3A3PA

Crystal structure of complex between e201a/sa-subtilisin and tk-propeptide
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
318
structure length
318
Chain Sequence
b'QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIAQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 113
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3a3pA00
1Y3DE 1S02A 4B5LA 2DQKA 4HVLA 2PYZA 2PQ2A 1SCNE 2XRMA 3I34X 4YN3A 1JEAA 3VV2A 1R6VA 1SBIA 4NE7A 1S2NA 1ST2A 5FFNA 2W2OA 1PFGA 5FAXA 1BFKA 1WMFA 2SICE 5AMXA 1ZVKA 3GCXA 1BJRE 1GTJ1 4OV6B 3HJRA 1KDVA 1Y34E 1Y4DE 3ZXXA 2WV7A 1YU6A 1YJBA 3PRKE 1BH6A 2Z2YA 3DE6X 4DJ5X 1CNMA 1XF1A 2IY9A 1SBTA 2TECE 1NDQA 1GA4A 2DUJA 1AV7A 1TO2E 1GT91 1AU9A 2PRKA 2GKOA 1TO1E 3F7MA 3EIFA 2Z30A 5ARBA 3AJ9A 1WVMA 5SICE 4OMDA 1WMDA 3EDYA 1PJ8A 2W2QA 1SUBA 1KDYA 3DVRX 4WOCA 4H6VA 1SN7A 2ST1A 1SCBA 1DUIA 5ARCA 1S01A 1HT3A 3PTLA 1SUPA 3WIVA 3T41A 2ZRQA 1PTKA 2WWTA 1TK2A 4KB5A 1R0RE 1A2QA 5FBZA 1SELA 1YJAA 3GT4A 3UNXA 4RYDA 2PWBA 2W2PA 1P8JA 3CNQS 3DE4X 5CW1A 3DE5X 1BE8A 1V5IA 1GNVA 3BX1A 1IAVA 4ZOQI 3Q5GA 2IXTA 4FONA 1THMA 1GA6A 3SICE 4DZTA 4AKTA 1MEEA 1C9NA 4MZDA 1SIOA 3DDZX 1T1GA 1SPBS 2XTJA 3VV3A 1TM7E 4DWWA 1WMEA 5K7SA 1C3LA 3CO0S 2HD4A 4H6WA 2SNIE 3I2YX 5JMOA 3QMPA 5JXGA 2X8JB 3DW3X 3DE0X 1Y3BE 3F49S 2ZWOA 1TM3E 1GA1A 1GTL1 1KDZA 1C9MA 1AVTA 3I30X 1ST3A 4CFYA 3AJ8A 1SCAA 1TM4E 3F7OA 1GTG1 4KPGA 1SIUA 1P7WA 1BFUA 1C9JA 3ZXYA 3DWEX 1Y48E 3H42B 1WSDA 3WIUA 1KE1A 4NMXB 1Y4AE 3A3NA 1V6CA 4CFZA 2SBTA 3AFGA 4KG7A 5AVKA 5ARDA 1SUAA 1VSBA 3GT3A 1R64A 2Z56A 3LXUX 1EGQA 3DE2X 2PKCA 3DYBA 3TECE 3VHQA 1UBNA 1PEKE 2Z58A 4J94A 4OMCA 5JXIA 4HX2A 2ZWPA 1GCIA 3DVSX 2V8BA 4ZARA 3SQOA 1AH2A 3LPDA 1TMGE 1OYVA 1TECE 1LW6E 1SCDA 1ZVJA 2ID4A 1AQNA 3I37X 1SUEA 1OT5A 1DBIA 1BE6A 2Z57A 3GCWA 3QTLA 3QFHA 1Q5PA 3OSZA 2Z2XA 3DE3X 3VTAA 1GNSA 4WOBA 3LPAA 4Z2AA 1T1EA 3Q40A 3TI7A 2WUVA 2X8JA 1SCJA 3D9QX 2W2NA 3DVQX 4K8RB 4LVNA 2WUWE 1Y1KE 3BPSA 2SECE 1SH7A 5JXJA 4BWGA 1SUDA 2ID8A 2G4VA 1IC6A 1YJCA 3WHIA 5I9SA 5AVJA 1AK9A 1NLUA 5AQEA 3VYVA 4NE9A 1OYOA 3A3PA 2PWAA 1SBNE 5JXHA 2DP4E 3VSBA 2QTWB 1Y3CE 1P7VA 1SBHA 1Y9ZA 1SIBE 5B1DA 2P4EA 4I0WB 4C3VA 1AF4A 2PMWB 4JP8A 3DE1X 1SVNA 3WQBA 1Y33E 3A3OA 3DW1X 4M1ZA 1SUCA 1MPTA 3EE6A 3P5BA 1NDUA 4AKSA 4LVOA 1CSEE 4CG0A 3L1KA 4GI3A 2B6NA 1EA7A 3LPCA 5B1EA 1TM5E 1Y3FE 3TI9A 1KE2A 2E1PA 4C3UA 4H6XA 2HPZA 1TM1E 2Z2ZA 3D43A 3BGOS 1T1IA 2W2MA 3DE7X 1SBCA
chains in the Genus database with same CATH superfamily
3CLUD 3L0IB 1CU1A 1UMKA 1C0LA 4MGHA 4WLNA 5FX2A 2Q6VA 1IJEA 2I22A 3GOQA 3DMFA 3ENVA 2Q50A 2QN9A 3UHOA 3BAFA 2PYZA 3EXHB 5BQPA 2BWJA 5HTKA 3B7GA 3IO5A 3DEKA 1YQ9A 2BMDA 3D4IA 3I34X 4G1FA 3UEOA 4NYIQ 2WYHA 2XKJE 2YX1A 2VJMB 3L1JA 3QYPA 3TSOA 3VV2A 3DHNA 1ZK4A 1IK4A 2NV0A 2D3WA 1TC2A 3PD1A 4FZVA 4YJ3A 4NU8X 1YH3A 2CZGA 3NDIA 4FW8A 1PT8A 3JQ9A 1RDFA 4QEKA 3MVEA 3ZW9A 1A69A 1U7UA 3R0VA 3KVOA 5B37A 4B4KA 3PVCA 3WYNA 4IHQA 4EM6A 4QPCA 2AUMA 1WSBA 1ZK2A 4M0DA 1NPYA 1BFKA 2VJLA 3INRA 1E2GA 1KI6B 2V4UA 3ZHRA 3I32A 5AW6A 5KKNB 2ZIEA 1HY3A 1UKBA 1QRDA 3M82A 3SS8A 1BRMA 2BBSA 3I42A 4UJ3A 1BOOA 1U9YA 4QFDA 1GAWA 4RADA 3D8HA 3JQRA 4PNEA 3WBJA 2ACKA 2RI1A 4G5OA 1TGVA 2HPVA 4EB3A 4K9RA 5A4IS 5THKA 1KDVA 1ONNA 3PE3A 4H1UA 4HFNA 5EIOA 4UATA 4CHTA 1ZNWA 2F1KA 1X7ZA 1R27A 1NSFA 4P54A 1LPPA 2RHLA 3FMIA 1MDBA 3FDXA 3OQBA 1UBSB 1X3SA 2REBA 2XPCA 5EJGA 3V9AA 1K2VN 2RGBA 1L4YA 4QUHA 1L5RA 3ZNQA 1SVOA 1IBLB 5JG7A 3I01A 2XD4A 1DARA 2CDNA 1MIHA 1S6YA 1M74A 2A86A 2IY9A 2FW1A 3NOQA 1Z17A 4R2XA 2F9FA 1H6BA 1M2HA 2TECE 3EFBA 1KARA 1FC0A 3L7AA 2R6JA 2NNLD 2WNHA 3D02A 3USZA 2JBHA 3OE1A 1EDDA 4K9SA 4XUEA 1FFBA 2A5YB 4REQA 4NMHA 5CLGA 4KBGA 1UKCA 2HY7A 1RWVA 2ZRJA 2B21A 1IBRA 4G4JA 1AU9A 4BMDA 4TXLA 2PEZA 4G0WA 3SSNA 1BCRB 4P0TA 5CT5A 3F71A 1JAXA 5CT6A 5DT2A 1X9HA 3LQ4A 2QU7A 2J9RA 1NXVA 3QTTA 5A1JA 1WVIA 4FFPA 5CJPA 3T0GA 1KEZA 1DKOA 3P4XA 4IHKA 4JK3A 3CH5A 5AK5A 5JVDF 4HXFB 3GJTA 3UYLA 2JI9A 3CISA 4R9RA 2Q5FA 2NM0A 3HY3A 4LEIA 4WOPA 3KVYA 4XWGA 1L5QA 4BNNA 1H2FA 4GQIA 3EW9A 3M5DA 2VJPA 2XTNA 2GPTA 2WD7A 4WOCA 4EGQA 5A9RA 1USWA 3RE1A 8LDHA 1JBEA 1NT2A 5F51A 5DLQC 4O2AF 5C8YF 3NXKA 1SJ9A 3A9SA 4P5DA 4ZDIA 3FHLA 1KAGA 2IPXA 1SOVA 1SCBA 1UDBA 1WPQA 3C6ZA 1Y8ZA 2BZ0A 4C0WA 1M5RA 3HYTA 2H1OA 3VGJA 3EVZA 5DNDA 2NW6A 4EMUA 4LKRA 3L18A 2QVGA 4OP2A 2QBYB 1BVRA 4TVOA 4Y2SA 1L9XA 3QMVA 1YIOA 3AEQB 1KR2A 2WKQA 1I33A 9LDTA 1BX1A 3KZVA 1EVYA 1SUPA 4CCAA 3V6LA 1H5UA 1VLMA 3D3NA 5J5AA 3TW8A 5IWAB 4F3TA 2D1SA 5IABA 1PZXA 2NVUA 3NOVA 4N03A 4MP8A 3WISA 5ADHA 3D8RA 3WL5A 1FXWA 2RDMA 3ASZA 4GYKA 2AVNA 2BF7A 3FMGA 3QJ5A 4K6OA 1TQ4A 1VLZA 2O0JA 3KSDO 4FE7A 4DSOA 4E12A 1G5RA 4X6XA 4W1PA 1GR0A 1VHDA 1KRHA 2RHRA 4HFJA 4MGEA 2WFLA 4UZSA 5PNTA 4EATA 5J4VA 2XQKA 3HU1A 1Z8NA 2OLKA 4RO0A 4M8LA 2RE8A 1BKSB 3D3QA 1JX6A 3KWFA 3NBMA 4JUIA 4QBGB 1JKMA 3KZOA 5C9ZA 3H5NA 1KY2A 4MQFA 3MWJA 5F52A 1OX4A 1BDIA 4D3DA 1ULTA 3O83A 1XB2A 4LE2A 4I8DA 2ZR9A 3SQXA 1KS2A 2AOUA 1KAEA 3KQSA 2PANA 3V8VA 1IVNA 3IERA 4MUMA 3SVZA 2ISQA 1I30A 1BQEA 4QZVA 2UZAA 1XRPA 1W36D 