3A3TA

The oxidoreductase nmdsba1 from n. meningitidis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
193
structure length
193
Chain Sequence
DDDKAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAHLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTAFDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the oxidoreductase DsbA1 from Neisseria meningitidis
pubmed doi rcsb
molecule keywords Thiol:disulfide interchange protein DsbA
molecule tags Oxidoreductase
source organism Neisseria meningitidis serogroup b
total genus 73
structure length 193
sequence length 193
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3a3tA00
2H0GA 2L59A 4MA9A 1GNWA 2IFQB 4NWYA 2P31A 5GAND 1R26A 3HA9A 1ML6A 3PGTA 4OFTA 1B4QA 2H6XA 4ZBBA 2OJLA 2H1AA 1NHYA 1MEKA 3Q74A 4CDOA 3W6GA 2EIOA 3F4SA 1IYIA 4IQAA 4PQ1A 5JWQB 4K7NA 2V6KA 3FHKA 4OO5A 5F07A 1JHBA 2IFQA 3IC4A 2PUKC 3GMFA 3QR6A 3F63A 2V1MA 3DXBA 4NPBA 3TJGA 2R2JA 4LMWA 2X99A 3MDKA 3IAS2 2VLUA 4N0ZA 2RM6A 5IQYA 1K0MA 1V40A 2OE1A 2TRXA 2X8GA 1TI3A 3LORA 5F05A 3UBKA 2YJHA 5IMFA 1XVQA 3KMOA 4ECJA 2H0IA 3F6DA 1V98A 2IMEA 1A8LA 1EGOA 3DKSA 1QFNA 1OC9B 3ZMLA 2HE3A 1O6JA 1SKSB 2JSYA 1OYJA 2I4AA 2CVDA 1SK2A 1SL2B 4WF4A 1SD9A 5ECOB 4X0XA 2Z9SA 3IHQA 2AYTA 2A2SA 2H19A 4NHZA 3HDCA 3TKSA 1XVWA 4GSNA 1C72A 1Q98A 4XRAA 1ZZYA 4MF6A 4IJ3A 5F8BA 3VK9A 2J23A 2XBQA 3TB2A 4Q5QA 4PX1A 5IMDA 5KN1A 3P8WA 5ECIB 2OBIA 2FWGA 2QSIA 4OCEA 2H70A 1BEDA 1Z3EA 3F3RA 5DQYA 5J5NA 1OE8A 4WBRD 3F0IA 2GQLA 1NM3A 6GSTA 1XCCA 4FIWA 1OE7A 4I97A 1WWJA 5G1KA 2C0FA 2VCQA 1A23A 1PGTA 2F8AA 5DJLA 5IMAA 4PUFC 3GL5A 1RK4A 3CTGA 5D8IA 4ZB8A 2IWTA 1XW9A 3LFLA 2YWMA 1WIKA 1XWBA 5B7CA 1AQWA 1ZOFA 2KUCA 1WJKA 4NMUA 2NPBA 1PKZA 2YNXA 4GSSA 2VAFA 2HT9A 3NIVA 2B3SA 5IPHA 4OD7A 1GRXA 3IPZA 2YV7A 3KGKA 1AC1A 2OKAA 4HZ2A 1DE2A 2G2QA 3ZRDA 2FUG2 2PPTA 4I2TA 4Q5NA 1H75A 2B5XA 2C0GA 2YN1A 3PR8A 2IMFA 3GURA 3KJYA 3D6IA 4XHMA 3GUSA 3KEBA 4F9ZA 3TRXA 1N2AA 1KBNA 4POKA 3I43A 4HUAA 1BQ7A 4TR0A 4AGSA 1SKRB 1U88A 2B6MA 2LQOA 2HZEB 12GSA 4O7HA 5B8BA 2LTKA 1K0CA 4PGTA 5CYYA 2P0GA 1X5DA 2X8CA 2HNLA 2OE3A 5HR2A 10GSA 4TN8A 4FYBA 2L4QA 3M8NA 2DJ3A 4GLTA 3H1NA 2GZPA 4KGIA 5JWOB 1QQ2A 1SENA 3L4NA 3TKSE 2KP1A 4EO3A 2HZEA 3VPTA 4PUAA 1K3YA 1UN2A 1O7UA 4ACSA 3QAVA 2JADA 4KUNA 2PVQA 2YOIA 2MMOA 2VL3A 2PWJA 4O92A 1IYHA 2LJRA 3A2XA 3UIWA 3HCZA 1JZOA 2I9HA 2YPMA 4XS1A 5IMZA 4OFNA 4OFMA 4BWQA 1T1VA 3G9BA 4HS1A 4KSMA 3DRNA 3MWHA 3FRCA 4TR1B 2B1KA 4I6XA 1X5CA 2CAIA 5C04A 7GSSA 4V1Ag 1FB6A 1YKCA 2TRCP 1MDJA 3FYGA 3IK9A 4POLA 1HNAA 2AV4A 1XBSA 4MZBA 5J9CA 1M2DA 3RDWA 5HQPA 1VRSD 5JCGA 4XS6A 2WRTA 5ECKB 2JZSA 5KN0A 2YWIA 1A8YA 2CV4A 2GVPA 1U3AA 3MNGA 2L5LA 3RPNA 4FO5A 2FCHA 3J7Yk 3DIEA 4XS4A 4G19A 3DGQA 1ERVA 2HRNA 3DVXA 3EYTA 3KH7A 3G7IA 2ES7A 6GSYA 3QCPA 2VD0A 3BJ5A 3N5OA 2DLXA 5E59A 2K8SA 5DCGA 2N5BA 4K9ZA 1SYRA 4IBPA 1THOA 3GL3A 1E6BA 4YAPA 4GCIA 1GSEA 2XC2A 1DUGA 1FG4A 1M2BA 2V6OA 4MH3A 1T3BA 4RQRA 1THXA 5A4WA 4KB3A 2WFCA 19GSA 3CYNA 1ZYQB 4BVXA 4GTUA 1TI1A 1ERWA 3FR6A 3G7YA 1CQGA 3ZIVA 2L6CA 5FHIA 2E2GA 2VLVA 1K0BA 4DEJA 4HQZA 2PMTA 2D2ZA 4MH2A 5D9VA 3SWLA 1TU7A 3HJPA 4AJ7A 2WCIA 2MMNA 2ON5A 1U6TA 4ZB9A 4BWSA 1G7OA 3QAGA 5LCZA 2F3MA 5EY6A 1F3AA 2YANA 4KDXA 4E8EA 3ZFBA 2OADA 4LLRA 3TKPA 4WR5A 5L71A 1GSYA 5HR3A 1LU4A 1Z7PA 2XPDA 4GQFA 1HD2A 3GV1A 1TJDA 3L9UA 3EWLA 3LQ7A 4ISDA 1URMA 1XWAA 2HLSA 5CNWA 1GSUA 5GSTA 2WZ9A 2PU9C 1T4YA 4K2DA 2IIYA 2L5OA 3WYWA 1WE0A 3APQA 3QDNA 2IJYA 1SJIA 4F2IA 4TXVA 3F4RA 2N5AA 4WXTA 1V9WA 4ECIA 1JLVA 3GX8A 4JR6A 3JCML 1YQ1A 4RI7A 1AXDA 3H8QA 6GSXA 1QK8A 1EWXA 1TRUA 3IOSA 5HFKA 1AW9A 3C8EA 1TW9A 1Y6EA 3L9SA 5GZZB 1XWCA 4ML1A 4ZL8A 5IIZA 3TJBA 2V32A 5AN1A 4L0WA 5HFIA 5G31A 2CZ3A 2RUEA 2C1YA 2GGTA 1GTIA 3D4TA 3LWAA 1X9MB 1PD21 1YEPA 8GSSA 6GSVA 1SJZA 3H93A 4Q5RA 4NHWA 4HU9A 1B9YC 2JL4A 2IL3A 2CX3A 4DSSB 2XBIA 2PVOC 5DVBA 1OKDA 3D21A 4QL9A 1AAZA 1M7TA 1OC3A 4ZIJA 4MPFA 5EPFA 4ZXGA 2B7JA 3UBLA 4AJ6A 11GSA 5EL8A 4N11A 1Z7RA 2CVKA 1SL1B 3P7XA 5AIVA 1BG5A 2RM5A 3PINA 1EOHA 3IXRA 3LEFA 1TDIA 5B6NA 4YQUA 4TRXA 1GLQA 3QOUA 4H86A 1SL0B 2FNOA 4K7OA 1FHEA 1XWGA 1U87A 1XW5A 5IO2A 1HNBA 3IE3A 4I2UA 2GQKA 18GSA 3GHAA 3M1GA 2LS5A 3GSSA 3FZAA 3FK8A 4MK3A 5CP1A 2ZUPA 2H1BA 4MABA 3O76A 4N30A 3WGDA 4IS0A 5G30A 3O3TA 3GYKA 2DIYA 2GZYA 2OE0A 4MZCA 4X1UA 4JBBA 4F03A 3Q18A 5F0GA 1EGRA 2B5YA 1GL8A 2VL9A 1S3CA 3HVVA 1MD4A 5FWGA 1EV9A 3CXGA 3TKQA 2DBCA 4L0UA 5GAPD 2GSTA 1OC9A 3LXZA 3P90A 3D22A 1X5EA 4QQ7A 1Q4JA 2MBSA 2PGTA 3QAWA 4KAEA 3GKNA 3R2QA 4RUVA 3KP8A 4HJMA 1QUWA 3ME7A 4K7IA 4TVEA 4EDYA 4V2NA 1JLWA 5CAXA 4K0GA 4TW5A 4MLYA 2VCZA 2X8HA 5H5RA 2B5EA 4IELA 3PH9A 4G2EA 3M0FA 1TKDB 2H72A 1QGVA 4WEYA 3U6VA 1PL2A 2FWHA 3CSHA 4OWYA 4YH2A 2CVBA 3M9KA 4WKWA 3VI5A 1V58A 6GSWA 3ZFLA 3Q6OA 2B1LA 1E2YA 3H79A 5AISA 2HSHA 4PXOA 2LNSA 2C3QA 3K8NA 3HVSA 3GA4A 1K3LA 4EKZA 1USBA 4ECCA 1RQMA 1ZMAA 3QPMA 3VFIA 4K1FA 2QKEA 4LMVA 1BYEA 1GTUA 3DYRA 4O32A 2R37A 4GXZA 1DE1A 5JWRB 4WBJA 5ECMB 2VM2A 3TRPA 3A3TA 3GN3A 4IN0A 5ECPB 2FA4A 2DMLA 3RPPA 1A0RP 2V2GA 1G0TA 3UOMA 1T7PB 1GSFA 1G6WA 1Z6NA 3EC3A 2GT5A 2H75A 3UEMA 2C3NA 2VL2A 3HZ4A 2YZHA 3HD5A 1PKWA 3F9UA 3TJJA 3ZZXA 4WETA 4FYCA 13GSA 3WGXA 2MZCA 2WULA 1K0OA 4XCSA 2CQ9A 4HQSA 3FKFA 