3A3OA

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the five c-terminal residues
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 115
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3a3oA00
3DE1X 1YJCA 1R0RE 1TK2A 1Y3CE 3WHIA 3A3NA 2PKCA 1KDVA 4H6XA 4KB5A 1TO1E 2W2OA 5FFNA 3VHQA 5JXJA 1TM1E 2WWTA 1SN7A 1WMFA 4KG7A 4RYDA 2DP4E 5ARBA 4YN3A 3LPAA 5ARDA 1SBCA 3P5BA 4Z2AA 2V8BA 3BGOS 2SECE 3HJRA 1AK9A 2Z57A 4OMCA 2WUWE 4LVNA 1PJ8A 1KE2A 1JEAA 1S01A 3GCXA 1AF4A 1P8JA 3DW3X 1YJBA 3A3OA 3GT3A 2ID8A 3AFGA 4WOCA 2QTWB 3L1KA 2W2PA 1TECE 4KPGA 5FAXA 3DVRX 1ST3A 1Q5PA 3EDYA 3ZXYA 1SUAA 4H6WA 2DUJA 3WIUA 4NE9A 1GCIA 3BX1A 1IC6A 1T1GA 3DWEX 1NDUA 1C9MA 1UBNA 1OYOA 2WV7A 1GA1A 1TO2E 4GI3A 1HT3A 1BFUA 1SBNE 3H42B 1GTL1 4NE7A 3TI7A 3QTLA 1YJAA 1Y9ZA 2HPZA 2GKOA 3PRKE 1Y3BE 4CFYA 5JXHA 3QMPA 3EIFA 1T1EA 4CG0A 1WVMA 3UNXA 1P7WA 3DDZX 5FBZA 1KDZA 4JP8A 2ST1A 1GTJ1 1SUPA 3F7MA 3PTLA 1PTKA 1Y33E 1SUBA 2IY9A 2PWAA 3GT4A 1CNMA 1T1IA 2ZWOA 3DE6X 1SCJA 3DVQX 2X8JA 3VSBA 3DW1X 1DBIA 4B5LA 4H6VA 5AVKA 4DZTA 1ZVJA 4FONA 1BFKA 2XRMA 3I30X 1OT5A 3DE5X 3OSZA 3WIVA 1SBTA 1BH6A 2SBTA 3CO0S 4C3VA 2IXTA 2X8JB 1GTG1 1BE8A 1TM5E 1VSBA 3GCWA 1V5IA 1Y34E 3LXUX 5SICE 4K8RB 3TECE 2W2NA 4WOBA 4M1ZA 4CFZA 3LPDA 3DE4X 1XF1A 1C9NA 1Y4AE 2PQ2A 2SICE 2Z56A 3T41A 3WQBA 1SVNA 1DUIA 5B1DA 3DE0X 1SBHA 1V6CA 4HVLA 1GA4A 1SH7A 1SUDA 3EE6A 3QFHA 3I2YX 2Z58A 2W2MA 3LPCA 3DE3X 4OV6B 4NMXB 1R64A 2TECE 1SIBE 3VV2A 1IAVA 1Y3FE 4ZARA 2PYZA 3SQOA 1GNVA 5AQEA 5I9SA 2PMWB 1Y48E 2E1PA 2Z2ZA 1Y1KE 1KE1A 1AV7A 1LW6E 3TI9A 4MZDA 1TM3E 1SELA 2WUVA 1S02A 2B6NA 1PFGA 2DQKA 1S2NA 2ID4A 4HX2A 2W2QA 3I34X 1AVTA 1GT91 5AVJA 1SIOA 2HD4A 1BE6A 1C3LA 1WMEA 5CW1A 3DVSX 4AKSA 1GNSA 2ZRQA 1SUCA 3CNQS 4J94A 1CSEE 4ZOQI 3VTAA 4DWWA 2P4EA 1EGQA 1THMA 3Q40A 1P7VA 1AH2A 3DE2X 3D43A 1SCNE 4LVOA 2Z2XA 5ARCA 1GA6A 1SBIA 3ZXXA 3SICE 4C3UA 4DJ5X 1ST2A 2ZWPA 3VV3A 5K7SA 2PRKA 3D9QX 5JXGA 4BWGA 1BJRE 3I37X 2XTJA 5B1EA 1SCDA 1SCAA 3VYVA 1YU6A 5JXIA 1KDYA 1Y4DE 1MPTA 1WSDA 1SPBS 5AMXA 3DYBA 3DE7X 1SUEA 1NLUA 1SIUA 3Q5GA 1OYVA 1MEEA 3AJ9A 1EA7A 1C9JA 1R6VA 1WMDA 1TMGE 1TM4E 1TM7E 3F7OA 3A3PA 4I0WB 4OMDA 3F49S 1SCBA 5JMOA 1NDQA 2SNIE 2Z2YA 2PWBA 3AJ8A 1Y3DE 2G4VA 2Z30A 1AU9A 3BPSA 4AKTA 1ZVKA 1A2QA 1AQNA 1PEKE
chains in the Genus database with same CATH superfamily
5BRAA 5BV8A 4XIGS 4OJKA 4JX8A 4NABA 2WAOA 1ITZA 2YWHA 4P3YA 3MMZA 5CCDA 5CFRA 3AF5A 1OHHA 4C06A 1WHTB 3QH4A 5LSAA 3CVYA 2FKNA 3W7AA 5K09A 4C0BA 4O02B 2OSVA 5JTTA 1ZRMA 2JLYA 4P08A 2QYHA 3PUJA 3HPRA 4PRZA 3T61A 3X44A 4TV9F 1GIAA 3EIOA 3IAFA 4EGJA 1PF7E 3OESA 5CB6A 4RIEA 1C1DA 1DIOB 3AUJB 3D7KA 3SXUA 3UWPA 1J8QA 2BHRA 3K1YA 2UU9B 4OJQA 4OB8A 2C5FA 2H7CA 4XTRA 3RUPA 3DF9A 1R15A 1T1GA 3MCAA 1X1CA 2GPJA 4E1BA 3BHMA 3E03A 5HE9A 1GPJA 3LUCA 4P1ZA 2HSGA 4GX5A 5DM2A 3T35A 1XBTA 2GYVA 3WNQA 1G1MA 2QU7A 1J24A 4K9LA 4JUBA 3ROXA 2QZ9A 3ZNOA 4DA6A 2ZYSA 3N8GA 4FFNA 3WP1B 2R7NA 4LXIA 5GGYA 2QF7A 2CXOA 3DGEC 1GZ4A 3EGDB 4AC9A 4F97A 5A5GA 2D06A 3ESDA 3ZVNA 4NC9A 3J7AC 2VO1A 1OXBB 3FZYA 2Y0PA 3UH1A 1KO1A 5THKA 4Q02A 3USES 2V7QD 4A03A 3F6RA 3KOOA 2O2JA 1ML3A 1J0AA 3BZBA 3W2TA 4TLMB 5TARA 1G6KA 4GE0A 1C0KA 4MDYA 2CJWA 3KJEA 3VDRA 1IJBA 3WLQA 4MWOA 2VPXA 1ZEMA 3QG1A 4FINA 3T5GA 1D2EA 3KPYA 4QOSA 1PL7A 3DTYA 1P2SA 1QNLA 1T2CA 1IZ0A 2Z95A 4KZKA 2JLQA 5DP2A 3WZLA 4H7EA 4QX6A 5I3ZA 2QI9C 1UKAA 1TQ2A 3KYCA 5C8YF 2AWOA 3FX2A 4CUKA 2UYYA 4MA4A 4NG4A 5KTMA 2I6TA 3ZQJA 3QU4A 2GRJA 4Y2PA 4GLFA 5CURA 3LZCA 4BS9A 1W8IA 1ZOSA 3M6FA 4P34A 2FOXA 2VHCA 2G3YA 4ZYXA 3SWWA 3RASA 2P9GA 4JOBA 1HTBA 4PSUA 5DTQA 4DWWA 5JJKA 4G4GA 1SCNE 3SIPA 4W8GA 1EE1A 1RTKA 3RVRA 3ENZA 1FEZA 2BR3A 4MVJG 1DJPA 2J31A 5B2EA 4G4IA 5ALNA 5C51B 3HXPA 4FHFA 2Q3BA 3AQIA 2A9VA 1TF7A 2AFHE 1E79D 4JBYA 1KEUA 2XNCA 4PBRA 4RD6A 5KREA 3BA6A 3LA6A 4BX2A 2D5LA 3D7SA 1US8A 2QZSA 1CVLA 3I6IA 2AG8A 4G36A 1ICEA 4R69A 4ZAWA 1OWOA 2IZZA 3SF0A 3GZTB 1S8OA 1Z34A 3BXZA 4KDCA 1XPJA 4M0KA 3L49A 4TRNA 4TKUA 2FJPA 1R6XA 4XUGB 5DHUA 1EEXB 4PIMA 3ZW8A 4CR7A 4OIFA 4CT4B 1LV8A 1RXCA 2AN1A 4HDQB 3SHQA 3WHIA 4R83A 2G6BA 3H86A 2KSQA 3HZOA 3KJFA 3TLEA 1KDVA 1SWWA 2PT7A 4KXNA 1L4MA 1YD7A 4L08A 4Q4HB 5K0LA 3T7CA 4CQMB 2H2GA 1GPLA 1LRKA 2QT0A 3JQ7A 2I6GA 4U5QA 1CYDA 2JNWA 3ONWA 4GR4A 4Z4FA 4ZVNA 1DLIA 5I3CA 1UPBA 1ZKDA 3HCWA 3QHQA 2FOLA 4Q12A 4KR9A 3ZV3A 1HO3A 1SAYA 1UBHS 2MR5A 2RJOA 5ALKA 3IQDB 2Y1EA 2HMVA 1JHDA 4KYUA 3FFAA 3FCEA 5TIIA 2VPTA 4JB2A 1P8JA 2XBLA 4S1OA 3KB6A 1WTCA 5GM1A 1L5KA 4ZOLB 2CMFA 1U4NA 3UH0A 5GZ6A 1ZM9A 3NT4A 1FSFA 4L3OA 3W1EA 1LGYA 4GLJA 1E4EB 3EDYA 3K9WA 3TR5A 2X13A 2GJ9A 3I76A 5BQPA 4QQ8A 4TKVA 1I30A 1V5GA 2DWQA 4Q9KA 5CD9A 4QVIA 1ZHOA 1UXGA 1JYSA 1NI5A 4ERNA 1JPUA 3DCIA 4LC1A 5FPTA 2LKDA 3DFFA 2G9ZA 2WIJA 4CE6A 5DIFA 2XSZA 4WLUA 1KEEB 5HCNA 5LCXA 3QKSB 3BL8A 2ZUFA 4E3WA 5CX1B 1AKWA 4X20A 3AHGA 4CR8A 3CH6A 5CCBA 1E2NA 5BW6B 3CW8X 1NIPA 4MQFB 4N39A 4RULA 2VDVE 4PX3A 1Y5MA 3K6KA 3V8VA 3ZWDA 2BP7B 5FUBA 2XT0A 2A5JA 2BHNA 1DCFA 4PC7A 3V2UA 2X42A 4K5QA 1ACMA 2PUWA 3MYRA 3ORHA 4ACAA 