3C7KA 3CVOA 3IVRA 4MMZB 3HXPA 4L27A 2QVBA 1NBME 4OA5A 1JIUA 4LXUA 3W4IA 2F6RA 3A58B 5MGNA 3VO9A 4ESVA 3MCUA 3OIUA 5F5LA 4M1KA 3OZBA 3GJ0A 1YZGA 1JJAA 1M6EX 3QU5A 1EQ2A 2QV7A 3R1IA 1XRRA 4MI6A 4YAKA 1J9EA 4OI1A 4E7PA 1UC4B 4Q7KA 1JR3A 2ZYVX 3KPVA 3WGGA 2ACEA 3T52A 4DLKA 2R65A 2WJ6A 1OLUB 4HDRB 1VCIA 3QA9A 4J6EA 2C7VA 3DTVB 3OOSA 4C05A 3GLFB 2D5BA 2OHJA 3QVWA 3AX6A 2PT9A 3ONEA 4LZPA 3PI6A 3OZCA 5L3VA 1GNQA 2WDZA 4MO2A 4DTIA 3QEMB 1V7ZA 1XHEA 1XOIA 5I9MA 4OHYA 2VP5A 4TSKA 1GOTA 2C9BA 4OL9A 5C32A 3E0XA 1M1UA 4KV9A 2HR1A 1TM7E 5DW0A 2HGSA 3EWIA 4IW3B 3A6KA 2VTKA 4Y0AA 3IBYA 1QYVA 3ROTA 3V1UA 5JI3E 1EJ2A 2VF5X 2VLBA 3GFRA 3EG5A 3CO0S 2JGDB 2VDKB 4U0KA 4EY3A 2SNIE 3N58A 2CEKA 4UU7A 2IDZA 4WXRA 2AG1A 5AVZA 1C0KA 3FNBA 5JATA 3TM4A 1PVVA 4Z4CA 1WXXA 3JD2A 1ZVQA 3DC2A 4C43A 3U6KA 1IXSB 4X97A 4MRRA 2D6FA 1VKHA 1PL7A 1E9EA 2E1RA 1E1CA 3WLMA 4B3BA 2HJSA 1UZUA 4YRZA 3GCDA 3KKOA 3LBYA 3LSYA 4B40A 2Z5LA 3UMCA 3B5EA 4BVAA 4N5NA 2XT9A 2MT9A 3VBCA 5KCMA 4B7XA 4E5SA 1WB6A 3U1VA 1QP8A 1RI2A 1T3GA 2VKTA 4JR2A 4NJMA 3ZH9B 5IN5A 1GA1A 2OMEA 3N6XA 4TLEA 3U2QA 3FUXA 3T7IA 3STTA 4EKYA 3NUGA 1YRBA 2YWGA 4KR0A 1M0WA 2FRDA 5IBPA 5T57A 2RHDA 3DMTC 3OZIA 2Z2IA 1Z4OA 4P22A 1XXLA 3GY0A 4PG6A 3OE5A 3ERCA 5CA0F 1ZI8A 3VNBA 1MC8A 4FBGA 3IGFA 3H5TA 2C9DA 2HDOA 4XVHA 4I50F 1C8VB 4HB2A 3KE9A 2FN7A 4IF6A 4JI5B 2Z4SA 3CVUA 4U2CA 4G8JA 4TRNA 5G1NA 4KODA 3B48A 1Z2DA 3MBIA 4FYXA 3VZRA 1YD7A 4NS4A 2VHTA 2ZUSA 3DDUA 3VYWA 3WIUA 2G08A 4GGOA 1G4HA 3VOSA 3SKYA 3WHPA 4LNHA 1W8DA 4JVNA 3UUEA 4WI1A 3ZEIA 1JJVA 2QD2A 2QMUA 3A1VA 3DVAA 4MROA 4RMJA 2BEUA 3FA2A 3K8OE 3MJDA 3GT7A 3BSFA 2BDEA 3UXYA 3L8MA 3HPQA 3R7BA 1KJNA 5K8TA 4XQ9A 2QX9A 3I1FA 3FUTA 2R6ZA 2Y8EA 4LNAA 1RI3A 4IUBS 3NHZA 5L4NA 4KPEC 3UWPA 2HWWA 3PE4A 4RD1A 3FMVA 2V0NA 2WSBA 3T7AA 1UBJS 1NQAO 1GHTA 3BMQA 3O93A 4UQOA 2XODA 3TJMA 2GH1A 2WTEA 1EGQA 3BHIA 1JLRA 4I55B 5B7NA 4AQYB 1CZUA 3W78A 1WXEA 2HIHA 5U4XA 3V1KA 3CRNA 2YHIA 1FSPA 2J7PA 1R5BA 4JA2A 3KOXA 1PEKE 1B0AA 5FWYA 3ADDA 2PXCA 1E3MA 2EU8A 3ESYA 4CKWB 3VR3D 1NVXQ 2CLMB 1ZN2A 1TZBA 5IBQA 1EFPB 5EXPA 4FMCB 1U8UA 4YMLA 4OLAA 2SHKA 4OHMA 4HX2A 4KYVA 3SJBA 3TZLA 2DH6A 4K9PA 2QUKA 3TDMA 2VJKA 4K0KB 2X0DA 5C7LO 3N2KB 4QGGA 1KFJB 1OPRA 2ZE8A 4HDSA 1ENPA 1O7JA 4NCNA 4BNVA 4C01A 1FIUA 5AVRA 1SXPA 3FGPA 2Q0XA 4ZP1A 3A3YA 5E4JA 1R16A 4RKWA 1JIQA 1MX9A 4RJJA 3S1LA 1ACJA 1SULA 2GA8A 1OFGA 3L4KA 1WV0A 3VDRA 4OQLA 1O4VA 1U63A 1SCDA 4C7JA 4UHKA 3X3HA 1Z6PA 2L42A 2DUMA 2LD4A 1OWNA 4ARCA 2QUJA 4EI9A 4DDVA 3T5AA 2RGCA 5JH7B 4HN2A 3DLPX 4LOHA 1QFXA 2RHHA 2ZE7A 5LYJF 2GTPA 1FJGB 4OAQA 4EJ6A 1N3IA 2VSXA 2XB2A 3FUUA 3F9IA 1CUBA 3EY9A 3WLHA 3RKSA 2CB9A 4KN5A 1ONBA 2FDCA 2WICA 4PXSA 2IK8A 3B1KA 3MLAA 5KNLA 1VLHA 2GN1A 3CTMA 4TKVA 2ECFA 4UMEA 4RV5A 4RANA 5F3RA 4NR0A 4KQFA 3BDVA 4LMPA 3UAVA 4YRKA 3OSZA 4W9NA 1MJGM 2NUBA 3W5DA 1GQ2A 3VNVA 3B3FA 1SB8A 4J1SA 3TL6A 1JTEA 3WWOA 2KMLA 5JCPA 2WFMA 1XQ1A 4BLWA 4YV0A 3FYCA 4MQ6A 3SYMA 3PQ2A 2R85A 3HCEA 1SD1A 3LUAA 5CDTA 3DC7A 3WNCA 3WWZA 1XTSA 2AEJA 2W2VA 1Z5OA 3EG9B 4H7IA 1Z6XA 2HJHA 1GAQA 1XQYA 3FRJA 1A95A 4TPKA 2XYGA 5DLYA 3KB8A 1S0UA 2YY5A 2WIBA 2HU7A 2FWJA 3DVQX 2YJGA 1GSAA 2FQYA 2Z08A 1LNZA 2H1VA 1I1OA 3KJHA 4Z9BA 2ZCVA 1GGKA 4B3IA 4IJKA 1J7KA 1TJ3A 3PR1A 4I19A 5FT9A 3UT5B 1DKNA 3PNOA 1UC5B 3ZZ0A 4DCVA 3EEFA 3NH6A 2XUGA 3OU2A 3THWA 4ILEA 2FEMA 4J9UE 4XVCA 3X2EA 5CH8A 5F9HA 1PK9A 1RAGA 3FXAA 3V33A 4E22A 1TFRA 5BV8A 3O8CA 1BX0A 4ZEXA 2EYQA 5JJLA 2UYYA 4CKBB 4ZI7A 4O4LB 3EY4A 3MT7A 4OLBA 3O9VA 1TYAE 4NCHA 3HU3A 3LKVA 2G4VA 5EWLB 2P68A 2WWXA 1A5BB 4Y1RB 2QX6A 4RL6A 3WB9A 2FWPA 3KQWA 2X2EA 4QUJA 1ETHA 1N8NA 1OSNA 1CUZA 1ZN8A 2ZBEA 5E95A 2X9NA 2C42A 2DWPA 3BGDA 3WHIA 1NY5A 3U4QA 1XZ8A 3ZDFA 3AW8A 4D8YA 1AK9A 4QOFA 2QN2A 3PR2B 4XUDA 3LBAA 5FPPA 2VWPA 4IUCS 1FFEA 1MAUA 4BO6A 1A9ZA 4DEVA 3SK0A 1U0JA 1C29B 3IBGA 2F8TA 3LXMA 4UVIA 3RUDA 3PXEA 2ERCA 2X0RA 4NNJA 2VEOA 4AY6A 3EODA 4PXYA 5TB5A 2GZRA 2BJHA 5DGXA 3GRUA 1H05A 1KGSA 3LUCA 1JXMA 3C45A 3Q10A 2B30A 1NBIA 3UATA 4PG4A 5IJWA 1SVLA 2NO0A 5I4KA 4X20A 1XMVA 2JATA 1TYEB 2MJLA 3W9UA 4U7TB 2FCAA 3S8MA 3NV9A 3TOVA 4F5EA 2GI4A 4AZSA 1XDGA 3NRJA 3HE3A 4U9HS 4Z4QA 2HCRA 3LUJA 1WULS 4TT3D 3V7FA 1KJ9A 3BE8A 4EEKA 3VC1A 3BQMB 3B20A 4GR5A 2EARA 3VYSB 1SIBE 2YN2A 3CLVA 4KDFA 4P82A 1RAEA 2O2YA 2CGEA 3NHJA 1Z5PA 4FCVA 2AXNA 3AHEA 1H4TA 3ISVA 3LDFA 5CX4A 4DNFA 1U5BA 3CH7A 5ITZB 4IDOA 5FNVB 3A4TA 4MVCA 4Q03A 3WKDA 4BDSA 2ZJOA 4D45A 2P9EA 1SD2A 4NBUA 3U3DA 3ZE2B 4FI3C 1AMUA 2J3HA 2DYKA 2R48A 4TYQA 5TPZA 3QXXA 3W04A 3N1UA 4YT4A 3EAGA 3T1HB 4PONA 4LHZA 5DV9A 4D9CA 4QELA 1K6EA 4FYWA 2WHPB 4AM8A 1XD9A 4Y2RA 4ETWA 721PA 3ZNNA 4JI7B 1E6CA 4F0JA 3TTTA 4LF9B 2P4UA 3IEUA 4TMZA 2X1LA 1QDEA 4MCIA 4MV0A 5CXXA 5EE1A 1LJ8A 3ER9A 1EGAA 3DKIA 4X41A 2WF7A 4F4HA 2OCBA 2VIIA 1RXSA 3BD7A 3WFIA 4DBVO 4RSMA 2OV3A 4XGQA 2UYHA 3OD1A 5EAIA 5EIXA 5ECGC 3VH4A 5JZBA 2NO4A 3KU4A 5HM6A 1Z33A 4EJ0A 3RAFC 1KE2A 1XVVA 3W5IA 1KJJA 1K92A 1UFQA 2A5GA 3H4VA 3PXGA 1CP3A 1X74A 2D1FA 1ZM9A 4F5DA 4QVIA 1BVYF 4CLOB 5CA1A 2HPZA 1UJ4A 3KSUA 4BRSA 