4JR4A 1Z9HA 2RIIA 4MJBA 4EF0A 3ZTLA 1OC8A 2K18A 2XHFA 1KNGA 3IK7A 4EXJA 3L0HA 1ILOA 1BX9A 5IOWA 3KMNA 1EZKA 1WPIA 4IVFA 4AJ8A 3VWVA 2YJ7A 4JU5A 3CSJA 5A4VA 1PX7A 3TJFA 5IMVA 3KIJA 1M9AA 3ZVJA 3E3EA 4TKYA 2LKUA 2VCWA 3OR5A 2O8VB 3NOFA 1EP7A 5GSSA 1K0DA 1VF3A 2REMA 5D9XA 2LSTA 3H4KA 3TDGA 1S3AA 2LRTA 3BOAA 3ERGA 2GZZA 2GTUA 1YF0A 4L5LA 1GTBA 4JE1A 2MYGA 4F82A 2PBJA 2DSAA 4MJEA 4KDYA 4N0VA 1M9BA 4KA0A 2OA7A 1OAZA 1W89A 1EV4A 2B7KA 1NSWA 1WRYA 4KCAA 4GSTA 2AJQB 3KCMA 3RHBA 5H5QA 3F8UA 4V2LA 2LUSA 1F37A 1FVKA 2O89A 4X43A 4QL7A 2E2MA 3TKSC 3MAKA 5A5KA 4HEA2 3M3MA 2A2RA 2WB9A 3L78A 1JZRA 1I5GA 3CTFA 2NBSA 2IPAA 2HFDA 3A2WA 4NXIA 4POBA 3CRUA 4CHSA 3VURA 1AIUA 2WGRA 1M99A 3GTUB 1TK8B 4LL1B 3VWWA 3UJ1A 4KSOA 3C71A 3SBCA 5CREA 3TOTA 1VGLA 1T8EB 4GF0A 1WOUA 2TIRA 3N9JA 4LA1A 4PNGA 1YDKA 1B8XA 5D93A 3U5RE 3TRQA 2HRFA 3GH9A 4TR1A 2K6VA 3HXSA 5B8AA 1O8XA 3BBYA 1ERUA 5J41A 4GQCA 2GSSA 3IA1A 1R5AA 1XOBA 3ZIJA 3GTUA 16GSA 4ECBA 1NHOA 6GSUA 3GSTA 2YWNA 1CQHA 3ERWA 5IO0A 2R6KA 3LYPA 1YEXA 2A4VA 1XPVA 2JZTA 2OACA 1TTZA 1T4ZA 2IMKA 3GNJA 5ELAA 3C1SA 1FOVA 3HHVA 1TU8A 2VIMA 4FYUA 2F9SA 4ID0A 3GKKA 5F06A 1X9WB 4D73B 4PQHA 2H76A 17GSA 2M72A 4J2FA 1ERTA 1PA3A 1JZWA 2P5QA 2FY6A 3D5JA 2F51A 5AGYA 3FZ5A 4IGJA 1YF1A 3LGCA 5IMCA 5COHA 1S3DA 3HY2A 3TUEA 2LEGA 3GRXA 1U3IA 3P2AA 3IDVA 3DMLA 4O5RA 4D73A 3E9JB 4MJCA 3HYPA 5G5FA 2VCXA 3D0ZA 5ENUA 4YAVA 2LQQA 2HYXA 2C0EA 2L6DA 4KH7A 2GS3A 5ECLB 1N8JA 2C3TA 2FA8A 4TR3A 1TP9A 5G2ZA 4HZ4A 1A2JA 4MF7A 2FWEA 3UVTA 4JRRA 4IP1A 1M2AA 3Q19A 1K0NA 4EUYA 3VPQA 2R5GA 1A24A 2C4JA 1Y25A 2DMMA 1FW1A 3W8JA 3ERFA 3NZNA 1WP0A 3UVHA 3FZ9A 2JSZA 1F6MC 1ST9A 20GSA 1K0AA 2CA8A 3V1WA 1J08A 2MMAA 2HZFA 4MMMA 3WD6A 4MDCA 1TRSA 2E7PA 4MPGA 5ID2B 2LRNA 4NV2A 1VF4A 4P3YB 4FH8A 5HFGA 3VWXA 2H01A 3ZVJD 2H66A 2MBTA 3QFBC 3J7Yb 3ZYWA 1O85A 2H30A 3HKRA 1TOFA 2ZNMA 2JU5A 1JFUA 2DC5A 1H4OA 3S9FA 2O85A 1GLPA 4XRDA 5DQSA 2WDUA 3HJMA 3I9V2 3US3A 4KNDA 3LXTA 4XTSA 3KP9A 3HJOA 1UC7A 5IM9A 5ID2A 3GH6A 3BCKA 2H8LA 2H73A 1EEJA 3LG6A 5ECNB 1F2EA 2J9HA 3ZITA 2FLSA 3AY8A 4I5QA 3WT1A 2BJXA 4DSSA 2LJAA 2M80A 1BAYA 1F3BA 4F0BA 1GUHA 5JCWA 5ECHB 1PN9A 5LNKe 2XPEA 5EVOA 2HI7A 1SYXA 4XIHA 6GSSA 4BA7A 1SK0A 4IP6A 5AIXA 3QMXA 3KD0A 4MP4A 1Z5YE 1XWKA 2H1DA 1AQXA 1SD8A 2CX4A 2DIZA 4ILFA 4NV5A 1BJXA 1OKTA 4I8BA 1MTCA 4J57E 3CMIA 4JZQA 4V1Ap 3EMXA 3C1RA 2ON7A 1KEBA 4GRFA 1GSDA 1O8WA 4Q5FA 5DALB 4BPYA 4RI6A 4G9HA 1SU9A 2QGVA 5HR1A 1FB0A 3L9VA 2G0FA 5D9WA 2EIQA 3KM6A 3IV4A 3FEUA 4KCEA 1J9BA 1ZL9A 3IBHA 4DSQA 4F0CA 2FGXA 1B4PA 4LL4B 2DJ1A 2VCVA 5INYA 4ZL7A 1YJ6A 1YY7A 4EVMA 2YV9A 4BVYA 1YKAA 3APOA 5DALA 4ZL9A 3MSZA 2PN8A 3E0UA 5LD0A 2NVLA 3C7MA 2L57A 5ECQB 1PQNA 3A2VA 1G7EA 2O7KA 3I69A 4K0NA 5DCHA 4GWRA 1R7HA 1G6YA 2R4VA 3GKMA 4PNFA 3QFAC 2IMIA 3ZREA 3WGEA 3FZ4A 4OO4A 2EIRA 1TRWA 4E8HA 3BD2A 2H74A 1ZGNA 3DVWA 4ZILA 2DJ2A 2H6ZA 3EURA 3IR4A 1R4WA 4L5OA 4TR4A 3KTBA 1GNEA 1SK1A 3UL3A 1Z6MA 1XFLA 2YZUA 2VD1A 1B48A 2NTOA 2FWFA 2RUFA 1SKWB 2MMZA 2GDRA 3TKRA 4HDEA 1EOGA 4IHUA 2CAQA 1DBYA 1UVZA 2WJUA 2YWOA 1XW6A 3M9JA 2LJKA 1GULA 3EINA 4WF5A 2I1UA 3BCIA 3TGZA 2VUPA 3ISOA 3EU3A 3FR3A 5ECSA 1LJRA 2VM1A 1MDKA 3FR9A 2X64A 2O87A 2BMXA 4K6XA 3ZL5A 3EU4A 5B6MA 1PMTA 1YZXA 2YCDA 5D9TA 1ON4A 1ACVA 1KTEA 2C80A 1X9SB 1OVNA 1GUMA 1TXXA 4EDZA 2JZRA 2CT6A 1GWCA 4MCUA 4ZBAA 5H5SA 4JEDA 2IN3A 2AAWA 4KDUA 1O81A 1VF2A 3EVIA 3WT2A 2CZ2A 2NDOA 1I9DA 1GTAA 4ML6A 1AQVA 1X0RA 3A5WA 1HQOA 2I81A 2F8FA 4PURA 1R5PA 4EE0A 1A2MA 3EE2A 4K8MA 3CBUA 1GSSA 2ZCTA 4YQMA 4V2MA 3GKXA 1TK0B 2H1GA 4YQVA 4TOPA 1VF1A 2H71A 3FW2A 2KOKA 1FAAA 1A2LA 2OBKA 1K3OA 5A4UA 3F3QA 2K9FA 4NAXA 1PX6A 4HJ2A 1F9MA 5ECRB 4HOJA 4ZBDA 2VO4A 2GQMA 3ED3A 4IW9A 1TRVA 4MJAA 2VOCA 3KXOA 2DJJA 5JCUA 4KE3A 5C00A 2JACA 1PSQA 5DAKB 4KW6A 2YP6A 4PQIA 4CW9A 1XZOA 3UAPA 1FO5A 3CSIA 1A0FA 3KZQA 4ULXA 3GX0A 1T00A 4L8EA 2H6YA 2WS2A 2LNTA 5CRHA 1HYUA 2KP2A 3DEXA 5J4UA 22GSA 5ELGA 2FD3A 4XS4B 5KEJA 1GUKA 1J0FA 4HU7A 2K8VA 5DAKA 1V57A 3TOUA 1JZDA 3EMPA 1HNCA 5G5EA 4G10A 4IQ1A 4WR4A 5KN2A 2GT6A 2VCTA 5HR0A 1V2AA 3FY7A 3KTLA 4J56E 3W8SA 3ZLPA 3F4TA 4Z7XA 4OCFA 4ZB6A 2AHEA 5CRWA 5ABRA 3VWUA 2FHEA 3UMAA 4RQXA 3RBTA 4EL1A 4EC0A 3O6TA 3DD3A 3LYKA 2KHPA 5DJMA 2R3XA 2VLTA 2V41A 3APSA 2BTOT 5FT3A 1RW1A 4N10A 3LJRA 4POMA 9GSSA 3RHCA 5KN3A 3F6FA 1NW2A 1TK5B 2PERA 3G7JA 3ZMKA 2VL2C 1EP8A 14GSA 1SJ6A 2LRCA 2H0HA 1QXHA 2QC7A 1ZYEA 2HXKA 1LBKA 1GSQA 1FVJA 2EC4A 3QD9A 2E0QA 4MF5A 3GFKA 3VLNA 3RAZA 3UARA 5J9BA 3HVXA 5E4WA 4OMVA 4IJIA 5IOXA 5D73A 2IMDA 3CRTA 5D96A 1WMJA 3TJKA 2GLRA 1AUCA 4TXOB 2GSQA 2DJKA 1MDIA 2HSYA 3HZ8A 4AF2A 1ABAA 2C0DA 4MZWA 3IAM2 1DSBA 2LV3A 1B9XC 3GIXA 2N5FA 5CRDA 1MD3A 5IPGA 5G1LA 2AUVA 5CO3A 4HI7A 4DSRA 3IRAA 2ALBA 3KH9A 2C8UA 1PL1A 3DWVA 4TXOA 1UA5A 2DJ0A 1GP1A 5DDLA 4KX4A 1M0UA 2P5RA 2RLIA 4BL7A 4DVCA 1XXUA 2M46A 3I6AA 3LSZA 4IKHA 1EEMA 2AB6A 2KLXA 2I3YA 3VI7A 5J3RA 1GH2A 3ME8A 3C73A 1XIYA 1ZCPA 3TCOA 3D4MA 1QMVA 5CRGA 1PRXA 5DBQA 2L4CA 1XOAA 1O73A 1W4VA 2GSRA
chains in the Genus database with same CATH superfamily