1MIOA 1ZK2A 3GFBA 1W4AA 5CITA 3M6XA 4AT1A 2XBMA 5LQUA 2OCGA 2ONKA 1NR7A 4EZBA 3OIDA 4TSFD 3T3NA 3ZNPA 1N1EA 1U8EA 1YR1A 2WDZA 2WVJA 3M4NA 3NLLA 4G89A 4EFMA 3BRQA 5ALMA 4PZ0A 2SICE 5C53B 5L7WA 1QK3A 5ITWA 2QU8A 1E79A 1WOMA 3H13A 1Y82A 2VIIA 1KEZA 3HGQA 3NI2A 3O4HA 4Q3KA 3OZDA 4GMFA 4R05A 4CM9A 1ID8A 3M6VA 1B14A 1EXMA 2Q9BA 5GY7A 3GB9A 1K08A 2OTCA 2OHXA 1DEOA 1R9NA 2ZJ1A 1K0FA 5BSKA 3GWZA 3JR3A 3QIVA 2L19A 2IUEA 3RIEA 5AO9A 1A0OA 1MV8A 3BRCA 3WX0A 1EGAA 5JD3A 1G5PA 4HH0A 3UA3A 2NAPA 4JUDX 1G18A 3DVSX 3F3MA 4LWPA 2I7XA 3GJZA 2WTBA 1X1QA 1P19A 5HTOA 3MTGA 1O5TA 5MGNA 3QPBA 1GPWB 1KOJA 3O7MA 1JWBB 2YV5A 3PE6A 2QXUA 3SN6A 3CF4G 4C14A 3UGJA 3WFJA 5ADVA 2VN8A 3F6YA 3S5JA 3IQHX 3ISVA 3WRYA 1OB2A 4DIUA 2EKQA 3FVVA 1FMTA 2VEDA 2IXAA 2OHOA 2HNKA 4IV0A 3S2ZA 3PI7A 1MHTA 4PPNA 2NZUG 3JV7A 1J07A 4KC0A 3ZHQA 1RXIA 1VE9A 3GPIA 3RAEC 1XR3A 2VYNA 2DX7A 2O48X 1FSGA 1QX4A 3B3FA 2CLOB 5K51A 3IKLA 3A58B 2YMLA 3ON5A 4MVJF 3F5SA 4RENA 3D4BA 2AOTB 3GT0A 5BN5A 5LXTF 1LF5A 4DUGA 1YBMA 1Q77A 1IVSA 1IWOA 3A0RB 4YT5A 3SK0A 4YP6A 4YCMA 1Z9BA 2DULA 4UBKA 4HPWA 1OYYA 3JQAA 3PQ6A 4KGDA 1EJBA 2IEIA 4TSKA 1BKYA 2YR0A 4UNIA 4YCAA 3HBLA 4G5RA 3B1XA 5E7IA 3VO2A 5C37A 2O8BA 2OVBA 5C18A 4KPEC 3THXA 4K9RA 4LZZA 4WA7A 5SZJA 1E9RA 2HLNA 3Q4GA 5JDIC 3ND8A 4H9GA 3FF4A 3DOFA 4AG3A 4JI4B 5C46F 1KH2A 2VK2A 1QKJA 1QS0B 3I01A 1P74A 1YOVA 3ESYA 1NMQA 3U6BA 2QN2A 2W2VA 4FS8A 1J2YA 3P45A 2YICA 4FFWA 5CPFA 2QPOA 3EF3A 3FKQA 2G70A 13PKA 1LCIA 1ZD5A 4HNTA 1RPJA 3AM4A 1E3IA 4LG1A 1ZJ5A 2RKOA 5DHTA 3C1UA 4CCAA 2CUZA 5H81A 5I45A 1N92A 1IN1A 4AJKA 1DV2A 2NUBA 3HSYA 3NIDB 4L78A 2V45A 1K63A 3RVJA 1UJMA 4R1MA 2JVIA 3SZMA 4A73A 5LNK1 4AYTA 1J8FA 2H7VA 4BP9A 3L06A 2IW3A 3P2MA 4JASB 2CL5A 4L07A 4YRPA 3PDWA 5AKJA 3OZAA 1D8TA 2WKWA 2CSUA 5JAUA 3D2CA 3BGVA 2B4TO 4QPNA 2R65A 3G2HA 4B4KA 3MBIA 3L7NA 2C9MA 1XRPA 4X92A 4IHJB 2QDKA 3DB2A 1GPAA 4Q4JB 5DBIA 4CW7A 1JA9A 3I5UA 1KK0A 1XMSA 5DXAA 4D79A 1J2TA 3DZJA 1W34A 1EFHA 3DF7A 1XMJA 1XZAA 3I2HA 2BJVA 1YGYA 3OP1A 3TNDA 4D9FA 3LLSA 3AM1A 3QKRB 1M0SA 1WW2A 4Q7QA 4JVLA 5KQMA 4WVLA 5G4LA 4BO3A 5JDCA 1EUYA 3NGXA 3D4IA 1LC0A 4RH0A 1H6BA 3HJBA 3GJ5A 3I45A 4LYHA 3BWCA 1ENZA 2Z2ZA 3AR6A 3V33A 2VP3A 4WNCA 5KEIA 3MAJA 4L75A 3TG2A 1K7YA 1XEXB 1HDXA 4YMLA 3D81A 3PUZA 2OO3A 4ND8B 5J59A 5EJ4A 3DZHA 2ATIA 4EJ2A 3BMXA 3CH7A 1U3DA 3JAWA 4WINA 4F85A 5DYIA 1H22A 3KZXA 1OY1A 4RTPA 2WWRA 4MV3A 5JFTA 1G38A 2CBGA 3O8QA 4YWHA 4DQLA 3FZGA 4Z3KA 2XYHA 1YK0A 2CKMA 2GYYA 3GROA 2P9FA 3OX4A 4JL5A 3L0IB 1ISRA 5C5DA 2ZANA 5I9NA 1U7WA 5E0KB 1PO7A 3L8DA 4KFUA 3LDHA 4IDOA 5E6SA 1DKUA 4J4TA 2PR2A 3EYWA 4WK6A 5DYTA 5TGTA 3WWEA 1B26A 4L5CA 3D4LA 3DE7X 3B1ZA 4DPMA 1P5ZB 2VHEA 4Y2TA 1MB4A 5DI9A 5AKHA 5AVWA 2E85A 3OOJA 3CJQA 3HO6A 1LLQA 1N4AA 3S8EA 2XE8A 1UPFA 2FX5A 5SZKB 2J9GA 3ECSA 3H2IA 4MUMA 2GF2A 1QGDA 4H6PA 2HXYA 3OZEA 4XAQA 2JANA 5C3UA 3BIWA 5T8KA 1UDBA 1BA2A 4R2WA 3PE4A 1QQ6A 4IDHA 4TLEA 1J8YF 3HYLA 4Z9FA 3KQHA 3BQ9A 1CUSA 3KAKA 4RK0A 3JWIA 5HPYB 5JHGB 4FK8A 4II2A 5CNIA 1XDUA 2NADA 4D82A 4NU6A 2O3TA 3BREA 3KWJA 4MUIA 1E20A 1SHTX 2RFLA 1H2WA 1J6UA 5CHYA 5ICSA 1J00A 1E1KA 5A9RA 4GPTA 4WKBA 2ZRGA 4EKEA 1PJ8A 2C57A 2WJZB 1JEAA 4UTOA 3WICA 4C29A 4DR6B 1QB8A 2ZQ5A 3GLHB 1CB7A 3R9XB 2BMWA 5EIAA 3HM9A 3B8EA 1YUBA 1NRJB 3KOUA 2C00A 2PX5A 1T6XA 5HUQA 4REQB 1NU8A 1I7SB 3Q5EA 1XA4A 3AKCA 4FCVA 4X62B 2NN3C 4YCSA 5KQPA 4BO6A 1GA1A 1B16A 2HRQA 4A8PA 1BFUA 2XCTB 1EVYA 3G7NA 1K8YB 1SUSA 2OR3A 4R0VA 3RADC 3A2KA 3H2SA 4ZEMA 1MB9A 2PSJA 4CBVA 3WSVA 2JZNA 3D0KA 4KDFA 4DIOA 3EIFA 4EL5A 1DIHA 1YB7A 3A11A 1UT6A 2UAGA 1WV1A 4LQLA 5ITZB 2BEWB 4QC2A 1JHYA 4TS4A 4RBNA 1JFSA 1V26A 1ZNQO 1DWPA 4BO1A 1ZJJA 2YUTA 3GAFA 1J9EA 1L4BA 3WIVA 2YJGA 3RUDA 1UODA 1SHUX 1DC6A 4YK7A 5AXAA 4OVKA 5FCDA 1N6HA 3GVCA 1V5IA 3MLEA 1UADA 2XUHA 1GITA 5I7AA 4RJJA 1UKEA 2R5FA 2Z04A 5DHSA 2ZETA 1QGUB 1W76A 4Z1OA 3EPLA 4OQMA 1SURA 3W4JA 2B2CA 1GAQA 4C89A 5HWSA 4WCDA 3C6YA 2XRZA 5KPDA 2W2MA 4WT7A 4PFQA 1FYFA 5KI6A 1QYIA 2HJGA 3S70A 2BT4A 3S4YA 4IIJA 1N2OA 3BKXA 4LDNA 2ZE8A 4H16A 4GI7A 1A7JA 1W4BA 4KAJA 1EDEA 4B7AA 4L0QA 1JVBA 5HF9A 3I34X 5CFPA 1F9AA 3F47A 2HZBA 1Q7CA 3WGYA 2Q2WA 3E2IA 2NU6A 4N8EA 2DT5A 4NPHA 4EUFA 3ADDA 2J3QA 1L4LA 1X87A 2PDAA 3A2NA 4OH1A 3AF0A 3K0BA 1K88A 1VKRA 4XLZA 3UW3A 2I99A 5BRJA 3BGDA 2EDAA 3PGVA 4XPZA 1K3UB 3FHOA 2YXPX 4FMCF 4BNMA 3LGAA 1ADBA 1GLVA 1H3FA 1GO2A 1G3RA 2AZDA 3I28A 2PMFA 1T9GR 2FW1A 4M0DA 4QGHA 1Y9AA 1LDEA 3A9UA 3UATA 4NU0A 3TK1A 5JQGF 3FHJA 1GUZA 4IMIB 3CC8A 3ZJTA 2D2FA 2JK1A 1K86A 3OTIA 4UBOA 4Z2YA 4CMBA 1EFKA 4KVZA 5IJ9B 1L6RA 5LQSA 4KQ6A 2EGGA 5JMOA 3CWCA 3DWFA 4OLBA 1RZRD 3ZOKA 2AN5A 2ZIEA 3JZAA 1QIKA 4DKXA 1VLQA 1T5BA 1HX7A 3QWHA 3L05A 5EC8A 1GU1A 5D6OA 3SZ3A 1TLFA 1XHLA 3L82B 1W0JA 2PTHA 1VM6A 4QLOA 1YE3A 4TMYA 3T4XA 1X8XA 3E27A 3KQPA 4RK5A 3I9NA 4MYHA 4TUYA 3LC1O 3HN2A 5CHEA 5BT9A 3NDRA 2GPBA 3TZLA 2EZ9A 3O5AA 4PYRA 3LNTA 2ZB7A 1RWPA 2NU8B 2VWGA 2WFMA 2A9RA 4DCVA 4MHOA 3QWIA 4U63A 3M6MD 1OW3B 4E11A 2OY0A 1RYZA 2QN8A 3RREA 4ALJA 2YWCA 2OBMA 4RHCA 3ETEA 3QI2A 