2WK1A 2ZJBA 2BBTA 5T41A 2HUNA 4TSRA 3JZFA 4PLYA 2WHYA 3A6LA 3HB7A 3IOEA 1PFKA 4QXPA 2J6BA 4A0FA 1JVNA 4N8EA 1BKYA 5F5XA 2OBXA 4C08A 4R0MA 2OFFA 3Q0TA 2OORA 1ORIA 2O8VA 2WKPA 4EGJA 1T5HX 1SHTX 1AMOA 4OTZA 4CM8B 2NQ8A 1QH8A 2XHEA 1HKHA 2HLDD 3L7CA 4JBNA 3NMUF 3MS4A 4RD2A 5AW4A 3RRYA 1WAMA 1YL6A 3IBFA 2LCIA 4LF7B 4V03A 2JEOA 2JAQA 2WKRA 3IO3A 4RY8A 1ZN9A 2GXUA 2G7ZA 5IJ0B 2EFGA 1G4UR 1XU7A 4FGWA 2XYQA 4PPNA 4QXMA 2E82A 3HMQA 4RIFA 1L5SA 3NM6B 1N1DA 3PJEA 5LDDC 3VZSA 3CRW1 3P9PA 1D04A 1UPFA 1R0WA 3FPLA 1FP2A 4DQDA 4BVHA 3LP8A 2BYTA 1Z45A 1XZIA 3IH5A 2JZNA 4V24A 3E9MA 4FDTA 3ZGNA 3W2GA 2I62A 3FLAA 3K6JA 3PG5A 2MSEB 2VXBA 3GT0A 3QGMA 4NICA 4PR0A 1QKKA 2Q3JA 3E3MA 5DM70 4DQXA 2MIIA 3D3JA 2Y68A 3KPJA 3EJWA 2VDWB 4QFMA 4GYJA 2IV7A 4EHNA 1YQQA 2B4QA 3DL7A 3W6PA 3G2KA 3SC2A 3SC3A 5AJZA 2R84A 5JEDA 2K87A 3IP5A 2QJWA 2DHDA 1R8SA 1CQIB 1ZBQA 3S55A 3TCXB 4DY6A 5TEWA 3K2BA 3G79A 4HYQA 2CNNA 1QTIA 2B7LA 4QDTA 2AFHA 4X94A 1DGQA 2Y9PB 4R84A 4DPKA 3ORQA 3UH0A 4CF7A 1U7WA 2ENWA 3RTGA 4U4AA 3ZHXA 5MN5A 4N6GA 4MDFA 1DIBA 2B4KA 5A0VA 5DTEA 2KJQA 2FEOA 1QCZA 1EHCA 3KSBC 1N5LA 3MWEA 1QO9A 1I4LD 3AFMA 5CDFE 3ZIDA 1WZCA 4JJKA 4UTRA 2ZIGA 1K3FA 4A7PA 5L95A 5FUMA 2ODWA 1ZMOA 1TA4A 1TU3A 3OT1B 2VR1A 2ZCUA 4M22A 4YVFA 3TQCA 3FOFC 4QIHA 5JRDS 3ZD8A 2CXUA 4CLRB 1XT6A 5G3YA 5G40A 1MW8X 4A36A 2FQ1A 4AJJA 5LIPA 2EJBA 3FGNA 1ZM3A 5KOJB 4IOMA 4FMPA 3O2SB 4KIUA 1OB2A 1P18A 3AJ9A 3MA0A 2C58A 1Z12A 2O19A 3SSOA 1WG8A 3T95A 4ZVSA 3R3JA 3UCFA 1FF9A 1ILEA 3PX2A 4AX8A 1N2CE 3UANA 1ZJZA 4XA8A 5AJTA 2F9MA 1T5TA 3HQ4O 3OJCA 4OQYA 3GRFA 4RZSA 5LB2A 4ZU3A 1IG0A 1P9OA 2QB5A 2RH4A 2W9XA 2Y0BA 1VA5A 1GFIA 4M0UA 4NZZA 2OECA 4GC5A 1O97D 3H2BA 4UOZA 5LNK6 3H65A 3V3KA 1PUJA 1Q21A 2GFHA 3GUYA 3GVPA 3HUUA 3QWBA 4CTKA 2V54A 1PKEA 5IVPA 4XCXA 2GHRA 2E37A 4KGVA 4QPJC 3RIGA 3EPKA 3N8NA 1TRHA 3C1TA 3OM8A 3PPXA 4R8RA 1MQ8B 4FT2A 1U3DA 1Y8QB 3AR4A 3DFZA 3L8ZA 1AN0A 5ANRB 5KJEA 3SF8B 2JIRA 5CK5A 5JC1A 5LQAA 1SKMA 4WX2B 4BQPA 4YDHB 4D81A 1J23A 2WQ7A 4X92A 2B8TA 1BXRB 5AVWA 4S0ZA 2RKBA 2YQ5A 1PJSA 4MUHA 4TM8A 3ZWOA 2AJLI 1TC1A 4HR7A 1RYZA 4DT1A 3A9UA 1ONOA 4GQBA 4WEQA 5D85A 2ZDGA 2HZ7A 4P83A 1CHNA 1URPA 2GTIA 3WK9A 1LF5A 1VGRA 4KB5A 1V96A 3M6FA 5MN4A 3PX7A 1VL2A 5BURA 3BGVA 5AXBA 4D0LB 1LBIA 5F9MA 2DTEA 2OBMA 3Q9LA 1AKNA 1SCUA 1A2QA 1AY0A 1MUUA 2N3ZA 4DGSA 4DLBA 3CX3A 2EW2A 1O1YA 1F6BA 3HU5A 4IH1A 1CJKC 4MV1A 4W5HA 3IMFA 4KIJA 1M5TA 3PHLA 4Z7OB 1SCQA 2Q4TA 3ONFA 1U90A 1T9ZA 2GEUA 3AF2A 3UWMA 3ZW8A 3PDUA 4R2JA 3WO1A 4A9AA 5F7JA 2DWOA 4M36A 2A5JA 3CRMA 3ILYA 1ZM7A 4PGHA 4A3SA 1PDVA 1U2TA 2FN3A 4XWOA 1BMQA 5JBIA 4BNGA 3IAS6 4FCCA 3W34A 4G86A 1YU9A 4LJ4A 1EFTA 1RXYA 4KQKA 4LKOA 2OORC 4Q4LA 4TMFA 1JEYA 1OQAA 1GWNA 2NPIA 2MYUA 2PT6A 2NXCA 5A4KA 3RWMB 4W99A 2EZ4A 4HAYA 3NM5A 2CSUA 2IZ0A 4TLLB 3KXPA 3QEKA 3STXA 2JLUA 1VSVA 2IA5A 3SF0A 5HFNA 1SWWA 4PZLA 2GD0A 5E1DA 2BGGA 1IHOA 4TQ9A 5F35A 1XZQA 4LBYA 5DGTA 1KYXA 3K73O 4H3SA 3FSRA 2GO1A 2X1VA 1Z2CA 3SJAA 3T7SA 2QRHA 3ZR4B 4B87A 1GXSA 2R4TA 2YMQA 4TL8A 1B41A 1M1YA 2HNBA 1RLIA 4ZT7A 3QBTA 2J41A 3I04M 5ITWA 1V7QA 1DZ3A 2AYYA 3D0QA 3OY2A 3VH3A 3IALA 1R15A 4EG0A 3GH1A 3TIVA 2PZBA 4ODIA 1DS6A 1JG1A 4UUAA 1A04A 2XTMA 5AXAA 5CNIA 1Z6AA 3W3ZB 1DX6A 3GJ3A 3EBLA 2D1QA 3DSRA 4BZXA 4I1VA 1W5TA 3I4FA 4TZKA 3COJA 1T8WA 2WTBA 4NFHA 3EOAI 3DYIA 1WXQA 3L6UA 3OCWA 4UM9D 2NV2B 2OBBA 2W5UA 2ZZKA 3EIUA 5AJHA 5GGXA 4XB1A 2HA4A 1LPMA 4PZDA 3RUFA 1HSZA 3T5CA 1FRNA 3IAEA 1OPXA 3U3XA 4DANA 5B1YA 4NPHA 4U2BA 1ILWA 3CZ4A 4AWAA 2CD9A 4A8JC 3DD1A 1NNLA 5KJFA 1UDWA 3WKBA 3OX1A 1JHZA 2VBFA 4UE2A 3TGLA 1P0FA 4UHBA 4DV4B 2H8KA 1K86A 3MUOA 1Z7YA 4OKSA 1THGA 3FNGA 3RBXA 3B1ZA 2BHNA 3C85A 1YDWA 3FDIA 4FOLA 1IOZA 3QMWA 5ENDA 4HUQB 2IH4A 4UVHA 3E2MA 1ISHA 1ST3A 4KI7A 2XDAA 3QF7A 4XDZA 1GDDA 3ODPA 5F23A 4X7BA 3GDHA 1PJ4A 1J39A 1WKCA 2AI1A 3G9QA 4X45A 4F2PA 3T6KA 3ABIA 3CJTA 4HL6A 5D7BA 4I4TA 4F1KA 4F9EA 1E0JA 5L8VA 3GEIA 2VSNA 3G8BA 1Z07A 1YQEA 4EX7A 1R6TA 4PX5A 4MW7A 2NO7A 4P7KA 1PEYA 4X1KA 4ZOBA 1ZR4A 5JQGB 5ICFA 2ISCA 2A78A 2MWMA 4L08A 1DL5A 3N05A 1S2MA 3FYTA 3N39C 3QIAA 4X61A 1ZU4A 5TQJA 4L4ZA 1KE1A 4BMPB 1BMTA 3VHRA 2OCPA 4F9FA 4MV6A 2ZR7A 4ZDJA 1N5IA 1O5IA 1GL9B 5EA2A 3W05A 1V6CA 1JKJA 3U56A 1LLUA 4HRAA 5BMVF 1VPTA 2CK3A 4Q7LA 4ZO9A 4LXTA 3P9IA 3ZCQA 2NVBA 4WCFA 2QRKA 1NVMB 3O3NB 4K9OA 4OU4A 5EINA 3WP1B 2AB0A 3V8RA 3ZDZB 5AVKA 2Y05A 2QW8A 3B12A 4DLLA 1FRZA 2XOXA 5JSZA 2XEDA 4M1YA 4ZVOA 3MIIA 4NQZA 2IBTA 4M83A 1ELOA 4II7A 1DUSA 1P4SA 2PKQP 1J97A 3A7DA 3DBLB 4K1XA 4RK6A 2M1ZA 5BNTA 4URXR 1Y1SA 2VBGA 3ABQB 2P2YA 3HWWA 2BSXA 3I1YA 2JPDA 1B8NA 3IHLA 1BWPA 3BS4A 3PHGA 2M1XA 4E03A 3B6MA 4DZRA 4QT4A 4NQRA 3G9XA 2CXSA 4IVRA 2IDMA 3QFRA 1UQUA 1Q84A 4LE0A 2JDID 3FNIA 2OGUA 2G8NA 4O33A 3WIBA 1L7OA 2REOA 3C3DA 1VZ2A 4MGYR 2AN1A 2IUEA 3AKZA 2WWYA 1ZICA 1N6RA 4G41A 2G9ZA 3BE4A 4CEJB 2HRRA 2NYRA 2PZAA 2XMPA 1CE8A 4ZT2A 3WFZA 4KQHA 3A05A 4UDXX 3NFYA 1P1FA 5FUBA 5JXIA 3GLGA 1PD0A 1WCYA 3AHDA 1VG9B 4KWEA 5REQB 2CCGA 2X3UA 1GCIA 1DQNA 2E49A 4RQTA 1E4OA 1AH2A 5HJ2A 1RMQA 2W6ZA 1G8FA 1SCKA 