2H0GA 2L59A 4MA9A 1GNWA 2IFQB 4NWYA 2P31A 5GAND 1R26A 3HA9A 1ML6A 3PGTA 4OFTA 1B4QA 2H6XA 4ZBBA 2OJLA 2H1AA 1NHYA 1MEKA 3Q74A 4CDOA 3W6GA 2EIOA 3F4SA 1IYIA 4IQAA 4PQ1A 5JWQB 4K7NA 2V6KA 3FHKA 4OO5A 5F07A 1JHBA 2IFQA 3IC4A 4YKGA 2PUKC 3GMFA 3QR6A 3F63A 2V1MA 3DXBA 4NPBA 3TJGA 2R2JA 4LMWA 2X99A 3MDKA 3IAS2 2VLUA 4N0ZA 2RM6A 5IQYA 1K0MA 1V40A 2OE1A 2TRXA 2X8GA 1TI3A 3LORA 5F05A 3UBKA 2YJHA 5IMFA 1XVQA 3KMOA 4ECJA 2H0IA 3F6DA 1V98A 2IMEA 1A8LA 1EGOA 3DKSA 1QFNA 1OC9B 3ZMLA 2HE3A 1O6JA 1SKSB 2JSYA 1OYJA 2I4AA 2CVDA 1SK2A 1SL2B 4WF4A 1SD9A 5ECOB 4X0XA 2Z9SA 3IHQA 2AYTA 2A2SA 2H19A 4NHZA 3HDCA 3TKSA 1XVWA 4GSNA 1C72A 1Q98A 4XRAA 1ZZYA 4MF6A 4IJ3A 5F8BA 3VK9A 2J23A 2XBQA 3TB2A 4Q5QA 4PX1A 4KF9A 5IMDA 5KN1A 3P8WA 5ECIB 2OBIA 2R0CA 2FWGA 2QSIA 4OCEA 2H70A 1BEDA 1Z3EA 3F3RA 5DQYA 5J5NA 1OE8A 4WBRD 3F0IA 2GQLA 1NM3A 6GSTA 1XCCA 4FIWA 1OE7A 4I97A 1WWJA 5G1KA 2C0FA 2VCQA 1A23A 1PGTA 2F8AA 5DJLA 5IMAA 4PUFC 3GL5A 1RK4A 3CTGA 5D8IA 4ZB8A 2IWTA 1XW9A 3LFLA 2YWMA 1WIKA 1XWBA 5B7CA 1AQWA 1ZOFA 2KUCA 1WJKA 4NMUA 2NPBA 1PKZA 2YNXA 4GSSA 2VAFA 2HT9A 3NIVA 2B3SA 5IPHA 4OD7A 4G0KA 1GRXA 3IPZA 2YV7A 3KGKA 1AC1A 2OKAA 4HZ2A 1DE2A 2G2QA 3ZRDA 2FUG2 2PPTA 4I2TA 4Q5NA 1H75A 2B5XA 2C0GA 2YN1A 3PR8A 2IMFA 3GURA 3KJYA 3D6IA 4XHMA 3GUSA 3KEBA 4F9ZA 3TRXA 1N2AA 1KBNA 4POKA 3I43A 4HUAA 1BQ7A 4TR0A 4AGSA 1SKRB 1U88A 2B6MA 2LQOA 2HZEB 12GSA 4O7HA 5B8BA 2LTKA 1K0CA 4PGTA 5CYYA 2P0GA 1X5DA 2X8CA 2HNLA 2OE3A 5HR2A 10GSA 4TN8A 4FYBA 2L4QA 3M8NA 2DJ3A 4GLTA 3H1NA 2GZPA 4KGIA 5JWOB 1QQ2A 1SENA 3L4NA 3TKSE 2KP1A 4EO3A 2HZEA 3VPTA 4PUAA 1K3YA 1UN2A 1O7UA 4ACSA 3QAVA 2JADA 4KUNA 2PVQA 2X49A 2YOIA 2MMOA 2VL3A 4PTSA 2PWJA 4O92A 1IYHA 2LJRA 3A2XA 3UIWA 3HCZA 1JZOA 2I9HA 2YPMA 4XS1A 5IMZA 4OFNA 4OFMA 4BWQA 1T1VA 3G9BA 4HS1A 4KSMA 3DRNA 3MWHA 3FRCA 4TR1B 2B1KA 4I6XA 1X5CA 2CAIA 5C04A 7GSSA 4V1Ag 1FB6A 1YKCA 2TRCP 1MDJA 3FYGA 3IK9A 4POLA 1HNAA 2AV4A 1XBSA 4MZBA 5J9CA 1M2DA 3RDWA 5HQPA 1VRSD 5JCGA 4XS6A 2WRTA 5ECKB 2JZSA 5KN0A 2YWIA 1A8YA 2CV4A 2GVPA 1U3AA 3MNGA 2L5LA 3RPNA 4FO5A 2FCHA 3J7Yk 3DIEA 4XS4A 4G19A 3DGQA 4BVXB 1ERVA 2HRNA 3DVXA 3EYTA 3KH7A 3G7IA 2ES7A 4K5RA 6GSYA 3QCPA 4Z2TA 2VD0A 3BJ5A 3N5OA 2DLXA 5E59A 2K8SA 5DCGA 2N5BA 4K9ZA 1SYRA 4IBPA 1THOA 3GL3A 1E6BA 4YAPA 4GCIA 1GSEA 2XC2A 1DUGA 1FG4A 1M2BA 2V6OA 4MH3A 1T3BA 4RQRA 1THXA 5A4WA 2R0PA 2WFCA 4KB3A 19GSA 3CYNA 1ZYQB 4BVXA 4GTUA 1TI1A 1ERWA 3FR6A 4G0LA 3G7YA 1CQGA 3ZIVA 4YKFA 2L6CA 5FHIA 2E2GA 2VLVA 1K0BA 4DEJA 4HQZA 2PMTA 2D2ZA 4MH2A 5D9VA 3FMWA 3SWLA 1TU7A 3HJPA 4AJ7A 2WCIA 2DKIA 2MMNA 2ON5A 1U6TA 4ZB9A 4BWSA 1G7OA 3QAGA 5LCZA 2F3MA 5EY6A 1F3AA 2YANA 4KDXA 4E8EA 3ZFBA 2OADA 4LLRA 3TKPA 4WR5A 5L71A 1GSYA 5HR3A 1LU4A 1Z7PA 2XPDA 4GQFA 1HD2A 3GV1A 1TJDA 3L9UA 3EWLA 3LQ7A 4ISDA 1URMA 1XWAA 2HLSA 5CNWA 4A5PA 1GSUA 5GSTA 2WZ9A 2PU9C 1T4YA 4K2DA 2IIYA 2L5OA 3WYWA 1WE0A 3APQA 3QDNA 2IJYA 1SJIA 4F2IA 4TXVA 3F4RA 2N5AA 4WXTA 1V9WA 4ECIA 1JLVA 3GX8A 4JR6A 3JCML 1YQ1A 4RI7A 1AXDA 3H8QA 6GSXA 1QK8A 1EWXA 1TRUA 3IOSA 5HFKA 1AW9A 3C8EA 1TW9A 1Y6EA 3L9SA 5GZZB 1XWCA 4ML1A 4ZL8A 5IIZA 3TJBA 2V32A 5AN1A 4L0WA 5HFIA 5G31A 2CZ3A 2RUEA 2C1YA 2GGTA 1GTIA 3D4TA 3LWAA 1X9MB 3MYDA 1PD21 1YEPA 8GSSA 6GSVA 1SJZA 3H93A 4Q5RA 4NHWA 4HU9A 1B9YC 2JL4A 2IL3A 2CX3A 4DSSB 2XBIA 2PVOC 5DVBA 1OKDA 3D21A 4QL9A 4G0IA 1AAZA 1M7TA 1OC3A 4ZIJA 4MPFA 5EPFA 4ZXGA 2B7JA 3UBLA 4AJ6A 11GSA 5EL8A 4N11A 1Z7RA 2CVKA 2R0GA 3P7XA 1SL1B 5AIVA 1BG5A 2RM5A 3PINA 1EOHA 4ICYA 3IXRA 3LEFA 3CQFA 1TDIA 5B6NA 4YQUA 4TRXA 1GLQA 3QOUA 4H86A 1SL0B 2FNOA 4K7OA 1FHEA 1XWGA 1U87A 1XW5A 5IO2A 1HNBA 3IE3A 4I2UA 2GQKA 18GSA 3GHAA 3M1GA 2LS5A 3GSSA 3FZAA 3FK8A 4MK3A 5CP1A 2ZUPA 2H1BA 4MABA 3O76A 4N30A 3WGDA 4IS0A 5G30A 3O3TA 3GYKA 2DIYA 2GZYA 2OE0A 4MZCA 4X1UA 4JBBA 4F03A 3HVNA 3A5IA 3Q18A 5F0GA 1EGRA 2B5YA 1GL8A 2VL9A 5BRTA 1S3CA 3HVVA 1MD4A 5FWGA 1EV9A 3CXGA 3TKQA 2DBCA 4EIQA 4L0UA 5GAPD 2GSTA 1OC9A 3LXZA 3P90A 3D22A 1X5EA 4QQ7A 1Q4JA 2MBSA 2PGTA 3QAWA 4KAEA 3GKNA 3R2QA 4RUVA 3KP8A 4HJMA 1QUWA 3ME7A 4K7IA 4TVEA 4EDYA 4V2NA 1JLWA 5CAXA 4K0GA 4TW5A 4MLYA 2VCZA 2X8HA 5H5RA 2B5EA 4IELA 3PH9A 4G2EA 3M0FA 1TKDB 2H72A 1QGVA 4WEYA 3U6VA 1PL2A 2FWHA 3CSHA 4OWYA 4YH2A 2CVBA 3M9KA 4WKWA 3VI5A 1V58A 6GSWA 3ZFLA 3Q6OA 2B1LA 1E2YA 3H79A 5AISA 2HSHA 4PXOA 2LNSA 2C3QA 1PN0A 3K8NA 3HVSA 3GA4A 1K3LA 4EKZA 1USBA 4ECCA 1RQMA 1ZMAA 3QPMA 3VFIA 4K1FA 2QKEA 4LMVA 1BYEA 1GTUA 3DYRA 4O32A 2R37A 4GXZA 1DE1A 5JWRB 4CY8A 4WBJA 5ECMB 2VM2A 3TRPA 3A3TA 3GN3A 4IN0A 5ECPB 2FA4A 2DMLA 3RPPA 3R3EA 1A0RP 2V2GA 1G0TA 3UOMA 1T7PB 1GSFA 1G6WA 1Z6NA 3EC3A 2GT5A 2H75A 3UEMA 2C3NA 2VL2A 3HZ4A 2YZHA 3HD5A 1PKWA 3F9UA 3TJJA 3ZZXA 4WETA 4FYCA 13GSA 4MNNA 3WGXA 1ZYNA 2MZCA 2WULA 1K0OA 4XCSA 2CQ9A 4HQSA 3FKFA 4JR4A 1Z9HA 2RIIA 4MJBA 4EF0A 3ZTLA 1OC8A 2K18A 2XHFA 1KNGA 3IK7A 4EXJA 3L0HA 1ILOA 1BX9A 5IOWA 3KMNA 4Z2RA 1EZKA 1WPIA 4IVFA 4AJ8A 3VWVA 2YJ7A 4JU5A 3CSJA 5A4VA 1PX7A 3TJFA 5IMVA 3KIJA 1M9AA 3ZVJA 3E3EA 4TKYA 2LKUA 2VCWA 3OR5A 2O8VB 3NOFA 1EP7A 5GSSA 1K0DA 1VF3A 2REMA 5D9XA 2LSTA 3H4KA 3TDGA 1S3AA 2LRTA 3BOAA 3ERGA 2GZZA 2GTUA 1YF0A 4L5LA 5BMUA 1GTBA 4JE1A 2MYGA 4F82A 2PBJA 2DSAA 4MJEA 4KDYA 4N0VA 1M9BA 4FQUA 4KA0A 2OA7A 1OAZA 1W89A 1EV4A 2B7KA 1NSWA 1WRYA 4KCAA 4GSTA 2AJQB 3KCMA 3RHBA 5H5QA 3F8UA 4V2LA 2LUSA 1F37A 1FVKA 2O89A 4X43A 4QL7A 2E2MA 3TKSC 2QA2A 3MAKA 5A5KA 4HEA2 3M3MA 2A2RA 2WB9A 3L78A 1JZRA 1I5GA 3CTFA 2NBSA 2IPAA 2HFDA 