4CLOB 4FR2A 4UNNA 1IN4A 5HUJA 5E4TA 2ZPUA 4AO7A 3VPSA 4F93B 3ZE6A 3PX7A 5JWOA 3IP3A 1TD1A 3PX3A 3MB8A 1D7OA 4II3A 1Y7PA 2B9EA 1B7GO 4JKIA 3JRWA 4L5BA 4NYMR 4OU4A 3EC2A 1WDKA 3A9TA 4RDCA 1TK3A 2IVZA 4MV0A 4OI0A 1DAMA 4C7MA 2DPYA 1G5TA 3A04A 2VCYA 5CJPA 2P9EA 1KHHA 3QF4B 1BS2A 3AJRA 3TZEA 2Q7DA 1N5KA 3S7ZA 5P8WA 2IJGX 3UV7A 4O08A 2QQ0A 4HAXA 1PHPA 2QW0X 2QRJA 2ZDGA 5A2QA 2G25A 5HG0A 2J4DA 2CMDA 2RGWA 1ECPA 3T0GA 1HK7A 4RK1A 3PQ5A 2RD2A 2OV2A 4U2FA 4BMNA 1NULA 4B3XA 2PUEA 5DN6D 3BVPA 2SHKA 3DVAB 4NCHA 1NATA 3IVMA 3OF3A 2XW6A 1KI2A 2JFUA 3L8ZA 3QU5A 3TQHA 3VU9B 5ALZA 2DBRA 3OHSX 1DHTA 1VOTA 1DAKA 3F7NA 1VJRA 2BFOA 3E7DA 3MILA 4H60A 4HN4B 5D6NA 1KY4A 3HP7A 3TIIA 4LJ9A 1QKIA 3HA5A 3EOBI 2HTEA 2O3QA 2HSZA 5FOSA 4D7AA 4EUEA 5CYGA 3CYFA 3V1UA 1SMKA 1DRKA 1ECJA 2X23A 2X5OA 3CA8A 4PZLA 1IPHA 2EFYA 3C6ZA 2ZT5A 5DJ5A 5TEVA 3LPCA 2ZQYA 4EHBA 2GLUA 3ME5A 4TMZA 4ZQIA 4GYJA 3RVSA 4MWTA 2PMWB 1EM8B 2V6BA 2HIMA 4MDFA 1K7EB 5EMHA 1KEEA 1YRYE 4KR2A 4TYYA 3V55A 1U3WA 1IQPA 3PFIA 5ALUA 1WCWA 4LQCA 1PNQA 1DJOA 3EPRA 2PG3A 3D7NA 3M5DA 3OA2A 3I83A 5EMJA 4AKSA 1VSTA 4F4CA 2QRGA 2BGRA 1A9XA 2DTXA 3KBBA 2YOGA 4HWGA 3I6ZA 3MHPA 1MABA 4O59O 4RKFA 4DN6A 5KKCA 1GGEA 1GEEA 1QGYA 4MWEA 3T9AA 2IEDA 4CV1A 1JSZA 2ASVA 2UVPB 3H05A 2GBCA 1G41A 2QE7D 3GJSA 2RK4A 2XLCA 3LI2A 1MA0A 5HFNA 1YFJA 4FOSA 1M54A 3TBHA 4R3NA 3HA7A 3EMKA 3ACBA 4PNEA 3HCCA 4YRQA 4CLRB 2KQUA 2O5CA 4NV0A 3T9EA 2AD1A 2VDQB 4JL6A 1CJCA 4PLPA 5BOSB 2AD5A 1XOIA 2CEAA 3GAMA 4OKIA 3U3MA 3VZBA 2DR2A 3RFUA 3EOZA 4EYGA 2JFFA 1XCPA 3OQJA 2XIJA 4E1VA 3MGKA 4R71A 3GLFA 1MJ5A 4AKTA 4Y0VA 2I76A 2NAFA 4B6OA 5TY0A 4GMGA 4F96A 1I7LA 1JSXA 1VJ1A 1ZIOA 3HBMA 3N2IA 1GR0A 1PEKE 4DLNA 1MW8X 1FDRA 4KHZA 1TLTA 2HXGA 1PWXA 3UK2A 5J2UF 1R5BA 3EVTA 1FXWF 4TUYF 1QANA 4UHBA 3Q11A 1Q0SA 1NI3A 3QTTA 4BGUA 4LGVA 4M7PA 2DKNA 5DM70 2CZCA 5HKKD 3WY9A 5LB2A 1FQWA 3ZU2A 3N3AC 2NVUA 2PYIA 2VYVA 1W88B 3NWEA 1C1DB 3PNOA 4MB0A 4DVGA 2ZZMA 2GDZA 3DQZA 1X1TA 3KQNA 1PT5A 3MWKA 1R6TA 1NNLA 1L5GB 4GG1A 3F8WA 3PZRA 4G0ZA 2PZLA 3TOXA 1HLPA 3NBFA 3G5AA 4INZA 3ZU4A 2ZIVB 1SA0A 2QPAA 2YMQA 3JWGA 5EKTA 1KOGA 3HKCA 4IM7A 4JBXA 4OGWA 4S1NA 5C5CA 1OXMA 3TLZA 2BMEA 1ZZEA 1MO3A 4FXPA 2H0RA 4D4HA 3U7EB 1VYUA 1UBNA 3CCCA 3A4MA 3KZMA 4XVQA 3K1JA 2V7GA 3FY4A 3H42B 4LC0A 3QA3E 3DDHA 5U9CA 2XRYA 2JLXA 4C2UA 2GARA 5JUWA 1V47A 1C3OB 1I2BA 2AS0A 3EZFA 1FXWA 2B7BA 4QPJC 3GR6A 3BS4A 4Z6KA 2ST1A 3GMIA 1BWRA 4RVUA 3TLBA 4QG3A 2F9LA 1U3TA 2PWAA 2ZI9A 4DR7B 4B3GA 3OQOA 4QSMA 5EVCA 2PS1A 2EG5A 5KOHA 1N7GA 1XLVA 3MJDA 1Z0FA 1EFPA 3H9GA 3SAJA 4BYMA 5K2OA 3GYBA 3QEBZ 4I08A 2ISCA 2QVBA 2XH8A 5ER6A 1KMHA 4N6GA 3QKIA 2YHUA 4ANFA 4BAZA 4QQKA 5A71A 4BFWA 4LDJA 2NTEA 4AK9A 4WX2B 5A0TA 2VPYA 1LXCA 1QQ5A 4LZNA 2OBXA 2W7TA 3UUWA 1QO0A 3FPSA 3P9RA 5CEFA 2FSFA 2O23A 1N2SA 5A04A 1U1IA 2KW5A 2FEOA 2P3LA 2QGZA 4XE5A 3RS0A 1S9HA 3W3AD 1T2AA 2RBGA 3DMPA 3C87A 4K9SA 2GAAA 4UFPA 3FR8A 1FFXB 3PJFA 5FEMA 5KS2A 3TL2A 3IMEA 1NLZA 1Q21A 3FWKA 3IBSA 2HD4A 1SEPA 1Z0AA 3H11B 4C88A 4QJ3A 2L18A 4NF2A 1W1WA 1MC4A 1XZHA 3U7FB 4BFXA 2LDXA 3KNZA 3HHPA 3KOYA 5AW8A 1EFDN 1I9CA 3AINA 3CH4B 1JSRA 4HUJA 1VLHA 2QZPA 3QI7A 4UE3S 3EPPA 4ZVPA 1SHKA 1KRXA 5AUPB 4FEAA 4GQAA 3BA1A 4S12A 3ASZA 4DREA 2GM5A 2Z1DA 5FOQA 1O95C 3TFQA 1YDHA 3SFVA 2JH9A 3FNIA 3TPCA 4DGSA 1H5NA 2O6LA 4J0CA 3TNJA 1FDVA 3FHLA 3F49S 1SCBA 1ZI6A 4J0GA 3EVEA 4K9OA 3B3JA 4KIWA 1FPMA 4PGFA 1V43A 2OV1A 3M33A 1NP3A 3IB6A 4LBWA 3VVMA 1TYDE 3U3XA 1NUUA 5ETJA 2GN2A 4TQUS 1DCKA 3GLIA 1W5AA 2AZTA 5IC6A 3WO1A 3VPGA 1NVVR 4IIVA 4GICA 1JFTA 2P9CA 1V6SA 4HKTA 1S3IA 4II7A 5TPWA 2W2OA 3FGZA 3IPYA 4BLRA 2CDBA 2K5UA 3MUEA 1G7CA 4B3JA 1P0QA 1V9LA 2XAAA 4F56A 3K0FB 5HW0A 1O6CA 3R3XA 2DT8A 3ONVA 4RYDA 2GCIA 1OWLA 5BSWA 2AHRA 3OUTA 5JCOA 2CE2X 1THGA 3ZU5A 2JCGA 2XWJI 2NT3A 1N6NA 1N6PA 3AIMA 3OJXA 4Y6QA 2AFHB 3W6OA 1Q3TA 1ULTA 2GT1A 3EEYA 3MWFA 4PR3A 4Z9XA 2J5XA 4QYSA 3L8EA 1U8ZA 2A1UB 4N5NA 4Z0PA 3FVTA 3W5CA 2WQ6A 1H4QA 2PS9A 4JIMA 4NI5A 5EP2A 3K4HA 5JFOA 1YZKA 1KH1A 1TJ4A 2BGNA 2GUWA 1BMDA 2F1JA 2HHCA 2IDKA 3IP7A 4BTLA 3U60B 1E3QA 1CUVA 2J3EA 5SV2A 4LY6A 2JGKA 4O2AA 5A2GA 4FDUA 2ZR8A 2CK3A 2OFWA 4PXYA 4DIEA 3VHXA 2PGAA 3HVIA 3UF0A 4RGBA 5BV1A 3BIFA 2BTOA 3AUXA 1IXZA 2XTNA 1PJRA 1R18A 1XVVA 2VH1A 3AKDA 1GZSA 3QW4B 3GRRA 1QH1A 2GXSA 1GJRA 5ESRA 2YXDA 4W9NA 1XN1A 4AJIA 5K20A 1S2IA 4L15A 1RCUA 2W0SA 4X41A 2BUCA 4UTNA 2BZ0A 3ZY6A 3H2ZA 1PZHA 1AQUA 1DAHA 2CGEA 2R8EA 3GVHA 4X6UA 4KTTE 5B3JC 3UGTA 2WFZA 2YASA 3HADA 5SYAA 1U2ZA 1CUWA 1LH0A 2O3JA 4B0OA 2II6A 4MRRA 1ZK3A 2R3SA 3LQRA 5JPIA 2XWPA 1T8WA 2JEZA 1MJHA 1NBAA 2IGBA 4OU5A 3SQDA 4LYEA 3N2ZB 3NR2A 4D8YA 1CR2A 4E15A 1HSZA 1H5QA 1QWOA 3KPWA 1OI7A 5TXGA 4MS4B 2MDTA 1KJJA 4ZVMA 3VISA 3AERA 1I1NA 1WXWA 1QQTA 1UXJA 2AC2A 3L7OA 3OFVA 2NXNA 1WZIA 4XYLA 1P7YA 3CUEF 3K32A 3ILXA 3RQSA 1GCOA 3DEJA 1JVNA 3GQBA 3NIBA 4TYQA 5CA0F 3DZKA 4O63O 3ICEA 2E0IA 2YTZA 3O8NA 1AVTA 3K5PA 5EWLB 3KQKA 1BEZA 1DRUA 1FDWA 1JR3D 2C94A 3C8MA 1ZR2A 4IKOA 3PDIB 4ZQEA 1ATZA 5JH7A 3IAXA 2QENA 1P7VA 4LV8B 3PHGA 4EP1A 