3A3KA

Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain: Possible allosteric regulation and a conserved structural motif for the chloride-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
molecule keywords Atrial natriuretic peptide receptor A
total genus 146
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a3kA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a3kA01
4RK1A 2IKSA 4HNRA 5IUNC 5IULC 3FFWA 4NV3A 4UHKA 5CNIA 2V0NA 4S05A 2LBPA 4P1ZA 2Q5CA 4W5QA 4LE0A 4G0PA 4WXMA 4YGXB 1QPZA 1XHFA 1EFAA 2MYUA 2I6FA 3N53A 4RY9A 2GI4A 2JCGA 1NXSA 3EGCA 4IILA 4RY8A 2ZWMA 3CKMA 4IMJB 1RXEA 4GNRA 3HVRA 4MR7B 4KNYA 1AB5A 5GOTA 1IIBA 2MYPA 4JAVC 3CZCA 1D2AA 2WJAA 5JNUA 3OQMA 4MS1B 3MIZA 2GWRA 1JYFA 1VRVA 1GCAA 2VK2A 3A0RB 1RXIA 4RWEA 3SG0A 2MYNA 3MQ4A 4RV5A 5TQJA 2ZAYA 2NZUG 4Z0NA 4RK5A 3LUAA 4WUTA 3C6QA 4IRXA 4HYEA 1RZRD 3RVQA 4CBVA 1ZGGA 4W5TA 2FXIA 2ID7A 3F73A 1EWVA 3RVOA 4GPAA 4TLMB 1FSPA 3C3MA 1FFSA 3CG4A 2PKXA 2FEWB 3NNDA 4G0MA 4KK3A 5GQSA 4HNSA 2IDMA 4S04A 2FLKA 4PE5B 2IPNA 3OM1A 5TPZD 2FLWA 3IP5A 4OG2A 4NCBA 4N0PA 2L19A 4N03A 5ED4A 3EJWA 5FWXA 1MB3A 3LKVA 3OO1A 4EYOA 3BRSA 4IGAA 3T8YA 2MYTA 2FKAA 3I5AA 3GL9A 3UUGA 4MLCA 4WZZA 3K4HA 5TQ0B 1D4ZA 3QX8A 1D1QA 3VNBA 3GYBA 1YVUA 5B3JC 1SD5A 1DJMA 3H5OA 1ABFA 1LJLA 3H5IA 1Z2EA 3KLNA 3B2NA 3HS3A 2HQBA 4RK6A 3N8IA 1ZDMA 5JNVA 2PUDA 1MB0A 3OLWA 2WY2D 2RJNA 2NZVG 4L85A 4OLBA 3BREA 3H1GA 1HEYA 1Z18A 2L2QA 4MQEA 5TPZA 3IP9A 3RVSA 4XLTA 2FN8A 1GLGA 2E4WA 3H5VA 4MS1A 1AB6A 2PL1A 1NXTA 4KK4A 5IEBA 4FE4A 2IOYA 1NTRA 4Z99A 4LDAA 5BQ3A 3KJXA 4RK7A 3L49A 1PHRA 5TQ2A 1JFVA 1ZVVA 2CHFA 1JDNA 2R25B 3KTOA 3HM9A 5IUKC 2QVGA 2GBPA 4KFCA 1RPJA 2J48A 5KC9A 4QYMA 1PNTA 1LJUA 4TLLB 1MAVA 4RY0A 3CLKA 4MR9A 2FW0A 1OXBB 1URPA 3QLTA 4RSMA 4G0QA 4EVQA 5FWYA 4KV7A 6CHYA 1QP0A 1NY5A 3CNBA 3OMWA 3ROTA 4G0OA 2PE5A 3LTEA 2NUBA 2B1JA 1TJYA 3TD9A 5ABPA 3JVIA 1GCGA 5TPWA 7ABPA 3HEBA 4O5AA 3LUHA 4B09A 2JBAB 1DRKA 3JTEA 4MGEA 4P98A 3SQNA 5JNRA 3H5WA 3JPWA 3BILA 3HV2A 1Z16A 2PUFA 4D74A 2QZJA 3CS3A 3SM9A 1ISRA 1USGA 3HUUA 2CHEA 4XFKA 4H60A 2W42A 3FFXA 3A0UA 4ZMSA 1S8NA 2IPAB 5CNJA 2F8SA 3UKJA 4Z4GA 4LZLA 5DCLA 3TMYA 3HZHA 4RXUA 4MQEB 4ZYLA 3CHYA 1QNLA 2PLNA 4Q6BA 9ABPA 4PZ0A 5I4CA 1LK0A 2A9RA 2FEPA 1DC8A 2WJWA 4XAQA 3OQNA 4N41A 4EYGA 2DRIA 4MRMB 4XARA 4O1HA 3Q15C 3KHTA 4MQFA 3F6PA 4QICA 4YLEA 1DBQA 4D6YA 2RDMA 4O1IA 3DZDA 3A3KA 3MA0A 2P4UA 1M5UA 3GA5A 4DN6A 3OO0A 4PEVA 3S99A 2L18A 2R4QA 1YMVA 3E61A 3O2JA 4ETIA 1SRRA 1BVHA 4YRZA 2BGGA 4OBBA 1E6MA 2HSGA 5FWXB 4JOQA 3L6UA 3JVDA 3BRQA 1PEYA 2JBAA 3O74A 3EQ2A 4OTZA 4RKRA 4IF4A 4RU1A 2CWDA 3D8UA 3MF4A 2WWVD 1D5WA 2JK1A 4KPYA 1KRXA 3SY8A 1ZITA 3CTPA 4Z9BA 1RZRA 1LBHA 1QKKA 3OQOA 2GKGA 4ML3A 2IPLA 2FMIA 1LBIA 4QPJC 4XXHA 1BDJA 4YCSA 1KMIY 1DCFA 1APBA 1NXVA 2OQRA 1NXPA 3RQIA 3N6VA 2VUHB 3HK2A 1Z25A 3QEKA 4KVFA 2O20A 4Z4IA 4F11A 5JS1A 2LPMA 3JY6A 4RKQA 1MIHA 1NXWA 1JLKA 2AYXA 4RXMA 3LOPA 3EDCA 3I09A 4H3KB 1FQWA 2R48A 1Z17A 2PMCA 3VNAA 1L5YA 1Z13A 4EY3A 2IYNA 1FFWA 4JB0A 4RS3A 1PUXA 4FE7A 3ROFA 1JYEA 2FVYA 5IBQA 2NT4A 3M9WA 3O75A 5DGCA 3NBMA 2QU7A 3EQZA 2JVJA 2A9QA 3NNNA 4N47A 2PUBA 4W5NA 4MR7A 3RVNA 1F51E 5BRJA 4ZPJA 3GV0A 2E4UA 3IPAA 5KI6A 4W5OA 1H9CA 2PAFA 4TN5A 3O1HB 4Z9AA 4MAAA 2FEKA 3RVKA 5BR1A 3CG0A 3EAFA 4WWHA 1C0EA 3Q7RA 4MPTA 5BRAA 3DLBA 3N75A 5TQ0A 2RJOA 1U2QA 2JB9A 1NXXA 3QLVC 1YK0A 1TM2A 1YS7A 1SXIA 4MR9B 3C3WA 1F4VA 5FWYB 1Z2DA 1DCKA 4Y9TA 6ABPA 3MYYA 5DLEA 1M2EA 1ZHHA 4G0ZA 1VLZA 1W25A 1QO0A 3H5LA 3KG2A 5HM6A 3KSMA 2FMKA 2FTKE 2TMYA 1ZY2A 2FSPA 1U0SY 4PICA 1BA2A 4JB2A 1ZAYA 1EHCA 1M2FA 1E6KA 1SXGA 3IPCA 1JFSA 2PL9A 3H1EA 3CRNA 1GUDA 2VYCA 3KS9A 3IP7A 5C5CA 1EAYA 4G0XA 3H5TA 1JWLA 1K68A 4Z4EA 4QYWA 4MR8A 1Z12A 2M1ZA 3O2SB 1C4WA 3CFYA 4PYRA 3A10A 4NCAA 3ILHA 3LUJA 5KQMA 3I45A 5D2CA 4E7OA 4F8JA 3I42A 5FBKA 4HNQA 3DBIA 2QW1A 1ZH4A 3GWGA 1A2OA 3LUDA 3KCNA 3HO1A 4LRQA 1I3CA 2A9PA 3LKBA 1E2BA 4N0QA 1JFTA 3RVLA 1CEYA 3EODA 3K9CA 1B00A 1ZH2A 4MYRA 2E4XA 2FQXA 5JNTA 3QLUA 4YP9A 2XDYA 3D02A 4Z4HA 3DLHA 5CNMA 2FQWA 4DADA 3RVJA 4IMIB 3GRCA 4F3TA 2A9OA 1JX6A 5TQ2B 2JRLA 3UK0A 1CYEA 4YWHA 3O1IC 2MSKA 3LFTA 1U8TA 2YHBA 1NXOA 3GT7A 1UDRA 3Q41A 1SXHA 2H3HA 2FQYA 1J56A 4ZJPA 3IDOA 4RDCA 4OATA 4RK0A 1USKA 1XWWA 4FB4A 3TX6A 3G85A 3RH0A 2LUOA 5T7BA 1E6LA 5KQGA 1OXKB 2HQOA 3T6KA 4G86A 4UHJA 2HJ9A 5FBHA 5JNWA 3HUTA 1D1PA 1VKRA 4XASA 1DC7A 1JH9A 1A0OA 1DBWA 2NT3A 2OENG 3N0XA 3HSYA 1KRWA 1BAPA 4RZSA 2LIVA 2R47A 3QELB 3T95A 4MR8B 5E3JA 1YIOA 1ZN2A 2ID9A 4EGSA 4KQ9A 1EWKA 4LE1A 5PNTA 8ABPA 4Q7EA 3KYJB 3FDFA 3LUKA 3NNSA 5EWLA 3RVMA 4ETNA 3NHZA 2QSJA 4MLDA 2PUGA 2E4VA 3F7NA 5CNKA 3H75A 4KQCA 3SNKA 3O2QB 3OMXA 5IEJA 3SAJA 3M9XA 2QV0A 3JPYA 4M88A 3HDVA 4ETMA 1PNRA 3URMA 1ABEA 1FFGA 2AYZA 2FMHA 3KYIB 4NQRA 3Q9SA 4EVSA 1DCMA 5F64A 2CD7A 3F6CA 4YV7A 3LMKA 1Z15A 3KLOA 1JF8A 3C97A 1P6UA 3EULA 4EVRA 1USIA 1TMYA 3N0WA 1TVMA 3Q7TA 1QMPA 4RK4A 4F12A 3T38A 1Z26A 4MRMA 5EWLB 3MM4A 1DP4A 1M5TA 2M98A 4LDZA 5CHYA 5EWJB 4Z4FA 2WRZA 5KWSA 4RXTA 3NHMA 3QLUC 5EWMA 3H6GA 3O1JC 2WMYA 