3A2WA 4NXIA 4POBA 3CRUA 4CHSA 3VURA 1AIUA 2WGRA 1M99A 3GTUB 1TK8B 4LL1B 3VWWA 3UJ1A 4KSOA 3C71A 3SBCA 5CREA 3TOTA 1VGLA 1T8EB 4GF0A 1WOUA 2TIRA 3N9JA 4LA1A 4PNGA 1YDKA 1S3RA 1B8XA 5D93A 3U5RE 3TRQA 2HRFA 3GH9A 4TR1A 2K6VA 3HXSA 5B8AA 1O8XA 3BBYA 1ERUA 5J41A 4GQCA 2GSSA 3IA1A 1R5AA 1XOBA 3ZIJA 3GTUA 16GSA 4ECBA 1NHOA 6GSUA 3GSTA 2YWNA 1CQHA 2HSMA 3ERWA 5IO0A 2R6KA 3LYPA 1YEXA 2A4VA 1XPVA 2JZTA 2OACA 1TTZA 1T4ZA 4USSA 2IMKA 3GNJA 5ELAA 3C1SA 1FOVA 3HHVA 1TU8A 2VIMA 4Z2UA 4FYUA 2F9SA 4ID0A 5KOWA 1XG8A 3GKKA 5F06A 1X9WB 4D73B 4PQHA 2H76A 17GSA 2M72A 4J2FA 1ERTA 1PA3A 1JZWA 2P5QA 2FY6A 3D5JA 2F51A 5AGYA 3FZ5A 4IGJA 1YF1A 2X4AA 3LGCA 5IMCA 5COHA 1S3DA 3HY2A 3TUEA 2LEGA 3GRXA 1U3IA 1M3IA 3P2AA 3IDVA 3DMLA 4O5RA 4D73A 3E9JB 4MJCA 3HYPA 5G5FA 2VCXA 3D0ZA 5ENUA 4YAVA 2LQQA 2HYXA 2C0EA 2L6DA 4KH7A 2GS3A 5ECLB 1N8JA 2C3TA 2FA8A 4TR3A 1TP9A 5G2ZA 4HZ4A 1A2JA 4MF7A 2FWEA 3UVTA 4JRRA 4BL7B 4IP1A 1M2AA 3Q19A 1K0NA 4EUYA 3VPQA 2R5GA 1A24A 2C4JA 1Y25A 2DMMA 1FW1A 3W8JA 3ERFA 3NZNA 1WP0A 3UVHA 3FZ9A 1FOHA 2JSZA 1F6MC 1ST9A 20GSA 1K0AA 2CA8A 3V1WA 1J08A 2MMAA 2HZFA 1ZYPA 4MMMA 3WD6A 4MDCA 1TRSA 2QA1A 2E7PA 4MPGA 5ID2B 2LRNA 4NV2A 1VF4A 4P3YB 4FH8A 5HFGA 3VWXA 2H01A 3ZVJD 2H66A 2MBTA 3IHGA 3QFBC 3J7Yb 3ZYWA 1O85A 2H30A 3HKRA 1TOFA 2ZNMA 2JU5A 1JFUA 2DC5A 1H4OA 3S9FA 2O85A 1GLPA 4XRDA 5DQSA 2WDUA 3HJMA 3I9V2 3US3A 4KNDA 3LXTA 4XTSA 3KP9A 3HJOA 4EIPA 1UC7A 5IM9A 5ID2A 3GH6A 3BCKA 2H8LA 2H73A 1EEJA 3LG6A 5ECNB 1F2EA 2J9HA 3ZITA 2FLSA 3AY8A 4I5QA 3WT1A 2BJXA 4DSSA 2LJAA 2M80A 1BAYA 1F3BA 4F0BA 1GUHA 5JCWA 5ECHB 1PN9A 5LNKe 2XPEA 5EVOA 2HI7A 1SYXA 4XIHA 6GSSA 4BA7A 1SK0A 4IP6A 5AIXA 3QMXA 3KD0A 4MP4A 1Z5YE 1XWKA 2H1DA 1AQXA 1SD8A 2CX4A 2DIZA 4ILFA 4NV5A 1BJXA 1OKTA 4I8BA 1MTCA 4J57E 3CMIA 3MIXA 4JZQA 4V1Ap 3EMXA 3C1RA 2ON7A 1KEBA 4GRFA 4BVYB 1GSDA 1O8WA 4Q5FA 5DALB 4BPYA 4RI6A 4G9HA 1SU9A 2QGVA 5HR1A 1FB0A 3L9VA 2G0FA 5D9WA 2EIQA 3KM6A 3IV4A 3FEUA 4KCEA 1J9BA 1ZL9A 3IBHA 4DSQA 4F0CA 2FGXA 1B4PA 4LL4B 2DJ1A 2VCVA 5INYA 4ZL7A 1YJ6A 1YY7A 4EVMA 2YV9A 4BVYA 1YKAA 3APOA 5DALA 4ZL9A 3MSZA 2PN8A 3E0UA 5LD0A 2NVLA 3C7MA 2L57A 5ECQB 1PQNA 3A2VA 2HRAA 1G7EA 2O7KA 3I69A 4K0NA 4O5QA 5DCHA 4GWRA 1R7HA 1G6YA 2R4VA 3GKMA 4PNFA 3QFAC 2IMIA 3ZREA 3WGEA 3FZ4A 4OO4A 2EIRA 1TRWA 4E8HA 3BD2A 2H74A 1ZGNA 3DVWA 4ZILA 2DJ2A 2H6ZA 3EURA 3IR4A 1R4WA 4L5OA 4TR4A 3KTBA 1GNEA 1SK1A 3UL3A 1Z6MA 1XFLA 2YZUA 2VD1A 2UZ8A 1B48A 2NTOA 2FWFA 2RUFA 1SKWB 2MMZA 2GDRA 3TKRA 4HDEA 1EOGA 4IHUA 2CAQA 1DBYA 1UVZA 2WJUA 2YWOA 1XW6A 3M9JA 2LJKA 1GULA 3EINA 4WF5A 2I1UA 3BCIA 3TGZA 2VUPA 3ISOA 3EU3A 3FR3A 4X4JA 5ECSA 1LJRA 2VM1A 1MDKA 3FR9A 2X64A 4CY6A 2O87A 2BMXA 4K6XA 3ZL5A 3EU4A 5B6MA 1PMTA 1YZXA 2YCDA 5D9TA 1ON4A 1ACVA 1KTEA 2C80A 1X9SB 1OVNA 1GUMA 1TXXA 4EDZA 2JZRA 2CT6A 4BIKA 1GWCA 4MCUA 4ZBAA 4K2XA 5H5SA 4JEDA 2IN3A 2AAWA 4KDUA 1O81A 1VF2A 3EVIA 4HSCX 3WT2A 2CZ2A 2NDOA 1I9DA 1GTAA 4ML6A 1AQVA 1X0RA 3A5WA 1HQOA 2I81A 2F8FA 4PURA 1R5PA 4EE0A 1M3JA 1A2MA 2A4HA 3EE2A 4K8MA 2HRKA 3CBUA 1GSSA 2ZCTA 4YQMA 1PFOA 4V2MA 3GKXA 1TK0B 2H1GA 4YQVA 4TOPA 1VF1A 2H71A 3FW2A 2KOKA 3IC8A 1FAAA 1A2LA 2OBKA 1K3OA 5A4UA 3F3QA 2K9FA 4NAXA 1PX6A 4HJ2A 1F9MA 5ECRB 4HOJA 4O5UA 4ZBDA 2VO4A 2GQMA 3ED3A 4IW9A 1TRVA 4MJAA 2VOCA 3KXOA 2DJJA 5JCUA 4KE3A 5C00A 2JACA 1PSQA 5DAKB 4KW6A 2YP6A 4PQIA 4CW9A 1XZOA 3UAPA 1FO5A 3CSIA 1A0FA 3KZQA 4ULXA 3GX0A 1T00A 4L8EA 2H6YA 2WS2A 2LNTA 5CRHA 1HYUA 2KP2A 3DEXA 5J4UA 22GSA 5ELGA 2FD3A 4XS4B 5KEJA 1GUKA 1J0FA 4HU7A 2K8VA 5DAKA 1V57A 3TOUA 1JZDA 3EMPA 1HNCA 5G5EA 4G10A 4IQ1A 4WR4A 5KN2A 2GT6A 2VCTA 5HR0A 1V2AA 3FY7A 3KTLA 4J56E 3W8SA 3ZLPA 3F4TA 3EPTA 4Z7XA 4OCFA 4ZB6A 2AHEA 5CRWA 5ABRA 3VWUA 2FHEA 3UMAA 4RQXA 3RBTA 4EL1A 4EC0A 3O6TA 3DD3A 3LYKA 2KHPA 5DJMA 2R3XA 2VLTA 2V41A 3APSA 2BTOT 5FT3A 1RW1A 4N10A 3LJRA 4POMA 9GSSA 3RHCA 5KN3A 3F6FA 1NW2A 1TK5B 2PERA 3G7JA 3ZMKA 2VL2C 1EP8A 3LW9A 14GSA 1SJ6A 2LRCA 2H0HA 1QXHA 2QC7A 1ZYEA 2HXKA 1LBKA 1GSQA 1FVJA 2EC4A 3QD9A 2E0QA 4MF5A 3GFKA 3VLNA 3RAZA 3UARA 5J9BA 3HVXA 5E4WA 4OMVA 4IJIA 5IOXA 5D73A 2IMDA 3CRTA 5D96A 1WMJA 3TJKA 2GLRA 1AUCA 4TXOB 2GSQA 2DJKA 1MDIA 2HSYA 3HZ8A 4AF2A 1ABAA 2C0DA 4MZWA 3IAM2 1DSBA 2LV3A 1B9XC 3GIXA 2N5FA 5CRDA 1MD3A 5IPGA 5G1LA 2AUVA 5CO3A 4HI7A 4DSRA 3IRAA 2ALBA 2A2PA 3KH9A 2C8UA 1PL1A 3DWVA 4TXOA 1UA5A 2DJ0A 1GP1A 5DDLA 4KX4A 1M0UA 2P5RA 2RLIA 4BL7A 4DVCA 1XXUA 2M46A 3I6AA 3LSZA 2DKHA 4IKHA 1EEMA 2AB6A 2KLXA 2I3YA 3VI7A 5J3RA 5KOXA 1GH2A 3PPUA 3ME8A 3C73A 4K5SA 1XIYA 1ZCPA 3TCOA 3D4MA 1QMVA 5CRGA 1PRXA 5DBQA 2L4CA 1XOAA 1O73A 1W4VA 2GSRA
chains in the Genus database with same CATH topology