4WJLA 5A7FA 1Z7YA 1VBFA 4PLFA 5ES3A 1C50A 1WUYA 3HEAA 3TLMA 1K9VF 5A6VA 2F55A 4IKPA 1UMCB 2ZWPA 1IBMB 2OCXA 2I8AA 5D00A 4BO0A 4GDFA 2PBZA 1C2YA 5IPFA 1RCTE 2IVFA 1I1OA 2XTJA 3NOQA 3T3PB 2ODAA 2J3MA 5FIUA 4GI2A 3G0IA 5LLSA 4FGJA 4GHWA 3C97A 2X3YA 3FNFA 1E2BA 2H3EA 1AGPA 2DZDA 4IIDA 4QBFA 3QX9A 4PWZA 1UAAA 4NXMB 4UCXA 1AA9A 4QYXA 1YIDA 1IHYA 3IA7A 3DLAA 4MOWA 2OYCA 1AN9A 3K1AA 5DDIP 1P1FA 3U4QA 1KQ3A 2ISSD 2DY1A 5FOVA 3RC7A 1OH5A 2VH5R 3ODGA 4JXKA 2AT1A 4UATA 2CWWA 5DV9A 1VL0A 3UM9A 1JR3A 3OQBA 4NCKA 1GGVA 3QLVA 5TPZD 2X2EA 3NTOA 3WB1A 3ZJ4A 4CDGA 4AXXA 3ZR4B 1EAYA 4DSNA 4X1OA 4DWVA 2DERA 3VUEA 1I3CA 2QT9A 2A33A 1AKRA 1U1FA 3BWEA 1ADCA 1Z13A 5B3KA 3K0KA 5ADUS 1DTWA 2JIRA 5L6LB 3JWJA 3OZGA 1X15A 3G3EA 1M7HA 1OU0A 3ZDBA 3ZZ1A 3MGCA 3G9UA 4JLAA 5BR1A 4XASA 4BVJA 2YQZA 3OQMA 1QIHA 4J9UE 4YDSA 3QEJA 1AKVA 5F77A 3LK7A 5ALOA 4YNBA 1BHSA 1CY6A 2CKDA 3HBJA 4U5XA 3RJ5A 3P2KA 4BNDB 4ZEWA 2OPHA 3C6KA 1E5QA 5C80A 4NRDA 4UOQA 3KAQA 1EDBA 3UANA 4UNRA 4M7RA 5GGXA 5L3RA 5K8VA 2UZ1A 2VHZA 1G3IA 3BXHA 3CU5A 2WHXA 3MD0A 4BXOA 1XT6A 2V55B 4V3CA 2GN1A 1USKA 1QE0A 3PLRA 3A6HA 1T5DX 1QHNA 1RVDA 2B30A 3TSOA 3WE7A 4MDHA 2P2YA 1NFQA 4PN7A 2ZYHA 2ZAMA 3K92A 4ZPJA 5DN9A 4U7HA 5E2IA 2P35A 3LHFA 3O2JA 4F3NA 4NR0A 1FYVA 4ILKA 5SZIA 1BYIA 2YUIA 1II8A 5F3RA 1U0EA 3NBUA 2QXTA 4DCOA 3GPLA 1JJBA 1HFKA 121PA 1SD1A 2H08A 2PAFA 5EOVA 5FNVB 4F2HA 4DMFA 5ALVA 2O20A 2ATCA 1YZUA 1O0CA 3B70A 1EH5A 1H4TA 1DBIA 3A1EA 4OHBA 5LA6A 4S2EA 4ZHQB 3WLRA 4LNAA 1E58A 1Q6ZA 1WL8A 5CLQA 4DFDA 1KEKA 3PEWA 1EFVA 4XYGA 1NT2A 2QIOA 4H59A 3LCCA 4OYLA 5T57A 4YACA 1YVEI 2B5OA 5DEOA 3S44A 3QKRA 3TM5A 3TQFA 3RYCA 4BMCA 1GVNB 2BELA 2C3YA 2QJWA 2QVLA 3HNOA 3PGA1 5HF5A 1XV5A 2IHYA 3G9QA 4BMPB 4BKPA 3JARB 1JF8A 1T24A 5IVPA 4JENA 1TQ4A 1OGJA 2ZJZA 3OT5A 3Q7IA 2JCBA 3H5IA 1SH7A 2JAHA 3EXIA 4CMAA 1WR8A 4CKCA 2G1JA 2YW2A 3A1NA 3KWLA 3VNBA 2XUFA 3K8YA 2H1CA 4IKEA 5DTIA 1JIUA 2PKEA 4Q03A 4EOGA 3MT8A 1V6AA 5BR4A 1W87A 3K6SA 4O4HB 1Q95A 1RKUA 4JWTA 4QD3A 5K3OA 5FQNA 2D6FA 1SVUA 1XL0A 4WZZA 3CZRA 2JLUA 2PSDA 1ZM2A 4XR9A 5A3JA 3CZPA 3WJAA 4XRGA 1JTFA 1M0TA 2GFQA 4EI9A 2ACEA 2EP5A 3E23A 5HE8A 1W30A 4N7BA 1YL6A 2NPFA 4AVYA 1TEHA 2YCBA 2AG1A 1N6RA 4UBNA 1Y42X 2Q4RA 5LFAA 5KHOC 3J81A 3N6RA 2ZRNA 2QLNA 4NTZA 5AOBA 5E6RA 3QNMA 4UEOA 2G40A 3BSWA 3JRNA 3QU9A 3WLKX 3EMDA 4GLOA 1TZKA 3TINA 4ZGBA 1U0TA 3O90A 1P45A 1L8LA 1Y8RB 2WTEA 1PJBA 2J0UA 1WCV1 2VCEA 3OIVA 3OZXA 5MN6A 2VHQA 4LDPA 1OCEA 5DULA 1QC5B 1OH6A 5K3SA 2F90A 2GERA 4EWLA 3K15A 5BSVA 3MBOA 3VR6D 3D54D 2COKA 1G21A 1U9IA 1YONA 3LNCA 1RLMA 3OICA 4ME6A 3VR4A 1ORRA 3ZHBA 1XEFA 1T6ZA 4PN3A 3SYTA 4MR8A 2OORC 5D1HA 1TAQA 3QE3A 1QO7A 4E6PA 2D3WA 4NDAA 5ALSA 4CYMA 2ZWVA 5A4MS 4YP7A 3KHSA 3FDIA 4JKYA 4AY4A 4KMMA 5BPHA 4HGNA 3I23A 3V9AA 4H77A 2HF2A 1FTNA 2DH5A 3FA2A 2RC6A 3V3TA 4QUAA 1P91A 4UEKA 1AO3A 4XGRA 5GAJA 5A9SB 3IE1A 4ZYYA 1RI4A 3QZUA 3MD9A 1T9CA 1DLJA 3R5KA 4OQ4A 3O9VA 4Y6LA 5JCJD 1CBUA 4O2BA 3R5SA 1KJQA 2CJYA 3D6TB 2ID8A 1U7DA 1YL5A 1UBFA 2LV8A 2GGSA 3HU1A 4J16C 3FUTA 3R7NA 1HE2A 2YH2A 1D0IA 2FWRA 2HRCA 4NDZA 2AMFA 3MC1A 1V3VA 1A76A 1EVJA 2NYAA 4GKJB 3F2IA 1E66A 2CBZA 2Q29A 2W6ID 3DBRB 5FBHA 2O54A 3LWZA 1EUDB 1YU9A 3EQ8A 1S7GA 1SEVA 3VH2A 3P52A 4OAOA 2D1YA 2PO7A 2H1HA 2E55A 3R6GA 1KI6A 2HSEA 4QSHA 1ZXXA 1EWQA 8ABPA 4S1WA 3JQFA 5AKZA 3U0VA 3VSBA 3P9IA 1XA3A 2A35A 3M0EA 521PA 4LOAA 2QBYA 2WU1A 3DC7A 4K6OA 1JU3A 4PF1A 5J9FA 1X7ZB 2FEXA 3C6MA 3HACA 3VR4D 4FMPA 1JDJA 4ZI2A 5TX7A 2X14A 4UMEA 4NENA 1NLMA 4IW3B 1PBTA 4HATA 1EFPB 1JHZA 2EARA 4QTYA 1HNNA 5JZBA 1KZ6A 3C6XA 4ER0A 3G7SA 6NULA 5GJBA 1KJZA 1E5XA 4DWOA 3Q7PA 1C8KA 3REQB 4I5EA 7GPBA 4BZXA 5LLDA 1MA3A 1YQGA 2M6SA 3R24A 4LSZA 3VZPA 3ZCRA 4H7DA 3RTBA 2WIKA 2VF2A 5G1PA 1RU3A 1B41A 4JEUA 4RIGA 1E3EA 1LZLA 3EXIB 4JX9A 1WOYA 4NYJR 1KVTA 1E92A 1VJ0A 2ET6A 3ZW7A 2BFMA 4JI7B 4OHRA 2JEOA 4YP5A 4A6EA 2Z6QA 1SUCA 4KV9A 4P33A 3T7SA 5JVDA 3WYDA 1DAOA 3WGOA 1KYXA 3HY4A 4LCBA 3L0DA 5FBWB 5EIXA 3FTCA 4LK2A 2XKAA 3RYCB 1HYGA 4GUAA 5AJUA 5KDOA 1U2QA 4GRDA 5DASA 2JIZD 3DZDA 4YV2A 5TF4A 5HXAA 2IBMA 3W8NA 1ENYA 1OQAA 3LKDA 4MHSA 1JBKA 2MYUA 3A2MA 3EEBA 3PG5A 1CK4A 1H0RA 4LHSA 4RVFA 3T4PA 1RKQA 1Z26A 1XRLA 2AWNA 1ISIA 3FYSA 3S2GA 4DB2A 4KU4A 3GLSA 1RJWA 4JLJA 3S8MA 1Y8QB 4DCMA 2Y67A 4TTAA 4EA9A 1H2HA 2HMAA 1UZUA 3JASA 3QVOA 1Y6QA 3E2MA 2Z2YA 4DJFC 2WZDA 2VNJA 2Y2VA 4OXQA 3R7FA 3V00A 1IN7A 4OI1A 2FRDA 1RYNA 2RB4A 4MV9A 3MJEA 5DBGA 2IY8A 3K9GA 3ESAA 1CZNA 5ABPA 2COEA 3W8DA 1Z5NA 4AG5A 3GLFB 4JLKA 4DR5B 1FFGA 2JAOA 2ODNA 1Y9JA 2XGOA 5IDVA 2WWVD 4O6VA 4KYTA 2CNBA 4XGNA 1XNRB 3HGTA 4TV8B 1O0SA 3WWPA 1FFYA 1KBZA 4KLNA 4TLBA 3EIHA 1I2MA 1QFJA 3GLHA 3OE4A 3P0FA 1XSEA 1L4FA 1LLFA 3VYSB 4D99A 2VZ0A 4EYKA 4HTAA 3IVAA 1QZUA 2VDNB 2PU7A 1COWD 3VR3A 4ZVOA 3TUJC 4AU1A 3KZVA 4U2DA 3IDZA 2PANA 2NU9A 3NW9A 3ZE9A 5EE5B 3T52A 2DB3A 1MORA 2L69A 4HP8A 5B6PA 2A86A 2HV8A 4YAEA 3GUZA 4GZLA 1SC1A 2HCRA 5KBYA 3PLAE 1JDSA 3N8IA 4CMEC 4FDAA 1Y5RA 3B7PA 4TV8F 3PJDA 2J8ZA 3KYBA 4L27A 1V96A 4M83A 1I3KA 4RO0A 5FBLB 5FTLA 3KQLA 