1JDPA 5IC5A 3OM0A 5KQLA 1YK1A 3QX9A 4KZKA 1KGSA 3FGZA 4KMRA 1DG9A 1JL3A 2VUIB 3H6HA 1JBEA 2HQRA 1QO0D 1R8JA 1A04A 3QELA 2PJUA 3QK7A 3HDGA 2QVCA 2RGYA 2GX6A 1WETA 4OLAA 1P8AA 2B4AA 1K66A 3Q7SA 4JP1A 4EYKA 4H3HB 4KRFA 1DBPA 5B3JA 3ILYA 4ZMRA 3KKEA 2LP4Y 1P2FA 4EYQA 3LUGA 5EWJA 1W9HA 4NICA 4E7PA 2E4YA 2L17A 1XHEA 1U04A 4LX8A 5TPWB 5HSGA 1ISSA 3JS5A 2JVIA 3M6MD 1JHZA 4EUKA 5TE9A 2FMFA 3QLVA 3CZ5A 5JS2A 1DRJA 2PUAA 4Z4CA 4JASB 4MS4B 3C3KA 3QEMA 1EWTA 1GUBA 4G0YA 3RVRA 2JVKA 2MSWA 1U2PA 3FFTA 4L4UA 4N76A 5KC8A 2QXYA 3IP6A 3BBLA 3LUCA 3N0RA 2N9UA 5HQJA 1L5ZA 2X7XA 1T34A 5JNSA 4F06A 3CU5A 1TLFA 2MSLA 4W5RA 2KYRA 4MS3B 1MVOA 2PUCA 1QQBA 4JA2A 4G97A 4MQFB 2H0AA 5KQPA 3DGEC 2IPMA 4DQDA 3OLZA 4YO7A 3TO5A 1NATA 4D6XA 5EWMB 2YHAA 1Y1LA 5C5EA 3TB6A 1YTUA 3OLXA 1QP7A 3OLYA 1RNLA 1VPWA 2F8TA 1ZESA 2QR3A 1YMUA 1ZGZA 2PUEA 5HKOA 3P9YA 3W9SA 1P6QA 4MS3A 4YS6A 2WB4A 2E4ZA 1QQAA 3OLVA 1PEAA 1YS6A 2P9HA 5T3YA 5IX8A 3HCWA 3LUFA 4Q6WA 5IUJC 1BDIA 1BDHA 4KREA 3G1WA 1QP4A 3FMVA 5DKFA 3RVPA 4MS4A 3HJFA 3MMNA 3O21A 2FN9A 3R0JA 4LE2A 4WT7A 4YR7A 2HPHA 3H1FA 1DZ3A 4WXEA 3GBPA 3HXMA 3GBVA 5DTEA 1CHNA 3E3MA 3DGFC 4TMYA 3QEMB
chains in the Genus database with same CATH superfamily
1V5GA 5AI6A 2ACEA 2FW7A 4TSKA 3TAUA 3KQNA 4A0SA 4XZ3A 1LPPA 1Z5UA 3H04A 4HLQB 3VJRA 5IYZA 5FR1A 1EFAA 2ODAA 4GYJA 2QTTA 4MKGA 4CNBA 4G8JA 3TZEA 2KBEA 4H1VA 5CX4A 1YKFA 4OHYA 5ALYA 1U3GA 1QH8A 4YCAA 3V1NA 4B1FA 4BYMA 2WJ6A 1AB5A 3DE5X 4FINA 4N7JA 1U7TA 1KI4A 2RH5A 2EU8A 5A9RA 1BRTA 1CZOA 2I78A 4MCHA 3FDJA 4OGGA 1KK0A 4HDMB 1M67A 5G1PA 1AUXA 4B40A 3WIDA 4HLCA 2D0DA 1RXIA 3KAJA 4FN5A 1CEQA 3STYA 3VNSA 1FFBA 3IKJA 1ND5A 4YRFA 1TYCA 5C2JB 2V6FA 3UXYA 1SC4A 2WKPA 4RK5A 1YDEA 1H1DA 5L7YA 2Y1KA 2QI9C 4BMDA 3QVJA 2JEYA 1MFPA 2HUNA 4K9OA 5NULA 1IN8A 1BE8A 1DTWA 3MCVA 5KNDD 4A9AA 3BWEA 1C8VB 3MS4A 1XIVA 3QBVA 4HL6A 1HT1E 4JR0A 5GQSA 4S1TA 3V8NA 1QLWA 4AG5A 1WR8A 2HR1A 1RJDA 1QPBA 1XD8A 1KI2A 3V7NA 4HB2A 3T3NA 4N0PA 2LV8A 4M89A 1GU1A 1HR0B 4ZQGA 2N3ZA 5EGSA 4BAUA 2E4AA 1CVRA 3S28A 3BRSA 3GJ8A 4R1SA 4RDXA 1XZLA 3ZDAA 3SYKA 1H22A 5K3FB 1SN7A 3UUGA 2V58A 1L5QA 1QHHB 2FPWA 1TAHA 4FYHA 5IT5A 3KZKA 4DJ5X 2ZB4A 1EFDN 2O1SA 3HNOA 2Q4BA 4NBWA 1K06A 4M83A 1IUKA 3FHCB 4JNCA 4BVAA 2GD0A 8MHTA 1JXAA 4E15A 2AFIA 2GTHA 1K86A 2QTZA 3QM1A 2AN4A 1QAMA 3VSBA 1J9ZA 1OT3A 1D1TA 4DR7B 1RAHA 1COWA 2I3DA 3IH5A 5ALSA 3KTFA 3BDAA 5JYBA 5G4LA 1KETA 2C9BA 3AHDA 4B3JA 2I1LA 5LZ2A 1XZEA 2GVDC 4MI1A 2YJ4A 3RC7A 3ASVA 1GOTA 4HQFA 1WB5A 2G4LA 3PFIA 4IIYA 2XYHA 1W5SA 2BSAA 3KAPA 1UBEA 4L9AA 5AMXA 1AB6A 3U17A 3ADCA 2HK9A 5CIYA 3WLPA 5I47A 3RIYA 4RVUA 2P11A 2M6KA 2CEAA 3OQJA 3ADBA 3L04A 2JF0A 5BSUA 4MDHA 1HPLA 2C5FA 2QGFA 5ERGB 3C6ZA 3KTOA 3G68A 1LRJA 1F0PA 1U1IA 2GBPA 3LXMA 4GOJA 4XWAA 4E1VA 2H4JA 5HMLA 1N5IA 3L8YA 1JWBB 4LQLA 4LDRA 3WWPA 1FNMA 3ZJ5A 1UIMA 2IHUA 1VSTA 4IM7A 3ZBUA 4G0OA 4OGLA 4QXOA 4HEA1 1IK6A 1CJUC 3RHFA 4MGKR 1E2MA 2O8CA 1U2EA 4HWOA 3A6HA 3UF0A 3DB2A 4R2WA 2PGNA 5DLQC 3SQNA 4AG6A 4F5DA 2GSDA 5DSZA 5KOHB 1EB9A 2ZYDA 4XB1A 2RBEA 4Y3UA 1WVMA 1R4MB 1TIBA 1A8IA 2IX9A 4FYWA 1YQWA 2H4XA 1W7AA 4D5EA 4R0VA 1UODA 1Z37A 3NBFA 1O9BA 2ZUCA 4P7KA 5E95A 4B34A 3EQ8A 1BH6A 3TSWA 5ECDA 3UKJA 5DCLA 4GR9A 3VZDA 3NAQA 1SUWA 1E5LA 2CB0A 1BXZA 4KL8S 3SVTA 4WXPA 5B30A 5FD8A 4Q6BA 3AF1A 4AY6A 4RZ3A 3OT4A 3HHEA 2IHNA 1E2UA 4R8VA 2GXUA 1WHSA 4E4YA 1USUA 4N7BA 4WDQA 4M1EA 2E1PA 1CXZA 3VYRB 5IBCA 2CNWA 4QJ3A 3Q7IA 1JJVA 3KKNA 2XNCA 3UG6A 3U5TA 4WK6A 4MQFA 3U3DA 4C7KA 1G17A 2VHEA 1Z0ZA 3OFSA 3ZWAA 1CDOA 3MA0A 4XGRA 4RZXA 4Z0TA 1U3TA 3DXFA 4DYVA 5IDWA 1E1NA 2HIGA 2K2QB 4CMIA 2N47A 3E5RA 2O5CA 3AGQA 3TLMA 4F3RA 3QEJA 5BV2P 3TZBA 1C0KA 1KZYC 1UKVY 5SYAA 5FPKA 3BRQA 3BPSA 4DDUA 1CY6A 3U5ZB 2N1MA 3Q2IA 5K01A 2QYOA 3MF4A 5D3MB 4XRGA 1NP7A 4I6EA 4IHJB 2R8RA 2W8BA 2EBUA 1KP2A 4H31A 2QRMA 4I5DA 4BO1A 4EW1A 4JXZA 1YBHA 3FIJA 4YCSA 4DG5A 4Q05A 4B6RA 2B2NA 1MX1A 1HI9A 4KE8A 3CIOA 4ENUA 5FQNA 5DEIA 3IKLA 1HDZA 1MGPA 3CGGA 3TZKA 3N1UA 4ZGWA 4NEHB 4YCLA 1SKYE 1ZIDA 4PN3A 4KXNA 2NTVA 5DX0A 3Q8XB 1T8WA 2FGJA 3LOPA 5DM1A 4YYEA 5KWEA 1HE8B 3FLBA 2G83A 1OYVA 2BYTA 5JADA 1FDUA 3OU6A 1YRLA 3VSEA 3K8ZA 3U7GA 2QSYA 3S5UA 3EZ7A 1Q7BA 4W6ZA 1H85A 1EQAA 1HOXA 1OFUA 2J9RA 3A4IA 2UUAB 1PKEA 4DPLA 1JYEA 3I37X 1F60A 1D8AA 1GPUA 2PG3A 2WD7B 3PICA 4HDMA 4MW6A 3O75A 5FWAA 4EIWA 3EQZA 1IEQA 2I7XA 3HJHA 4BC1A 1QFXA 3BMNB 5HBGA 4LCBA 3JR7A 3GAFA 4Y7CA 4EY8A 2BY4A 4RIHA 1O6FA 4BQEA 1YZNA 4AJPA 1OSNA 1E6EA 2PAFA 2IOFK 4XSGA 2VYVD 1DHTA 3RVKA 1XA0A 4AN1A 2OO5A 2VP0A 3DW3X 1C0EA 4IHJA 2D06A 1A9PA 1MAAA 2DSTA 2I71A 4WOCA 2REOA 1L7BA 2J30A 3FPGA 4PC7A 4KQXA 2Q1WA 5LIRA 3H1BA 2O2IA 4US1R 2FR1A 1IQUA 1B3BA 3F96A 2WVHA 4MAMA 5EEHA 4J75A 3O91A 1F4VA 3B36A 3RS0A 1Y63A 3TVYA 1SUFA 3L8HA 2PRSA 4R8MA 1XI2A 3S1AA 2Q41A 5DLEA 2JJYA 4YXFA 3W5CA 1TO6A 3MFQA 1QVAA 2PVSA 1Q77A 3OUUA 1P7WA 2P3SA 1Z75A 4HQOA 1VPVA 1K4KA 2W90A 1AA9A 2ATXA 1PFVA 4BNUA 1HE3A 2FSVC 2HLPA 4MEBA 1PR1A 3U13A 4Q47A 3WGYA 3EZYA 1N3IA 2BI4A 4KXQA 4UEQA 2YZKA 2P1RA 5LKAA 2O3SA 1K8XB 2ECQA 3A6FA 5F9MA 4BNXA 