN9B 1Q0HA 3HCNA 2UYQA 1K8XB 1YFKA 2YIMA 5C32A 5GONA 1ZW1A 2B34A 1MJHA 3JPWA 2DPHA 1EZ4A 3EEQA 1I4TD 1QF9A 3U4IA 4G4SP 2NU8B 3KC2A 4FW8A 5H16A 3P2YA 5EWJB 4JJ4A 1K2WA 3WGMA 4MI3A 2R9VA 1OZAA 2VP6A 4NP6A 3H84A 4QU0A 1GT91 1VIVA 3DB1A 4D0RA 2VYCA 2V7EA 4HZUB 4NICA 1BWQA 2Q8QA 2P6PA 1CUCA 1K3TA 2VS1A 3HACA 3IOBA 4G1FA 4HWRA 4JL8A 4XQ9A 2H85A 2PU5A 4AJIA 3LQ2A 4C5CA 5AQ1A 3V1YA 3WGVA 2YV3A 4HRAA 4YUVA 1T1SA 1GJRA 3Q9NA 4J16C 1NY6A 3FMVA 1FTGA 2YCLA 4IJQA 1FS5A 1RYNA 3QVKA 1N1MA 4MVJE 1W52X 1DAIA 1HKUA 4MRRA 4YI5A 3GBVA 2DPLA 3U7HB 1H4TA 1UBMS 3O3NB 1QHSA 4F0JA 2D7JA 4LZWA 2PS3A 3H6KA 4I5DA 3EIUA 4HAWA 4FNGA 1MF7A 3EXEB 5TDHA 3S2EA 4BLQA 2VSQA 3TLCA 1FPQA 1Q0UA 1YE3A 3TBFA 3WL5A 4KREA 2QAGA 4KQHA 2IEBA 4BNFA 1GU7A 3WWDA 1SNYA 4R2WA 4OQFA 5BN5A 3H0CA 1P77A 3WBKA 5C1PA 3A1UA 3B2NA 1P0PA 5BQ5A 2C4NA 3HP4A 4PYOA 3VGJA 4KO3S 1R5BA 4RGVA 1BXRA 4WNAA 3USCS 3T7SA 5A3RA 2AK2A 1NR1A 1UBKS 2H3EA 1WMFA 2R6ZA 2VKQA 1ZP6A 3DD5A 4KN8A 4EA9A 3PVCA 4YI3A 3B3QA 3RYHA 3GAAA 3R40A 4BLPA 2BMJA 5I9NA 1FXSA 5E3IA 4LOKA 5CNIA 1SXJE 1BKSB 4NK4A 3H2BA 4FTWA 5IAKA 4XUCA 5EQJB 1RJ9B 3ZDQA 4IHJF 1JHPA 4WNAB 4IZIA 3GLFB 4QWMA 1XHFA 3LKBA 4B2LA 3KLNA 2QLTA 3IRVA 4QDKA 5E3JA 1VP9A 3HGTA 2XMCA 5LIPA 3ESDA 4QA9A 5K9ZA 5KYTA 3AONB 3QVGA 4RW0A 2Q29A 1YB7A 1AKYA 1XZAA 4X20B 5T4HA 2OUKA 3LJKA 5COQA 5JWRA 2AN4A 1CFZA 1F2TB 4RK4A 5GP1A 2IOFA 3UIEA 2V54A 5FLEX 3DV9A 1V9SA 4KNWA 2ZB2A 1QBKC 2H57A 3AVPA 1TCAA 4F71A 1X9HA 3T0IA 4TSFA 3KAKA 3R0IA 1XLTC 1FNDA 4HUQA 1ZI6A 4PQYA 2PMKA 2EGGA 1SZDA 4JOCA 4NCHA 2GBLA 1XDGA 2B8TA 5DX8A 2R8OA 1GGKA 4DC1A 4ZDKA 1YA6A 2P62A 2Q6IA 1KMQA 1NX6A 1ZYUA 2H1WA 2X1LA 1U8CB 2Y0EA 4JBXA 1TYDE 4YH1A 3ZQUA 1B8UA 1REQA 3VAYA 1CUGA 2G5CA 5EP1A 5FADA 1B8NA 2VJYA 4D4MA 2GH1A 1LLFA 4TLBA 4DLVA 1OH8A 5FNVF 2O54A 3GPDG 1ZMOA 4LIPD 2N75A 