2CUTA 3IE2A 2GESA 2JCYA 5JZSA 2XXAB 4BGVA 5EIBC 3JRNA 2NPFA 1L7AA 1P5HA 3OQPA 5GV7A 3FFTA 1XTZA 1ABBA 3L77A 3W1WA 3U48A 1OREA 3JVDA 1Z18A 3KCNA 4I50A 5DM1A 5B58C 3EZLA 3F8TA 3GJYA 4TSFD 5IYZA 1E79A 3G8YA 1VPVA 3A6EA 4HGPA 2VAPA 3L1HA 2IU3A 3ON5A 4W5NA 5TQVA 1CEQA 4LQ4A 1FXSA 1O95A 1GARA 4PQFA 5L7TA 1YFZA 4RK0A 2ZREA 1IVSA 2HU5A 2CLOB 4DM7A 1HE2A 2I2DA 2QMZA 2ZIUB 1OFTA 1Z3IX 3FFBA 4G5SA 1X0VA 3LVFO 4IVNA 3HRKA 4KP7A 3K1JA 1PWYE 5EI5A 2PGLA 3NBUA 4R3UC 4HO1X 1NXXA 4IGEA 5HK8A 5BO5A 3HCAA 3ZC3A 4F92B 1KO1A 3R3UA 1W0CA 1FY2A 1YB6A 1NONA 2H51A 2XOKA 3E1KA 1OA1A 3F6PA 3NYIA 5DWVA 2I55A 3RV4A 1AO0A 5KC9A 1Q44A 5L4LA 4C6HA 2O8DA 2YWEA 2X0IA 4WNCA 2P8SA 1XD2A 2RGWA 2X8JA 3DZHA 4AN1A 5ICCA 1XAIA 2YMLA 3D9QX 3Q6NA 5ALSA 1OASA 4MINA 4URWR 3RASA 4B2PA 5DTRA 3IB3A 3NASA 3G88A 2Q6IA 3TTYA 2GPWA 2HDHA 2QGNA 2RGEA 3K0CA 2AC2A 3LX4A 4E11A 4QUBA 5KQMA 4O4HF 1TT5B 3QU9A 3UYKA 4HP8A 1CJTC 4ND4A 2FPPB 2IUSA 3IOCA 1W88B 2R6CA 3KJEA 2GRAA 3IVXA 3REFA 1XRQA 2W8ZA 5BR8B 1D07A 2RH8A 5JAOA 3V80A 1LC3A 3ZKWA 2XADA 4KV7A 1CLUA 4A0RA 4MRVA 3PA8A 1F12A 3OICA 4NENB 4LI3X 3VTZA 3IAHA 2NU7A 2AE1A 2ILTA 3B85A 1YJ8A 2FN9A 1FQWA 1SXJB 3LDHA 4NAUA 3ZIUA 2NZWA 1KYTA 1EA5A 3IXQA 3PQ3A 2EEZA 4RH3A 1HXHA 1IQPA 2PKRA 1XVLA 4OQFA 4M76B 3VZPA 1HFWA 4C4AA 1VIDA 4H08A 4ZOEA 1QQTA 3PNMA 4OXIA 2C97A 3RRXA 1UJNA 4Z4IA 2VYND 1D0VA 5LDGA 4B8YA 3GC6A 4E4RA 4YJ2F 5T8KA 2WHEA 4YFYA 1WW3A 5JS6A 2J31A 4CMCA 3JWGA 3QBDA 2GYYA 3PNKA 4WZBA 2VHZA 1KI9A 5JXHA 1EDZA 4GI7A 2H3EA 3D31A 1CRWG 3TD2A 4U7DA 2W42A 1JFLA 1H2HA 1PR0A 1U3VA 1TYBE 2CVPA 5LP6B 3JW8A 4L0DA 4ND6A 2B8EA 1SAYA 2FU5C 2QZSA 3QFFA 1P81A 1TZKA 1SBHA 3A14A 1J2UA 2GZSA 4KGZA 2JLSA 3QPWA 1OWOA 5BW4A 4YRSA 4RTJA 1QYCA 5JY6A 3GA5A 5IUNC 1MGPA 4O2LA 2IYAA 1Z5WA 5C1IA 2AT1A 1PWXA 2AFIB 1T0BA 4MRMB 3ZH2A 5TS2A 5C1PA 3GQBA 1ECJA 2BFBA 2FW8A 2DULA 4LA4A 3MQ4A 3DW1X 3KYDA 1W4RA 5KJ1A 3TDNA 1RAHA 3PFNA 3ZWVA 4P4LA 3NRCA 4PXAA 3D59A 4H0CA 1RQGA 4MUNA 2E5LB 2PH7A 3C15C 1BYUA 4P08A 1EJ0A 2FSHA 3PGA1 1TADA 5IK2D 2FTKE 3NZEA 5B58T 4FDAA 3FHJA 3QVTA 4CU5A 1B1AA 1T1SA 1J24A 1U0OC 1KWGA 4G26A 2Y99A 1YS1X 4ZO8A 3MHPA 1CLEA 2Z5GA 3G5UA 2C5HA 4OI2A 3CXRA 4ASUA 1KIFA 3OETA 4BQIA 3OCXA 3OFJA 2IP2A 2X23A 1GVNB 3BKXA 4S24A 2P69A 3VYTB 2G88A 1MENA 2E1PA 2QX7A 2ZJAA 1CFJA 2J9ZB 4NBNA 4MRAA 4XTRA 1EU1A 3BG5A 3MJCA 3K70B 4DMHA 4DREA 4AWBA 3E58A 4ZQGA 1RQNA 5C1OA 4WZAB 4XVUA 2Q4EA 2AR7A 3O26A 2BFEA 4KLRA 4JXZA 4QD3A 3EPRA 2CXPA 5JCJD 5LBUA 3K4QA 5A4JA 5LN1A 3K5WA 1S02A 3Q8LA 2C57A 1Q3HA 2FRVA 4BO4A 1AZLA 1EUDA 1E96A 2GM3A 5HZKA 2EQBA 1QPZA 1Z8FA 1SBQA 2FPLA 2A4MA 1SXHA 3TVDA 3A2KA 3KOWA 4JYCA 3EGCA 2BT4A 3QE3A 1P3JA 1O95C 2JBAB 4EO9A 5GINE 2H1CA 2V7QA 3NANA 1H0KA 2A33A 2UYGA 4WBNA 1GQRA 1EWKA 4XXHA 3TN7A 4AS2A 1BVUA 4IVQA 3LUFA 3BCUA 2JK0A 1C8BA 1GUFA 3IEVA 3IXLA 3DLTA 3HLTA 4DA6A 2J3QA 1XLTA 2KW5A 3MYRA 3IURA 2RB5A 1X2EA 1P5FA 1VIYA 4C22A 3RSFA 4RVHA 5D01A 1I4WA 2WSSD 4N7RA 4BGUA 4CM4B 2G71A 1NUHA 3MFQA 4TZTA 3NDBB 3PENA 2OYRA 1RW4A 1W9MA 3M4ZA 1Q77A 3E1SA 5CVDA 3HABA 4ZJPA 3LKBA 3O73A 4S1WA 1P31A 4YLEA 1IM8A 2EHDA 4FYJA 4NAVA 2I9PA 1I7PA 5CHEA 1C1YA 2J3LA 4RFVA 1Y6RA 4O5OA 1MIOA 1ZOIA 2I67A 1H3FA 2Q8PA 3EC1A 5LZ5A 3IR6A 3JAKA 4RWZA 3ENZA 1C3JA 1UT8A 2NZVG 2IYQA 1Q1ZA 5JMPA 3WRXA 3AM1A 3OHPA 3KT8A 1X19A 3W4KA 3HCNA 2PIAA 1G1AA 4TMVA 4CL2A 2BCGY 4OU5A 2VYVA 3DWFA 3WXMA 4A91A 4DBLC 1EWQA 1FYVA 2DWUA 2P6MA 3ESCA 4QGFA 5FTLA 5IWCA 2FEKA 5A2QA 3UJNA 1SUFA 4HWGA 4KZKA 2VRWA 4WFIA 1PNRA 4BQOA 2I0FA 3RGWS 3OPYI 2BKXA 1NUQA 3H13A 4L5JA 4CN9A 1A88A 1F3OA 8OHMA 4AECA 3F7TA 4ZIRA 3SIRA 2Q28A 3RVNA 1FTGA 1IH8A 1QQ6A 2OHXA 2P2ZA 4E07A 3OKAA 3C7TA 1A8SA 4GSLA 3WNDA 4FZRA 4C6TB 5ALNA 2X8AA 3CF6R 4RVCA 3H3JA 3HJAA 2BMVA 3NPMA 4L0QA 3TVTA 4BGEA 1A8PA 1GT91 1EFKA 5F64A 3ITDA 1II0A 4D2IA 2VZ9A 2YNMC 1KSGA 1UAGA 3G8DA 4YCSA 2DX7A 1ZH2A 1M0SA 3F7MA 1PUIA 2CCJA 2R8BA 5ARBA 2W98A 2NZXA 2F7SA 2FZ5A 3ISTA 4M98A 4PO8A 3RCBA 1WSWA 3LCVB 4B46A 3PQ5A 1YMQA 5HS6A 4LJLA 2R47A 3ETLA 4NMLA 1QIKA 4X8LA 1R66A 4X90A 4AU1A 5I7FA 1P61B 4L5AA 4XLZA 2AMYA 5LL6P 3ND5A 1CDZA 1E5DA 3P2KA 4IP0A 1PZMA 1QVVA 1F4VA 3OAAD 4O4JB 1WXIA 3GFFA 2UVPB 3SJ7A 2H63A 3WRYC 4IFTA 4M89A 5KMGB 3FZNA 4Z3DA 3GP8A 2JI7A 1W4BA 2ZRLA 2ZPAA 5B4UA 4C7KA 4HGOA 4UE6A 1A97A 4F06A 1I3OA 3JQAB 3T1QA 4RV4A 5GIOE 2FX3A 2Y2UA 4Z8YA 3TQSA 1P60A 3GEGA 1NY6A 4N9WA 2ZVQX 5KNDD 1EVIA 2R62A 4MYHA 3RR2A 4B31A 1HDCA 3GOHA 3QYJA 2WD9A 4JDUA 4BIMA 1H42A 1PW5A 2JCBA 2OLEA 1R8XA 3O0DA 4AI6A 2AI3A 1EFRA 2R751 3FOBA 3WLAA 2YOGA 1UKVY 3T15A 1L8AA 1KVRA 2GEKA 3WMFA 2H06A 2J5QA 1KYIA 1T0UA 2VHWA 5ALMA 1VGQA 3SYKA 5JTUA 1XPOA 2CV1A 3AL0C 2UAGA 5B3JC 4W1RA 3JRWA 3LXRA 1T4DA 3ZG6A 3OIYA 3AFOA 5KHLB 1X7HA 3AUJB 4P32A 1U7XA 4JVLA 3B3QA 3QE9Y 1F2DA 1U7DA 1ZN7A 3NBAA 4ZQFA 4YV2A 5KQGA 3TBKA 4CKEB 4G1CA 1TZJA 4ZMSA 5BR7A 4LS3A 2XDQB 5HR5A 3Q3CA 1VSTA 1RQRA 3U62A 1X1DA 2RAVA 3FW1A 2WB2A 1SU8A 2NU6A 5IW8A 1K4KA 3I6QA 2XECA 1TGYA 4EG4A 2TSYB 2ZAGA 1UDRA 3WIOA 4DIMA 3U3OA 3O4RA 4GM4A 2UXBB 2QTRA 1QIHA 5GY7A 2W2LD 4GR9A 4IEEA 3KUUA 1V6SA 