2PL9A 2PV7A 1WTCA 3BSSA 4BL5A 3UB3A 3W6OA 5C5CA 4LTNA 4IDGA 3W90A 4NULA 4QJBA 3NBYC 4KGDA 1XZKA 5TQVA 4C5CA 1Z12A 1F0KA 4DJFC 2XD9A 3LLCA 4OHFA 4BPRA 1WULS 3ILHA 1P1RA 3IBTA 1IDOA 1Z0IA 1X9IA 3MCAA 5EA2A 5ERXA 3CF0A 2HDWA 4BLUA 4E70A 4HNQA 4MP8A 2DLNA 5AOVA 3WL6A 4CYMA 2W2MA 2QW1A 1X1EA 2QX8A 5F4BA 2OXFA 3D8HA 4D9KA 3BHNA 4PPFA 1H2EA 1Q6ZA 3TM5A 3W6PA 2X5XA 3ONWA 2WTXA 3C7DB 3ZUGA 3COVA 1VL0A 4L15A 5LYYA 2FW1A 1L5VA 2Y27A 1DKQA 4X6LA 1K8RA 1WMFA 5JMOA 2RGRA 2VKQA 3AFOA 1P44A 1TJ4A 3C4QA 3LNTA 5I48A 3QLUA 2RJ3A 3BE5A 1MA0A 1HKUA 1Q1QA 3E5MA 3R44A 1JIKA 1M6YA 4RTSA 3LF2A 2NXWA 4R2MA 3SKXA 1JFFA 4QNNA 1QORA 4E08A 3AF2A 3SLKA 3WP1B 5JNLA 3E27A 1GQYA 5JCJA 1TNDA 4QXAA 3MFYA 1Z5GA 1ZRMA 4FWTA 3U2QA 5L8VA 4X1IA 1NVVR 2P9YA 1HT0A 4HMQA 1DV2A 1JJAA 2AZMA 5FX2A 2WAOA 1GARA 1L1FA 3WR5A 3L8DA 2BCEA 4DSAA 3E82A 2H1WA 5T7BA 3QV2A 4DIEA 5JY1A 2XE6A 5B37A 3ZVLA 5EZYB 2P8SA 4HT3B 2G76A 4Q3NA 1B0AA 3B9QA 1KEWA 1TTQB 4GICA 1X1SA 3JZIA 3Q8MA 1CRPA 4RSRA 1X19A 3OQIA 3KSAC 5JTUA 2MMGA 5EHIA 2WWYA 2Q3FA 3USES 4OM7A 4WL0A 1N2CE 3IUEA 3WLAA 4DDMA 1O77A 4CUJA 3BL5A 4JELA 1YR3A 3WNZA 5AUOB 3C6XA 5CB8A 2VSFA 2HBRA 1QK5A 4G5QA 1CUDA 1PJ4A 3TS1A 2PYZA 3JATB 5DCWA 1XZBA 4KQCA 1EX6A 3RJ9A 1IWOA 4IZHA 3LCRA 1XMJA 2XMQA 4UHEA 2YJZA 5K0ZA 3DZIA 4M88A 1SK9A 2XHZA 4UTOA 5INTA 5ILOA 1DEXA 3BWDD 4J3JA 1JNYA 5JALA 3DMNA 4NFYA 4LOJA 1UPCA 1Z2AA 4JI1B 1WXGA 1SVLA 3DZJA 5GONA 4LXHA 1C1XA 2X23A 4IKPA 1UK7A 4MCAA 4R69A 3LMKA 3F3YA 2OGWA 1V4NA 4H0NA 5CAEB 1QBKC 2XMSA 4CZ2A 3CMMA 3EULA 4L4RA 5C4GB 5LFAA 4IGKA 2F9MA 1QDLB 4RL4A 1Z6ZA 3KT6A 2C96A 2W2VA 3AEKB 4MGZR 1USIA 1M1UA 3B1WA 1T1IA 3H9JA 4WBSA 5FADA 5C53B 3AKZA 1B8VA 1EXMA 2Y05A 3FLEA 4MIKA 4HMOA 4RK4A 4ESEA 2IUUA 1UPAA 3LPCA 2RH9B 4HHEA 4KWEA 1JAIA 1U63A 3HXOA 2VJAA 2HSWA 2WE8A 1S1CA 3PXDA 4MRMA 4H18A 2OUKA 4O08A 5IF9A 5EUBA 2GS9A 3DPUA 2GDZA 2J6CA 3EIFA 4Y6RA 3RU3A 4RXTA 4LYEA 3GP5A 5LB4A 3WRYC 4QU5A 3O84A 4TWBA 3E03A 3O1JC 2YN4A 4CQMB 2AWNA 2DWCA 1QDEA 1WCWA 2Q4RA 4NENB 1KU6A 2D59A 3C6BA 3AI2A 5JD5A 1QRRA 3ADDA 2MIIA 1A82A 2JFHA 3NJ8A 4Y9UA 3ABIA 3QK7A 4UBKA 1Q22A 1F0YA 4C6HA 5IJAA 2QT9A 5KYWB 2QTNA 2WT4A 3RBZA 2EFYA 1PW7A 4BRSA 1HZJA 1CUYA 5EJEA 4KRFA 2JZOA 3VC2A 1Y4ZA 3HJTA 4IUDS 4CMAA 1CS0A 5IDXA 3WK9A 5B7PA 1JIIA 2RH4A 3BHIA 5BWMA 5M3BA 4DR2B 2W6JD 1BHSA 3QXJA 5DH9A 4W5HA 4PSDA 1ECFA 2I6QA 4UM7A 5AVZA 2V7BA 1N4DA 2D2XA 1TZ2A 3H42B 4BEVA 1V2HE 1K3TA 1ZD5A 1HYBA 1UKBA 1U8FO 2IZOA 5JS2A 1E64A 5JFOA 1AS3A 2H1RA 4JIMA 4J16C 3IEUA 1M3SA 2QUIA 1HLPA 4FOPA 4TLEA 4C9BA 4E46A 2YASA 4M4SA 4RH3A 3ENZA 1NXQA 3HBMA 1NVXQ 1IJKA 1L2TA 1PUIA 2PPLA 2GA8A 3DO8A 5EE5B 3WO0A 2ZRAA 3K09A 3KQQA 1LBSA 1B43A 2CFRA 1U2PA 1RJEA 2HWXA 2NO4A 3ANNA 5EIFA 4BLWA 4ZALA 3OT5A 1NBAA 5JECA 4I7EA 4AF7A 3QTTA 1JKJB 3LUCA 3WYEA 2ET6A 4UUNA 1RTKA 3EQ6A 5AJZA 2X7XA 2J3QA 1XNJA 2EFDB 2HXGA 4PPNA 1FTGA 1FX1A 2G40A 2V5AA 2JLSA 5HW0A 4I1VA 4DJEC 1DIGA 1NSYA 4MQFB 1V1MA 4UATA 1SC6A 2AMJA 2HQSA 3DKPA 4YCMA 2RHDA 2QZZA 3N0VA 1ZU4A 4LDPA 4QYTA 2JNWA 4DAOA 1U2GC 2BKVA 2X2PA 3IEPA 2UYHA 1OT5A 2J85A 3PPWA 2NSLA 4B80A 2JCXA 4I2VA 1PEKE 1QGUB 2QR3A 5ALWA 3S81A 5DHTA 2ECKA 2XD4A 1LLCA 1N5KA 1QCCA 2HLNA 3X2EA 2ESRA 3ROZA 1Y34E 2YOGA 1HQCA 3WL8A 3W9SA 5AW1A 3V4ZA 3W1EA 3PUVA 1JG6A 3ID6C 4HF7A 4PZYA 3B51X 1WQ3A 5J40A 4WNAA 5HS4A 3FDIA 4R1MA 1W1IA 1Y48E 4L57A 2G0AA 5DNCA 2PAAA 1N6LA 4JN6B 1O4VA 3D2BA 3TG8A 2H1LA 1S2IA 4JMLA 4NHEA 3H1FA 3QYFA 4WXEA 4CKEB 1W4LA 2AR7A 3F9RA 4RABA 1E3JA 3ZDXB 3ZIAD 1OA1A 2AG0A 4LVCA 2HSEA 1ISHA 2IU6A 2AE2A 5IM4A 4TMYA 2B4YA 2PX8A 2ODBA 4Q16A 1X15A 2YW2A 4GF5A 2CLHB 1Q6YA 4B74A 1I1NA 2AVDA 5IUNC 4NV3A 2OWEA 4HLNA 1J6UA 4FS8A 2I0FA 5CFRA 3IDAA 5E3IA 3HJCA 4IW3B 4M9ZA 4YRIA 1Z0KA 3FH0A 4CRWB 3CVWA 1XR3A 2YQ4A 1ISMA 1M2VA 4DNOA 2YNMC 2O3UA 1CUSA 5HS6A 4IMJB 2A88A 1HL7A 2UAGA 3NUZA 1SZDA 1ILWA 2ISCA 4O2AF 3ZNPA 2A4KA 2CNKA 3OTGA 5EUQB 4YH1A 1QS0A 4LA4A 4JBGA 5I9SA 2PZLA 5TS3A 4UHFA 1OHHA 1B3RA 1JA1A 5HF5A 3C85A 1OFGA 2NQ2C 2DT5A 5HUHA 1NSTA 1GKUB 3QKRA 5EZYA 3ZWPA 4AYWA 1EG7A 3QE3A 4FNAA 3OKPA 5B3KA 2XCTB 1SHZA 1H9AA 4OLJA 1U0OC 3N70A 1WPQA 1GSHA 2W0SA 3FYHA 3UMCA 1QOZA 3VFDA 5CG1A 4W1SA 2VRCD 1V4BA 1KI9A 3GLSA 2GM5A 4KTTE 4TWJA 4UZFA 4WUTA 5J4HA 3K71B 3U0VA 1N0UA 1V3UA 4W5TA 1E2KA 5SV2A 1PJZA 2YHSA 3EXG1 5HCUA 2CFIA 5EYPA 1F2UB 2Q5HA 1X3LA 3DO6A 3QNMA 3NFYA 1KFCB 2HA6A 1PV4A 1DXOA 1OTXA 2AG5A 1JJIA 2IPNA 1YRWA 2JIDA 1UM9B 3A4VA 3OM1A 4YROA 1C9DB 4BFUA 4EO4A 3C6MA 4KP7A 3DEZA 1T9KA 2QJWA 2O3QA 2ZYGA 4LXQA 3I61A 3DQQA 1EH5A 4C4XA 1IHOA 3L6OO 4MW7A 5BYJA 3B2QA 3NALA 4BMZA 4F9EA 1UWCA 4OX9B 1KC1A 4XM1A 2WQ6A 3D8BA 3GVPA 3CZQA 1ZGBA 2FFJA 2WF9A 3PNPA 5TDHA 3AJEA 3BIOA 5JVDB 4AP9A 2CXPA 3G0BA 1ZS9A 2IYOA 4OJNA 1KI8A 2JG3A 5B57C 3LSYA 3ZZ0A 4CM7A 1EP3B 1XZPA 2IS6A 3F2VA 4D41A 3CX8A 1SXJB 1DJMA 3T7AA 1I33A 4EB6B 1BC5A 2AMLA 2NO1A 2CCJA 1IBKB 4U3JB 2CWWA 1HDEA 5FBRB 4Q1EA 3VAZA 1V5WA 2HIHA 2R8XA 4GR4A 4NF2A 2JFGA 1TM4E 1RYDA 2YXEA 2VDVE 3GDWA 2PUWA 4PPYA 2WKWA 1NMYA 1T4GA 2WG1A 2YJ3A 3KX2A 4ZT2A 4BEBA 2GVZC 5I7FA 3ZD7A 2P6NA 