3B3QA 5TT1A 1GCGA 2GA9A 3TNLA 3ICPA 1BIFA 3FLMA 3CVOA 2X0FA 5HF8A 5M34A 1USGA 1A5TA 3HDHA 4FYVA 4DC9A 5H70A 2PUGA 4Y0AA 2V3CC 2HK6A 2J9YB 4TLCA 5KNBA 1H66A 2JAPA 5AK4A 1ANKA 1YDMA 1FDTA 5F21A 1TUIA 1GL7A 2GJKA 2UZIR 1LVGA 3CKKA 4QWWA 2ATXA 2ZXEA 5K4GA 2E48A 1KKUA 2EYUA 2ZTHA 3LQ2A 3T54A 1ISHA 5IARA 2Y3IA 5CFMA 4A2CA 1V7QA 5CT8A 1VSBA 3VZQA 5LMUB 1HE1C 4MSUA 4ZQBA 1T0UA 2IF0A 2V6FA 2A67A 3NPMA 3IHKA 2CXNA 2H11A 4N4AA 4C2BA 4AZ3B 1DI0A 4UVGA 4XZ3A 4QELA 3IT0A 3FUWA 4XIIA 4YJ2B 2ACKA 1J22A 5DNVA 1X0XA 2E4WA 2R1UA 4DV6B 1R64A 3C3EA 3ACDA 3OU6A 4G9GA 1ZVVA 1Z39A 3L8FA 4IMRA 3LV8A 4B9EA 4G84A 2JS7A 3U1VA 2GCNA 2CXRA 1EFLA 3X1DA 2ILTA 3R8CA 1YS2X 3MNFA 3NEAA 4LUCA 4XWKA 4FQ8A 2D8MA 4GX0A 3EAGA 2O7VA 5DYGA 3E48A 5HK9A 3PNMA 4AS2A 2J1LA 3E8MA 5IN4A 1E18A 2VWQA 4R1QA 2J87A 2HBYA 1JKJB 1KIFA 3R7WA 2H5IA 3KTAA 2AN9A 2H18A 3FD8A 3L0OA 5DT9A 3VR5D 5HR5A 4BP3A 5B6IA 1GNPA 3VYVA 4RY2A 1SPBS 2ABWA 2UDPA 3JPWA 3M9WA 1A95A 1JEQB 3K70B 3KSAC 1RZVA 1TLLA 1U99A 1NKSA 1TJ5A 2M32A 1I14A 1H85A 3O2SB 2XUAA 1C41A 2VI5A 2YBDA 3KU4A 4GMHA 1QONA 1HMYA 2P9JA 3GA7A 3RPEA 4BWFB 1MO6A 4YT2A 5B4VA 1BD3A 2BGLA 4K8OA 3WIOA 4E2YA 2H8GA 3E3MA 1GGJA 1XAGA 3OEHA 4KN9S 1OA0A 4G0YA 1E4OA 2B7LA 1G21E 3AR7A 1VRCA 3C74A 3SE0A 5EHXA 2MMGA 2UZ0A 4GMKA 2UUPA 3Q85A 1WMFA 4YJHA 5BWNA 1KJNA 1YQWA 2QN9A 4GBJA 2JCXA 4X66B 1LI4A 4NLLA 4PHFA 1GV1A 4XDYA 3C3XA 4PGGA 3U17A 1WVGA 5INTA 5F2OA 3ZE0B 2ZSIA 4GGOA 4V1CA 4PVDA 4I6JA 3R7LA 1DKMA 2R5WA 4KYVA 3ETNA 1EJ2A 2ID9A 1BJKA 4Y9RA 3IEMA 4EA8A 4XI9A 3K70C 3C8UA 3OT1B 5TE9A 3EWAA 5BSUA 2R44A 3CEJA 5CX1A 3ZPXA 2H51A 3BD8A 3T6KA 2O8CA 3QKSA 1LNZA 4X1KB 4GSLA 1MAUA 1ZCFA 2UUOA 2X9VA 2WQ7A 4KQ1A 1J2EA 1H4VB 1M73E 5CEEA 5M29A 1PWEA 3ANXA 4BBZA 1B6RA 2OC9A 3BILA 4RKYA 1U7XA 1HQCA 1K68A 2DLNA 4I6GA 5EXSA 2B25A 3AEKA 3BN3A 3W5DA 1SUPA 3O4VA 2XVXA 4ZO6A 4QU9A 4LIPD 2WU0A 4BWGA 1JR3E 2OWEA 1DKQA 3DP7A 3N8DA 1IE3A 4YJFB 4FYKA 2EW1A 2ZSEA 4AP9A 2XD4A 5HOEA 4CM8A 4ARAA 4QOIA 1QGUA 1XZPA 2ZRAA 4RWEA 4WOJA 3EQ7A 3BK2A 2PLRA 1CQXA 1GYPA 1E1QD 3IELA 3KHKA 3LRTA 3VSEA 5SICE 1PV2A 3RVQA 1E2EA 4OQDA 4IIGA 1E0DA 2PCJA 5CGZA 4WVFA 2B4YA 2V1XA 5EA2A 2GZHA 1KS9A 1SUDA 1FFXA 5IBQA 4BVEA 2AX3A 3Q3CA 4KW7A 4MVJD 4NCJA 4HNGA 1XD2B 5CVDA 3A4NA 2I2FA 5K4HA 1N36B 1QC5A 3ZWYA 1GUAA 3MFQA 3OFKA 3EZGA 3UTDA 3CPHA 2ZRCA 4L51A 2W9XA 1C1YA 3CLSD 1VL6A 3NUZA 2LR0A 1U0JA 3BXOA 3UOAB 2I3BA 1YRBA 2PH1A 4H18A 5REQA 3DMFA 1H1LA 2GPWA 2H1IA 3ROFA 1R3DA 2QTHA 3QLVC 3QJYA 1ZG3A 2AJLI 3PR1A 1OMOA 4KUHA 5BR8B 1YR2A 4AY2A 1DEHA 3GAZA 3KJXA 1M3SA 3ZY5A 3GJ4A 4PLYA 4HEQA 1K97A 3RIMA 4ENSA 1Y6RA 4QA9A 8ATCA 5ED4A 2I3GA 3WJ2A 5C0OE 1OLUA 2FEMA 4LGMA 3TAUA 4A16A 4C22A 1X7YB 4M7OA 1E6EA 3VNSA 5IVKA 3VPXA 4UXJA 2EXXA 4N6NA 2NVBA 2WE8A 3N70A 2YYZA 4UHEA 3TUIC 5GIPE 1EKXA 1CC1S 1Y1PA 2XMRA 5FHQA 3VAAA 5G3ZA 3PDJA 4W1QA 3GMSA 4BBAA 2ZYAA 4C0AC 4JJ6A 3PA8A 3UWMA 5L3VA 4PFSA 2QX6A 1YR8A 2FZ5A 3BFVA 3V1LA 4D2IA 1B3RA 5JXJA 1HE8B 5D7BA 4ZODA 4A6PA 1J33A 1RIFA 4QNNA 1GGFA 4IOMA 1DKNA 1GPH1 3IP5A 1DAPA 4FGWA 4KG7A 1JU4A 3QPUA 5E8JA 3LYAA 2WNSA 4S1VA 4URYR 3KWFA 3P5BA 1Q3KA 5K0GA 2W6QA 3BGOS 5D2CA 2HX1A 1N6KA 2BFDA 1L8QA 1EFVB 1GLGA 1QORA 2BEUB 3HXTA 4FT2A 4MRMA 4FU0A 2PUTA 3KKMA 3KX2A 4WY2A 1MAVA 2XYQA 4PZAA 3T99A 1MT3A 3AJAA 2Q50A 1EB9A 3ZCQA 3TTUA 1MC5A 4DOMA 1M72A 5CD1A 1UAYA 1NBWB 5DNEA 3DLCA 2DQ4A 4ENWA 2W2PA 5J4YA 3NRJA 4CCWA 4B7XA 4HLQB 3DULA 1E3WA 3H5NA 3LF1A 3NIWA 3DWEX 2QMEA 4ZDWA 1QSGA 2WLTA 1JL3A 2VFAA 2PS3A 3JWPA 4BPRA 1OVGA 1D4AA 1V1MB 2Q1YA 5E7MA 3LE8A 4N7MA 5BMVA 1KQGA 1PTJA 1MNQA 2B21A 2WUGA 1XO1A 2IDZA 4GYWA 5CLJA 1E5LA 4L4RA 5IYZB 5FL7D 3I8XA 1L7VC 3D3JA 4GO1A 3RRBA 3B1VA 3M83A 1X7ZA 5EGSA 4AKIA 3CH5A 5TDHA 4HRYA 1ULHA 4Q7EA 4CM5A 4UM9D 1K2VN 2H07A 3KO8A 3SEQA 3TQQA 2XA9A 2DETA 2I55A 3A6EA 5EESA 3UBTA 4MRMB 1BH6A 5BVHA 4YGYA 3PFFA 1RJDA 4ZZIA 3EOAI 4B0PA 5LA6F 2BFNA 1NYRA 5F7JA 2Q8QA 1CR1A 1TCBA 2ERXA 3HKBA 3GFRA 4IZHA 4K8RB 1G8GA 4EDHA 2Q62A 1C7IA 4JBHA 3U7GA 1U3CA 2JAUA 5HKBA 3I0ZA 4OUKX 4L8YA 4L7VA 4HUQB 1ZD2P 3BXEA 5CR9A 3GG2A 4AL4A 4AJ9A 1XDDA 2I9KA 5GONA 2HW8A 2C04A 3VDMA 2Z58A 1SOMA 2R9VA 4F21A 3VV2A 3EPKA 4G1UC 4E22A 5PGMA 5IVHA 3P2YA 3W0LB 2ACVA 5E38A 1Q7TA 3H1PA 3AVOA 3NM4A 1ZK0A 4GOKA 3L01A 1PUIA 5TT0A 3OOHA 3VR2D 4MVJH 5FUMA 4BMYA 5E1OA 4YMTA 2Q99A 1LPOA 2ZRQA 4LMBA 1O6BA 3C3BA 3Q3GE 3EXHC 4YHBA 4YMSA 4ECAA 2J0SA 3VPDA 1D6MA 1N3BA 4QYMA 3PQCA 1QHXA 3ODPA 4WZBB 1T3LA 3ZGVA 5LXTB 1Z6ZA 2B99A 3DMGA 4GGPA 4NHOA 4OLHA 1INLA 5IBPA 1VGRA 4DNFA 4GC5A 5KKNB 1F60A 2FP4A 4JBLA 3J81k 4G86A 4LC9A 4ZC8A 4C7XA 4KITB 4GWKA 5ESDA 2HWXA 2QYTA 4Z0NA 4A10A 2IYEA 5F9MA 4U2EA 1WXXA 1WSDA 1TT5A 1ZZGA 4IQ8A 5J40A 3UHFA 3WDKA 5I7UA 3SVTA 3C5CA 3H6KA 4DQUA 3GLQA 2WRZA 1HTTA 3HH8A 1XTJA 1EXVA 4JI1B 3CF6R 4GP7A 3KR9A 4Q9IA 3PDUA 4NFHA 4NH0A 4Y9TA 4XIFA 4EVRA 5L53A 4FE4A 3S1LA 4O4JF 1JQBA 2BC9A 3EDRA 3JQAB 4CF3A 4HH1A 1L8OA 2ZB4A 1UPUA 2R66A 1S1CA 3FOBA 2I6UA 1CLUA 1OI3A 1CDZA 4NCIA 4CTNA 4QBTA 3AVUA 1O95D 3A1DA 2WB2A 1HYQA 4D4IA 4DBLE 3GV0A 4R31A 2NZVG 1YK1A 