1BDHA 1G5FA 1XRJA 3UF0A 5GMOA 3EOZA 1EZ1A 3G5AA 1B6RA 3WWEA 1UUFA 1Y4ZA 2ENUA 3HEMA 4FPXA 5DNWA 1TF5A 1C81A 2VYQA 2J5XA 5F1PA 2QI9F 3KT3A 5F5NA 3MLEA 3E7DA 1LVUA 3L9WA 1HC7A 3MBOA 3MS7A 3PNLA 4FP9A 1RZVA 5KIAA 2XF8A 5JANA 1U3WA 2C8VA 3BCRA 4ME6A 1QJ4A 3R3XA 1IHYA 4N54A 3UMYA 4AUKA 5I48A 1DIRA 5L45A 3GFQA 5AWFC 1EINA 1O9GA 3FRIA 1A8UA 1YFLA 1ZMBA 2YWCA 3N0TA 4RZ2A 4A6PA 2N75A 1S9HA 2NQ2C 4KAAA 1LI5A 4QOEA 3DAHA 3PGVA 1AIPA 1YKGA 4DZTA 5C1DA 4ZXFA 1QO0A 2JJMA 4UTXA 3ZHTA 2YH2A 3C14C 3FCYA 1FNDA 3FWKA 2FW0A 1NVVR 3RPEA 8AT1A 2AJ8A 4Q47A 2ZWAA 1VG8A 1W5EA 1RWQA 4NBRA 1T4CB 4OF4A 2CDCA 2Z8YM 4L5YA 4BXOB 4Y2UA 3TLAA 2I34A 2RB4A 4PZAA 5TMDA 5B30A 3X1KA 2ZRHA 7MHTA 1RT9A 4H6WA 5DOVA 4S3MA 3P9XA 3FNHA 4JL8A 4PLHA 5GWXA 1N4AA 1GSHA 4X24A 2ESRA 1EIWA 2C5BA 1G20A 1ZHHA 2WTUA 3P45A 2AWOA 5LQUA 1T9KA 1M6VB 2GZAA 2WUDA 3AERB 3CNHA 2FF7A 1QAQA 3CU5A 4RPLA 3RBVA 3SX4A 5F7OA 1VKNA 2YBDA 4DG9A 4K9DA 1Y1LA 1YFKA 2RJ3A 5ELLA 3ZWAA 4C87A 1O94D 4BVFA 5ES4B 4IY1A 4CEIB 3GZTB 1W1IA 3BH6A 3SG0A 1C9MA 1NJ2A 5DASA 4D8WA 3AOEA 3DUFB 1P72A 4EUKA 2G1AA 4PO9A 2IXAA 3L4SO 1ND6A 1KMHA 1RKXA 1C30B 1DOHA 1SKUA 3OFNA 4E3ZA 5ICGA 1G6KA 2AC7A 3JVUA 3LGAA 2PTGA 5HUQA 1IXZA 4OATA 1N7HA 1TM4E 3F7OA 4TROA 2BGKA 2GYWA 2OPBA 1C7JA 2QGFA 1FVOA 1SG0A 1OKKD 2RC6A 3H17A 2XE8A 3NNNA 4FIZA 5C2JB 3R0IA 5BQFA 1HNZB 4C04A 2CVOA 1Q7EA 1XA4A 1ZJ6A 3UQYS 1P7WA 2VJBA 3PC4A 2OILA 4J3NA 3W4JA 3AONB 2IY8A 4A4DA 5F98A 1RXWA 2BFOA 2V55B 3ZXYA 1KH1A 1OI4A 5D6OA 4A2PA 4HLUC 3RYCB 3BBPA 3IKVA 4ND2A 3AFNA 2FMTA 1A0OA 3HEAA 1ZM2A 1W2GA 3ENWA 5ALHA 4EF5A 4Q37A 2XZPA 3ENKA 1RI4A 1TI7A 4O63O 4DJTA 3WTBA 4B7CA 2PS9A 4D26A 1GO2A 1RSZA 3GLFE 4O6VA 2CDRA 4BUZA 3AVPA 1P17A 1CF9A 1XLWA 2B99A 4W5RA 1PG0A 2RG1A 2A9VA 3D4BA 3GAZA 2DLDA 1OFIA 3K4PA 3M6IA 4IH9A 5DBGA 5DOZA 2G72A 3OIVA 4C0SA 4MVJE 5DYTA 3K9QO 4BMZA 2G40A 1G6HA 2WSLA 2I4TA 3F90A 3N6VA 2C99A 2C5EA 2QVLA 3OQHA 1LTQA 4P7BA 4CMGA 1SPXA 1VL6A 3ZBTA 4DRXB 4E2ZA 3TKAA 2ZBGA 5K09A 3THYA 3W3AH 1RKBA 1JBQA 3L84A 1J5EB 1A5ZA 4MWZA 3F5SA 4Q15A 1DFGA 1HT2E 4LX8A 1SEPA 3BJRA 4LCEA 4AJHA 4G81A 1JB1A 2AG5A 5DK6A 1D8AA 4B33A 3G2PA 1L5VA 4RVFA 3MTDA 4I5DA 3CVVA 4KQ2A 5A05A 1MXHA 3H3FA 4PLPA 8GPBA 4E5UA 1CQZA 4PG8A 1UJMA 2OBLA 3G8AA 2O8FA 2GB4A 3HO8A 5LOVA 3IHTA 3VTFA 4CUZA 1NI4A 1B1CA 1C4KA 1NURA 2DPYA 3JWJA 3W9BA 5AW2A 4ZARA 4CWAA 3UWDA 4U9UA 1OA0A 1XXHE 3LPDA 5I9TA 3HZOA 1GRRA 3J81k 3IJ5A 1XD8A 3S8EA 2OV2A 1JQEA 3HJNA 1PT6A 2D5CA 4BPRA 3I6ZA 4DCUA 2R6GA 5C1BA 2IBSA 1RHQA 2WT9A 2CNBA 3MT9A 5JNTA 4K9LA 2NSYA 5J9FA 1KGDA 1XDUA 4HWOA 3T0IA 1NTOA 1DAFA 4WKCA 3VJKA 2OCGA 1SQSA 3A1SA 2JZCA 1QTQA 3HTXA 4CODB 2OV4A 1YCFA 3CM0A 1JDSA 3O8LA 2VPYA 5KJ6A 1GG2A 3H84A 3TOZA 4WPGA 1XGKA 2UUOA 1TCVA 3UAXA 3AXTA 3ILXA 3KUDA 3V55A 1ZJWA 1F6DA 3VVBA 3OH8A 1L7RA 4AZTA 1BDMA 4JBLA 4F85A 5BXYA 4PFQA 2ZJ2A 5BMVA 1JQDA 1G5HA 1RMTA 3P9RA 3OO0A 4OLFA 4R1UA 3WBKA 1B2LA 1JKXA 3I6YA 3TLGA 5HJEA 5CIYA 2FPIA 1UIMA 2OKGA 1U7OA 4BZPA 3MXOA 5FAKA 3F4LA 4KJXA 2JIQA 2CHUA 5EHXA 4YJ3B 4BNJA 3SQWA 3D8SA 2G9QA 3AKDA 3N2GA 4DV2B 1TO6A 3FKSD 5FBRB 3QF4A 2C78A 3DL0A 1VP3A 1ZIDA 4NJOA 3OM1A 4ZVLA 3RUHA 4ZTZB 3ILVA 4RJTA 3N3AC 1LK5A 4NESA 1D2RA 5FL7A 2BKLA 1K66A 4Y0VA 1G5QA 4ZKEA 5MFZA 2QUIA 2JFNA 1J09A 2P67A 3DT8A 2GPNA 1F9EA 2W22A 5FLEX 4CMEA 3UV6A 2ALJA 2NZYA 2WA2A 4GZ6A 3O9MA 2SECE 3K9LA 5T3YA 4WJKB 1IN5A 1O0SA 2Q0QA 3D3WA 4TV8F 3SIXA 4KDCA 3N2NA 1M2EA 2X58A 4JITA 2EG9A 4X63A 3IODA 3LIPA 4WUVA 1PFQA 1X7ZB 2FOXA 3H5AA 4FFVA 3OTQA 1DHRA 2W8BA 1J1ZA 2PO7A 4HTAA 3H4MA 3CKKA 1YXMA 3CIFA 4KYIB 3H8WA 3AOEC 4BU0A 4PICA 2EATA 3AB3A 3K1ZA 3VDXA 4LVUA 1NQTA 5EHIA 2UZ1A 2OXEA 3EQ6A 4RELA 3W7VA 4BFLA 4D92A 2QVZX 4QU8A 2V8OA 1KQPA 4OB8A 1VMAA 3FD8A 1Y9DA 1QE5A 2CJFA 1IM5A 2DFNA 2YIMA 1KRXA 4UCFA 5IMBA 5BN5A 3U4MA 1NR5A 3G9ZA 4GBJA 1DJQA 5DEIA 1HDYA 3UA4A 3EGIA 1NFFA 1SBNE 4ZRMA 4AJPA 3ZGZA 4UBMA 3EAQA 1N0HA 2I2AA 1PL6A 3PJDA 3QUBA 4LRUA 1JDBB 1RRKA 1UM8A 2FAXA 4XDGA 2I3GA 1SOMA 3GHHA 1N1EA 3ZNOA 4ZOLB 2EW8A 2PD3A 5FFFA 2PKEA 2YMPA 3IHWA 2EYUA 3R0QA 4G9EA 1E6WA 3MGKA 2P4EA 2OFPA 5LM3A 4HNQA 3GRCA 1M5UA 4YV7A 1R4MA 3U17A 1A4IA 3STHA 2OR3A 2OXRA 1GRQA 1M54A 4UD2A 5E4YA 4YMGA 2B4TO 2BSAA 1VB3A 2Q4DA 4QPPA 1F9AA 1I6LA 3QW4B 1ZKDA 3KQVA 3RU7A 4HN9A 4BQRA 3C8ZA 1C3OA 1SG6A 2WD7B 4JBWA 3TSYA 4RHFA 5BVHA 4N3GA 4QQFA 3A8TA 1XZBA 4I9NA 1BU5A 1SUCA 3PWSA 4KIGA 4O4HA 1MHTA 1KDTA 2IXBA 3GZNA 4U39A 4AYXA 2O8BA 2W2TA 1I8TA 2X4DA 4D4LA 4IILA 2F4NA 1W94A 4ZYVA 1XL1A 1EG2A 3KKKA 1PV4A 4GUAA 3QEOA 5KVCA 2BRUA 2XSZD 3QEAZ 2BTEA 5L7WA 1ATIA 3JQ7A 3TW8B 5CIWA 3M8KA 3B1JA 1X8LA 3EGEA 2X0FA 1VCMA 2DT5A 3CUTA 4GFDA 2NVUB 1EWTA 2IV2X 1CR0A 1BROA 3SP1A 1AE1A 3VISA 5I9BA 4RMNA 4RTLA 1JTVA 3BERA 1UFRA 1P6UA 2JH8A 5AKYA 5KTMA 2FX5A 2FMIA 2Y0DA 4JGIA 2WFLB 4I4CA 1VHWA 4NCXA 6AT1A 1V7PC 1ZGZA 1LLQA 2F3RA 4JU9A 2EJVA 2FR1A 2PFSA 3E22A 4B45A 1L5MA 1UPTA 2B5OA 1FLAA 1KVQA 3JR3A 4A2CA 4DYDA 4IJUA 4IV0A 4F6LA 1NVKA 4IWNA 1N2CA 2DFPA 1VI5A 1TUBA 2C54A 4MQFB 5CR9A 3UHPA 3VJMA 3CE6A 1OX4B 2GEFA 2ZT7A 3MPOA 4OHUA 1GPAA 4W7HA 1E2NA 