1MVLA 3IP9A 1D2RA 3MMPA 2B4TO 1QIDA 4URHA 3WLOA 1ORWA 1IY9A 4GSKA 4Y2JA 4D4GA 2ERCA 2H1SA 2B0CA 3G88A 4J1TC 2I34A 4NZZA 4CMKA 4UBMA 5ALRA 5FTLA 4LDAA 1P61B 4R1PA 5FHRA 5LZ5A 1A7UA 1PHRA 3FMGA 2OZPA 4BJ3A 3OPXA 5AKJA 5AW8A 1VGQA 5HIJA 5IUKC 2XXBA 2QVGA 4WZBA 3UMBA 2J48A 2A7QA 3WV4A 5K8JB 1KK1A 1PNTA 1UKAA 2BM9A 2FJPA 3AIMA 3I9OA 2OBLA 3UUEA 3PR2B 4WRRA 3GT3A 4JGBA 3QLTA 4OY3A 3PXGA 3V3TA 4BGUA 4EVQA 5I5EA 1E4YA 1WXIA 2XNKA 1W1WA 2VDNB 3VPCA 2YZ2A 1NY5A 3DEYX 4QO7A 5FV4A 3HBFA 4FJ2A 1ZLYA 2VF8A 3KXIA 2IXDA 2ECFA 3AF0A 3TD9A 3F9CA 1N2OA 3AL3A 3S7TA 4CF6A 4PSVA 4MLZA 3LCUA 3N3BC 5L3SB 4JX9A 1QYDA 1U0BB 3ZQJA 4DLRA 2YJGA 1P9WA 3WGJA 3EGDA 4L02A 3KJQA 4ZMSA 1WX1A 1OZAA 1QCYA 3KV3O 1KH2A 1OXTA 1WNTA 3GT4A 1JXQA 1PVDA 1MRSA 1Y8CA 3FAKA 4JLSA 1ZM7A 1BQ3A 2PIDA 4IGIA 2H85A 4WCFB 3ZV7A 3CSDA 2YKGA 2XMGA 9ABPA 3FMFA 5CR9A 2C2ZA 5DRTA 4DCUA 1UOPA 2RI1A 4AC9A 4EOGA 3K9FC 1PT5A 1FP6A 1WF3A 1TZKA 2I1VB 4Y6OA 3VHXA 1AUPA 2IITA 5I9BA 5ECWA 4C5AA 4XAQA 4C01A 3CF6R 3AM5A 2EZ9A 1JEYA 2IY9A 4MRAA 5IXJA 2P9BA 3ZR4B 1W6UA 1DKUA 3FA2A 3SICE 4ZXFA 1QWSA 1J42A 2RDMA 2XX3A 3CSSA 2ZRJA 5COQA 3R75A 4NYJR 3L0BA 3TLJA 5HP4A 4Y2VA 1X38A 4DN6A 3L02A 1QFSA 3QYAA 2VT7A 4MITA 3M5WA 4DB4A 2FPUA 2KLBA 2NU7A 1AKQA 1VP9A 3O38A 4JOQA 5AKLA 3L6UA 2Q29A 3JVDA 1T5OA 4J0FA 3A6EA 2IYYA 1UJ5A 2IEIA 5JJKA 3FOAA 4MI3A 2Y9MB 4JHLA 2CL7X 4E2YA 1Y3IA 1VLVA 3GNSA 3I58A 3H83A 3CTPA 4ITUA 2EBHX 4XEUA 4HAWA 3ZDEA 2XNJA 3ZWVA 5BVHB 2RE8A 1X7WB 2CJXA 4RM2A 3LIIA 4OHUA 5F1YA 3LZ6A 1HTTA 1AN0A 4IDNA 4Y2SA 2V6MA 3OJEA 1K3UB 2DM6A 5KBYA 1U7HA 2FMTA 4IIGA 2IUSA 3M4ZA 3BMQA 4KFUA 3G5UA 1KI6A 3Q3EA 4YAEA 1JG3A 1WHSB 3FSGD 2HA4A 2QLMA 2ZIGA 1QYXA 3AEUB 1QH1A 3QMWA 1NMXA 3LDUA 3HSSA 4QU9A 3L79A 3DMFA 2VF4X 1JQEA 2A1UA 4MVJG 3C16C 4PTLA 5E6RB 1Z17A 2VHTA 5ILGA 1JZTA 4F3NA 3C4VA 4HWSA 1XRRA 3SBEA 3GLGB 3OM8A 4FE7A 4TL7A 2ICAA 5IBQA 1O7JA 1V3QE 4OQFA 4CV2A 3DEJA 4CDNA 5AJXA 5DM60 4DV2B 3GARA 3GLKA 4EJ0A 4N1AA 1RFLA 3MJCA 1N1MA 4HEJA 4KE7A 4EHHA 4TYWA 2FWRA 2GCEA 4I8DA 4RZ2A 1VCOA 1J99A 4BDTA 3IMEA 4OHKA 4KWHA 4X41A 4Y2UA 4MV1A 5EG5A 3WA7A 1XDWA 4LBVA 1EJ6A 1J00A 2WMNB 4KQWA 1L5HA 4G1CA 1ZM4A 2PDAA 3DB1A 4B8ZA 3VPAA 1NDUA 1OTYA 5TQ0A 2V59A 2XQIA 3IV6A 5JZBA 2Y2UA 4G4JA 2SECE 3RUHA 5LL6P 1EEXB 2B21A 3EG9B 2JFBA 2W98A 1RBYA 2NVBA 3DLIA 4HI0E 4EPTA 2AL7A 1ZH8A 5BW6B 5KUTA 2D2VA 2NXEA 1FX0B 4BB6A 3QMVA 1XLUA 1K7CA 1JSZA 4TMXA 4WKCA 4YUAA 1XF9A 1N1GA 3SJBA 1IWBB 1VLZA 1GPYA 3TQFA 1SUEA 1IFXA 3L3BA 3VZBA 1QO0A 3EWIA 1I0ZA 1LWNA 3OJ0A 3Q8KA 3G6KA 2ALJA 4DZZA 3LBHA 1XMQB 2V7TA 4JUBA 1XROA 3FYUC 5FKJA 3AYZB 1P45A 1K8QA 1QHYA 2IUTA 1WCIA 3SQWA 1TRHA 2SCUB 5DASA 2ZANA 1N4AA 2QRHA 4MYSA 1QOPB 2BUCA 3SJAA 2R7KA 2X19A 1I4WA 2HCJB 2PPVA 3RTEA 5IRCD 3HCBA 2QX9A 3OCJA 4HS4A 3K16A 4G0XA 1TKBA 2HA7A 5BN5B 2YCBA 1V8FA 3O2SB 1UBJS 1JG7A 2UZ0A 3M33A 4ZVUA 2P9QA 1AZLA 1TMKA 4NCNA 1I6LA 3VMMA 3ZCVA 2VP9A 4M9RA 4BJHB 1WDTA 1FOEB 1XC7A 5D2CA 4LK2A 2VP2A 5EPOA 3I42A 3S2EA 2ECOA 1I10A 1P31A 2F4NA 3LL7A 4S1VA 4XWTA 3WB1A 4URWR 2JIQA 4TL6A 4TXMA 1JG2A 2ZYWX 2PRIA 3ETCA 1VHQA 5B53A 4D8TA 4O4LB 5LQDA 3ER9A 2FW9A 3I01A 5CVUA 4HNGA 2QXUA 3HEAA 1H8HA 3RSLA 1DUSA 2R7MA 5EKUA 3C0KA 4MJLA 4QGFA 5CVDA 3K9CA 4ZTBA 3B38A 1JTVA 3UW3A 2XA9A 3RG2A 4Z4HA 1F12A 2F90A 1KYXA 2X3FA 3NAMA 4Q24A 3OIVA 2DTEA 2VQSA 2GTIA 1BXRB 2E0IA 2JGFA 4IMIB 1R8YA 4JUCA 2QZ4A 4M53A 2OD7A 2RHJA 5MGBA 2PMFA 4TYMA 2JLUA 3QWIA 3H84A 4YMHA 3RK1A 5KTMA 2ONCA 3O1IC 4BLOA 1V96A 4RHCA 5K8VA 3PGA1 3UB2A 4AZSA 2M9MA 3AUJB 3ZE7A 1KI1A 2QYTA 4LGMA 1NVFA 8LDHA 3TUZC 3R3UA 3NT5A 3Q41A 1GTMA 1SXHA 1K7FB 4U2CA 3BGOS 4KKVA 1RE0A 4CTJA 1E3QA 4EPYA 3B1JA 3H4TA 2QXTA 2ZPTX 3LBAA 1CJCA 3PHLA 3DM9B 4RANA 1CT9A 1VKRA 3OURA 4CL3A 2ZVQX 4L16A 4DA0A 1KRWA 5KCZA 4PFSA 2VLIA 5ICMA 1ENZA 1ZOIA 1M75A 2WTNA 4DYHA 2GPWA 1I9GA 1T15A 2BGMA 3P2OA 3W5AA 5T4EA 1ML4A 1V48A 4UQPA 1G8GA 2JHFA 4Q7EA 3AFMA 3D6VA 4MVWA 3NC4A 2PFSA 1TC1A 1U99A 2C0PA 4CR8A 2Q6LA 3GEEA 4PYNA 1QG6A 3GO4A 5HCIA 3WJ1A 2JLWA 4FFPA 2J8ZA 5JXGA 1QH9A 1Y5NA 4R8RA 1QAOA 3SAJA 4LJ8A 4W99A 2I65A 1NDHA 4N01A 3FOEC 3DTVA 4WBXC 5BQXA 2ZRPA 3MYRA 2QE7A 2W8BB 3UH0A 4ZQCB 1GNTA 1FFGA 4MV3A 5GZ1A 4JT2A 3RU7A 3U7QB 3LT2A 5IVKA 1OX5A 3WDSA 3FM9A 4M1MA 3EZXA 1VYTA 1CF2O 2Z5FA 3AETA 4R05A 2J0EA 4LG1A 3C43A 3H2HA 1CS4C 1A3CA 1FQKA 3W7BA 3L7IA 2IBSA 4I99A 1XKQA 1RPNA 4ZCPA 3A1DA 1KKMA 4XW2A 2O50A 4P7BA 1GL9B 3ZV4A 2P2GA 2WV9A 3CVJA 4FCWA 2C2KA 3DOEA 4G41A 4KVZA 4HEA6 3AF4A 2A86A 1ZNWA 3QFHA 1AKWA 2JL1A 2BHRA 1Q1ZA 4PZCA 1T36A 5GJWC 4BLSA 2PZJA 3CKYA 3HQ4O 4KMSA 3NHMA 4BV9A 4LFAB 3DUFB 5IVHA 3VV2A 1L5LA 2P9FA 2GO1A 2Z1MA 3P0HA 5EIEA 1ZJWA 5JJLA 2BFCB 3W4KA 2A14A 2SHKA 1KS2A 1MN6A 1IUPA 1J2UA 2ZSAA 4Q1CA 3ICPA 4P58A 4IV0A 3RSFA 4QPPA 1ZW1A 4O6VA 1S8FA 5JQWA 1X1DA 4ASUA 5ALVA 5IJWA 5F5NA 1K5HA 2B1RA 1QG4A 2G04A 2RK6A 2ZI3A 1EI9A 3IBGA 3PP8A 2XODA 4GOMD 4MKHA 4ATNA 1NAHA 3Q7SA 5AKEA 4C7MA 4EF4A 1JJFA 1DBPA 3LQ2A 5I7RA 1P3DA 4L5IA 1C80A 1RQLA 4EYQA 4CR7A 3LT5A 1H2RS 4UU1A 3ZW7A 1BRMA 1IOZA 3G8CA 2W6ID 3P9PA 2ARKA 3ESAA 4PYMA 4E5VA 