2O6HA 3LL4A 3ZLVA 5FOXA 4WXEA 1MFPA 1OKKD 4D42A 1E62A 3JVEA 3VX4A 4BJ6A 4TL9A 3TL6A 3LQYA 5E9WA 5EEGA 1JE1A 1TXGA 3NIFB 1DZIA 4ND2A 1JHAA 3MUFA 4HNQA 2AKAB 2PEYA 4LI3X 4XQ0A 1AZTA 4C01A 4EM6A 4B5KA 1U9CA 2ZZKA 2CLSA 5SY9A 4KGVA 3C3AA 3OAAD 4RL4A 5F7ZA 1XTIA 1U9IC 1BMTA 3TLAA 3ZGLA 4BLOA 4K6MA 2FUG1 1WSBA 1YVDA 1JQDA 1ZJYA 2O0JA 1A7KA 2WAAA 3DR3A 5AXCA 4Y1RB 1ULBA 5CH5A 3ZHRA 3SYMA 4N0EA 3OT4A 5DGDA 2CXHA 4QXOA 4Q1CA 2F6RA 5KYVA 2LP4Y 2WJYA 4MGYR 4CLXA 4LQ4A 2C0QA 5EMKA 3WMGA 3U9TA 3U09A 5AK6A 5CG1A 2F9FA 2FXVA 4EKIA 3R7AA 2NXWA 4OJYA 3I04A 1KDZA 3MM4A 4MW0A 1W0KD 1L3IA 4LCJA 5B3LA 1WPRA 4JN6B 5FR1A 4QU5A 3Q7SA 4C7VA 4AY6A 2PH3A 2Y76A 3OEHD 3ZYZA 3HB0A 5AW0A 2C4NA 2FH5B 1JG4A 3G8CA 4QREA 1CVRA 3E7FA 1BDHA 2QTZA 3DMHA 3THYA 5FNVA 3W2IA 4MGKR 2QD3A 3AX6A 4MRSA 4PIVA 4XUEA 3WGJA 2MSNA 3AZPA 5DBOA 1BE8A 2PVPA 4F3KA 1OI2A 2OZPA 2ADFA 1J56A 3OZTA 4HS9A 2QBYB 5IWCA 3QOYA 1C8VB 5GADl 3IHWA 4LF6B 4IHAA 1FVXA 2E7ZA 5KVAA 5EPUA 2VQEB 2C92A 1JKMA 3U19A 1GL9B 1PZFA 4PBSA 4JLNA 2C9BA 3I2GA 4FFBA 1TIKA 2P1DA 1SIBE 1MV5A 4LBZA 4RKQA 4XWYA 3RE1A 4JA2A 1AHPA 2I1LA 1B0UA 1SFRA 2X41A 3QKWA 1K5HA 1Z2OX 4NBLA 4NH4A 1YJXA 3FAKA 1KAMA 3JSXA 5C8VA 1I6WA 1Z45A 4IJMA 2YY5A 1AGYA 3DXYA 1L4HA 3AI7A 4GVXA 3A14A 3EF1A 1A4UA 1CY8A 1P75A 2MWMA 2O05A 3SQMA 4BN4A 1UK8A 5ELMA 1HE4A 4PHHA 3ZQ6A 3UKOA 1FTQA 2FFQA 5AKKA 1NW5A 1NI4A 1YAHA 2GRUA 1Q6YA 2RIPA 4DAOA 3ZXXA 1X1DA 1AUOA 4HT3B 3I5XA 4EZIA 1YQUA 1M5TA 1NN3A 4H1TA 1XGKA 1A9PA 1XMXA 2WSBA 3INRA 2RGCA 3FXAA 2I4LA 4JC5A 4N82A 1Q17A 4NFSA 1RZ3A 1R6AA 3FRIA 4P6VF 3M5CA 4X97A 5JS8A 1IJEA 1VSVA 4MPJA 2X4DA 2A1TR 4HY3A 1RMQA 2GM9A 4MW9A 2QRQA 5ERYA 4CV2A 2I4MA 2H65A 4X5OA 2G17A 4D3ZA 3QVSA 2AOVA 3BT7A 4Q37A 3T1TA 2DHCA 5EP3A 1ZICA 1SKAA 4AZ0B 4YRIA 4TOIA 5I5GA 4HLNA 4R8MA 4PLVA 3WGLA 2XE6A 3TX2A 2Z98A 2EGUA 2JH8A 2FPWA 1B8OA 1NAHA 4UM7A 4CIDA 4LTMA 1SC9A 4PX5A 3UAYA 5KOJA 3NDIA 3EVFA 2FCRA 2IHNA 1XMQB 2DTEA 1XRSB 3FZNA 1FOEB 1U94A 3OPQA 1MF7A 4FPXA 1HY3A 1RE1A 4V1CB 1FL9A 1QIJA 1ATIA 2H1VA 3IX7A 4I55B 1HRDA 1GNLA 4GOLD 1LQ2A 3ESZA 4XFDA 3TLJA 4DT1A 2FMKA 3NHRA 2V7UA 4RJKA 2OCKA 4NZZA 3R23A 3I12A 5EY5B 4CLDA 4RSMA 2X9NA 2BSAA 1K75A 1HBJA 4GD3Q 1F2DA 4GOXA 4KPGA 4WFQA 4F4JA 5HJ7A 4OOFA 2Y1GA 1ZEJA 3O9ZA 5FQOA 2XR1A 4TRMA 4JEMA 1C3OA 3DT9A 4AIRA 3BIXA 1AUQA 5CYFA 3ZU3A 5IAOA 2BZGA 2QAJA 3UMVA 4CL3A 3SS8A 3ZD6A 1R8JA 3VDXA 4NJOA 1PZXA 4EB6A 2GXAA 5F5XA 4KIFA 3OEED 2Y71A 3ONNA 4JVMA 4S3MA 2RI6A 2GSDA 4Q39A 2VP4A 1OBOA 2GNPA 1O4VA 2VSOA 2ZOSA 3IA2A 1OV6A 4FNMA 1QH9A 2EDCA 3QU2A 2FEPA 2J4CA 2N1MA 3E6AA 5FWXB 5HUHA 3O95A 4JP5A 2IW1A 1MBZA 1X8JA 1P6UA 2P68A 4DMMA 3K0AA 3BERA 3H1TA 1OPXA 1I2AA 1NC3A 3L18A 3HV2A 4TN1A 4E07A 4N40A 3BH0A 4MROA 3BE6A 5CXQA 1LC3A 3CZ4A 1GGHA 1UMCA 1JEJA 1JKJA 3E9CA 5A1JA 5MFZA 1ZMXA 1WVIA 2ECOA 1T8UA 1FP1D 5K3FA 4PLHA 4RABA 3JX9A 2C2MA 4U9UA 3LPDA 3O3MB 5AJTA 1JA0A 4MPRA 4UVIA 2FDRA 1OE0A 4ABYA 2NO1A 1A2OA 2E49A 1ZVQA 1X1SA 5EJEA 1MOSA 2WOJA 2JBWA 4V39A 1P1CA 1QOZA 4MGIR 2XNDA 4DYHA 2HSWA 2OXTA 3R3JA 3CX3A 3PL1A 4ND8A 4D43A 5EUCA 1LPNA 3NHYA 5HMLA 3K7EA 2A57A 3MRSA 3KTOA 3VXKA 1I5OA 3I73A 4DLRA 4ZRNA 3MTDA 1R4AA 4EI2A 1SC6A 2Q1TA 2HMTA 4N3BA 2B1GA 2HRZA 1NW6A 3E3AA 1V16A 3O83A 4D9IA 4LJRA 5CA0A 1X94A 4DV7B 3SDZA 3T12A 1M6EX 1KFEB 3VNAA 3P2JA 2RGNA 2FUCA 3TDKA 4EENA 1VLZA 2XLBA 4CMJA 1DWUA 4BX0A 2HQ1A 3RUHA 2FP3A 1KK3A 1TJ3A 4C9BA 4AJLA 4E88A 2X8BA 4IH9A 3QLUA 1SCAA 4F5YA 5JBIA 4G0VA 1NZFA 3WYNA 3D5EA 4NBWA 1VG8A 2PGIA 3IT1A 3OU7A 3FBWA 4DDHA 2RCYA 1AZSC 4FEEA 4AJPA 4BV3A 3GLFE 3DHEA 1N6OA 2IYFA 1A27A 3SX2A 2VA8A 3F7OA 1C4OA 4LY0A 3ZLBA 3ILSA 1IHDA 3RVLA 3GQVA 3JALB 3LX5A 3PXUA 5A03A 4RSRA 1FXSA 3EFEA 4QEKA 4LF5B 1ZVKA 1TF5A 1PK8A 1F3LA 2Q21A 3KC2A 2R96A 3IALA 3L9XA 1CZKA 2BUAA 3IE0A 1QHIA 3OMLA 3Q7QA 4MTLA 3GLRA 4WBNB 1TK2A 1TO6A 1DG1G 3LGSA 3P2IA 4I4TA 1W52X 3ABIA 3H5LA 2BZSA 1GRRA 2CB0A 1NQVA 2LRHA 1GUYA 2EJWA 2YJZA 1YZTA 3CB4A 3FGNA 3WGMA 2X1MA 3EQZA 2X15A 4LYAA 4C7JA 1F5SA 4EYSA 4A36A 3G0DA 2QMOA 1U3UA 4X8OA 3WOHA 3LUPA 5HS6A 3EXG2 5FLYA 2QE7A 1KFKB 4FZJA 1B0ZA 1BWSA 1L5MA 2I1WA 2D5IA 3Q6IA 4KMSA 4OXIA 2HBRA 5C5EA 1FJXA 4GKKB 3D1JA 1IOVA 1OXUA 3TLKA 4JLUA 3UMBA 1GQSA 4I1VA 2QTRA 2ZBGA 4L02A 1R27A 2GN9A 2XVAA 3G2OA 1WQ3A 2YWGA 3F96A 2DAPA 3IJEB 3MF4A 3RHSA 3URMA 3ZD8A 4BO9A 5AK3A 4D6PA 1UWCA 2PL3A 4PTZA 4Z86A 5JD5A 5TVKA 5JZVA 1RMYA 3KAJA 5EZ5A 4FYWA 3VZCA 4DM3A 5JPDA 4TZKA 2WF5A 1W5TA 1C9MA 4N7RA 5JYDA 1IZ8A 2HBZA 3GPBA 2QVXX 3QLUC 2ZR7A 1KERA 2C3UA 2W93A 3JQQA 1DNPA 3T06B 1SU8A 4Q4DA 1NTOA 1AD2A 2B3TA 4LYFA 2C4TA 4UHKA 4HNUA 1ZUIA 1PFQA 4IUCS 4YJHB 1Y33E 5DI3A 4RKRA 4N3GA 2NIPA 3OCXA 1T0JB 3ZKWB 1G0OA 2I54A 2RG7A 2HMSA 3WGIA 5CM8B 3Q2OA 3WWYA 3H5VA 3JW8A 3QMVA 5YASA 1CUGA 2XUZA 2ZPTX 1X86B 5CA1A 1CF4A 5C31A 4LA4A 1TUBB 4QGAA 1MTZA 4DXHA 1HT0A 1ZINA 5AW5A 3GAAA 4P3OA 4ZIRB 1DWQA 2CV0A 3RDPA 5DYYA 5JIBA 1W4RA 5BWBA 1GV0A 5K0SA 4AN4A 4PS0A 5E6UB 4B9AA 1FNCA 3UN1A 2WP8J 4XSVA 3G0OA 4BO4A 3NC4A 3VFDA 2MSLA 5JMPA 3TGPA 3MGGA 3LK6A 2O8EA 5AQEA 3UVEA 3H4MA 3ILYA 