1R6DA 4EHHA 2AOUB 2H4FA 4BATA 3FSJX 3PUJA 4EPXA 1B8OA 5FA8A 1XC7A 2E5FA 1SBIA 1N92A 1GPJA 3VRHA 3PJFA 5D00A 5KDDA 2YXNA 4NBVA 3CE9A 4Y18A 4NZ9A 1GYRA 4GE3A 3DGEC 1RJDA 1EFHA 1GTMA 4TX1A 1WP9A 3WKCA 3EBPA 3RGGA 2YRWA 2E0IA 3LHDA 2W6OA 3EXIA 4YRTA 2GERA 4EUSA 2OGZA 4IDFA 5ADWA 5TLSA 2DTDA 3NHLA 1HL7A 3AMVA 3BB3A 4U1RA 2N46A 5J63A 4D82A 4FCWA 2R7KA 1X0XA 4H7HA 1A9XA 3RYHB 3GMIA 3UPUA 4L8GA 2EKPA 1W44A 2CFRA 4Q9LA 2W83A 5FHRA 3H2GA 1U4SA 4LHXA 5G53C 5JROA 2X77A 3P9NA 4BMCA 4ZAGA 2H11A 5DHTA 3A9WA 2OQ2A 1WZUA 4Z1OA 1Z74A 4CMJA 1ZOPA 1NW8A 2Y1OA 4FYPA 3SZMA 3C39A 3DMHA 3JD0A 1YJBA 3KHTA 4PX2A 4CMEC 2C3MA 4EFLA 1WETA 2QSUA 5B3AA 5CCBA 3PRHA 1M34A 1UBEA 3CCFA 3QJGA 4KO4S 4LYDA 5BN1A 2PLFA 1NYQA 4JMLA 1XZMA 1Z4NA 1NW6A 3ZYCA 2B25A 2Q5QA 3S7ZA 4XSGA 3MGBA 2TMKA 1Q2XA 2Q1YA 2ONZA 3C87A 3ROMA 2J0EA 2ZI4A 3UXMA 2BUAA 2FUCA 5LQCA 3SEZA 4BNDA 1KVSA 4FEYA 3VMMA 1YS9A 3ER6A 4EJFA 4WADA 1SHKA 4QECA 1P6QA 1JLLA 3C0KA 1AUXA 2P62A 3RO7A 1JG2A 3BXHA 4IFIA 4RFLA 3VKGA 2ZYTX 1ZK0A 2IHVA 3DONA 3IL2A 1HKUA 4BVLA 2J0UB 1R00A 5FYQA 1E4EA 4O0MA 1V9LA 2ZKLA 1QH0A 4XM2A 4C6SA 4EMSA 1F06A 1GGHA 2O2CA 2FH5B 1V3QE 2XDYA 2X40A 4HAVA 1SGWA 3T5DA 4MEJA 3S5UA 2JGEA 4JBHA 1J06A 4WL0A 3GLVA 2OOSA 5TMEA 1BGXT 2FHPA 4N5LA 4WBXC 3HFJA 3KAKA 3HCDA 3ZQUA 1XVAA 3VXKA 3SE0A 1E3WA 2OAP1 3V2UA 5F1YA 5FPQA 2WD8A 1H9AA 1M6HA 1CB7A 2DUNA 4C4XA 3ME5A 1GQQA 2VJDA 3Q3JB 5KTNA 3QV1A 3ILSA 4TTSA 3RVBA 5HYVA 2QRGA 3D8NA 1UT5A 1PQ4A 1T15A 2BEUB 5EESA 2JCSA 1E7SA 1NFRA 3DXZA 1ECFA 1G5PA 2WAMA 2V65A 3FVQA 1RHKA 5CT4A 1GRNA 1LD3A 1D2AA 5EQJB 3H87A 3KKQA 1SVKA 2P11A 2O07A 2NU8A 1V95A 5FIUA 3CKLA 3LCMA 1SA0A 1F8XA 3QXHA 3L41A 3EVEA 2IZ1A 4QJBA 3WFJA 3EEQA 1NXWA 5JECA 4WECA 2WE7A 3TLJA 3BMQB 3OX4A 4IDAA 3ZCXA 2BZ1A 3GU3A 1OI2A 1HZZC 4M7PA 4DLUA 4NWIA 4YC7A 3T5MA 3PEYA 3B1WA 5CXQA 2YHIB 2P9TA 2FV8A 2WG2A 5FOUA 5B1IA 4DA8A 1C2TA 2I7TA 4B3GA 3RWOA 1M76A 5FWYB 4ARVA 5AI9A 1ZZEA 2ZANA 3NJ4A 5AVUA 5IRCD 3RVQA 1IHUA 4OYLA 5EJ9A 2HA0A 4QYIA 4XRGA 3I1JA 1C7RA 1OGIA 3QVGA 5HIJA 4RF4A 4I81A 1JQKA 2J0SA 5IANA 4YT8A 5HF9A 4KQMA 3EEYA 3VC3A 3WL8A 2WYIA 1FYDA 3OF2A 1L7QA 5B7GA 4KLCA 2FDXA 3GI1A 2K6GA 3UJ9A 2GARA 2AOWA 2GZ3A 3HUFA 4WASA 4EL5A 5JR3A 1O6ZA 3DF7A 4HDSB 3ZWYA 2WJZB 1XG5A 3TSCA 2XNDD 4AT1A 1IJBA 4N41A 1U2EA 4MXDA 2J8ZA 2YWDA 2BC9A 3KYJB 4R7ZA 3FDFA 3Q41A 3QV2A 4JCCA 1GIAA 3ZHOA 2C83A 4P3XA 3WYGA 4ZOQI 1Y6JA 1P2TA 1R5NA 3HA3A 4QTYA 4QOIA 4WDQA 1U7ZA 1Z2OX 4K8OA 5HBRA 4MV5A 1D3AA 1S96A 1TMYA 1IZ7A 1ZGAA 5K0LA 3S44A 4RM3A 1THMA 3FNEA 4WRRA 5FD8A 3VU0A 1AKUA 2I6UA 1F51E 3B89A 2XKBA 3BXXA 5A4DA 1FFYA 2GSDA 3SEAA 3KVNA 2P9FA 1OH8A 3OECA 3NWPA 1WCIB 3SICE 3FSEA 4U7PB 4LYHA 4IZIA 1MA3A 4TKVB 4AJ9A 1SY7A 3H16A 2PUAA 4ZFNA 1TXGA 4JJGA 5AW1A 3RFCA 3ZU3A 2D2VA 1XRLA 2ZSKA 3LVBA 1SPBS 1JE1A 4MYUA 2QR3A 3I9MA 1EPUA 4XARA 3E9ZA 2FMKA 2PX8A 1A7JA 1N3LA 1T2VA 3NTLA 4QJ4A 3ZTTA 4DMUB 1RBZA 2IJGX 3A9TA 1OZHA 1JQAA 1FUIA 5B3KA 1IUNA 5BWOA 3MJ4A 4Q1CA 1RTTA 5JWOA 5K7SA 1QB8A 2GMWA 3T4UA 2G28A 3L5OA 3N74A 4HLNA 1TUIA 4KTVE 3RHZA 2AIRA 1BXZA 4I7EA 1B6SA 1HYBA 3CF0A 4DL9A 1IRXA 2BBWA 4NH0A 3M3HA 5BV1A 2GUWA 3ROEA 1Q12A 1Q1GA 4G2TA 4EZEA 2GM9A 4JODA 4RF5A 1KORA 2IH5A 2WTNA 3KUXA 4QDXA 4EBBA 3L7OA 1ID1A 3HV2A 3ISJA 3IR7A 2H59A 4Z0TA 3M3DA 1CVRA 4MJXA 3VKFA 4P38A 3WQSB 1EEXB 1YQWA 2FZGA 3NLLA 3WSVA 1YHYA 1YWGO 3BQ9A 4JBYA 2AZXA 1M6NA 5L40A 3GLHA 1OLXA 1NL3A 3H2SA 5JI2E 2IUFA 3DULA 2HLNA 4B75A 3H9BA 1R6AA 3KKLA 4JAVC 2HMVA 4N6OA 4ND8A 3DBOB 3KJXA 1QYXA 2XWSA 4ZI7B 1JHYA 4N0MA 3SYRA 3L04A 4GZ5A 1QZ3A 4AXBA 16PKA 1HE1C 2E4WA 2Z9DA 7AT1A 4KR2A 1L4KA 2XZDA 2IS1A 1EFVA 4FEAA 4B6RA 4F3KA 2QKYA 4EVIA 2JL1A 4G3XA 2ID7A 2VAMA 2Q5HA 2VSFA 3H19A 4DV1B 1VLJA 1KQGA 3AHJA 1EK2A 5A03A 2HCBA 1K9SA 3IPXA 3SKVA 1A7AA 1QRRA 5KI6A 1CVLA 3BMNB 2XWBF 5KVSA 2D13A 3I0MA 3K6SA 1IE3A 1R4NB 3AI1A 5CVEA 3CNEA 5FBWB 3HG7A 1ZXBA 3EQ8A 1G7SA 3G2OA 2Q1UA 3AVOA 1Q16A 4C9BA 4BV2A 1J0CA 1VIAA 5B6PA 1T3HA 1D9ZA 3A6PC 3SYTA 1ECGA 3OFVA 1EG7A 5ARDA 4LYEA 2JC3A 2GN8A 3HFGA 1E7YA 4M87A 2XWJI 4YJFA 4X20B 3SZ3A 4B3FX 4D6XA 3M70A 2Y93A 1MXFA 2FW6A 1GGEA 4O2RA 3LTNC 4FLEA 1Q11A 5G0VA 1DC3A 3TQQA 3V1YA 1KR5A 4N4AA 4E33A 2G77B 4DEYA 1OH6A 1AHPA 2PKCA 3S8YA 2ZUFA 5K1ZA 3ZV3A 4LGVA 2I8LA 1KHTA 3H75A 4EPTA 1N5MA 3OHSX 3R8CA 3TZEA 3ZDRA 4F2WA 9MHTA 5AK4A 1U5BB 1J4AA 4KRYA 1N3BA 5IX8A 1OBFO 3HGQA 1THZA 3NGMA 1BA3A 4US2R 2DSNA 2BKAA 1MJGA 5EPUA 1VE1A 2WMYA 2FUKA 2X1MA 3SHWA 1JQLB 1XCMA 1FCJA 1REQA 2HB6A 4DIOA 2HHHB 4N3NA 3NS7A 4DV0B 1NVEA 2C92A 3L92A 5LPNA 2Z04A 3E4CA 2ZBVA 3SQOA 1LDYA 3WLJA 1QVZA 2FFAA 2GN9A 3WV4A 5A5VA 5AP9A 2C2BA 5HP4A 3DM9B 3BMCB 2P3QA 1RAIA 4L5CA 1S3SA 3RHTA 3V8NA 4RMIA 1LA2A 3DFMA 5HKLA 1Z4KA 1IULA 1IXRC 2HYDA 3ACBA 4IPTA 3RYFB 3C5WP 3FDJA 2PGNA 1VJDA 3KAJA 4ZO7A 5MDHA 1KL7A 3VR2A 1ZWLA 1COZA 1WNFA 2FLKA 1SUEA 2ACWA 4RLSA 3KV3O 1U9IC 2PYIA 3CZPA 4FLFA 3IULA 2AA3A 1NVFA 3CGGA 3M9LA 3NT5A 4LPKA 1OWPA 3HA7A 5CA1B 4WH0A 5G0TA 1I2BA 5EXXA 2YV2A 4GO1A 1RFLA 3IELA 3KXKA 3QTLA 4AK9A 2O1SA 1WZNA 1LFAA 3TQOA 4Y6RA 5CDUA 4RPJA 1ESEA 2Y4OA 