4GPBA 4G1BA 5AM3A 1QCZA 1GG5A 1TZJA 4M6WB 4ZEVA 3QPUA 5HSGA 1C14A 3SDSA 4BWGA 2JC3A 3A58B 3R23A 4GI2A 4KOEC 4ENTA 1YNSA 2XWSA 1G98A 3VR0A 3T1YB 4HQKA 4MS4B 1IZ0A 2GN0A 2HJHA 1QO9A 3R5KA 2HHJA 1D4AA 3IR5A 5AW0A 2JJ8A 3VVBA 5SICE 2SBTA 2F1IA 2MT9A 4GSLA 3V6LA 1DI0A 1RD4A 3LI2A 4QRIA 5JQGA 1S4QA 2F1RA 2K6GA 2OOSA 2QHXA 2XQGA 5GZ3A 1Y8RA 2D4HA 3GLHA 4M38A 1HTBA 2PFGA 1Y9ZA 1U11A 1YZ3A 2YWDA 1EM6A 2W4QA 3P9ZA 2XUKA 3PR3A 5E7QA 4C2BA 4UTRA 1B8PA 2DU8A 2I54A 2DH5A 2CHUA 3P9SA 2D54A 3PQ3A 1CSEE 3VU9B 1PEDA 3CVYA 4PZZA 2D1QA 3EZFA 4X66B 2OV4A 4GDMA 1CUBA 1MPTA 3C6KA 5DTRA 4N7MA 1RT9A 3T1OA 1NM5C 4RCVA 3TCNA 3GRPA 2BONA 3M6IA 4DQDA 5EUCA 3DHEA 1PDWA 4RVCA 5DWDA 3ROGA 5K3OA 2AJ8A 2YHAA 4EUFA 1OI2A 1P18A 1SBIA 2RIRA 3HHPA 3KZOA 4YGYA 1C3LA 5JCJD 3V42A 1MNQA 3PFWO 2P2DA 4RGBA 3UWOA 3UHOA 1F2TB 3CT4A 2V7QD 2QMUA 4UNQA 5FTMA 2PLRA 4D9FA 3OKAA 1SUDA 5JRJA 5T4FA 4BFCA 2ZATA 4LY9A 2DFNA 3CLRD 4MA4A 2VCYA 1XJ5A 3CEAA 4U5QA 4NPAA 5ALEA 3GRUA 1EFUA 3OUTA 4AYTA 4FKBA 3F8SA 2QIPA 5A71A 5IASA 1AKVA 2V5UA 4MWEA 5DISB 1L4HA 2PFKA 4HYYA 2O3RA 1L8LA 4KBFA 5AHRA 5DKFA 3RFVA 4F1KA 5B3LA 1XA3A 4OQXA 3KU4A 4GRDA 1SD2A 5E4YA 3HXMA 2I2CA 2O57A 2WF5A 4DAEA 1J8VA 3FRIA 3AB7A 2LCFA 2VDPB 3LPMA 3QU5A 4YJ2F 1GPDG 4O25A 4ZZ1A 4X71A 2DKNA 3QFCA 1GDDA 3ED1A 2DX7A 3LGXA 1QLHA 1VKJA 5FLYA 5CNIA 3TD6A 3OE4A 3A1EA 2BBTA 2C4NA 4M21A 4U6NA 1D0IA 1J0DA 1A7AA 3VTZA 3ZWNA 1FS5A 1TB4A 1XHFA 4GOKA 4AFNA 1FLDA 2PJDA 3QA3E 5ENDA 3W04A 3GLIB 2XWQA 5A4DA 3ZLJA 2ZWMA 1RC0A 3OHPA 5K51A 1N8KA 2X2FA 3CH6A 3T3MB 1E3MA 3JZFA 5DI3A 5BRNA 3NHUA 4TS9A 5JCPA 5JRDS 3GEHA 5MN6A 1D2AA 2XZPA 2CBXA 5DE3A 3GUYA 4JL6A 1GY8A 2CSUA 2Y76A 2ODNA 5AK3A 3RDPA 1J2JA 1DIBA 2PEYA 3A1SA 3LIPA 1N8NA 5DW3A 1G7CA 4ZT7A 4F92B 5JAIA 2MYNA 3CN9A 3AY0A 2R7AA 2TMKA 4IIUA 1TIPA 2G25A 1KJZA 2RGCA 4QREA 4R1UA 2WK1A 2A5FA 2WICA 5L7WA 4NFSA 5CMLA 2EYQA 2PUHA 3GMSA 1VE3A 4FFRA 4IRXA 4S0ZA 4QOGA 3UK2A 2X2OA 5BUQA 5JBQA 3CE9A 4XUDA 3HFJA 1EWVA 1YB5A 3B9PA 4L8WB 1FMJA 3I12A 1P9OA 3RVOA 2BR4A 3C3MA 3FPFA 4TUYB 5ALHA 1CR1A 4UEKA 4X3PA 2HSJA 4G0MA 3T52A 4OHBA 5JSQA 4LF7B 2QN2A 4DUGD 2ZRQA 2PXCA 2WIFA 4G56A 1N34B 3GI1A 5ENVA 1IBRA 1VIAA 2RGUA 2AH5A 4JCOA 5JSFA 3O90A 2H7YA 1SC9A 1RHMA 2PZGA 3D5EA 1QC5A 1LQUA 5FWXA 1M0SA 3RTCA 3B5JA 3GX1A 3G0HA 5GINE 3OZXA 3OO1A 1FTWA 1B41A 1LLFA 2C5HA 3D5TA 1C1XB 4BNHA 4JLWA 4CGYA 3RBXA 1EFKA 2FWAA 4A2PA 2AVNA 2FRDA 3DTTA 4P5PA 3QLEA 4Y1GA 1I01A 3KEOA 1BS9A 1DKLA 1EVKA 2CL0X 2QG6A 4GX5A 5CT4A 5EE3A 2QUJA 3ET4A 4QQNA 1QPZA 1AKEA 2J3MA 1JW9B 2ZXFA 3KLNA 3W9YA 1DQYA 4BS9A 4DR6B 5AO9A 3ZX5A 2GPYA 4MYTA 3V8PA 1TF5A 3W78A 2XGGA 1KQFA 5GVRA 2OZLB 1RWKA 1FXWF 5KWJA 2O1EA 3BHJA 3Q3GE 4AL4A 2C1EA 2WY2D 2B3TA 1QYIA 2PKQO 3B78A 2DECA 1LC3A 1NOKA 4D4HA 1Q14A 2E6UX 4DMUB 4Z51A 1M34A 3CZ4A 3Q87B 4XLTA 3RF7A 1BOFA 1GLGA 1QAQA 1V7PC 4OH7A 3USCS 2OFWA 1U4SA 1ZGJA 3CNOA 1EDDA 1EVZA 1DC3A 3GJYA 1N5LA 3FTNA 4UXJA 4A6PA 1T3HA 1Z2OX 3TQRA 2K4MA 4UEWA 1Q2UA 1VG9B 2DBYA 2WM9B 4CKYA 1AOXA 5K03A 1KOFA 2IOHA 4KFCA 2QQ5A 4KBGA 2JHGA 4QYMA 2XKJE 1VYVA 3HB7A 1R0XA 3UAGA 3PA6A 3ZWYA 4A8JC 5CUQA 1LLDA 3ZGYA 1Z7BA 1U0NA 3EC7A 1SCDA 3OMWA 1UL1X 4OHOA 1MX9A 1OR8A 3K3PA 4AVYA 1EM8A 2JZNA 3ER8A 5CLQA 3PC7A 4DT1A 1UP6A 1DFHA 3WGMA 2BKUA 2JAOA 4P98A 4UW9A 3QYPA 1AQ6A 1MBZA 2JH3A 3PFGA 3HV2A 2JCVA 1A1SA 2QW0X 4EZIA 2BEWB 2QZJA 3CS3A 4GLOA 2N0SA 4RF3A 4UOZA 4D3ZA 3QSYA 3ZNNA 5CVVA 1N0IA 1TD1A 1DXHA 2ZSBA 3HCRA 4OQYA 3TDKA 3ZTYA 4BJ6A 1T9GS 4OSPA 5L3VA 1ZH6A 2AFHB 2WLSA 3ENWA 2EJTA 2H2WA 2H5JA 4LY3A 1FRFS 5LQSA 1LXCA 4CMBA 5JJIA 2HWWA 5BN4B 4ND8A 3U7EB 3E48A 1IWPB 3RT1A 5AD1A 1LLQA 2QLBA 4AI6A 3IQEA 4G07A 4PONA 3KE8A 1AHPA 1E1RD 2IE8A 5H3LA 3A9RA 4WY8A 1P5ZB 1VJTA 5EKSA 2XJ9A 1OGYA 4XQ0A 2ENUA 2DP4E 2F1OA 3PL5A 4U00A 4DA7A 1DAOA 4DM7A 5JDCA 1CY4A 3ZE9A 2XT0A 3ACDA 4IIHA 4KQKA 3KELA 1G20B 3L06A 5C81A 5LP6A 4D6YA 1Q84A 3I34X 2NUTA 4KYIB 3KXDA 3H2IA 4H08A 3KSDO 4QX6A 5HILA 2COKA 2HMUA 2WR8A 1TU3A 4OA8A 3MGBA 3IMFA 3LC7O 5ESDA 4ETIA 1IPFA 1FJGB 3EWNA 1KAGA 1KVRA 2QX6A 2WYHA 3QG1A 1XLWA 1MGOA 2J0UB 1RQRA 3AR4A 3IOYA 4JEUA 1G2IA 1WDWB 3GDGA 1O97D 3MWJA 4KX5A 5AKGA 5KNCD 5C8YA 2OLKA 4KIFA 4B87A 4PU0A 2A9KA 3RFTA 1KRXA 4LWZA 2YHIA 1P4HA 4IXNA 5KYXA 5L3ZA 5MGNA 2HRRA 3R3SA 3HA5A 1B6TA 3GDHA 4IDPA 1YR8A 3D3NA 1T6YA 3C3AA 1Y6RA 3D6HA 2WSMA 3OCUA 3OOWA 2CVHA 3W7AA 3VAYA 4MYHA 3CUEF 4G81A 4KU4A 3N6VA 2VUHB 3B6MA 3DDOA 3IA7A 3RU9A 4Z4IA 1ZXLA 1A98A 5FO0A 3LWZA 1VSQA 2WHPA 3WGOA 3WK5A 4BVLA 1P5JA 1AKNA 2W71A 3A4LA 3L40A 3WLHA 4N4AA 4DV6B 3ZGVA 3H8VA 2OAQ1 1CQPA 3V1KA 1E1QD 3KLPX 3H2BA 4O3FA 4UBNA 3S68A 4KI0A 3D8RA 2R48A 3O03A 4MMYB 1V6SA 4U0KA 3ZE8A 3DVAA 4L27A 1XTIA 3GCZA 1XX6A 1K08A 3GEMA 3N74A 1E9BA 2CNOA 3OQVA 1H5QA 2QEQA 2WLTA 4ZC8A 2M6LA 4UU0A 1LC0A 2EJBA 2I62A 1VL1A 4OD0A 3NP7A 1D6MA 3K9BA 1JNXX 1NAIA 1NYLA 5K8LA 2Z0MA 3L7CA 1DFGA 1KWGA 5C4MA 2IP2A 4RJJA 3INTA 4A36A 4BFVA 4MR7A 3D7LA 5MFPA 4Q21A 1TT5A 4O2LA 4MWOA 3JQ7B 3LLSA 4WLFA 3RODA 3ZWMA 6LDHA 5IW8A 1SB9A 3O1HB 2ADMA 1CUZA 5BR1A 3EAFA 4GPIB 4R3WA 3PNKA 4H35A 3U39A 3VZRA 