2H0GA 2L59A 4MA9A 1GNWA 2IFQB 4NWYA 2P31A 5GAND 1R26A 3HA9A 1ML6A 3PGTA 4OFTA 1B4QA 2H6XA 4ZBBA 2OJLA 2H1AA 1NHYA 1MEKA 3Q74A 4CDOA 3W6GA 2EIOA 3F4SA 1IYIA 4IQAA 4PQ1A 5JWQB 4K7NA 2V6KA 3FHKA 4OO5A 5F07A 1JHBA 2IFQA 3IC4A 4YKGA 2PUKC 3GMFA 3QR6A 3F63A 2V1MA 3DXBA 4NPBA 3TJGA 2R2JA 4LMWA 2X99A 3MDKA 3IAS2 2VLUA 4N0ZA 2RM6A 5IQYA 1K0MA 1V40A 2OE1A 2TRXA 2X8GA 1TI3A 3LORA 5F05A 3UBKA 2YJHA 5IMFA 1XVQA 3KMOA 4ECJA 2H0IA 3F6DA 1V98A 2IMEA 1A8LA 1EGOA 3DKSA 1QFNA 1OC9B 3ZMLA 2HE3A 1O6JA 1SKSB 2JSYA 1OYJA 2I4AA 2CVDA 1SK2A 1SL2B 4WF4A 1SD9A 5ECOB 4X0XA 2Z9SA 3IHQA 2AYTA 2A2SA 2H19A 4NHZA 3HDCA 3TKSA 1XVWA 4GSNA 1C72A 1Q98A 4XRAA 1ZZYA 4MF6A 4IJ3A 5F8BA 3VK9A 2J23A 2XBQA 3TB2A 4Q5QA 4PX1A 4KF9A 5IMDA 5KN1A 3P8WA 5ECIB 2OBIA 2R0CA 2FWGA 2QSIA 4OCEA 2H70A 1BEDA 1Z3EA 3F3RA 5DQYA 5J5NA 1OE8A 4WBRD 3F0IA 2GQLA 1NM3A 6GSTA 1XCCA 4FIWA 1OE7A 4I97A 1WWJA 5G1KA 2C0FA 2VCQA 1A23A 1PGTA 2F8AA 5DJLA 5IMAA 4PUFC 3GL5A 1RK4A 3CTGA 5D8IA 4ZB8A 2IWTA 1XW9A 3LFLA 2YWMA 1WIKA 1XWBA 5B7CA 1AQWA 1ZOFA 2KUCA 1WJKA 4NMUA 2NPBA 1PKZA 2YNXA 4GSSA 2VAFA 2HT9A 3NIVA 2B3SA 5IPHA 4OD7A 4G0KA 1GRXA 3IPZA 2YV7A 3KGKA 1AC1A 2OKAA 4HZ2A 1DE2A 2G2QA 3ZRDA 2FUG2 2PPTA 4I2TA 4Q5NA 1H75A 2B5XA 2C0GA 2YN1A 3PR8A 2IMFA 3GURA 3KJYA 3D6IA 4XHMA 3GUSA 3KEBA 4F9ZA 3TRXA 1N2AA 1KBNA 4POKA 3I43A 4HUAA 1BQ7A 4TR0A 4AGSA 1SKRB 1U88A 2B6MA 2LQOA 2HZEB 12GSA 4O7HA 5B8BA 2LTKA 1K0CA 4PGTA 5CYYA 2P0GA 1X5DA 2X8CA 2HNLA 2OE3A 5HR2A 10GSA 4TN8A 4FYBA 2L4QA 3M8NA 2DJ3A 4GLTA 3H1NA 2GZPA 4KGIA 5JWOB 1QQ2A 1SENA 3L4NA 3TKSE 2KP1A 4EO3A 2HZEA 3VPTA 4PUAA 1K3YA 1UN2A 1O7UA 4ACSA 3QAVA 2JADA 4KUNA 2PVQA 2X49A 2YOIA 2MMOA 2VL3A 4PTSA 2PWJA 4O92A 1IYHA 2LJRA 3A2XA 3UIWA 3HCZA 1JZOA 2I9HA 2YPMA 4XS1A 5IMZA 4OFNA 4OFMA 4BWQA 1T1VA 3G9BA 4HS1A 4KSMA 3DRNA 3MWHA 3FRCA 4TR1B 2B1KA 4I6XA 1X5CA 2CAIA 5C04A 7GSSA 4V1Ag 1FB6A 1YKCA 2TRCP 1MDJA 3FYGA 3IK9A 4POLA 1HNAA 2AV4A 1XBSA 4MZBA 5J9CA 1M2DA 3RDWA 5HQPA 1VRSD 5JCGA 4XS6A 2WRTA 5ECKB 2JZSA 5KN0A 2YWIA 1A8YA 2CV4A 2GVPA 1U3AA 3MNGA 2L5LA 3RPNA 4FO5A 2FCHA 3J7Yk 3DIEA 4XS4A 4G19A 3DGQA 4BVXB 1ERVA 2HRNA 3DVXA 3EYTA 3KH7A 3G7IA 2ES7A 4K5RA 6GSYA 3QCPA 4Z2TA 2VD0A 3BJ5A 3N5OA 2DLXA 5E59A 2K8SA 5DCGA 2N5BA 4K9ZA 1SYRA 4IBPA 1THOA 3GL3A 1E6BA 4YAPA 4GCIA 1GSEA 2XC2A 1DUGA 1FG4A 1M2BA 2V6OA 4MH3A 1T3BA 4RQRA 1THXA 5A4WA 2R0PA 2WFCA 4KB3A 19GSA 3CYNA 1ZYQB 4BVXA 4GTUA 1TI1A 1ERWA 3FR6A 4G0LA 3G7YA 1CQGA 3ZIVA 4YKFA 2L6CA 5FHIA 2E2GA 2VLVA 1K0BA 4DEJA 4HQZA 2PMTA 2D2ZA 4MH2A 5D9VA 3FMWA 3SWLA 1TU7A 3HJPA 4AJ7A 2WCIA 2DKIA 2MMNA 2ON5A 1U6TA 4ZB9A 4BWSA 1G7OA 3QAGA 5LCZA 2F3MA 5EY6A 1F3AA 2YANA 4KDXA 4E8EA 3ZFBA 2OADA 4LLRA 3TKPA 4WR5A 5L71A 1GSYA 5HR3A 1LU4A 1Z7PA 2XPDA 4GQFA 1HD2A 3GV1A 1TJDA 3L9UA 3EWLA 3LQ7A 4ISDA 1URMA 1XWAA 2HLSA 5CNWA 4A5PA 1GSUA 5GSTA 2WZ9A 2PU9C 1T4YA 4K2DA 2IIYA 2L5OA 3WYWA 1WE0A 3APQA 3QDNA 2IJYA 1SJIA 4F2IA 4TXVA 3F4RA 2N5AA 4WXTA 1V9WA 4ECIA 1JLVA 3GX8A 4JR6A 3JCML 1YQ1A 4RI7A 1AXDA 3H8QA 6GSXA 1QK8A 1EWXA 1TRUA 3IOSA 5HFKA 1AW9A 3C8EA 1TW9A 1Y6EA 3L9SA 5GZZB 1XWCA 4ML1A 4ZL8A 5IIZA 3TJBA 2V32A 5AN1A 4L0WA 5HFIA 5G31A 2CZ3A 2RUEA 2C1YA 2GGTA 1GTIA 3D4TA 3LWAA 1X9MB 3MYDA 1PD21 1YEPA 8GSSA 6GSVA 1SJZA 3H93A 4Q5RA 4NHWA 4HU9A 1B9YC 2JL4A 2IL3A 2CX3A 4DSSB 2XBIA 2PVOC 5DVBA 1OKDA 3D21A 4QL9A 4G0IA 1AAZA 1M7TA 1OC3A 4ZIJA 4MPFA 5EPFA 4ZXGA 2B7JA 3UBLA 4AJ6A 11GSA 5EL8A 4N11A 1Z7RA 2CVKA 2R0GA 3P7XA 1SL1B 5AIVA 1BG5A 2RM5A 3PINA 1EOHA 4ICYA 3IXRA 3LEFA 1TDIA 5B6NA 4YQUA 4TRXA 1GLQA 3QOUA 4H86A 1SL0B 2FNOA 4K7OA 1FHEA 1XWGA 1U87A 1XW5A 5IO2A 1HNBA 3IE3A 4I2UA 2GQKA 18GSA 3GHAA 3M1GA 2LS5A 3GSSA 3FZAA 3FK8A 4MK3A 5CP1A 2ZUPA 2H1BA 4MABA 3O76A 4N30A 3WGDA 4IS0A 5G30A 3O3TA 3GYKA 2DIYA 2GZYA 2OE0A 4MZCA 4X1UA 4JBBA 4F03A 3A5IA 3Q18A 5F0GA 1EGRA 2B5YA 1GL8A 2VL9A 5BRTA 1S3CA 3HVVA 1MD4A 5FWGA 1EV9A 3CXGA 3TKQA 2DBCA 4EIQA 4L0UA 5GAPD 2GSTA 1OC9A 3LXZA 3P90A 3D22A 1X5EA 4QQ7A 1Q4JA 2MBSA 2PGTA 3QAWA 4KAEA 3GKNA 3R2QA 4RUVA 3KP8A 4HJMA 1QUWA 3ME7A 4K7IA 4TVEA 4EDYA 4V2NA 1JLWA 5CAXA 4K0GA 4TW5A 4MLYA 2VCZA 2X8HA 5H5RA 2B5EA 4IELA 3PH9A 4G2EA 3M0FA 1TKDB 2H72A 1QGVA 4WEYA 3U6VA 1PL2A 2FWHA 3CSHA 4OWYA 4YH2A 2CVBA 3M9KA 4WKWA 3VI5A 1V58A 6GSWA 3ZFLA 3Q6OA 2B1LA 1E2YA 3H79A 5AISA 2HSHA 4PXOA 2LNSA 2C3QA 1PN0A 3K8NA 3HVSA 3GA4A 1K3LA 4EKZA 1USBA 4ECCA 1RQMA 1ZMAA 3QPMA 3VFIA 4K1FA 2QKEA 4LMVA 1BYEA 1GTUA 3DYRA 4O32A 2R37A 4GXZA 1DE1A 5JWRB 4CY8A 4WBJA 5ECMB 2VM2A 3TRPA 3A3TA 3GN3A 4IN0A 5ECPB 2FA4A 2DMLA 3RPPA 3R3EA 1A0RP 2V2GA 1G0TA 3UOMA 1T7PB 1GSFA 1G6WA 1Z6NA 3EC3A 2GT5A 2H75A 3UEMA 2C3NA 2VL2A 3HZ4A 2YZHA 3HD5A 1PKWA 3F9UA 3TJJA 3ZZXA 4WETA 4FYCA 13GSA 4MNNA 3WGXA 1ZYNA 2MZCA 2WULA 1K0OA 4XCSA 2CQ9A 4HQSA 3FKFA 4JR4A 1Z9HA 2RIIA 4MJBA 4EF0A 3ZTLA 1OC8A 2K18A 2XHFA 1KNGA 3IK7A 4EXJA 3L0HA 1ILOA 1BX9A 5IOWA 3KMNA 4Z2RA 1EZKA 1WPIA 4IVFA 4AJ8A 3VWVA 2YJ7A 4JU5A 3CSJA 5A4VA 1PX7A 3TJFA 5IMVA 3KIJA 1M9AA 3ZVJA 3E3EA 4TKYA 2LKUA 2VCWA 3OR5A 2O8VB 3NOFA 1EP7A 5GSSA 1K0DA 1VF3A 2REMA 5D9XA 2LSTA 3H4KA 3TDGA 1S3AA 2LRTA 3BOAA 3ERGA 2GZZA 2GTUA 1YF0A 4L5LA 5BMUA 1GTBA 4JE1A 2MYGA 4F82A 2PBJA 2DSAA 4MJEA 4KDYA 4N0VA 1M9BA 4FQUA 4KA0A 2OA7A 1OAZA 1W89A 1EV4A 2B7KA 1NSWA 1WRYA 4KCAA 4GSTA 2AJQB 3KCMA 3RHBA 5H5QA 3F8UA 4V2LA 2LUSA 1F37A 1FVKA 2O89A 4X43A 4QL7A 2E2MA 3TKSC 2QA2A 3MAKA 5A5KA 4HEA2 3M3MA 2A2RA 2WB9A 3L78A 1JZRA 1I5GA 3CTFA 2NBSA 2IPAA 2HFDA 3A2WA 4NXIA 4POBA 3CRUA 4CHSA 3VURA 1AIUA 2WGRA 1M99A 3GTUB 1TK8B 4LL1B 3VWWA 3UJ1A 4KSOA 3C71A 3SBCA 5CREA 3TOTA 1VGLA 1T8EB 4GF0A 1WOUA 2TIRA 3N9JA 4LA1A 4PNGA 1YDKA 1B8XA 5D93A 3U5RE 3TRQA 2HRFA 3GH9A 4TR1A 2K6VA 3HXSA 5B8AA 1O8XA 3BBYA 1ERUA 5J41A 4GQCA 2GSSA 3IA1A 1R5AA 1XOBA 3ZIJA 3GTUA 16GSA 4ECBA 1NHOA 6GSUA 3GSTA 2YWNA 1CQHA 2HSMA 3ERWA 5IO0A 2R6KA 3LYPA 1YEXA 2A4VA 1XPVA 2JZTA 2OACA 1TTZA 1T4ZA 4USSA 