1DWOA 1HYGA 2H00A 2Z2XA 5C31A 3VR4D 4QRIA 4C5CA 1D03A 3DO6A 3PZBA 1KPIA 2I6XA 2X19A 4M7RA 4PYRA 3SBOA 3DAFA 1I01A 1E9RA 3ID6C 1QH8B 4HDNA 5AM5A 4D25A 4WY2A 1HPLA 4OAPA 5JOQA 5B36A 1AS2A 1JMYA 4IIYA 3N8IA 3CZ9A 1FNSA 1XRNA 1DX9A 1JFRA 2BKEA 1IPHA 1U3GA 2OM6A 3DNPA 2H0RA 3IS3A 4F3NA 4AY2A 4KJZA 4I4IA 1FYWA 1MV5A 4Z54A 1V47A 2Q4OA 3D6HA 4IV5A 4UHDA 4A0SA 3HR8A 4QPDA 1N8KA 2G4LA 4NECA 1MJ5A 1U04A 2INGX 5LJLA 4FQ8A 3A9VA 3AR2A 2ISSD 5IXYA 1QH1A 2PFKA 3NKFA 4ND5A 3MAJA 4REOA 4E5NA 3WTCA 2VNIA 3IPAA 5JNRA 1NX9A 1SKBA 2YUTA 4U2GA 2HK8A 2OA0A 1FX1A 2BJWA 3Q88A 1UAAA 2VP3A 4YHHB 5JXJA 2GK3A 4K1LA 3DG9A 2AOVA 4NFYA 4L2IA 3Q0IA 5M29A 1YJ5A 1K9VF 2P5YA 1RC8A 1NOKA 3AEUA 2X0JA 3MFYA 1GZDA 2XXBA 4FZ5A 4GR4A 4XIIA 4ZVPA 1N9ZA 3UJ7A 2WEKA 4WE3A 3AIMA 5ULLA 4FZ3A 4MV9A 1OXXK 4RY0A 4TRRA 1G8YA 1GTVA 3G5LA 2PO5A 3IX7A 4NU5A 4V02A 2GBLC 1E6UA 2ZIZA 4YMSA 3AYZB 4DPMA 3D5QA 2AFHB 4JWKA 1E66A 1QH9A 2JGMA 1R7RA 2FMHA 2JIPA 5IARA 1VJRA 4PLWA 5FO0A 1IEXA 3T4PA 3TQRA 5HTOA 3AUXA 4JV5B 3SIPA 1XDSA 4G5RA 3M34A 4X6YA 5B6IA 4EUFA 4ZANA 2CY0A 3MWEB 4Y1GA 4LRWA 3AJRA 2APJA 2GM5A 4CU2A 1EEHA 3DAGA 3NC1C 2BGLA 1VKJA 2GXSA 4R1MA 2OV8A 4PYJA 1T9AA 2PWAA 4IYRA 1CUWA 1ZC4A 5BQ5A 1QNFA 1C41A 5ES3A 2B1GA 3L7JA 1U99A 3WJAA 4ENTA 3SIWA 5CEFA 5DI3A 5DYWA 1OU4A 2GLTA 3LUGA 1CY1A 1CZKA 1DAIA 1UZMA 1ZXLA 2JB9A 3CUWA 2GK6A 2FK7A 2BFWA 2C5SA 3I76A 4HNSA 4MUGA 3BK2A 4KXLA 5EE0A 4FFWA 4FQ7A 5KWJA 3WOHA 5L3QA 2JJ2A 1K6IA 4RJ2A 1JSCA 1R9NA 1WO8A 4IXMA 3LCUA 3OZXA 3T06B 5BW8A 4RNDB 2RC5A 1YJQA 4PAGA 1E9AA 1UDAA 2UV8A 1M72A 1AX9A 1VYVA 3I72A 1VFNA 4HAXA 1R1DA 3WQRA 4C3VA 3BRWD 3E0QA 2FFBA 1RWPA 2BPOA 3N8KA 4HB0A 2DETA 5ALRA 2KLBA 3ZU6A 3W3AD 1LJLA 3E7PA 5IBCA 2WHQA 3CV3A 3AG6A 3ESAA 5E1MA 3GLGB 3LKZA 4YRFA 5TS3A 2ZYIA 1DAMA 2CLEB 3CN7A 1AQ6A 2CFSA 4QUIA 5IZCA 5AR1A 3G8CA 3OZDA 3L7DA 5A4MS 2QUBA 3TO5A 4D8XA 1S89A 2V9PA 3TAXA 2FQWA 3ZCPA 3NOOA 3GUZA 2P27A 4RVUA 4N7MA 1T9CA 4M0EA 2X8BA 3N5CA 4TV8A 3COYA 3NHAA 1YQUA 4EY6A 1TTPB 3DOOA 3UK6A 2B6NA 4YIKA 2EFDB 1J8YF 1ZH8A 3THRA 1R0LA 3CG4A 3UUWA 1W49A 1N36B 1KI3A 2Y92A 1S7CA 2BHLA 2ATXA 3ORRA 3H05A 2WUFA 2J1LA 4LF6B 3E53A 2VXYA 4Y1FA 8MHTA 4RY2A 3WLIA 1G8SA 1TZMA 3VPBA 2PAAA 4MV3A 1YZUA 1XNQB 1WIWA 2ODQA 3A1CA 4C06A 1D4ZA 4IJ5A 2OBYA 4W6ZA 1WHTA 2PWPA 4X00A 5BSUA 5KSZA 2ZUDA 2RGNA 1SBCA 1BCSB 2RHCA 5LWHA 3R44A 5DO9A 2DGDA 1SCUB 3ETEA 2QM8A 4K87A 1EGVB 1VL1A 3LZCA 3RF6A 3FKJA 5KSYA 3KB1A 1HRDA 2AF3C 3WL6A 3KQHA 3A37A 3EUFA 2A84A 4FGLA 4LRTB 4GLBA 3RTDA 1JEAA 1VL5A 1D1PA 4ZGGA 3LRTA 3LY5A 3AM4A 5JS1A 1LPBB 2NT3A 3EF0A 4PLZA 2CBZA 3EDMA 2NP6A 3LU1A 3OEWA 2Q99A 3HP1A 1J1IA 1XAHA 3FGZA 2X4GA 4D74A 1PN3A 1JEYB 3EZGA 5HIKA 3Q6IA 1W581 1E2UA 2AFIE 4JSTA 2O5VA 1DTWA 2SKDA 1NJ5A 3GFBA 3ZE7A 5AW5A 4JT8A 2J9YB 4RDXA 1JWBB 3LC0A 2ZAYA 1XJCA 5FCDA 2QLNA 1D0SA 1Z0UA 2OM2A 4LGYA 4M86A 3HJGA 3V00A 4A1OA 2A9RA 4WWHA 2YJZA 2JCXA 4GI1A 2I6FA 5FBQB 2PX4A 5C8YB 1GXSB 2YJ4A 4EW6A 5P8WA 4YDQA 1NW7A 4CM6A 5K8UA 2QY9A 1JEQA 5I9LA 1M1YB 4MGKR 2JZOA 3K1YA 3RYIA 3G7UA 5IVDA 3OU6A 5E9JA 3O4IA 1Q20A 2LXNA 1S3GA 3W3AA 4HSGA 5AK3A 5HG0A 1EYZA 1HETA 1ML4A 2HSZA 4MLCA 3BJZA 3BIOA 4PCUA 1CNMA 1PJZA 4IIFA 2C3PA 3O3CA 5KNBD 3BEDA 3S2FA 4F72A 1NAIA 4AL4A 2VRBA 1YA6A 1Z34A 1N2OA 4TRMA 4QOGA 1GA4A 4MVYA 4Q0MA 4DGQA 4EFKA 4RZ3A 5CCXA 3GFVA 3JAWA 4LF8B 3B8EA 1MOPA 1U2PA 1TMOA 2B7BA 2XYPA 5DMHA 2K7FA 4EOGA 5E2BA 1DIGA 1Z4IA 3TSZA 1GZ7A 13PKA 1KOFA 2XD9A 3CR3C 3PC6A 3VNSA 2O8CB 5AVQA 1E0SA 2C07A 3MM4A 2CVFA 5AJYA 4RD0A 4PZCA 4CJXA 1H93A 1WVMA 3QLVA 4TS4A 1JZSA 4KEAA 4C4RA 4C29A 2R11A 4INOA 1CJMA 4HNTA 2PVPA 2D8MA 1HT1E 1QFYA 3T3NA 3PNSA 4I4TB 3C7AA 4W4TA 1CNEA 1OI3A 4ZYZA 4DS3A 3FYUC 1Y89A 1SC9A 1TIKA 1E8DA 2IPNA 4X1KB 4KXMA 2R7AA 1Z2EA 3GB9A 2B1IA 1QOZA 3IQEA 4ZCLA 4EJMA 2C98A 2Q5IA 3NYRA 4ID9A 4QXQA 4FUTA 5FPHA 2P9ZA 2QTMA 4Y2PA 1P1KA 1QKJA 2G9UA 4J0GA 2TMDA 2A14A 1KEVA 3H6GA 4WFJA 3CBGA 5LLTA 4EDHA 3SOZA 3TGPA 1C9DB 2J9GA 3C4JA 4QUGA 4RK5A 4BRZA 1X92A 1JKJB 1R9MA 2XVXA 3H8SA 3DB2A 3IUSA 1S01A 3PFKA 4GEKA 1DAHA 3FTCA 4WCFB 4GOJA 3ZXSA 4Q1BA 1XVIA 1N2HA 3TBHA 1PU2A 3K5HA 4BP9A 2CMGA 2Q4BA 5GV8A 2YNMD 5FV4A 4NF2A 4YMWA 1GFZA 5JSZB 4Z4FA 2YJ6A 3KLPX 4Y1EA 3I0NA 4B8ZA 2Z98A 2M6SA 1KQOA 2EWMA 1ZAKA 4E31A 3OPNA 2BTQB 2J6HA 3RFFA 3FOEC 5CU7A 2HBRA 5LB4A 2BR3A 4Q3DA 3GRRA 2PNJA 5ERXA 1Q1BA 4ADSG 3I62A 3URKA 3ANLA 3FN4A 4M2LA 3STUA 3T41A 2JJ1D 3GUVA 1X1BA 1F4PA 3H18A 3WLOA 5K05A 4BNLA 3A06A 4UZFA 3MS2A 5E8JA 5CFOA 1G6OA 3IIIA 4RJIA 2HOQA 4L3OA 1J8QA 5L3SA 4E6EA 4EHIA 5I7UA 5KOIA 2YJ5A 3DEJA 1XP5A 3I04A 2VDNB 1X1CA 4QREA 4B81A 1HA3A 4FGZA 1KYVA 1LKZA 1DQSA 4RHEA 1FZTA 4H7FA 4L9SA 1CE8B 3FVTA 2CZQA 4RNCA 1BFDA 3S2UA 2HEIA 1FFSA 1H2YA 1KDRA 1I4TD 1UP7A 1YRYE 2X0KA 3F2VA 4HJRA 3EXAA 3DMYA 1DG9A 2VQ6A 4XIJA 5C34B 1JU3A 1XMSA 2Q2NA 1FYXA 1OIXA 4D4HA 5D3MA 2RGNC 5CAEA 2WU0A 3TMAA 3R6TA 3E7WA 3P94A 1AQIA 3EXHC 1X8KA 4RA9B 4DVGA 5E7IA 1JDTA 5C80A 1ODLA 5J47A 3O8QB 5HILA 1M0EA 4OLJA 2W71A 1G2IA 2E4ZA 2ZRGA 3A32A 5MF6A 4HDRA 2QP9X 1OLUA 2GEBA 4I8XA 1YB1A 5JCOC 3GLFA 4NY1A 4L9AA 