4A16A 4UBJA 4BLSA 2XGSA 1N9GB 1T26A 3SZGA 2VBFA 4GKVA 5IAEA 2B37A 1DJLA 3WWPA 2EKDA 3VR0A 3ASYA 2IOFK 3ZI4A 4O5OA 5U4QA 3TIFA 3P2IA 4QARA 3U9TA 5KOIA 1TAQA 2HQ1A 3VDXA 1VLJA 4EB6B 4UEKA 2V97A 1XQWA 3CG0A 4J1SA 1U80A 2QENA 4CCYB 4U1RA 5FPYA 4IEIA 3UUWA 5HUJA 1C1XA 2DP4E 4G5RA 1X3LA 3NTLA 2R1TB 3BCHA 1P7PA 2FW1A 4KO8A 2HK8A 1LGYA 4ARUA 4Z4FA 1XELA 1GAQA 1MH9A 4I55F 4UARA 5P8WA 4G5GA 4R31A 4B45A 4DDHA 1Z5ZA 1I6LA 1X80B 4HAVA 4UXIA 3CWCA 4B8YA 4BP1A 4QDUA 4CMBA 4DJDC 1JLSA 1L7AA 1N5MA 1DX9A 5KSOA 1LW7A 1XRRA 1KSJA 1GXSB 1E7YA 3DL0A 3FUXA 5A5FA 2L2QA 4S05A 2XXJA 1MB2A 3LI2A 1RM4A 2QTMA 1LSOA 3NVDA 3PPYA 3WFIA 4EX6A 1GSIA 3PZRA 4LDZA 2O8EA 2EZ9A 1NRJB 4Q7QA 1F6DA 2RGNA 3FTDA 1RWPA 2PX6A 3CA8A 3O8LA 3IEIA 2I6QA 2WUGA 1O77A 1KKMA 1DOHA 1UP6A 3W5IA 3TD9A 4CKCB 2DFVA 2CNLA 2IZOA 2QSZA 2YFQA 4B79A 1PQWA 3Q8LA 4WN3A 1NVKA 1JPNA 4A15A 1JJIA 4QU9A 1Z12A 5BSMA 4XOIA 1GG5A 1QQ7A 1WDWB 2X14A 3JYOA 5CB4A 2HK7A 3LRTA 4L8WB 5FWYA 5J47A 4DV1B 1GKUB 4LYHA 3R9XA 4H4DA 1B8PA 2J3DA 3PUYA 2IV7A 5AKYA 4ZI5A 1OFUX 4QASA 3N6VA 2GPYA 4QUHA 3EPJA 2F3QA 1SD2A 2KWIA 1A9XB 4CUZA 1SOUA 3ZV6A 3R6LA 4K28A 3TLZA 1M7HA 2QTBA 3KB2A 4LVNA 4JBWA 2WJGA 3D8TA 3MUFA 1ARZA 2FSHA 3RHZA 1GUBA 1P2GA 5FH9A 5C8VA 4QAQA 3ZU4A 1JPUA 1V8FA 4P81A 4N54A 1GGHA 4OBBA 4BX3A 4DR2B 1I33A 1P7VA 4KVGA 2BC9A 2BKEA 3JYQA 3LU1A 4RHEA 3C3XA 4WY5A 3QBTA 5HQ3B 4DV7B 2HLPA 1OB2A 1JLMA 3S2ZA 1G0NA 2IUSA 4U7WA 2JBAB 3P9SA 4CDMA 5JVDA 2CLHB 4XDYA 5CX4A 1AU9A 4X41A 4JUDX 5JALA 3CISA 2DAPA 1FNSA 4KWHA 3GLTA 2XHZA 1Y9AA 3DCNA 3FTQA 3K16A 4EUEA 3D7MA 1PK7A 4AZ3B 4RK6A 2GCNA 3F2IA 5AHXA 2BEWA 1N34B 4IIDA 1ZCAA 4RE6A 3RVBA 1BHO1 1XSEA 4HZUA 2HADA 5HIKA 2V7QD 5L3VA 1GLNA 3ZQ4A 5D5HA 1QVRA 4DR7B 1BVHA 1IVNA 5C7YA 5AWFC 4P2BA 3N3AC 3KOUA 1YQUA 1KEPA 4CV2A 2OXFA 3M3PA 2YJ4A 3T9DA 1ZK4A 