2IMKA 3GNJA 5ELAA 3C1SA 1FOVA 3HHVA 1TU8A 2VIMA 4Z2UA 4FYUA 2F9SA 4ID0A 5KOWA 3GKKA 5F06A 1X9WB 4D73B 4PQHA 2H76A 17GSA 2M72A 4J2FA 1ERTA 1PA3A 1JZWA 2P5QA 2FY6A 3D5JA 2F51A 5AGYA 3FZ5A 4IGJA 1YF1A 2X4AA 3LGCA 5IMCA 5COHA 1S3DA 3HY2A 3TUEA 2LEGA 3GRXA 1U3IA 3P2AA 3IDVA 3DMLA 4O5RA 4D73A 3E9JB 4MJCA 3HYPA 5G5FA 2VCXA 3D0ZA 5ENUA 4YAVA 2LQQA 2HYXA 2C0EA 2L6DA 4KH7A 2GS3A 5ECLB 1N8JA 2C3TA 2FA8A 4TR3A 1TP9A 5G2ZA 4HZ4A 1A2JA 4MF7A 2FWEA 3UVTA 4JRRA 4BL7B 4IP1A 1M2AA 3Q19A 1K0NA 4EUYA 3VPQA 2R5GA 1A24A 2C4JA 1Y25A 2DMMA 1FW1A 3W8JA 3ERFA 3NZNA 1WP0A 3UVHA 3FZ9A 1FOHA 2JSZA 1F6MC 1ST9A 20GSA 1K0AA 2CA8A 3V1WA 1J08A 2MMAA 2HZFA 1ZYPA 4MMMA 3WD6A 4MDCA 1TRSA 2QA1A 2E7PA 4MPGA 5ID2B 2LRNA 4NV2A 1VF4A 4P3YB 4FH8A 5HFGA 3VWXA 2H01A 3ZVJD 2H66A 2MBTA 3IHGA 3QFBC 3J7Yb 3ZYWA 1O85A 2H30A 3HKRA 1TOFA 2ZNMA 2JU5A 1JFUA 2DC5A 1H4OA 3S9FA 2O85A 1GLPA 4XRDA 5DQSA 2WDUA 3HJMA 3I9V2 3US3A 4KNDA 3LXTA 4XTSA 3KP9A 3HJOA 4EIPA 1UC7A 5IM9A 5ID2A 3GH6A 3BCKA 2H8LA 2H73A 1EEJA 3LG6A 5ECNB 1F2EA 2J9HA 3ZITA 2FLSA 3AY8A 4I5QA 3WT1A 2BJXA 4DSSA 2LJAA 2M80A 1BAYA 1F3BA 4F0BA 1GUHA 5JCWA 5ECHB 1PN9A 5LNKe 2XPEA 5EVOA 2HI7A 1SYXA 4XIHA 6GSSA 4BA7A 1SK0A 4IP6A 5AIXA 3QMXA 3KD0A 4MP4A 1Z5YE 1XWKA 2H1DA 1AQXA 1SD8A 2CX4A 2DIZA 4ILFA 4NV5A 1BJXA 1OKTA 4I8BA 1MTCA 4J57E 3CMIA 3MIXA 4JZQA 4V1Ap 3EMXA 3C1RA 2ON7A 1KEBA 4GRFA 4BVYB 1GSDA 1O8WA 4Q5FA 5DALB 4BPYA 4RI6A 4G9HA 1SU9A 2QGVA 5HR1A 1FB0A 3L9VA 2G0FA 5D9WA 2EIQA 3KM6A 3IV4A 3FEUA 4KCEA 1J9BA 1ZL9A 3IBHA 4DSQA 4F0CA 2FGXA 1B4PA 4LL4B 2DJ1A 2VCVA 5INYA 4ZL7A 1YJ6A 1YY7A 4EVMA 2YV9A 4BVYA 1YKAA 3APOA 5DALA 4ZL9A 3MSZA 2PN8A 3E0UA 5LD0A 2NVLA 3C7MA 2L57A 5ECQB 1PQNA 3A2VA 2HRAA 1G7EA 2O7KA 3I69A 4K0NA 4O5QA 5DCHA 4GWRA 1R7HA 1G6YA 2R4VA 3GKMA 4PNFA 3QFAC 2IMIA 3ZREA 3WGEA 3FZ4A 4OO4A 2EIRA 1TRWA 4E8HA 3BD2A 2H74A 1ZGNA 3DVWA 4ZILA 2DJ2A 2H6ZA 3EURA 3IR4A 1R4WA 4L5OA 4TR4A 3KTBA 1GNEA 1SK1A 3UL3A 1Z6MA 1XFLA 2YZUA 2VD1A 2UZ8A 1B48A 2NTOA 2FWFA 2RUFA 1SKWB 2MMZA 2GDRA 3TKRA 4HDEA 1EOGA 4IHUA 2CAQA 1DBYA 1UVZA 2WJUA 2YWOA 1XW6A 3M9JA 2LJKA 1GULA 3EINA 4WF5A 2I1UA 3BCIA 3TGZA 2VUPA 3ISOA 3EU3A 3FR3A 4X4JA 5ECSA 1LJRA 2VM1A 1MDKA 3FR9A 2X64A 4CY6A 2O87A 2BMXA 4K6XA 3ZL5A 3EU4A 5B6MA 1PMTA 1YZXA 2YCDA 5D9TA 1ON4A 1ACVA 1KTEA 2C80A 1X9SB 1OVNA 1GUMA 1TXXA 4EDZA 2JZRA 2CT6A 1GWCA 4MCUA 4ZBAA 4K2XA 5H5SA 4JEDA 2IN3A 2AAWA 4KDUA 1O81A 1VF2A 3EVIA 3WT2A 2CZ2A 2NDOA 1I9DA 1GTAA 4ML6A 1AQVA 1X0RA 3A5WA 1HQOA 2I81A 2F8FA 4PURA 1R5PA 4EE0A 1A2MA 2A4HA 3EE2A 4K8MA 2HRKA 3CBUA 1GSSA 2ZCTA 4YQMA 4V2MA 3GKXA 1TK0B 2H1GA 4YQVA 4TOPA 1VF1A 2H71A 3FW2A 2KOKA 3IC8A 1FAAA 1A2LA 2OBKA 1K3OA 5A4UA 3F3QA 2K9FA 4NAXA 1PX6A 4HJ2A 1F9MA 5ECRB 4HOJA 4O5UA 4ZBDA 2VO4A 2GQMA 3ED3A 4IW9A 1TRVA 4MJAA 2VOCA 3KXOA 2DJJA 5JCUA 4KE3A 5C00A 2JACA 1PSQA 5DAKB 4KW6A 2YP6A 4PQIA 4CW9A 1XZOA 3UAPA 1FO5A 3CSIA 1A0FA 3KZQA 4ULXA 3GX0A 1T00A 4L8EA 2H6YA 2WS2A 2LNTA 5CRHA 1HYUA 2KP2A 3DEXA 5J4UA 22GSA 5ELGA 2FD3A 4XS4B 5KEJA 1GUKA 1J0FA 4HU7A 2K8VA 5DAKA 1V57A 3TOUA 1JZDA 3EMPA 1HNCA 5G5EA 4G10A 4IQ1A 4WR4A 5KN2A 2GT6A 2VCTA 5HR0A 1V2AA 3FY7A 3KTLA 4J56E 3W8SA 3ZLPA 3F4TA 3EPTA 4Z7XA 4OCFA 4ZB6A 2AHEA 5CRWA 5ABRA 3VWUA 2FHEA 3UMAA 4RQXA 3RBTA 4EL1A 4EC0A 3O6TA 3DD3A 3LYKA 2KHPA 5DJMA 2R3XA 2VLTA 2V41A 3APSA 2BTOT 5FT3A 1RW1A 4N10A 3LJRA 4POMA 9GSSA 3RHCA 5KN3A 3F6FA 1NW2A 1TK5B 2PERA 3G7JA 3ZMKA 2VL2C 1EP8A 3LW9A 14GSA 1SJ6A 2LRCA 2H0HA 1QXHA 2QC7A 1ZYEA 2HXKA 1LBKA 1GSQA 1FVJA 2EC4A 3QD9A 2E0QA 4MF5A 3GFKA 3VLNA 3RAZA 3UARA 5J9BA 3HVXA 5E4WA 4OMVA 4IJIA 5IOXA 5D73A 2IMDA 3CRTA 5D96A 1WMJA 3TJKA 2GLRA 1AUCA 4TXOB 2GSQA 2DJKA 1MDIA 2HSYA 3HZ8A 4AF2A 1ABAA 2C0DA 4MZWA 3IAM2 1DSBA 2LV3A 1B9XC 3GIXA 2N5FA 5CRDA 1MD3A 5IPGA 5G1LA 2AUVA 5CO3A 4HI7A 4DSRA 3IRAA 2ALBA 2A2PA 3KH9A 2C8UA 1PL1A 3DWVA 4TXOA 1UA5A 2DJ0A 1GP1A 5DDLA 4KX4A 1M0UA 2P5RA 2RLIA 4BL7A 4DVCA 1XXUA 2M46A 3I6AA 3LSZA 2DKHA 4IKHA 1EEMA 2AB6A 2KLXA 2I3YA 3VI7A 5J3RA 5KOXA 1GH2A 3PPUA 3ME8A 3C73A 4K5SA 1XIYA 1ZCPA 3TCOA 3D4MA 1QMVA 5CRGA 1PRXA 5DBQA 2L4CA 1XOAA 1O73A 1W4VA 2GSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0G A;  2L59 A;  4MA9 A;  1GNW A;  2IFQ B;  4NWY A;  2P31 A;  5GAN D;  1R26 A;  3HA9 A;  1ML6 A;  3PGT A;  4OFT A;  1B4Q A;  2H6X A;  4ZBB A;  2OJL A;  2H1A A;  1NHY A;  1MEK A;  3Q74 A;  4CDO A;  3W6G A;  2EIO A;  3F4S A;  1IYI A;  4IQA A;  4PQ1 A;  5JWQ B;  4K7N A;  2V6K A;  3FHK A;  4OO5 A;  5F07 A;  1JHB A;  2IFQ A;  3IC4 A;  2PUK C;  3GMF A;  3QR6 A;  3F63 A;  2V1M A;  3DXB A;  4NPB A;  3TJG A;  2R2J A;  4LMW A;  2X99 A;  3MDK A;  3IAS 2;  2VLU A;  4N0Z A;  2RM6 A;  5IQY A;  1K0M A;  1V40 A;  2OE1 A;  2TRX A;  2X8G A;  1TI3 A;  3LOR A;  5F05 A;  3UBK A;  2YJH A;  5IMF A;  1XVQ A;  3KMO A;  4ECJ A;  2H0I A;  3F6D A;  1V98 A;  2IME A;  1A8L A;  1EGO A;  3DKS A;  1QFN A;  1OC9 B;  3ZML A;  2HE3 A;  1O6J A;  1SKS B;  2JSY A;  1OYJ A;  2I4A A;  2CVD A;  1SK2 A;  1SL2 B;  4WF4 A;  1SD9 A;  5ECO B;  4X0X A;  2Z9S A;  3IHQ A;  2AYT A;  2A2S A;  2H19 A;  4NHZ A;  3HDC A;  3TKS A;  1XVW A;  4GSN A;  1C72 A;  1Q98 A;  4XRA A;  1ZZY A;  4MF6 A;  4IJ3 A;  5F8B A;  3VK9 A;  2J23 A;  2XBQ A;  3TB2 A;  4Q5Q A;  4PX1 A;  5IMD A;  