3O83A 4ZDIA 2OM2A 3GOQA 4HATA 1BCRB 2XJ4A 2C4HA 2XR1A 2HRCA 4OQLA 2QRJA 4FFNA 4MR9B 2VDRB 3OEHD 4UDYX 4EYEA 4AUNA 1X42A 2V9CA 4AMZA 4WOBA 3WYNA 1V1JA 4ZVNA 2WHYA 1KNXA 5H4HA 4P0PB 4Y0NA 5KSWB 3THOA 1QTIA 1YCDA 3AEZA 1AE1A 4C6TB 1GRCA 2VRBA 4C76A 3AY6A 5D6OA 1L5FA 1SH7A 3N5CA 4OXYA 3PGMA 2M6RA 3PUJA 2PQMA 2R6ZA 1K63A 1FS4A 4IDEA 5HK8A 3KWJA 1GCUA 3HADA 3PXEA 4M7OA 4N9WA 3VPXA 2BFEA 3WLLA 2DVMA 4J7CA 1XLTA 1G6HA 4X6XA 3G0CA 1TZMA 1OZFA 2QOEA 3KRTA 4FGWA 1MT3A 1UPBA 2QRKA 2VBIA 3EGEA 4CF4A 2O0HA 5LUAA 1NPDA 2AZ4A 1T1RA 2OZKA 1PX2A 1XTRA 1W2GA 2R1TA 3C70A 5IHXA 5AUPB 1N7HA 1NVGA 4DA4A 1MJGM 2JBWA 1Z5PA 4EW3A 1Z4KA 4B75A 1L3IA 3D6MA 4MTLA 1RPTA 3FPSA 4ND4A 2Y9PB 2MOKA 4TRRA 3AHGA 2H1CA 4J90A 4LXTA 4OQQA 3BXOA 4DREA 4ZREA 4F93B 2BBWA 2H63A 2YHUA 4CV1A 2ZSIA 3K35A 1Q16A 4EMSA 1MZPA 1M83A 2OFXA 4QGHA 2Q3CA 3C87A 5CB0A 2PGLA 1UPXA 3I6BA 3I76A 4PLGA 5AM5A 2VJPA 4YP9A 4GEGA 5SZJA 5K6RA 2HHAA 3G9ZA 1X1RA 3VI4B 1X8XA 5CNMA 1YD7A 1RXUA 1TM3E 1Z22A 2QWXA 3P9XA 2R8EA 4XJVA 1H0SA 4X6YA 3N76A 3ZHSA 4X20A 4DA8A 1E20A 1K6IA 3D7NA 3PI6A 1F2UA 4UNIA 2IZ6A 3GQVA 4ALMA 4B45A 1TIKA 3WG9A 3IKTA 1VA4A 2GM4A 1TEVA 1WLYA 5EMLA 2FP4B 2D1RA 2PMDA 2FQYA 4C3OB 4LHZA 3LT1A 1TGVA 1GZ5A 4F4IA 5M5BA 4MUHA 4HFMA 2ZVDA 4MP3A 1VBKA 3R0VA 4JGIA 3VI3B 4N18A 3NCTA 4K6GA 2AOVA 3QTLA 1A0OA 1A9YA 1M8JA 3N0XA 4YCCA 4BQOA 3DDHA 3RHZA 1AJEA 1E8MA 2P5SA 4P84A 5PNTA 1FNSA 1CY8A 2WP0A 2XCLA 4GQBA 4LHEA 3G82C 2GXQA 3TZQA 1Q17A 3EPJA 3DMPA 4GPTA 2WJJA 5BMVF 5LLTA 4KPUA 1Z0UA 5E7IA 2FRVA 2Q1UA 3D64A 3Q88A 4L3OA 5A3QA 1J8FA 1JU9A 5I7OA 1R7RA 2D5AA 4ETMA 1FTQA 2QMHA 4JYBA 4U8GA 2QQFA 1F8GA 5F1PA 4WDRA 1XRJA 1KJJA 1IDN1 5I9MA 1YDFA 5JE8A 4RQBA 4UJ3A 4WN9A 5B7GA 4XIJA 3SYNA 2GAIA 1SG9A 5EP2A 4A15A 4YV7A 1XPUA 4M76B 1VDMA 5JWRA 1T6BY 4AP5A 1QU2A 4D57A 4XDGA 1V6AA 3GK3A 2VHZA 4UULA 3JQ6A 3TLYA 5A1TA 4TXNA 4QOEA 4F12A 3ZW8A 2WI8A 4WXYB 4MVJM 4YP1A 4BBZA 4RMIA 3PEVA 3H2ZA 1P3Y1 3RRJA 3CJTA 2R8YA 5CXQA 1ZBQA 4A6DA 1JEYB 3GUZA 5EWLB 4IX1A 4R1LA 4ER0A 3U49A 4WN3A 5CHYA 3ANYB 4N5NA 3PD7A 4ENRA 5IG2A 1EQUA 3CUYA 4RSHA 1FYXA 5A4MS 1RQPA 2VH2A 4M1QA 1GDTA 3IE1A 1VRWA 1Z68A 1E6UA 4NOLA 4KHPB 4TQ9A 4QJIA 5KSYA 4Y6GB 2EDCA 4R9UC 1XA4A 4MA5A 3FGZA 1XK7A 1GUFA 2I7DA 1UKEA 1JL3A 1G2OA 1Q1EA 5EIOA 5CD9A 4MV4A 2B4QA 4KVGA 3MXOA 4YJFA 1P8AA 1V3TA 1IXRC 4RZIA 4AY3A 4EYKA 8ADHA 1SIBE 5ITSA 3NW9A 4OHVA 4MW9A 1UPUA 3MZ0A 1ML3A 2C3MA 2X8BA 2ZIFA 4A8PA 2K2WA 1QX3A 3OHSX 4IFEA 4BMVA 1YZQA 4NU5A 4U9HS 1S2GA 2GBGA 1I80A 3ITDA 3P0JA 5AJHA 2PYDA 1CFJA 2BE9A 1WOMA 3L7MA 1RJFA 3HBLA 4P35A 1S2NA 4HZIA 2EDAA 2LZ0A 1YOBA 3C3JA 2QTRA 1DRJA 3TG2A 4JASB 1DL5A 2CXQA 2IBMA 5BSHA 1RYNA 2OCDA 3E7FA 2DFVA 1EWTA 1QF7A 2WW8A 3QP9A 4D0LB 5TMBA 4OXKA 5CB4F 2PL3A 2IV3A 5AM4A 1ZJ6A 4CLOA 2IY7A 1P2BA 2BD0A 2R1VB 4CV3A 3OECA 3EGVA 4WN9B 1G59A 3RSGA 4WOKA 1GFZA 2OILA 2MSCB 2TS1A 3KJIA 3OWXA 1AS0A 1W36D 2H57A 4PINA 1R1DA 1TCAA 1ODTC 3AP1A 3PIRA 1E2IA 4IFBA 4OIFA 4DDWA 3REOA 1J9GA 2WJGA 1PQYA 4UTVA 2BFMA 2MSDB 1ODKA 4JLJA 3UAOA 4MS3B 1MVOA 2VHCA 1UWKA 1S2LA 5BYAA 3JRWA 1G20A 3OFND 1A4UA 1YJ8A 1XMXA 2PGOA 3H13A 4OIMA 4RW0A 4XDZA 5CT8A 3UT6A 3WSVA 4DQLA 3OJWA 1DGQA 3OF3A 2GN4A 2ATCA 2WM3A 1KAOA 1BVUA 1W88A 3EEQA 3OM9A 2IF2A 4NMMA 4DANA 4BWVA 4YHHB 1H2AS 5L51A 2F8TA 2OGSA 1FUEA 2GVNA 2H7XA 4LQCA 3WK4A 3AHCA 1WP9A 4HPJB 1IYZA 3TCXB 3ZK7A 1UBSB 2I2BA 2OC9A 4Z1OA 1Q19A 1AA6A 1NVUQ 1Z5NA 3FKSD 4YRTA 1K8YB 2G8NA 4CU5A 3SC3A 3AVWA 3IILA 1H5NA 4FFVA 2W9XA 1PVVA 2VPZA 2Z2YA 4IWYA 4LXXA 1U2RA 3HCWA 4L76A 4NZYA 1ZBDA 4YJGA 5TLSA 4R16A 2KS6A 2JFZA 2DCMA 1EUZA 3LC2O 4EUEA 3HJFA 1W6RA 1Z4IA 5ARDA 5T4BA 5AVWA 4A7PA 3K4QA 3HR8A 7ADHA 1CDZA 2RKWA 2C1XA 4R81A 1Z5ZA 1CHNA 1U6IA 5CM9C 2Z56A 2I6UA 3Q12A 3OJOA 2GA9A 1UJCA 4AU1A 5F7XA 1FVFA 4ZAYA 4C21A 3T5DA 3V1TC 1NYQA 3A9SA 1GTSA 2HC9A 4EJMA 5AVRA 3HMQA 4CDMA 4Q02A 1BD3A 3MUFA 1L5HB 5IAOA 4GMHA 3HL0A 2CFSA 2YZ7A 2V1XA 2JCGA 4RA6A 1LSJA 5T6MA 5B36A 5COBA 3BRWA 3IVMA 1J8QA 1SCBA 2YXDA 5GOZA 2GJ8A 3ZXYA 3MMZA 4ER7A 2QSUA 5CA1F 2QBYA 2ZB8A 3GJ5A 5J5AA 1DUIA 2BFCA 2GZRA 2J3EA 4Q9AA 1F6DA 1GCAA 3ELYA 4D82A 2BFBA 4EK9A 4C1BA 3QWAA 5JFGA 3TF5A 2Q2VA 4GPZA 3NDBB 1LZKA 1R12A 2NU9A 1M6NA 2PIAA 3WRWA 4Z0NA 1JILA 1GTRA 2FPIB 2IT1A 1H8ED 1RWQA 2B8JA 2W6JA 3L6CA 1RZRD 1DTEA 3BSWA 2ZITA 1WDLA 4TX1A 3RS9A 1NX6A 3C7KA 1LTKA 3BMOB 4GPAA 2R8ZA 3WB2A 5JXHA 1AMNA 5K8TA 1F3LA 3AVOA 3CUUA 5E9QA 1O5TA 1Q1BA 2O8DA 5F2OA 1KP9A 4X92A 2GEDA 4U9UA 4XJXA 3RIHA 3HR4A 2DQYA 4ASUD 4HG2A 2W6MA 4L8LA 3R8CA 3EJWA 4M9SA 2BBSA 2FOLA 4XYEA 4TMTA 1L4MA 3WDMA 4D8YA 4UU8A 4KQGA 1TU0A 4JEMA 4NMXB 2XDWA 3U56A 3ZDDA 1LPNA 2W0MA 2A6PA 2MYTA 3T8YA 3OX3A 4KAAA 1XQ1A 3UQZA 3RC1A 4BKQA 1PGPA 3UM9A 4WZZA 5A7FA 3LS2A 4QOJA 2AJDA 4IDQA 3SQDA 1S01A 2OK7A 4F7DA 1YVUA 4OMDA 2CFTA 4PTYA 3UOGA 5IAEA 5KSPA 3DVRX 1JTFA 4AO7A 2VDLB 1PGJA 4JI6B 1TDJA 3KPVA 4G4SP 3SHFA 4D43A 2PUDA 4CIYA 1FU8A 1VFNA 2ACKA 1CE8A 2F6RA 1YOVB 3NKLA 3UWPA 1TUIA 1V45E 3SVLA 4I4TB 1WZNA 2OSBA 5CVEA 3MXTA 3S29A 2QP4A 4J0DA 3BWCA 4BRUA 1Y5RA 5KYYA 5LSAA 3GLFA 4JC4A 5TVKA 3UHAA 