1SC9A 3JQAD 5JMOA 3EA0A 1AQYA 2Z6AA 1K5HA 4TWIA 2JAWA 1ZCJA 3MCUA 2JEOA 3IMKA 2B7BA 4L72A 5ALUA 1Y4DE 3ESBA 1TM2A 3FJOA 3PUHA 4FSXA 2BAGA 1KQNA 2GZSA 1Y81A 5LDDC 4FGKA 3WWEA 3LHKA 1NNUA 4X7MA 1F1BA 3VNUA 2ZETA 4CQNA 1D9ZA 1DG3A 4OLBA 3FHLA 4FKMA 2GXAA 1NPYA 3TAUA 3AF2A 3TDMA 2V3WA 2C2KA 2IQIA 4XVUA 1JFSA 2OR3A 1E2FA 2PSJA 4ZAVA 1T5BA 3NV9A 5TMEA 2GTPA 1Z39A 3EWAA 1Q7BA 4P0TA 3VPHA 3ZD7A 1G9TA 3EZLA 4A6DA 1VE5A 1XZMA 2ORIA 3LP6A 1UAGA 4IQFA 2ZE8A 4WJKB 4ZVSA 1G3RA 4Q02A 1N5OX 4EPVA 2R8YA 2VXBA 4P4TA 4RIIA 3DFKA 2OVFA 2PKRA 1PG2A 1USVA 5AI6A 5CFOA 2ZRPA 4J75A 3TLGA 2BN4A 3THWA 2J6BA 3V1MA 3O8RA 5ALYA 2A5JA 3AZQA 1EH5A 1I9GA 1RYDA 5CVTA 1K6XA 2BR4A 2JI8A 1XWWA 1KQPA 1EP9A 2OQVA 4PFKA 1XQVA 2YTZA 2BKUA 4I1UA 4NS4A 2ZZKA 4HP8A 4KX5A 1PTKA 1T8WA 3L3BA 3VVCA 4I6EA 3QYAA 3FB1A 3F3SA 5IM5A 4C3ZA 3ZJ4A 5CDSA 2JIZA 2EF0A 3PIDA 4EG8A 3RS4A 3ZGZA 2NXWA 4OHMA 4PTZA 1UANA 1Z4KA 1ZM3A 3EIOA 2NQTA 3G9QA 3N2KB 3IUYA 5B1SA 3SJUA 2WINI 2FPRA 1YRYE 4HEA6 1YDGA 3ET5A 2ZJYA 2I3AA 3D6MA 1FP2A 3PFWO 4Y2PA 5CEJA 1TO2E 1GYQA 4BU1A 3PCTA 4V0LA 5HQTA 1XK6A 1Y4UA 3B3FA 3CVUA 1DSSG 2HCTA 2XMRA 4HUTA 4ZT6A 3H99A 4GPEA 2HCRA 3AWDA 3BDIA 2G1AA 1ZJ4A 3LE8A 4DDTA 3M4ZA 4G09A 3PBKA 4R1PA 4EG6A 5EKXA 2V5VA 4NEHB 3QVMA 2OV2A 2QW0X 3JD3A 5FF9A 4DDMA 2PT5A 3RFXA 2I2AA 3ZE0B 3AINA 1M2VB 1XVIA 1G8KA 1FNNA 1MT0A 2JZCA 3KB6A 1LF0A 4YASA 1BEEA 5DYTA 5T57A 3VTAA 3W04A 4BNHA 1CU1A 4D4GA 1QNLA 4DUZB 1NL3A 2EJWA 3UV6A 2J5QA 2VVTA 5JNTA 2PUAA 2E4WA 3KFVA 4TKLA 3P9KA 4GWKA 3UO8B 5DIZA 3ZWKA 1KMIY 3GEGA 1WLSA 4WT7A 5CHEA 4UZSA 5DTQA 3PG5A 2WAAA 1C50A 4QXOA 1ULTA 2A84A 1TTTA 4B6OA 5FDFA 2PSSA 1T9GS 1JWBB 2A5YB 5TIIA 1EFTA 1OF1A 2WICA 5JDCA 3MJHA 2AOTA 3MTJA 1E3MA 3QV1A 1AK1A 4D81A 2J0EA 2G9VA 1RAFA 3GZJA 3HA5A 3I9V1 2HXSA 2BGRA 2HA6A 2IIVA 5ICFA 4NATA 1PSZA 2FPIA 