1YS4A 1ULHA 2QK4A 5IYZB 1G3UA 4I50B 4FN4A 2IOHA 2JKVA 5EKUA 4HGNA 3RROA 1Z37A 3A11A 3EIXA 4BLQA 3F9RA 4J0IA 4TLDA 4V39A 4M4SA 1MOZA 3U7EB 3AEXA 2DTXA 1E3SA 1EWRA 3ORFA 1V4VA 2PH5A 1ZL2A 3CVYA 4F4FA 2GBFA 1FA9A 1JXAA 2YQZA 1S8OA 3OLVA 4HQNA 5K5EA 5LKAA 3P9ZA 5BUZA 1PSDA 1C9NA 2BY4A 1Z08A 5BRJA 5JBNA 3DZ8A 4CQJA 2P7IA 2ZT6A 3DDZX 4UEWA 2CKMA 2BI7A 1N3YA 4BC0A 3IV6A 1RLMA 1S8NA 1CCWA 5FEUA 1DSSG 2Q9UA 3W2TA 5AI8A 1QWSA 3DDHA 3W7AA 4AUNA 2A67A 1WMEA 3M83A 3WNBA 3TSWA 1SWVA 2EDAA 2R00A 4OCZA 3H9GA 2YFKA 3I5YA 2RCNA 2O8DB 2F1HA 2HQ1A 1RLUA 2X8JB 3MRVA 1QS0A 3D1JA 3D5EA 5FP0A 2HHJA 3FWNA 5AOAA 4QLAA 4GGMX 4HH3C 4HX5A 1W29A 4DEXA 2YTZA 4YQEA 3C5EA 4ALLA 1XXHA 3TUIC 1TJ5A 2OC9A 1ORTA 3I64A 2DPLA 3VPDA 3GVHA 3A1DA 1KYZA 4MS4A 4Z9YA 2ZBPA 4C7VA 3EDCA 1RZRA 1JP7A 4DIEA 3TZBA 4GHWA 3IFSA 3R6GA 2PGJA 3RVJA 3VBEA 4FKMA 4LV5B 2P5SA 3NALA 2O2HA 4JU8A 1ZD5A 1PJQA 1SCAA 3G0HA 4HXEB 3HDYA 1HFJA 4AMUA 1XHFA 2GHIA 4UBKA 5CW2A 2HJRA 2NU7B 3WKEA 4GKKB 1VPLA 3OMLA 3BILA 4CKYA 4CV0A 4MI9A 4TLBA 2HMTA 3BRCA 4ZZ1A 4BCCA 5ICMA 3E15A 4CQMD 1PNQA 3GRYA 3L46A 3MZ0A 4KK4A 1K8QA 1POXA 1D1SA 3QLVC 2H1FA 3OF5A 4WVLA 2I1WA 1XRSB 2WF6A 1RCFA 4G6ZA 2O2SA 4KE9A 4TVBA 3FZQA 4QSHA 4KKXB 3X1XA 4S05A 4LFAB 4WK2B 3T1YB 2O0MA 3PFCA 5IEJA 4WKOA 1MB0A 4XW2A 3DXFA 1L5GB 4MWGA 4KYTA 2BAGA 4WZBB 1YMVA 4F3CA 2I4IA 1Z7WA 4Y2HA 2HPHA 3ML1A 4JEMA 4CUJA 1KK0A 2XQJA 4YLGA 2ZIVB 4I55A 5EJ2A 1QSGA 2Q41A 1OIWA 1L1RA 2ZXFA 4O08A 5EJEA 1OZFA 3HJFA 3NT2A 1NZJA 4A1FA 1JDPA 5K99A 1V41E 4DJAA 1J25A 1RAFA 1QYWA 4GMHA 3S81A 3SDBA 1IEWA 1XROA 1P1CA 4HLDA 3PC8A 3D5TA 3WK4A 4ZYYA 1NBMD 4HQ6A 2AL7A 3L0CA 4GXNA 2DERA 3NJ8A 5ICSA 1AD2A 1IK6A 1EB8A 2I4OA 2HCTA 1WCXA 4JZKA 3LHKA 4ZVTA 4D0SA 2BDUA 4K2HA 3RRFA 5JSUA 1XCPA 2BFBB 2WYOA 4RKQA 3KYDB 2F1IA 5CFPA 4Z99A 3HS3A 4G85A 1QDUA 1E1QA 1NDHA 2GAJA 4AICA 3V4SA 3VNRA 4KQJA 4HV4A 1IB6A 3PCRB 3S4YA 3L6EA 4OBEA 5ESRA 4IX9A 1UK6A 5HBGA 3QVKA 3LKDA 2E7ZA 1YCGA 3MSXA 2ZJ1A 2C29D 4KDEA 2ZJ6A 4GGPA 1TECE 3EFOA 4OLHA 3B9QA 1CUYA 2XGGA 3KP1A 1FLNA 4RKRA 3UHFA 2HNAA 4JLUA 2DBVO 4U6QA 3QXCA 3NQ41 1UADA 4F96A 4YUYA 3HZZA 3GRKA 5AKKA 1LRJA 4UREA 2J7KA 1WTCA 2JEYA 1G8HA 2X2OA 3OWXA 4G4IA 1NE7A 1XEFA 3BDIA 4K6GA 1E2LA 2P5UA 4UMDA 4HOYA 3V5NA 4XWTA 4J0CA 4XJXA 5KSOA 2XJ9A 1K3UB 2GHTA 1QIJA 3HYRA 2C88A 1JTFA 3URMA 4CF6A 1Z8HA 3P52A 1G5TA 2BFEB 2FSVA 2BEVA 5EZYA 1U9JA 3ZZ1A 2PGAA 5BSEA 3RQIA 2ZSJA 3ACDA 1M8GA 1ZM4A 2PRSA 3T1VA 4UQPA 1DVRA 2OT3B 2HL6A 2BUCA 2RHMA 4XGRA 3OZGA 4I9HA 4JHLA 1N2BA 3LSTA 4RYLA 3S40A 1WE2A 4C14A 1EUDB 3I09A 4WOBA 4JYZA 2BI8A 3WK5A 5FOTA 3NWJA 4DV6B 1QGDA 2J9XB 2Y0CA 3Q40A 3QXSA 3T3IA 4HNAA 2WUVA 1Y5LA 1DWPA 4X1OA 3WE7A 4WBNB 4US0R 3F7NA 1ZVVA 5HM8A 3RVPA 2W2NA 4V3CA 4DWVA 5KYXA 5AOCA 4N6NA 1JDVA 1E3EA 1N5RA 4KO3S 4E1AA 2FLWA 3E7XA 4K26A 3LT5A 4B3SB 5LU8A 2NLOA 2QZ9A 3HA2A 4ENUA 3AI2A 3GLRA 1AUVA 2Z2JA 3AP3A 2R00C 2RCYA 2RAUA 5COBA 4XYMA 1W6UA 3H11A 4M9QA 3R0XA 2Z2KA 2CB0A 4JJ7A 3K0AA 4FN5A 4AZ0A 3R5HA 5CLFA 4Y1RA 4RIHA 1R0XA 4HT3B 2G36A 2QWXA 1MB3A 1KK3A 3P2MA 1MIOB 3PF9A 1K75A 2RHGB 4OUKX 4PZEA 2ETVA 5IU6A 4OQEA 3I9JA 3C6BA 2WVGA 1CEEA 2HSWA 1H2BA 1L4FA 2MMGA 2XGMA 4OHFA 3KBBA 2JVKA 2YVQA 4NK4A 4EG3A 5LWQA 1MZVA 3IPLA 4UAUA 1U0HC 2GF0A 3FVWA 4FOTA 5AOVA 5EWMA 5IM5A 4MWEA 4BLTA 3ICQB 1NRWA 2QXUA 1YVUA 2NZJA 3ZE9A 4EENA 4HPJB 4RESA 3KLNA 1SUWA 2VATA 4JQCA 4MUYA 5GOZA 3O7MA 2GWRA 3HLKA 3OX2A 1P0QA 3LW8A 4NPAA 2GZMA 4E5MA 1P1JA 2JFOA 3X2FA 2GR9A 3PXUA 3Q98A 2FPMA 2YWRA 3EIHA 3PDHA 4HVAA 3WGOA 1G63A 1P2GA 4E4YA 2H2WA 4BCDA 5LU9A 3I45A 4ND1A 1CHDA 3H86A 2VG8A 4ZQHA 4BV3A 1N78A 4KWIA 4D3FA 1QQBA 3TTWA 4TKMA 1VBNA 3ZE0B 221PA 2JF0A 2F9LA 1T24A 2UZIR 1ZR2A 2Y4NA 3KYBA 5HGJA 3M4JA 4Q24A 2PPVA 2H8GA 3DMGA 1KKLA 5FI3A 2M9MA 3PHJA 5J2TA 1JYEA 1GGVA 3QLUC 1UMBA 5EJMA 1YV9A 2DMRA 3S2YA 1YC2A 1QLHA 2QRNA 1CZNA 2WJ3A 4FJ1A 4UD6A 5I3ZA 4HCJA 1A71A 4PX3A 2R8PA 1I2DA 5DNVA 1E1RA 2Y1CA 3G0CA 4ACBA 4KKVA 1NG1A 1G7RA 5EFOA 3PHBE 3CZ5A 4JP3A 4DRZA 2JGFA 2RG7A 3AEYA 1KPHA 3FHTA 1D2NA 1EB9A 1F2VA 2G82A 2JFVA 3A27A 3HO6A 3LFTA 3PC7A 2A5FA 3A04A 4XB2A 3OQOA 4BNFA 4FE3A 3VC2A 4KDRA 1LC0A 1YTLA 3DXXA 1W0KD 3NYQA 4M8NE 4OMFG 5FPTA 4YCCA 3SN6A 5IT5A 5KTTA 2F67A 1AHIA 3HCBA 4IJVA 1QONA 3ZIAD 1Z62A 3JQCA 5EMNA 1H1LA 1U1DA 2WWHA 3W1EA 1U3UA 1H2WA 5CDHA 1MORA 1Q7BA 4FB4A 3N0WA 1SBZA 1RYHA 2BIFA 2P1RA 4X71A 1J9ZA 1NVDA 4YWHA 2KWIA 1U1CA 2PSSA 3E7FA 3PWKA 2FEPA 3G0IA 4BE9A 5LKRA 4ZZIA 2XIQA 3LC2O 3OUZA 1KH3A 4HZUA 4Q9HA 5JS7A 3E8SA 4C89A 2VTBA 2PUDA 1L8QA 4Y2TA 5CT9A 4BNMA 2BGMA 4BN4A 1AXGA 3ENNA 3HRIA 3BFKA 4ZAVA 3SFZA 1WL8A 1GZUA 3C43A 4CM8A 2VTVA 4EJSA 1B93A 3UKJA 4S1VA 5KREA 2YZ2A 5BSWA 4HMOA 1BMFA 2NU6B 3TZHA 1I80A 2I6SA 3HJCA 3OOEA 1D7OA 3RC8A 2ODTX 3SY8A 1GRCA 1IEQA 2DBRA 1LLFA 1B0ZA 3ZEAA 3ZD7A 3FOAA 4Q1VA 2J4FA 3PICA 4DMLA 3MWYW 4FR0A 1LV8A 3M4XA 2I54A 2QRUA 2ZQZA 4ZT4A 4D99A 2G0AA 2PZGA 2XLBA 3FSGD 1YASA 4G5QA 1Y1RA 4IVPA 4MWOA 3ETHA 3BTOA 3ELUA 4B74A 5BWBA 1XEXA 2IEAA 2O3JA 3C24A 4N01A 3DA8A 3C1UA 3FLBA 3MJFA 3R7WA 3RAGA 4IIBA 7MDHA 1C14A 2WU3A 3KG2A