4HFJA 4QDKA 3JQDA 1G7SA 4DCOA 4MICA 4RD4A 1QJ4A 4L5CA 4AYXA 3DZBA 3AH8A 4PG5A 3MEQA 5ALMA 2W8ZA 5AXBA 1JDSA 1UZLA 2H6EA 1LLUA 4Q9NA 4FOOA 4RULA 4AJNA 4R8LA 1M72A 1KBZA 2PV0A 3PX7A 4ZYZA 4KFRA 3RS8A 3HLKA 1R0BA 2BGUA 1JB9A 1RBQA 3ILXA 1UZUA 3SX4A 1C1DB 3LQQA 3IAUA 1BTOA 4ZU6X 4NBKA 3OU2A 5B5SA 4ZANA 1A9XB 1M10A 1CUEA 1ZPDA 1OAAA 2DC1A 5CDSA 1VDZA 1ITZA 5KHLB 4ALJA 2GKSA 1CZNA 3HP1A 1G2PA 3IUQA 4PCAA 4Y2PA 3JPWA 3AIKA 3T7IA 3KR1A 4A16A 5HZMA 4ND7A 4DG9A 4FGSA 2HJGA 1E5VA 1RXWA 3BWMA 2BFFA 2ORYA 3WFZA 3OESA 1UC5B 4MV6A 1HL3A 4XFKA 2FFAA 2HHCA 1WD5A 1SIUA 1GM5A 1N2CA 3QX7A 4FBGA 4S3MA 1RKBA 4LOLA 3VSDA 1U31A 3N7UA 4TTAA 3JQ8B 3FSEA 4JJIA 4YRJA 3TMYA 4WBNF 4HDKA 4RXUA 3JSXA 4G01B 2C7OA 3BAFA 3JARA 2A0KA 4ZYLA 5C7YA 4X45A 2ZJ8A 1IBSA 1YF3A 4XVHA 2NPFA 1W44A 4HAUA 2PNJA 3DOHA 4H6PA 4PZ0A 3RUAA 3V7WA 3L9WA 2VQ3A 1FL9A 4BO3A 1LS1A 4RADA 1TQ6A 4EFKA 4S24A 4R2XA 2ASVA 1YA4A 1KQPA 2YYZA 3GFVA 4MVCA 4K1LA 3SEFA 4TL8A 3DKRA 3VXKA 1JQ3A 4FZVA 3RYHA 4I55F 4M7WA 1T2UA 2QP3A 4CG0A 1LDEA 2PHZA 1CR4A 1J5EB 5DK4A 2EERA 1Q3HA 1RIIA 1OW3B 1OLXA 2BLNA 4RBNA 1YZUA 3ZHBA 5E2AA 3DBRB 4R84A 4B6PA 1MRZA 1M6VA 5CLGA 3PC4A 1BVHA 3ACCA 3KT0A 1L1EA 4UNRA 5FFNA 4MV9A 1YCGA 3H3JA 4JVSB 5CK4A 4OTZA 4AKSA 1HH4A 3PXCX 2MR5A 1S8AA 3KKQA 4JS0A 3VMFA 3NHAA 2R66A 4D45A 5CFOA 1WOYA 4FK8A 1EM8B 1XEAA 2YRXA 1QKKA 1Z2PX 2ZTHA 1PR9A 2B7LA 2OXTA 3TH5A 1LBIA 3ITNA 1EVYA 4LYHA 4LJYA 2ZTUA 2I7TA 4PV7A 2R2AA 1L5GB 3ELBA 2RI0A 3TGPA 3HVHA 1QX4A 5FWNA 4F6CA 5LOVB 1UEIA 3NUGA 1RVDA 3P0FA 3H18A 3M1YA 1Z0AA 2O8DB 2JLVA 5CD1A 4D79A 3B12A 3H2KA 1TVKB 2GAAA 3EE6A 1HO3A 3MIIA 1SVSA 4R2JA 3UMSA 2CJFA 4TTQA 2XRMA 5E1DA 1VG0B 1S89A 4JHXA 4Q7MB 2GLUA 1JLHA 3CUSA 3H8SA 3PIDA 4LZPA 3WRXC 5LM3A 2YXBA 1KA9H 2WWTA 1QRUA 1GN8A 2Q7XA 2VWHA 3PI7A 3T1HB 2ANCA 1ZQ9A 2AZTA 4I55B 3T4PA 2A3RA 1DQSA 3MJVA 4M2LA 2BV3A 2Z4TA 3H4IA 1CC1S 1KE2A 3GZ4A 4WJLA 2JVJA 3IP8A 3KIPA 2EWVA 1NR1A 3TUJC 2D62A 4XSVA 3BTOA 2GJ4A 4Q9IA 5I8PA 3D4LA 1EWYA 1Q1GA 2Y1GA 4UAGA 5KI6A 3JQAB 3RKSA 4R9SA 3BH0A 3FTFA 4TSRA 1GILA 1FYFA 1Q3KA 3DKKA 3PDIB 10MHA 4QBIA 3OA2A 1GAXA 2VJBA 1KJ8A 5HOQA 1NVVQ 2JIBA 3N75A 5EJGA 1LPSA 2WG2A 1K1EA 3MCWA 4N65A 1G8JA 3CO0S 1SVMA 1DADA 3JASB 4HAIA 4RS4A 2VA9A 3E22B 3QKUA 2OMEA 2VZ0A 4IPTA 3X1KA 1DCKA 2AD5A 4MARA 5IBRA 4M46A 5AVQA 1O0CA 3AEYA 2FI1A 1P1JA 1PG5A 1KIMA 3HE3A 2JIMA 2PN1A 3PRJA 4Q01A 5L9AA 3U4QA 2V6BA 2UYYA 3BMCB 2BBOA 4N5LA 4RIIA 1RIFA 5ALQA 2W2QA 3FMPB 3FJYA 3UOAB 4DKJA 2VTKA 5DT9A 1L5MA 1U8CB 4JVNA 1ZNZA 3RKRA 3K0AA 3K2QA 2TMYA 1C3JA 4TMKA 5F7JA 1GKLA 4WY5A 5ITZA 4HCJA 3LO5A 4JB2A 4DS3A 2Q1YA 3OZBA 3PIIA 4IV8A 3W5HA 1I2BA 2QG4A 4OP3A 1PS0A 5E1BA 5L6MB 3A4YA 5F76A 5TIIA 4EJSA 3PLRA 1SBQA 1QGUA 2VP5A 2VYCA 4UM5A 3UK6A 3UHJA 4QAJA 1K68A 1X86B 4GRIA 4QYWA 2QUAA 2BEUB 3K70C 1T2DA 4K05A 1YAHA 4O4HF 1WW3A 2EX4A 3A10A 5FPYA 3VKWA 3WFIA 3WL7A 1T2NA 4GXTA 1OI7A 3KL2A 3PUKA 4BE4A 1X7ZA 2HF9A 2W6OA 3E9DA 1EA5A 2FN4A 3GLRA 2Z2IA 2QPOA 4W1QA 4WCFA 3VJLA 2VPTA 1LPBB 3L0IB 2ZWVA 4LCEA 4D0RA 4LDNA 3EUWA 1O95D 1EK1A 1GGMA 3DBIA 5CT6A 3ZXIA 1ZUWA 2GRJA 4YK7A 2PZBA 4H17A 1UT6A 5COAA 3EFOA 5EKTA 4XX0A 1L6RA 4WI1A 3ZGLA 1XDDA 1YGYA 3MHPA 1I3CA 3R6GA 4CEIB 4FWIB 4D4MA 4IIBA 3HZZA 5KMGB 3LCVB 1D6JA 1JFTA 3H6KA 1UBOS 4QQKA 1QGAA 1ADCA 3TEMA 5KPDA 1ZH2A 3E8MA 4KPYA 2WBLC 1THZA 3Q0EA 3IURA 1GYRA 2RBKA 1C7QA 4I8XA 5C1IA 1WG8A 2REQB 1L7NA 1NE7A 1WMEA 1P62B 1XDZA 3DZGA 2P9EA 3OTQA 1U0EA 4WZBB 5H02A 4FSHA 5I8ZA 1M1YA 2CHVA 1QG2A 2RGAA 4S1NA 3NHJA 3VO8A 5EMHA 1DBVO 1TTTA 1DKOA 1I2CA 2JEZA 3RS4A 1EFHA 3QXSA 3IV7A 1NTOA 1UDRA 5ANRB 2AOWA 4XD7A 2H11A 3AVVA 1SCIA 1HG0A 1NLMA 2PVPA 3IUPA 4LOHA 1PZMA 3RSZA 2R6DA 3FTDA 4WA8A 1E2EA 3D7MA 1UF9A 1ORIA 1X80B 3DBLB 1KPGA 3PEFA 1UXGA 3N2GB 4GHWA 3S2GA 4O4HA 5KQGA 4MVJI 1HGXA 1X7ZB 1ZGAA 3QSGA 3NO4A 4YPVA 2DERA 4M1TA 3KR9A 3A2LA 1ARZA 2O5VA 3NUQA 5AI5A 5EE1A 2NU8B 2MU1A 2FE4A 4M1WA 4D46A 4FLFA 1BROA 3PK0A 3VTKA 5DXAA 1Z36A 2ZWIA 3KYJB 3VPSA 1GPJA 1NVTA 4CQMA 1Y9EA 3DUWA 3PS9A 1T13A 2VT6A 3F7NA 3HDQA 3MT7A 4OOFA 3DOJA 5B3AA 4KBYA 4K0RA 1OIXA 3TR0A 2DHRA 3H8JA 4DIUA 4DKXA 1IB6A 3SSMA 3ZGZA 3X2SA 1XVIA 4JB3A 2ZBUA 1AV6A 1J5PA 3TW4A 4B9AA 5C3MA 1HSOA 2LGJA 4HVCA 3HKBA 4XM2A 1PL6A 5CB4A 5JW6A 2YQ5A 3SK0A 4FB5A 5KU1A 3UTCA 3MMXA 3HI6A 4E94A 4H1HA 1B6SA 4MWSA 3ULKA 1TF7A 4QBGB 1T5BA 5BNFA 1PJSA 5E6SB 4DMLA 3LPNA 1KZ7B 3CRQA 1ID1A 4ER5A 3NASA 3MJEA 3OZ7A 4NZOA 5IZCA 3K0BA 1T3ZA 1C1YA 1VL5A 2FEMA 3RFFA 1A4IA 3CXRA 1UK6A 3T5MA 3V6MA 1Y82A 4R7GA 3IERA 3LD9A 3A28A 2GERA 1GV1A 3T4UA 2DHEA 2VT3A 4KN6A 2ZJ3A 3AIOA 3VOBA 3P26A 1OKKA 5BURA 1MH9A 4KR9A 3FETA 1NF9A 1PR6A 1RYFA 2VH5R 3KJNA 3EEOA 3OEYA 1KYYA 1JE0A 1OXUA 1Y4AE 2OHFA 3TLGA 2WFLA 5C5DA 1YK1A 2REBA 3NHFA 3GGOA 4PQYA 2BLLA 4WZ6A 1LSOA 1HETA 4JX8A 5K99A 2BMVA 2W6PA 3H6HA 3T35A 3WQRA 3UPTA 2IQIA 3QKRB 3GPDG 4Q3CA 2OV6A 2YWFA 5EMNA 1QRSA 4K87A 2ZJFA 3CPEA 4LXYA 4QDUA 5G4KA 5CVTA 2B4AA 2TMGA 5KDOA 2GNAA 3JU3A 4OO3A 4EY7A 4H3HB 2ACVA 3WLRA 2LP4Y 2XOKD 3D6TB 2WSLA 4QOSA 4MVJF 5ILQA 2GWHA 3EDQA 2XE7A 1Y6FA 4CUKA 3LHDA 1Q7RA 