4P4UA 1L5RA 4UTZA 1GUFA 4R9SA 3P94A 1U1CA 3VRHA 2GUGA 3B6IA 2BMJA 3VHLB 4GVPA 2VYCA 3ZCUA 3HP4A 4MW6A 1G8HA 3RAFC 1YUMA 5BYAA 4ZTBA 1FLAA 2AR9A 5KNDD 3ORQA 4WN9A 2VDMB 3CB2A 3WMFA 4EHKA 2HHHB 1MEOA 3A4IA 2VXOA 3FF1A 3P19A 4FP9A 4PW0A 4K6FA 2OQIA 4KK4A 1EHIA 5K3EA 4AQYB 5CBPA 3ZI0A 4AMVA 3B5EA 1TQDA 1QRDA 5L45A 3D9QX 1ZRNA 3ZBPA 1E9DA 2WFLB 3BMNA 2FPRA 4FWBA 5IVIA 2G9NA 2WWFA 4EPVA 1V5FA 4UXIA 5TR9A 2IV3A 2DHEA 4K6HA 2HA5A 4ND7A 3FNBA 3C3JA 1U0NA 4XLTA 2RGDA 1ZGGA 1HXHA 2A9OA 2JARA 2LCIA 1OAOA 4P7JA 4J3NA 4ZI3A 3G2LA 3LQ4A 3FVRA 4KTVE 5C1DA 5LP6A 1CEYA 1J09A 4BGEA 4G2TA 2GZ3A 4QYIB 1C7ZA 4R1OA 1O8CA 1T13A 2PXHA 2VTVA 3ZUPA 4EY4A 5CAEB 3PXCX 3EB9A 3L0SA 2UXDB 3S2EA 3ZQKA 5LOVA 4ZOAA 2VSNA 4AROA 2QQEA 4EEZA 3UMJA 2V6GA 2CLHB 1FDOA 221PA 1BGVA 3RI3A 4DL9A 1L5ZA 2J59A 2FDCA 1N4DA 1ULZA 1KA9H 3C98A 4HB2A 4MCHA 4JGBA 4US2R 3ZIAA 3OEYA 1E1LA 5A06A 2INGX 1OXVA 4YO7A 3BGIA 1PEYA 4M1WA 2GEJA 3SKXA 3WDLA 3MJRA 4KN8A 3OPYI 3ETCA 1UPCA 4FYMA 4JH0A 4LWOA 4MGZR 1M66A 3G2KA 3W06A 2HOQA 1EFTA 1G9XA 1G64A 4AIIA 2VTDA 2OAEA 2HJWA 2Q3EA 5CCXA 1CZUA 1NDHA 4U2BA 6YASA 1JMVA 4MVYA 4U2KA 4JDPA 4D9GA 3E1GA 1UM9B 1ZCBA 2XITA 4DCCA 1QDLB 1N2CB 1L3BA 3WQRA 2PKQO 2FPKA 2JG3A 4A8JC 3U7QB 3DBLB 2Q6IA 3FMGA 1Z4LA 5G40A 1I3MA 2TMDA 4A0SA 2B4RO 1QRSA 3UJNA 4IHKA 4CLEA 3L84A 4ETWA 1MU0A 3VM6A 4NZYA 2V6IA 2HIGA 2ZWOA 3DVQX 4YAOA 1SXIA 1DUSA 3TO5A 4FXOA 2IPXA 4ZTZB 5BOVA 1VL8A 3TS1A 3W90A 4TSFA 2FGKA 2V3VA 2VZ8A 4Q47A 3V97A 3R76A 3O8DA 4NQRA 4QXMA 4GIBA 3PNPA 3RT9A 3O8CA 4LHYA 5H9VA 3VKUA 4ABTA 4MLPA 2PLNA 2CNDA 4S1TA 4PZPA 4RPKA 2PMEA 7REQB 5D3MA 4F4DA 3HFGA 3WWOA 2WA1A 2G72A 3VR4H 1HOTA 3GNTA 4KIGA 1ZWKA 2E3JA 5AKYA 1JDNA 1YS4A 3TW8B 4O4HA 2EF1A 3BZUA 1GAWA 4JOSA 3FRJA 4J0JA 1Q0RA 5DH9A 4ZCPA 4CCSA 4JLWA 1IU9A 2WSSD 3ZLUA 5K99A 4JGIA 1KRWA 1H9BA 1GUDA 1Z73A 2Q7OE 3IQXA 4HWSA 1M1ZA 3AQ4A 4FTWA 1Q1NA 3MMSA 1BCSB 3VGPA 4DCUA 5FTMA 3GUUA 4N03A 4D8TA 4N0PA 2RAPA 1EP9A 1I9GA 4H7KA 1BFDA 1JJFA 1NXPA 1UJ5A 4JODA 5BVHB 1B2LA 4KAAA 3B51X 3ROZA 4M76B 5BUZA 3EW9A 5JAIA 2GESA 1Z4OA 4LPKA 3NFRA 2X6TA 1PJ3A 3RFFA 2WHRA 3V4SA 4U3JA 1AKMA 5L9AA 3ABQB 1O5IA 2QP3A 1QV7A 2XDWA 3CUUA 4Z7JA 3T4UA 4FM9A 3GUHA 3ZDDA 5KSPA 1DKRA 4JLMA 2O14A 1E1CB 3I9JA 3KL2A 3FE2A 3SHOA 2FMUA 1JIJA 5TLSA 2FRVA 2VSXA 4EYQA 1XAJA 2IZ5A 1OASA 1R0YA 1QVAA 1Y8QA 3PC4A 4HGRA 3WL8A 4P8RA 5LYJF 3EZ2A 3R5XA 4MKRA 1E2LA 1KWGA 4Z4GA 4OYYA 4OBXA 9ATCA 1M1XB 3E22B 1BX1A 1ZI8A 3FSGD 2RGAA 1K8ZB 2WG2A 3BWXA 5AIAA 2VT2A 1V48A 3H8VA 4OQZA 2CB9A 1GG5A 1XP5A 4RF5A 3QE9Y 1BX0A 2UYQA 3IEXA 1RQ7A 4LHXA 4BP1A 5HMMA 5IUKC 1HYEA 1MR3F 3OM8A 4NMLA 4DSAA 4CIYA 5KSWB 4D46A 3H2JA 2H4WA 2ZCVA 5HIKA 4YJ2F 1FFSA 2B8NA 1Z36A 3N9IA 2LBPA 4IHJA 4CIWA 1O95A 4XX1A 3KXLA 1EXWA 3MQFA 1CJBA 3LL7A 4RK7A 5BQFA 3OC6A 4HZIA 4XRRA 5DNCA 5C4MA 2ZM5A 4M22A 4F6CA 1G291 2JFYA 2PX8A 2XZTA 3GT3A 2R7AA 3H2BA 5B7PA 4KQJA 1OU4A 1KP9A 2JGRA 3G6KA 3FRHA 2BE7A 4P3XA 2FSPA 5AUQA 3BIJA 2IU6A 1NUHA 1X1EA 3COSA 3ZVRA 2C3MA 2QPTA 1WP4A 4MP6A 1AOXA 4WK2B 3E8SA 5CT5A 4DPLA 4QGGA 4UASA 5JHHB 4BO5A 3MPOA 2CYAA 3QMPA 5EKSA 1N0IA 5P21A 3RYTC 1XZKA 3BWYA 3D1LA 4S0XA 1LTHR 3VHXB 3EVCA 4C0SA 3AKZA 5JJLA 4OFWA 3PNLA 4INPA 1HMPA 1IHPA 1QHGA 2KB0A 1P18A 2OBLA 2FPPB 2XYVA 1NOIA 3A6GA 4X94A 3LVFO 3KQOA 1Q0QA 1Z6YA 3LPMA 5CUQA 2IYQA 4BX3A 2VJOA 2W0MA 4UHFA 1VHJA 1CJUC 2XRMA 4GX2A 1YOVB 4LJ8A 5BQ3A 3HO8A 5DN6A 4RHXA 2YNMC 3KDAA 1OILA 1A4RA 1R8XA 3BCRA 4ES6A 4OJTA 2FSVA 5FWYB 5BNFA 2PSFA 5JQGA 3AR3A 4I66A 2Z56A 5C8YA 1T5IA 1ESEA 3KQUA 3FGOA 1FTWA 2Q3CA 3TW0A 4BMDA 1FNMA 3ABSB 3SBDA 1PG0A 1K7FB 4E2WA 4EJMA 5FWYA 5JNUA 2QIPA 1BMFA 4RMIA 3PFWO 3QSGA 4A92A 3SQOA 1OBHA 1SK9A 5HKKA 3GNLA 3G85A 4HNAA 4N9QA 2AOTA 2Z1MA 5D1NA 2VXBA 3RUIA 3AESB 3S68A 1IM2A 3ZXSA 2AI3A 3VMFA 2D1RA 3KEGA 5EPOA 2QAGB 1NUQA 1UT8A 4DANA 4MPPA 4P35A 1QF9A 4NBNA 1L7DA 3DL7A 1CZRA 3HEBA 2G1KA 3CJTA 3AIOA 3DE2X 4AZWA 3WJ7A 3AK4A 4F2PA 1RXEA 2Q6LA 3DQPA 1IWBB 2ETXA 3UIEA 1SCUA 3V2IA 1PQPA 4U6NA 2WSIA 4WDRA 3C85A 4UUBA 1NUPA 5DPMA 4L8VA 3R5HA 5FI3A 2O5EA 1FNBA 1JBQA 4M37A 1GRNA 4ZCLA 2W71A 1IBLB 1XD8A 1WM1A 2G07A 2QWXA 4FOLA 1MZPA 2P0AA 4L1KA 2PX2A 4OMFG 4IY1A 5AJWA 4DRXA 3KTFA 2PZGA 3RR2A 4C0KA 5BMVF 2CL6X 2FSGA 3FUXA 3U3OA 3LDFA 1PKEA 2WEKA 3RUAA 9MHTA 1X77A 2XNJA 4UXHA 1UEXC 1L7EA 2JJYA 1R8SA 3OIYA 3O0DA 2NYVA 3STUA 2VAPA 5EVJA 4BNWA 5TMPA 2B1QA 4G07A 1RZUA 1EXNA 3CRZA 3IGFA 5MN4A 5ELLA 4DABA 4EYEA 5ICGA 5AIBA 1MJFA 2GO7A 3EFOB 3QV2A 1RAHA 4B8ZA 5IUNC 4K6GA 1J20A 4RZQA 1AG9A 1D5WA 3KSMA 3WNBA 1RQLA 5G02A 5LB4A 4DLLA 2LPMA 3F0TA 4MRNA 2ZJ0A 1EK5A 1Z08A 2IYSA 4QPPA 1DO8A 4BV9A 1WB4A 3IPAA 3JQ6A 3EIXA 4RJIA 1O89A 2C77A 4QDZA 4MV5A 4YAUA 1R4NB 3RCBA 1TTHA 3FOZA 3NC1C 4OQYA 5KTSA 4LXXA 2PL5A 3P1JA 1QP0A 2YW9A 2B78A 1DXYA 2HZ7A 3QPCA 2X22A 1FP6A 4JQZA 3NTUA 5CVEA 1I4LD 2JK0A 3RHZA 3WYEA 4F9TA 3QSYA 2Q9CA 4L8FA 3TDMA 2PJUA 1Y3BE 3ZVMA 1QU2A 1X14A 4XEHA 5FOUA 4AS1A 4ZYTA 3U80A 3TVYA 3B6KA 4CF6A 4KUEA 1IY9A 3RLIA 4F1JA 8ADHA 1ECLA 2VJKA 4KQWA 4C3VA 7MHTA 3FWZA 1SCJA 4PQEA 2XUJA 1GCUA 