5KN1 A;  3P8W A;  5ECI B;  2OBI A;  2FWG A;  2QSI A;  4OCE A;  2H70 A;  1BED A;  1Z3E A;  3F3R A;  5DQY A;  5J5N A;  1OE8 A;  4WBR D;  3F0I A;  2GQL A;  1NM3 A;  6GST A;  1XCC A;  4FIW A;  1OE7 A;  4I97 A;  1WWJ A;  5G1K A;  2C0F A;  2VCQ A;  1A23 A;  1PGT A;  2F8A A;  5DJL A;  5IMA A;  4PUF C;  3GL5 A;  1RK4 A;  3CTG A;  5D8I A;  4ZB8 A;  2IWT A;  1XW9 A;  3LFL A;  2YWM A;  1WIK A;  1XWB A;  5B7C A;  1AQW A;  1ZOF A;  2KUC A;  1WJK A;  4NMU A;  2NPB A;  1PKZ A;  2YNX A;  4GSS A;  2VAF A;  2HT9 A;  3NIV A;  2B3S A;  5IPH A;  4OD7 A;  1GRX A;  3IPZ A;  2YV7 A;  3KGK A;  1AC1 A;  2OKA A;  4HZ2 A;  1DE2 A;  2G2Q A;  3ZRD A;  2FUG 2;  2PPT A;  4I2T A;  4Q5N A;  1H75 A;  2B5X A;  2C0G A;  2YN1 A;  3PR8 A;  2IMF A;  3GUR A;  3KJY A;  3D6I A;  4XHM A;  3GUS A;  3KEB A;  4F9Z A;  3TRX A;  1N2A A;  1KBN A;  4POK A;  3I43 A;  4HUA A;  1BQ7 A;  4TR0 A;  4AGS A;  1SKR B;  1U88 A;  2B6M A;  2LQO A;  2HZE B;  12GS A;  4O7H A;  5B8B A;  2LTK A;  1K0C A;  4PGT A;  5CYY A;  2P0G A;  1X5D A;  2X8C A;  2HNL A;  2OE3 A;  5HR2 A;  10GS A;  4TN8 A;  4FYB A;  2L4Q A;  3M8N A;  2DJ3 A;  4GLT A;  3H1N A;  2GZP A;  4KGI A;  5JWO B;  1QQ2 A;  1SEN A;  3L4N A;  3TKS E;  2KP1 A;  4EO3 A;  2HZE A;  3VPT A;  4PUA A;  1K3Y A;  1UN2 A;  1O7U A;  4ACS A;  3QAV A;  2JAD A;  4KUN A;  2PVQ A;  2YOI A;  2MMO A;  2VL3 A;  2PWJ A;  4O92 A;  1IYH A;  2LJR A;  3A2X A;  3UIW A;  3HCZ A;  1JZO A;  2I9H A;  2YPM A;  4XS1 A;  5IMZ A;  4OFN A;  4OFM A;  4BWQ A;  1T1V A;  3G9B A;  4HS1 A;  4KSM A;  3DRN A;  3MWH A;  3FRC A;  4TR1 B;  2B1K A;  4I6X A;  1X5C A;  2CAI A;  5C04 A;  7GSS A;  4V1A g;  1FB6 A;  1YKC A;  2TRC P;  1MDJ A;  3FYG A;  3IK9 A;  4POL A;  1HNA A;  2AV4 A;  1XBS A;  4MZB A;  5J9C A;  1M2D A;  3RDW A;  5HQP A;  1VRS D;  5JCG A;  4XS6 A;  2WRT A;  5ECK B;  2JZS A;  5KN0 A;  2YWI A;  1A8Y A;  2CV4 A;  2GVP A;  1U3A A;  3MNG A;  2L5L A;  3RPN A;  4FO5 A;  2FCH A;  3J7Y k;  3DIE A;  4XS4 A;  4G19 A;  3DGQ A;  1ERV A;  2HRN A;  3DVX A;  3EYT A;  3KH7 A;  3G7I A;  2ES7 A;  6GSY A;  3QCP A;  2VD0 A;  3BJ5 A;  3N5O A;  2DLX A;  5E59 A;  2K8S A;  5DCG A;  2N5B A;  4K9Z A;  1SYR A;  4IBP A;  1THO A;  3GL3 A;  1E6B A;  4YAP A;  4GCI A;  1GSE A;  2XC2 A;  1DUG A;  1FG4 A;  1M2B A;  2V6O A;  4MH3 A;  1T3B A;  4RQR A;  1THX A;  5A4W A;  4KB3 A;  2WFC A;  19GS A;  3CYN A;  1ZYQ B;  4BVX A;  4GTU A;  1TI1 A;  1ERW A;  3FR6 A;  3G7Y A;  1CQG A;  3ZIV A;  2L6C A;  5FHI A;  2E2G A;  2VLV A;  1K0B A;  4DEJ A;  4HQZ A;  2PMT A;  2D2Z A;  4MH2 A;  5D9V A;  3SWL A;  1TU7 A;  3HJP A;  4AJ7 A;  2WCI A;  2MMN A;  2ON5 A;  1U6T A;  4ZB9 A;  4BWS A;  1G7O A;  3QAG A;  5LCZ A;  2F3M A;  5EY6 A;  1F3A A;  2YAN A;  4KDX A;  4E8E A;  3ZFB A;  2OAD A;  4LLR A;  3TKP A;  4WR5 A;  5L71 A;  1GSY A;  5HR3 A;  1LU4 A;  1Z7P A;  2XPD A;  4GQF A;  1HD2 A;  3GV1 A;  1TJD A;  3L9U A;  3EWL A;  3LQ7 A;  4ISD A;  1URM A;  1XWA A;  2HLS A;  5CNW A;  1GSU A;  5GST A;  2WZ9 A;  2PU9 C;  1T4Y A;  4K2D A;  2IIY A;  2L5O A;  3WYW A;  1WE0 A;  3APQ A;  3QDN A;  2IJY A;  1SJI A;  4F2I A;  4TXV A;  3F4R A;  2N5A A;  4WXT A;  1V9W A;  4ECI A;  1JLV A;  3GX8 A;  4JR6 A;  3JCM L;  1YQ1 A;  4RI7 A;  1AXD A;  3H8Q A;  6GSX A;  1QK8 A;  1EWX A;  1TRU A;  3IOS A;  5HFK A;  1AW9 A;  3C8E A;  1TW9 A;  1Y6E A;  3L9S A;  5GZZ B;  1XWC A;  4ML1 A;  4ZL8 A;  5IIZ A;  3TJB A;  2V32 A;  5AN1 A;  4L0W A;  5HFI A;  5G31 A;  2CZ3 A;  2RUE A;  2C1Y A;  2GGT A;  1GTI A;  3D4T A;  3LWA A;  1X9M B;  1PD2 1;  1YEP A;  8GSS A;  6GSV A;  1SJZ A;  3H93 A;  4Q5R A;  4NHW A;  4HU9 A;  1B9Y C;  2JL4 A;  2IL3 A;  2CX3 A;  4DSS B;  2XBI A;  2PVO C;  5DVB A;  1OKD A;  3D21 A;  4QL9 A;  1AAZ A;  1M7T A;  1OC3 A;  4ZIJ A;  4MPF A;  5EPF A;  4ZXG A;  2B7J A;  3UBL A;  4AJ6 A;  11GS A;  5EL8 A;  4N11 A;  1Z7R A;  2CVK A;  1SL1 B;  3P7X A;  5AIV A;  1BG5 A;  2RM5 A;  3PIN A;  1EOH A;  3IXR A;  3LEF A;  1TDI A;  5B6N A;  4YQU A;  4TRX A;  1GLQ A;  3QOU A;  4H86 A;  1SL0 B;  2FNO A;  4K7O A;  1FHE A;  1XWG A;  1U87 A;  1XW5 A;  5IO2 A;  1HNB A;  3IE3 A;  4I2U A;  2GQK A;  18GS A;  3GHA A;  3M1G A;  2LS5 A;  3GSS A;  3FZA A;  3FK8 A;  4MK3 A;  5CP1 A;  2ZUP A;  2H1B A;  4MAB A;  3O76 A;  4N30 A;  3WGD A;  4IS0 A;  5G30 A;  3O3T A;  3GYK A;  2DIY A;  2GZY A;  2OE0 A;  4MZC A;  4X1U A;  4JBB A;  4F03 A;  3Q18 A;  5F0G A;  1EGR A;  2B5Y A;  1GL8 A;  2VL9 A;  1S3C A;  3HVV A;  1MD4 A;  5FWG A;  1EV9 A;  3CXG A;  3TKQ A;  2DBC A;  4L0U A;  5GAP D;  2GST A;  1OC9 A;  3LXZ A;  3P90 A;  3D22 A;  1X5E A;  4QQ7 A;  1Q4J A;  2MBS A;  2PGT A;  3QAW A;  4KAE A;  3GKN A;  3R2Q A;  4RUV A;  3KP8 A;  4HJM A;  1QUW A;  3ME7 A;  4K7I A;  4TVE A;  4EDY A;  4V2N A;  1JLW A;  5CAX A;  4K0G A;  4TW5 A;  4MLY A;  2VCZ A;  2X8H A;  5H5R A;  2B5E A;  4IEL A;  3PH9 A;  4G2E A;  3M0F A;  1TKD B;  2H72 A;  1QGV A;  4WEY A;  3U6V A;  1PL2 A;  2FWH A;  3CSH A;  4OWY A;  4YH2 A;  2CVB A;  3M9K A;  4WKW A;  3VI5 A;  1V58 A;  6GSW A;  3ZFL A;  3Q6O A;  2B1L A;  1E2Y A;  3H79 A;  5AIS A;  2HSH A;  4PXO A;  2LNS A;  2C3Q A;  3K8N A;  3HVS A;  3GA4 A;  1K3L A;  4EKZ A;  1USB A;  4ECC A;  1RQM A;  1ZMA A;  3QPM A;  3VFI A;  4K1F