4JB0A 2GD0A 4O25A 4OXQA 1MABB 2CC2A 3B1WA 3KDPA 1T8PA 1B43A 2A3NA 1XCOA 4L16A 4LBYA 1JEQB 3BOSA 1AHIA 4ZT3A 3I9OA 3SR4A 3WGNA 4AMZA 3MJ4A 5KOJB 5AVKA 4XW2A 2BFMA 3PFHA 4ZMBA 5G53C 5H0IA 1SVMA 1DEAA 1TFUA 3G68A 3GDFA 4N39A 4QOGA 5EP4A 2PBRA 2X8LA 5K3FB 3DYIA 1KSHA 621PA 2WJJA 4Z4GA 1H2XA 4DYHA 1EGMB 3SIXA 3PV0A 2JLYA 4ARSA 1BJKA 4O4IB 2VQSA 1H8EA 1GFWA 3MTDA 2WTUA 2B4TO 4FILA 1OV4A 2YY5A 3GXBA 5AVQA 2NO5A 5FD8A 2XWQA 1HTTA 2OB1A 4YBZA 1VDMA 4I1IA 2EBFX 4W8HA 1PYDA 1USUA 1CULC 3WWOA 2BZ0A 2VWQA 2QQ0A 1RLMA 2XUIA 1KERA 5L3SA 2AZTA 2DKFA 4QUEA 4M1KA 4LWPA 4UEJA 5DWQA 2IW3A 3MJDA 1UZLA 3AFOA 1FF9A 3BTVA 5IBRA 2QTFA 2RHTA 4UHEA 5A0TA 2Q5IA 3OE7A 4AFNA 1E9RA 3JQRA 3TX2A 3AFNA 2WMOB 5IANA 1UKCA 3Q5EA 3FOEC 5EY5B 2IYZA 2EQBA 1ZD1A 2QF7A 1SFRA 3B3JA 4IZ6A 4ND6A 4PFSA 4TXHA 4TYYA 1QMGA 1QCCA 5BR1A 2N9UA 721PA 5D01A 4BIIA 1E3JA 1UP4A 3ACDA 1EFLA 1RQPA 4S1WA 4LAFA 4DG5A 1FTNA 4OG2A 4IOKA 4IGKA 2GXSA 1ISJA 2R60A 3H97A 1FFBA 1C9NA 3BIFA 2JGDA 1ECGA 1K7XB 2ZT7A 1EQAA 4AJ1A 3GJ3A 1QHIA 2R4QA 2W2VA 2PO7A 5CVDA 3RV3A 1NURA 2DVMA 1VLLA 5ER9A 5CCDA 3RUCA 1NW3A 1YOVA 4ZT2A 4C22A 4E1VA 4HWSA 4LECA 2YMQA 4U4AA 4YUAA 4JI0B 1PG5A 3SS9X 1ZD3A 1RYEA 4OQMA 2GD2A 1Q7RA 4RC9A 4ZGWA 2QR5A 2NG1A 1J42A 3U7EB 5BSHA 1WMDA 2EEPA 2HSZA 1E9EA 2HV9A 3G5UA 3D5EA 3EDMA 5ADWA 3ZDBA 1NTRA 5DTJA 1DI0A 3NPAA 1SHKA 4FMDF 2NSYA 4JKIA 1P45A 3WJ1A 4H1TA 2WLSA 4H0FA 1VHWA 1XNQB 4GLFA 4PG6A 4GMKA 4KJZA 4L4ZA 5LP6B 3NDBB 1OWPA 4Q1EA 4JSYA 4BUJA 4E4YA 4CTMA 1FP6A 2YWFA 3PWTA 1DAKA 5TS2A 2I9KA 3OQVA 1HE5A 4ZI7F 2VQ3A 3KKMA 2R25B 2VJNA 3ETLA 3DBHA 5TSDA 3TSAA 5DTMA 5EFZA 4LC9A 1PP4A 3OEHA 1ECFA 3ED1A 3HZOA 2DETA 3AEUA 1HEIA 1KAMA 1NUSA 2ZBRA 3CMCO 3ISTA 3GXOA 4Q3OA 5DIFA 3TL3A 4BVJA 1KARA 1NQWA 1QVAA 3DTTA 5JPIA 2GHRA 3VPGA 2H4YA 1G8AA 3EARA 5E9QA 1LNQA 1N25A 