4BO5A 2JGRA 5J2UF 1ZW6A 2WINI 1U9CA 4AKGA 4MGHA 1NVAA 1ZI9A 4YFYA 4C0HA 1VZ2A 1D2CA 1XTPA 1Z0SA 1HC7A 2NZXA 3WK6A 2VPPA 2AFVA 3LC0A 3TIGA 1GUBA 1LVUA 4G0YA 4UEJA 1UEXC 4NE2A 4AZTA 2FZKA 3H2GA 4XRRA 3GGCA 3FFTA 4N76A 1XCBA 1SB8A 4L5AA 1EP9A 1SIWA 4MUXA 3IALA 4OKNA 2VDWB 2HK7A 4KXXA 2N9UA 3TAHA 3WS7A 4TTVA 4CF3A 1L5ZA 3BJZA 1E79D 1LNZA 4ZYXA 3CX6A 4PS0A 1JV2B 3DOIA 3HJAA 5FAKA 5CW2A 4Q3DA 1E2NA 4G97A 2FMXA 3UK7A 3COYA 3FWYA 4BP8A 4ZYYA 2JGNA 2J9FB 3I5XA 2NPIA 3DXZA 5F78A 3QZUA 2Q62A 1YS4A 3SJ7A 4DNPA 1IY0A 3A32A 1QWOA 4BEJA 1X7YB 4MV0A 3CUVA 4KQMA 5H7XA 3LHSA 3GN2A 4PAOA 1YTUA 1T36B 2ZUWA 2HWKA 2FJUA 1AVTA 3OLYA 1JDTA 3QVTA 1TYDE 3HVUA 4MVJA 3VU1A 1MENA 2QB5A 1WUKS 4WOJA 1V5FA 4CLDA 1RADA 1JIJA 4LYDA 3VUEA 3KQKA 1DRUA 1DXQA 2OGZA 4RKYA 2G82A 3AOEA 4YS6A 1UT5A 2GJAA 3KQSA 5I4BA 2I03A 2XGJA 1PN3A 3THWB 2DXIA 5KNBA 1RRPA 2Z3VA 1QONA 1FLAA 1OXXK 1ZCAA 3G1WA 3GPIA 4HFRA 4UCXA 2UZ3A 2HY7A 2XXJA 3AI1A 3FCSB 3I72A 4LE2A 5K1ZA 3RTBA 5DHQA 2XUHA 3P32A 3FTEA 1FMCA 3ETNA 4NBLA 2XRFA 5EJAA 2CFCA 2I99A 3LSTA 4EW2A 4JBNA 5CDFA 2GD1O 1E9VA 4RF5A 2PMWB 1ZK4A 2PZ8A 4WKNA 4HNRA 2PGIA 3DAPA 3KVYA 4XCQA 1E4EB 2ERXA 3N2LA 2XQKA 1R0WA 4QATA 5G1OA 4GQAA 3QOWA 4M1ZA 1D9XA 1AF7A 4TT3D 1E0KA 1L1QA 1COZA 2FPKA 4QUHA 5FYQA 1OVMA 3ZY2A 4AKIA 3W6UA 2QVYX 2JFUA 3OFKA 1D07A 4UVEA 3W06A 2Q4DA 5BMVA 3BGIA 3IBYA 3PQCA 3VR6D 4XYLA 3T41A 1IIBA 5JSZB 4R54A 4MPDA 4IX9A 2CD9A 2QN3A 3OQMA 1LDMA 3GHHA 4QRHA 3AB3A 4TTTS 4EM6A 4CE6A 1PUJA 4LRYA 4C22A 2Q0XA 4GP9A 1Y4SA 2CJYA 4BN4A 3SG0A 4EMUA 3FHTA 4BLRA 1N6HA 4RLHA 5K0NA 3C3CA 2TECE 2FKNA 1XZJA 3L2OB 2CVPA 4KR6A 4J1TA 5IJ0B 2ZU6A 5FR2A 1KDVA 2VC2B 1E8NA 3PNYA 3FY4A 2QTMA 3F73A 1WM1A 1OB5A 1EX7A 2YCLA 3MS2A 4EHKA 2CV1A 1WB6A 3IAHA 2J5QA 1FSPA 3FWPA 2PSSA 4DNXA 4J4BA 1M1NA 3NNDA 4HAXA 5E7JA 3T9BA 3AWIA 2II6A 2GXSA 4RPKA 2CDRA 1BFKA 4OHPA 1NLUA 2YYAA 3LGSA 4HN4B 2ZR7A 3P7MA 5IKEA 2AXEA 4RFSA 3UPUA 1VI6A 2BPOA 4Q48A 1ICIA 1NW4A 1PR2A 4RPCA 1LBQA 3WGZA 1DX9A 3I2GA 3UTDA 1O87A 5AVYA 3PF9A 2JI7A 5I7HA 1QGDA 2QV7A 1EXVA 1BG6A 1VL8A 5HZGA 1NR5A 4EQ6A 1D1QA 4X6UA 1EE2A 3F8TA 2WQ7A 1W73A 1CJSA 4BKUA 1G2QA 3QJ5A 4DARA 3TRJA 5JH7F 1H8EA 2C3YA 4JVMA 3B13B 2WIJA 3ND9A 1ABFA 4OXRA 1PE0A 3L7NA 3HS3A 2OBXA 1DJLA 2PJRA 2W37A 2YS6A 3JVVA 3MWDA 3WGQA 2EKPA 2OO3A 1Y1KE 1YL5A 2BGJA 2AKYA 4PLZA 4RE6A 2A33A 3SOZA 3K9NA 5BXYA 2VQFB 2D1FA 1UM8A 3ETEA 2GJSA 4BZQA 3SC2B 2YBDA 3NYIA 3UWMA 3H1GA 2WC1A 3R5TA 1B6GA 1GPMA 5LA6A 3TAXA 1CR0A 1NNEA 1JJBA 3D59A 3BJRA 2JCBA 4PQRA 4QJ5A 3VH4A 2H2AA 2CXXA 2V4UA 2DSNA 2F8LA 4U6QA 2YFQA 2ZQZA 1JKIA 2QYHA 2IHZA 1QS0B 4F38A 3LHIA 1PFWA 1JI0A 5BQ3A 4RK7A 4HWRA 2KSQA 3FYCA 4HKTA 2W2KB 2R25B 2NUPB 5HM8A 5CH5A 1TKAA 3HO6A 4PO1A 2AXQA 2ZT6A 5H82A 3V4OA 2Q9CA 4JWTA 2YWGA 1K75A 3MBOA 4R7TA 3F3MA 3L6BA 5EJIA 2O8BA 4J43A 3P5SA 4BX8A 3ROTA 4OJKA 4IJ5A 4POOA 2UXBB 2NNWB 4B7UA 4ITRC 1QYVA 2ZRGA 5ABPA 1QZTA 1JDJA 7ABPA 4CM1A 1NQXA 1OZGA 1JJ7A 1TK3A 3N86A 1FNNA 1U0GA 1P7CA 2PH7A 5KJEA 3G8DA 4FU0A 4WNIA 1CUXA 2WWFA 1QKIA 4V0ME 2ZBRA 3ERCA 3FVRA 3QTBA 1Y6JA 1GQSA 1FTNA 4LHSA 1RQGA 2AHOA 2XYRA 3N2KA 3KO8A 1PWHA 4EUHA 2O2EA 5KTRA 2W42A 3UC5A 4F9FA 2I6GA 4FCTA 3TW8B 3OOEA 4MAFA 5ALZA 3UV6A 4Z4GA 1YXMA 4G5OA 4B44A 4CETA 1L7OA 1O0BA 1Y5LA 1X9HA 2FV8A 2G8LA 3NVMB 3RCBA 2IIVA 3ZHVA 5AK5A 2IUFA 3Q5DA 1MDFA 2O2JA 4HXFB 5EN4A 2BHLA 4QHSA 4YWJA 2VQEB 1RWMA 2Q3BA 3FFBA 4OQMA 1KI6B 1AHIA 3TOVA 1N0HA 1HUQA 1OAOA 2QROA 3QKWA 5K8IA 3QVOA 2FPGB 9GPBA 2ZW9A 4F91B 3LKDA 1CEEA 4XARA 3ZCTA 4GO1A 2ZJ2A 1S2MA 1E1CB 2PH1A 4J3NA 4DABA 4CN8A 1O8BA 2JFXA 1O94A 3OQHA 1A4RA 4ZOCA 3UCEA 4B81A 4URXR 4YRQA 1YJQA 1KO8A 2PKCA 5EKXA 4F72A 3H4VA 5C34B 4Y30A 2PXHA 4U7JA 2ES4A 5AIAA 3D8SA 5T4HA 4N8DA 2OCIA 1JQDA 5E3HA 1EFVA 3GXBA 4WH0A 1E6MA 4IICA 2IWHA 4PR3A 4EF6A 5KDLA 3HU2A 1SOAA 4R9VA 4F1WA 3BFVA 3LBIA 3DVLA 4IF4A 4RU1A 4BMXA 2NU7B 1I7LA 1PS8A 4Q3LA 4HTAA 3U3KA 4YAFA 3A6KA 2XY4A 3EFBA 3TTVA 5C37A 1A9XA 3WJ2A 4BPBA 3OQOA 1YIAA 3QF7A 3RNLA 3ZY6A 4X65B 4B6FA 2ZG6A 3I4CA 2UDPA 2ZIEA 5DMHA 5FB3A 4JI4B 3IQGX 1OAKA 4O2RA 1LH0A 2Z6VA 3RS2A 3IODA 1Q12A 4EGFA 3RABA 3BA6A 3PHIA 4ZTZB 3A1TA 3VR2D 4IDBA 2CK3A 5DFAA 2DFTA 4F11A 4ZZ0A 4FGJA 4GZLA 4MZDA 5BY2A 4YA6A 2QPAA 3RYCB 2HCBA 1C30A 3I09A 4RHTA 3UYLA 4DLVA 2RARA 3P9CA 1LDYA 1SG6A 2IHBA 4CQNA 1QH0A 3RWOA 4BNZA 1PUXA 1PL8A 2VN8A 1V37A 4BO8A 3A6DA 1L7QA 1T29A 1LQ2A 5CLJA 5IMSA 1MC1A 1RI2A 1YR1A 5IM5A 3T54A 1M33A 4FVTA 4HDAA 4AMBA 1ZK2A 1EDEA 4E5SA 3RVNA 4JL8A 4E6PA 1FNCA 2A7XA 2HJRA 3FRHA 2PSFA 1FU4A 5JSHA 3R6TA 4BXOA 1MVNA 4G84A 2ZRHA 4KRYA 3I2FA 4IJ6A 4CM4A 2F4VB 1NI4B 1FUIA 2A9FA 1VIMA 4ZXPA 1SXIA 3SSAA 2NXJA 3TLZA 4CG2A 5B1HA 3AHJA 1ZJYA 4B2IA 1U4OA 1EE9A 3WWZA 2UUOA 4FT2A 2IUYA 3PUIA 1W8IA 3I04M 4PAQA 5EC8A 3SKVA 1LEHA 3QVWA 1EP2B 5B1SA 4HNTA 1JHUA 1RBMA 3MWLA 5JASA 3PPXA 1ZHHA 4YDQA 1TL7C 1S02A 1V8OA 5EHNA 4YYZA 3WAJA 3FOFC 2DZDA 3AG6A 4XOIA 1ECGA 1E92A 1NT4A 2PRYA 1SCJA 3IMCA 3PA8A 2FTKE 4WVFA 4EFMA 3R9XA 4WCDA 4DY6A 1IJEA 2ENWA 2GXAA 1U2ZA 2ID4A 4PR0A 1TO1E 3GJZA 4I9NA 4Q19A 3IPCA 3BWBA 1JHRA 4RVGA