1ZVJA 4X84A 1XEWY 1FJHA 4YPFA 1SXPA 5JYCA 5ERXA 1KMNA 1SVIA 1K9SA 1NMEA 3T34A 2XADA 1YJQA 5FD8A 1R6DA 5TGDA 5JNTA 1RYHA 3BL6A 1KI4A 3JYHA 2Q1XA 4NECA 5GWXA 1OXXK 2I7CA 2D2EA 3FGPA 4RV4A 5FJJA 4RHFA 4HQ6A 3VDNB 4H7PA 2HWKA 3L79A 4QAJA 2JFXA 5DKFA 1M2OB 2B36A 2HHAA 4MWSA 2BH2A 1VGQA 2PAAA 4QTXA 1TCVA 2QMZA 3LC0A 2RGNC 2DGDA 2WFLA 4OMUA 3CT4A 4UD2A 4WCFA 5G1NA 1CY7A 3C15C 4I99A 1X7YA 1W36B 4RTKA 4YAFA 4P84A 4FYYA 1RFLA 3NJRA 3KJIA 3HVHA 2C2YA 3RV3A 3C5WP 2G08A 1FS4A 1IIBA 3E9RA 3WMEA 3O4FA 1IOZA 2QRHA 2QLJA 3R9KA 2GAIA 2Y1XA 3Q9UA 1PFGA 3ET4A 3G5TA 3RS7A 5C1OA 2IELA 3BSSA 3IFSA 3R3WA 4J4BA 4EEXA 4WIAA 5FNVF 3ETDA 3X1XA 1GILA 3RFTA 3P5SA 4E4YA 3V5NA 4PNHA 1ZUNA 1UMDA 2I3DA 2ES4A 2J6HA 4GH5A 4NG5A 4QQFA 1OZFA 3UUEA 3C3CA 3NGMA 4YR7A 1NOKA 3FMIA 2ADOA 5ALRA 2FPGA 2OQRA 3SD7A 5A4KA 1IXRC 1EB8A 4FSHA 1QK4A 4BFUA 1L4EA 1TE2A 2PUBA 2DFLA 4IDDA 1NVXQ 5AI4A 3EWSA 1RT9A 1M74A 3IOYA 3BH7A 4LXHA 5DLPA 3A1VA 1EFRA 2GZ1A 1GZVA 3FCAA 2D7CA 3IXQA 2R8BA 3O3CA 1MX5A 3EK2A 4RLQA 3ZE2B 5AVRA 2UYOA 4OMDA 2XGGA 3Q2KA 1K0UA 5DE3A 1HF3A 3M70A 1QCZA 2Q2VA 4FCCA 1KF0A 1Y3DE 2OCLA 3AHIA 2ID7A 4P3PA 3F5MA 3REOA 3ZS9A 3ZDCA 2QZJA 2A0UA 4CEIB 4A6DA 1J1IA 4NE2A 1ZNZA 4OPMA 4UMDA 4NXNB 4WFJA 4GC9A 3G23A 2H5LA 4V0NA 4B8YA 3W9YA 2Y05A 1TU3A 1UZLA 1WDWB 3N28A 4WDQA 3PJGA 1OFHA 2HA4A 2WJPA 2YVKA 1E0AA 3VPAA 2AW3A 2YY7A 3IULA 4IDGA 4RAQA 3V7FA 5ARBA 1I7DA 2AFVA 4K6CA 1SOUA 4PXSA 4R8LA 1KC3A 3E4CA 3P2EA 3LKBA 4JLSA 3T7KA 4G0QA 4D4LA 3NBZC 1T3SA 4MI9A 1G3QA 1TK9A 3H83A 4POAA 4ALNA 4BLTA 4OQPA 2ZE6A 1CUAA 1G55A 1U98A 2LCFA 2Q4EA 2VF7A 3F9CA 1UIMA 4FDLA 4FGLA 2PBLA 1ZLXA 3N0VA 2EJUA 1T36B 1HEUA 1Z29A 1TNDA 2D1FA 2LD4A 2J0UB 2SCUB 3LY8A 4FD2A 4WXMA 1JG6A 4BMSA 4G0PA 3Q98A 4BGDA 2NNWB 2PZMA 1TUEA 3GD5A 3OM0A 4YA6A 1HE3A 3WDSA 2DUNA 5GIOE 2CF5A 4DIDA 3EZ7A 2YZKA 2ANBA 2GK6A 4HEHA 3AC0A 4MWCA 2GKOA 5JXHA 1H0SA 2Y9MB 3D2AA 5HBGA 2A3NA 1XKTA 3FCUB 3UHPA 2MTBA 4LTNA 4MYDA 2CNWD 3PVCA 3NYRA 2R1VA 2VQSA 3SHFA 2C7RA 2G1UA 1P72A 3JYPA 1EIZA 4LNHA 3SOZA 1VCNA 3OQNA 3NBQA 2R8ZA 1VJGA 4I3FA 2WG0A 1C7EA 3DT8A 3HRKA 4PYJA 5DNUA 2B82A 2VKQA 2UVPA 4UFOA 2IGTA 4U7WA 4RJ2A 4J75A 1RDFA 4MIYA 1XTRA 5KVVA 3FB1A 1ZAYA 1IPEA 1U2EA 1CXZA 3ANNA 4ZVLA 2G82A 4WKNA 1U2DC 3CRNA 2OV3A 3MUNA 1E1YA 1W6RA 5BR7A 4KCGA 4BNVA 2EEPA 1LEHA 4DV1B 3I58A 2ONZA 3OIUA 2QN3A 2ERYA 2GMWA 3KUDA 2R97A 1D1QA 4LDRA 2VRWA 4S1PA 3K0EA 4KXUA 3VJRA 3GP3A 4PCVA 3PR3A 3UYLA 1DX6A 4ZCMA 1BCRA 1UPAA 2A0YA 2X6QA 1Z5ZA 3IT3A 1F9EA 1JT2A 1TM3E 3HP1A 3P9YA 4REOA 1GSAA 5FBVB 5HM6A 4AJ4A 1XN4A 4RXUA 3MTJA 3NM5A 4ZHQA 3CN7A 1VIAA 1NVKA 2OORA 1V4BA 3LBYA 2YWRA 2Z8YA 4BMZA 1QE3A 3BD9A 4D0NA 4EUHA 3EZXA 5AVYA 1TW3A 1FQJA 1RJEA 4MYRA 5DP1A 4KO3S 3NOXA 4YJDA 5A5EA 1XTSA 1H8ED 2AMLA 4L5AA 3T7TA 3V7WA 3VC2A 1S2OA 3VV3A 4CU5A 4EHLA 3ROPA 2G83A 4HGZA 4A0FA 1KQFA 2R86A 3L7DA 4A8HA 4D92A 4L16A 2HT6A 1R4MB 4I9UA 4Q0MA 3D59A 3WOVA 3A4YA 5DNWA 2D2VA 1DRWA 1NNSA 1YHYA 1JEEA 2VJYA 2A78A 1T3ZA 2PZAA 2CFRA 3KDPA 1TC1A 1CS0A 2GK7A 3WNDA 2WM3A 4YQZA 4I4TF 1GN9A 2NO5A 2CL0X 4NARA 1ES9A 1FJGB 2QJOA 4X00A 4EW6A 3BRWD 2GD0A 2C9OA 2ZJOA 3QLTA 5K8CA 4FGKA 1TIPA 3PPYA 2YDYA 3CLUD 3GDOA 3N5CA 4DW8A 5K8IA 1J06A 3PDHA 4X6YA 3ZH9B 3V2GA 1MN6A 1OREA 4U6SA 1C1HA 4M0PA 1HKUA 1B15A 3A6JA 4MLCA 1EWVA 2EFCB 1VHWA 3QPWA 2MSCB 4GR5A 2M6KA 3WADA 5LQKA 4WJKB 4CQJA 1M0WA 1Q84A 1UWKA 3BMCA 2R2GA 3C24A 5IT0A 1LLDA 2DEUA 4XD7A 3BAFA 1AF4A 1CR6A 2YZGA 1KY3A 3OWHA 3NRBA 2J0VA 4EG4A 3LW8A 3T7AA 4A0GA 3VNVA 1TECE 4IDAA 1JUDA 1R5JA 1YRHA 2VRCA 4JMLA 4ZXPA 2QL6A 1YZGA 2YVAA 3I9OA 1KR5A 3BHIA 3LP8A 3OWOA 3IMKA 2OZVA 3OZSA 4IR7A 3V4ZA 3HJNA 4FEYA 4A0RA 4ZYWA 2GILA 2G9RA 1O87A 3OZ7A 4MLDA 2NUPA 3BTVA 3Q15C 4TMTA 2CDCA 3IC5A 1ZJWA 2Q41A 1WRBA 1Z82A 2GX6A 1NIJA 3TIVA 2RJ3A 3JYLA 4A7PA 1DQYA 5JT1A 5DHAA 5IH3A 1G5HA 3U1TA 4HUTA 1AUPA 1U2GA 1E6LA 1QRTA 3AF6A 3ND7A 3U6KA 1UBMS 5LYYA 1KMHB 1RRFA 1T0HB 4RCZA 2X1HA 5CJ2A 3VHRA 3NNNA 4I4LA 1ESMA 4IG9A 2AG0A 1POWA 2O2YA 4U8HA 1JG2A 4ZI5A 5EQTA 4KGXA 2GYWA 5GM2A 4D3FA 2HV9A 5B6JA 1YDFA 2LDBA 2OCPA 1DT3A 2CHEA 4KO4S 2ZBEA 3K30A 3V2HA 4DQ0A 5JARA 2P9TA 1YBHA 1PR0A 1M8GA 2I1QA 2O5RA 1D6SA 3R41A 1E8DA 1PBNA 2B5WA 2JHPA 2VF5X 1L7QA 1BG6A 4ETNA 3GZNB 4V03A 1AQYA 1E61A 1QFMA 2DUWA 3AZOA 4YUVA 1QX3A 1A9SA 2YYYA 1DVRA 1F51E 4KE6A 3DZ8A 1T9DA 4P0TA 4YLYA 3AEYA 2IYZA 4ZEVA 2I80A 5AM0A 3WBBA 3L07A 1PSZA 1HDRA 1I6MA 1RVV1 1S2MA 2Q9AA 3WGNA 4ZZ0A 2HT1A 2HWUA 4ESHA 2D00A 4MAAA 5F1PA 4HX2A 5KWEA 1KXZA 1S2LA 4OLFA 4QRHA 3AVYA 2JHFA 1UJNA 3A27A 2JRCA 4XOIA 1UK9A 1W5EA 3RSZA 3FPHA 1BEUB 2E4XA 3Q40A 4HNSA 4S2UA 3ZDFA 4M1SA 1VJDA 2FDXA 3A6LA 3SLKA 2ZI4A 3IXLA 5U4QA 1XVAA 2H1RA 3VUFA 5F1OA 5IF3A 4BQOA 3UJ7A 3GIDA 1DADA 2RGXA 1A8SA 4ZI7B 1X7XA 2HI0A 1G2PA 1ZITA 4U7GA 3X43A 3NHFA 2QM0A 3RKUA 1Z3CA 3A9SA 4BGIA 1D6JA 3QUAA 4I5IA 3UJAA 1VE7A 2W42A 1EHCA 1MEEA 2ZREA 1EZZA 1U7OA 4H4CA 1MO2A 1P5JA 1JSLA 3DH0A 4PQFA 4X85A 2RHLA 3KOZA 2NP7A 1E9VA 2J0EA 2VRNA 3BMOB 3ECAA 2HCBA 5CFOA 4J49A 5A3RA 2QAGC 5C7LO 3B78A 3WVNA 5TS2A 3MN1A 5J5VA 1NQTA