2VDRB 1KH1A 1UXOA 2Z5LA 1R8XA 3AGQA 3ZWYA 1HTBA 2PX2A 2Q5QA 3F5SA 1H6BA 2J9FA 1VP3A 4LK2A 3HFRA 3DH0A 2VJCA 1XVLA 1A2BA 1SJ9A 1X7WA 3DMTC 1GL9B 4MUFA 3GEMA 4NJEA 5F9MA 1NZFA 2CUTA 4BEVA 2HSGA 2YYAA 4AURA 2X0FA 1Q6ZA 4CZ2A 3CLUD 2C7QA 1KK0A 3BILA 3G2NA 3LQFA 5D5PA 3DLTA 4OGGA 2Q6TA 2D4HA 2AQKA 3DMTA 3ELYA 1K1EA 2WJWA 4JJIA 2B8EA 2O50A 5EWJA 4ENUA 1ZH6A 5FTKA 3C3EA 3H9QA 2PZ8A 2IYAA 4AUMA 5KTSA 3ILHA 1W0JA 3DAFA 4IIFA 4EDHA 2O3UA 2PEYA 3D4NA 3NXSA 3OC0A 4O4LA 3KUDA 4QO8A 1RCTE 3MTBA 4UJ5A 2BFDB 4GLJA 3TDNA 3GH3A 3AR5A 3A0RB 4M0FA 1UKBA 2I3BA 2XQIA 1K2VN 1WUTA 3MJCA 5C52B 3BKXA 5J63A 4XDGA 4L8LA 3CNOA 5DLDA 2Q1TA 2XCLA 5EJIA 1DXQA 3M6WA 4MVWA 3UWPA 5DTIA 1R8YA 3PE4A 3QY9A 4WBXC 3ZWCA 1LK0A 3F46A 4CLDA 3PNVA 2EZTA 5A3SA 4PZLA 2B8JA 3SYNA 2BFDA 1FE8A 1VC2A 3CR3C 1GNTA 3EYWA 2RC6A 2B7LA 3UT0A 3T35A 3SF0A 1CQXA 1NXTA 1ZY2A 4XX0A 1RKVA 3JQ7A 3CIOA 4D57A 1G3IA 3OJXA 4FDTA 1Y37A 1IK6A 1GPWB 3HE3A 1DX6A 2J85A 1V96A 3LL4A 3P94A 2OP1A 4FGSA 4J0DA 3U0VA 3W77A 4ZAXA 3WYNA 3EDYA 4PM4A 4UE3S 3MOIA 3ZY5A 4KRGA 5ALRA 3RD5A 3AJ9A 3T5GA 3QLUA 3TLMA 4ALMA 2P9ZA 4KFUA 3RSQA 3ZHBA 1LBQA 4TV9B 4UXHA 3F71A 3UB2A 3HMKA 4GPZA 1DXYA 1NFQA 1G7CA 1IHDA 1Y1KE 3DP7A 3EIQA 3LPDA 1P18A 1Z08A 3BD7A 5JI2E 1IMJA 1IIRA 2W6IA 2HJRA 2QQFA 3V7NA 4E70A 3T1TA 4TTVA 3FFBA 4LFAB 3LLMA 2FWRA 4CL8A 2H6EA 1C30A 1SPXA 1TJ5A 4U7JA 2Y99A 4MUXA 3AKZA 5IJZA 2PFKA 3QBJA 2HTEA 4K9RA 4B80A 1KZHA 4EF5A 3OZXA 1KEKA 1UF9A 1FUKA 1DKQA 1VSQA 2TMDA 3ABQB 3HEAA 3KYBA 3LS2A 5DT9A 4DCUA 5TV2A 4IY1A 4TMXA 4OBWA 3W8NA 3N87A 1WXHA 2V7VA 4MQ6A 3W2IA 2BD0A 3MJRA 1JR2A 2QRLA 3OH8A 4CFZA 3FTEA 5D2CA 1FY2A 3GJ8A 5LU9A 3IULA 2O8BA 3B1YA 3JU3A 3HGMA 4II7A 4KW7A 3RVMA 1CCWA 1WXIA 5F4BA 5K45A 2C3MA 1H66A 1Q22A 3A31A 4N1AA 5LC1A 5FV4A 1OT5A 2ZI6A 5IG2A 5KQLA 2JA2A 2QAGB 2IE8A 2OENG 2IYOA 1P1IA 1KJWA 2WA2A 1RKXA 4UM9D 5M7EA 1VXRA 1YQTA 3DDWA 3CLTC 2FLVA 1BDJA 1B3BA 3GZ4A 3PIRA 4G0NA 3OFJA 4EA6A 3WGOA 5B30A 2BDTA 3KM0A 1W2GA 2NZYA 4MS1B 1R3UA 1REQB 2TYSB 3IQIX 2ZK7A 1JHOA 4UUBA 4X54A 2ZB7A 2O8CA 2JI7A 2W70A 1V1MA 3L79A 1E9VA 3AFMA 3QKRA 4MSUA 4XWGA 3DLHA 5KSZA 1Z63A 1V8PA 1DELA 4J0EA 3ZHCA 1PLKA 2CYAA 2EIXA 1QS0A 2GPWA 2JNWA 1PIWA 4DILA 3PNLA 4Q93A 3DVAB 2YRXA 4FJ2A 5G0UA 3BK2A 2Y67A 3WIEA 5IJ0B 1Z47A 2GA8A 3PFIA 4M1MA 1GNSA 4LJ6A 4MB6A 1YFJA 3AHGA 3IXQA 3EZ7A 1OXVA 2WP0A 1EBFA 1NDHA 1RXUA 2HJHA 2P11A 2QZZA 3A9VA 4TMKA 4TSRA 2H2IA 3RK0A 1T4BA 4EECA 2JFFA 2E9SA 3U4AA 3L0ZA 4FGJA 1RLIA 1Z2NX 1G6HA 4BLWA 2QTGA 1GD1O 1RBZA 1VMKA 2CHUA 4DLZA 2O3JA 3RIYA 4JVMA 4UKDA 4DC0A 4GP7A 4IVQA 2JIZD 1ZNQO 2LTAA 2YRWA 3OQJA 5FI1B 2AVNA 1TKRA 4BIMA 2O8NA 5CTAA 3GDHA 5TARA 4CRWB 4RORA 2NVOA 5LLDA 3VQTA 4IG9A 5EUBA 4D43A 5A05A 5F98A 3Q8XB 1ZS9A 2X0RA 1ATIA 1Q17A 3QI2A 2R7LA 3W5HA 1KIAA 3SR3A 2QBYB 3QW2A 4L9SA 2XWBF 4IOMA 2ID9A 1OUMA 2IOHA 3GCDA 2BL4A 4O4HB 2Y8EA 1E8DA 1M6WA 4E0BA 1SXJB 2Y1XA 3KJHA 4MV3A 1SUWA 4KWTA 1SQ5A 1P5FA 1R10A 1W6RA 3JAKB 4XFDA 3A3KA 2HWYA 3SG0A 4PAOA 1JRLA 2WW8A 3RTDA 1DE0A 2CNKA 2EARA 3A4TA 4RHFA 4H17A 1EGHA 1JIJA 4C0AC 3INYA 3IVAA 3PEEA 1BVYF 4DIMA 2CV1A 4CF3A 4ZCIA 5ADHA 2IQ5A 5FR2A 3LK6A 4BDSA 2Q8NA 4CG0A 4G67A 4J90A 3KT6A 3F78A 1ZUNB 2E4AA 2HYIC 4FOSA 1I3NA 2XYGA 1KNXA 1NXVA 2RGUA 4UC0A 4HFRA 3WRXC 1TU3A 5KMGB 2G9QA 3LL7A 4KHPB 2EYUA 3LUCA 3I76A 4L8GA 4RA6A 1L7QA 4G6ZA 4RQAA 2J1LA 3ASVA 5AW0A 2ZYSA 4MINA 2FYTA 4JA2A 4U2GA 4AK9A 1SUAA 3WFJA 3QUTA 1XU4A 4RYLA 5JWHA 4KSCA 4KX3A 4QGGA 5LYJB 1E0SA 2I66A 1EHYA 1R37A 4MQ5A 4F4DA 5IT9A 2NX2A 4HD8A 3ZWNA 3V7FA 2QM0A 1RYMA 5E8JA 3MBOA 2BKLA 3H5TA 4A0FA 3EDOA 3EGDB 1UPTA 1V0JA 4AMGA 4ERXA 3FBWA 1MORA 3QQ5A 1Z13A 2J9FB 2JJ1A 2QKYA 4HWTA 3UMBA