A;  2QKE A;  4LMV A;  1BYE A;  1GTU A;  3DYR A;  4O32 A;  2R37 A;  4GXZ A;  1DE1 A;  5JWR B;  4WBJ A;  5ECM B;  2VM2 A;  3TRP A;  3A3T A;  3GN3 A;  4IN0 A;  5ECP B;  2FA4 A;  2DML A;  3RPP A;  1A0R P;  2V2G A;  1G0T A;  3UOM A;  1T7P B;  1GSF A;  1G6W A;  1Z6N A;  3EC3 A;  2GT5 A;  2H75 A;  3UEM A;  2C3N A;  2VL2 A;  3HZ4 A;  2YZH A;  3HD5 A;  1PKW A;  3F9U A;  3TJJ A;  3ZZX A;  4WET A;  4FYC A;  13GS A;  3WGX A;  2MZC A;  2WUL A;  1K0O A;  4XCS A;  2CQ9 A;  4HQS A;  3FKF A;  4JR4 A;  1Z9H A;  2RII A;  4MJB A;  4EF0 A;  3ZTL A;  1OC8 A;  2K18 A;  2XHF A;  1KNG A;  3IK7 A;  4EXJ A;  3L0H A;  1ILO A;  1BX9 A;  5IOW A;  3KMN A;  1EZK A;  1WPI A;  4IVF A;  4AJ8 A;  3VWV A;  2YJ7 A;  4JU5 A;  3CSJ A;  5A4V A;  1PX7 A;  3TJF A;  5IMV A;  3KIJ A;  1M9A A;  3ZVJ A;  3E3E A;  4TKY A;  2LKU A;  2VCW A;  3OR5 A;  2O8V B;  3NOF A;  1EP7 A;  5GSS A;  1K0D A;  1VF3 A;  2REM A;  5D9X A;  2LST A;  3H4K A;  3TDG A;  1S3A A;  2LRT A;  3BOA A;  3ERG A;  2GZZ A;  2GTU A;  1YF0 A;  4L5L A;  1GTB A;  4JE1 A;  2MYG A;  4F82 A;  2PBJ A;  2DSA A;  4MJE A;  4KDY A;  4N0V A;  1M9B A;  4KA0 A;  2OA7 A;  1OAZ A;  1W89 A;  1EV4 A;  2B7K A;  1NSW A;  1WRY A;  4KCA A;  4GST A;  2AJQ B;  3KCM A;  3RHB A;  5H5Q A;  3F8U A;  4V2L A;  2LUS A;  1F37 A;  1FVK A;  2O89 A;  4X43 A;  4QL7 A;  2E2M A;  3TKS C;  3MAK A;  5A5K A;  4HEA 2;  3M3M A;  2A2R A;  2WB9 A;  3L78 A;  1JZR A;  1I5G A;  3CTF A;  2NBS A;  2IPA A;  2HFD A;  3A2W A;  4NXI A;  4POB A;  3CRU A;  4CHS A;  3VUR A;  1AIU A;  2WGR A;  1M99 A;  3GTU B;  1TK8 B;  4LL1 B;  3VWW A;  3UJ1 A;  4KSO A;  3C71 A;  3SBC A;  5CRE A;  3TOT A;  1VGL A;  1T8E B;  4GF0 A;  1WOU A;  2TIR A;  3N9J A;  4LA1 A;  4PNG A;  1YDK A;  1B8X A;  5D93 A;  3U5R E;  3TRQ A;  2HRF A;  3GH9 A;  4TR1 A;  2K6V A;  3HXS A;  5B8A A;  1O8X A;  3BBY A;  1ERU A;  5J41 A;  4GQC A;  2GSS A;  3IA1 A;  1R5A A;  1XOB A;  3ZIJ A;  3GTU A;  16GS A;  4ECB A;  1NHO A;  6GSU A;  3GST A;  2YWN A;  1CQH A;  3ERW A;  5IO0 A;  2R6K A;  3LYP A;  1YEX A;  2A4V A;  1XPV A;  2JZT A;  2OAC A;  1TTZ A;  1T4Z A;  2IMK A;  3GNJ A;  5ELA A;  3C1S A;  1FOV A;  3HHV A;  1TU8 A;  2VIM A;  4FYU A;  2F9S A;  4ID0 A;  3GKK A;  5F06 A;  1X9W B;  4D73 B;  4PQH A;  2H76 A;  17GS A;  2M72 A;  4J2F A;  1ERT A;  1PA3 A;  1JZW A;  2P5Q A;  2FY6 A;  3D5J A;  2F51 A;  5AGY A;  3FZ5 A;  4IGJ A;  1YF1 A;  3LGC A;  5IMC A;  5COH A;  1S3D A;  3HY2 A;  3TUE A;  2LEG A;  3GRX A;  1U3I A;  3P2A A;  3IDV A;  3DML A;  4O5R A;  4D73 A;  3E9J B;  4MJC A;  3HYP A;  5G5F A;  2VCX A;  3D0Z A;  5ENU A;  4YAV A;  2LQQ A;  2HYX A;  2C0E A;  2L6D A;  4KH7 A;  2GS3 A;  5ECL B;  1N8J A;  2C3T A;  2FA8 A;  4TR3 A;  1TP9 A;  5G2Z A;  4HZ4 A;  1A2J A;  4MF7 A;  2FWE A;  3UVT A;  4JRR A;  4IP1 A;  1M2A A;  3Q19 A;  1K0N A;  4EUY A;  3VPQ A;  2R5G A;  1A24 A;  2C4J A;  1Y25 A;  2DMM A;  1FW1 A;  3W8J A;  3ERF A;  3NZN A;  1WP0 A;  3UVH A;  3FZ9 A;  2JSZ A;  1F6M C;  1ST9 A;  20GS A;  1K0A A;  2CA8 A;  3V1W A;  1J08 A;  2MMA A;  2HZF A;  4MMM A;  3WD6 A;  4MDC A;  1TRS A;  2E7P A;  4MPG A;  5ID2 B;  2LRN A;  4NV2 A;  1VF4 A;  4P3Y B;  4FH8 A;  5HFG A;  3VWX A;  2H01 A;  3ZVJ D;  2H66 A;  2MBT A;  3QFB C;  3J7Y b;  3ZYW A;  1O85 A;  2H30 A;  3HKR A;  1TOF A;  2ZNM A;  2JU5 A;  1JFU A;  2DC5 A;  1H4O A;  3S9F A;  2O85 A;  1GLP A;  4XRD A;  5DQS A;  2WDU A;  3HJM A;  3I9V 2;  3US3 A;  4KND A;  3LXT A;  4XTS A;  3KP9 A;  3HJO A;  1UC7 A;  5IM9 A;  5ID2 A;  3GH6 A;  3BCK A;  2H8L A;  2H73 A;  1EEJ A;  3LG6 A;  5ECN B;  1F2E A;  2J9H A;  3ZIT A;  2FLS A;  3AY8 A;  4I5Q A;  3WT1 A;  2BJX A;  4DSS A;  2LJA A;  2M80 A;  1BAY A;  1F3B A;  4F0B A;  1GUH A;  5JCW A;  5ECH B;  1PN9 A;  5LNK e;  2XPE A;  5EVO A;  2HI7 A;  1SYX A;  4XIH A;  6GSS A;  4BA7 A;  1SK0 A;  4IP6 A;  5AIX A;  3QMX A;  3KD0 A;  4MP4 A;  1Z5Y E;  1XWK A;  2H1D A;  1AQX A;  1SD8 A;  2CX4 A;  2DIZ A;  4ILF A;  4NV5 A;  1BJX A;  1OKT A;  4I8B A;  1MTC A;  4J57 E;  3CMI A;  4JZQ A;  4V1A p;  3EMX A;  3C1R A;  2ON7 A;  1KEB A;  4GRF A;  1GSD A;  1O8W A;  4Q5F A;  5DAL B;  4BPY A;  4RI6 A;  4G9H A;  1SU9 A;  2QGV A;  5HR1 A;  1FB0 A;  3L9V A;  2G0F A;  5D9W A;  2EIQ A;  3KM6 A;  3IV4 A;  3FEU A;  4KCE A;  1J9B A;  1ZL9 A;  3IBH A;  4DSQ A;  4F0C A;  2FGX A;  1B4P A;  4LL4 B;  2DJ1 A;  2VCV A;  5INY A;  4ZL7 A;  1YJ6 A;  1YY7 A;  4EVM A;  2YV9 A;  4BVY A;  1YKA A;  3APO A;  5DAL A;  4ZL9 A;  3MSZ A;  2PN8 A;  3E0U A;  5LD0 A;  2NVL A;  3C7M A;  2L57 A;  5ECQ B;  1PQN A;  3A2V A;  1G7E A;  2O7K A;  3I69 A;  4K0N A;  5DCH A;  4GWR A;  1R7H A;  1G6Y A;  2R4V A;  3GKM A;  4PNF A;  3QFA C;  2IMI A;  3ZRE A;  3WGE A;  3FZ4 A;  4OO4 A;  2EIR A;  1TRW A;  4E8H A;  3BD2 A;  2H74 A;  1ZGN A;  3DVW A;  4ZIL A;  2DJ2 A;  2H6Z A;  3EUR A;  3IR4 A;  1R4W A;  4L5O A;  4TR4 A;  3KTB A;  1GNE A;  1SK1 A;  3UL3 A;  1Z6M A;  1XFL A;  2YZU A;  2VD1 A;  1B48 A;  2NTO A;  2FWF A;  2RUF A;  1SKW B;  2MMZ A;  2GDR A;  3TKR A;  4HDE A;  1EOG A;  4IHU A;  2CAQ A;  1DBY A;  1UVZ A;  2WJU A;  2YWO A;  1XW6 A;  3M9J A;  2LJK A;  1GUL A;  3EIN A;  4WF5 A;  2I1U A;  3BCI A;  3TGZ A;  2VUP A;  3ISO A;  3EU3 A;  3FR3 A;  5ECS A;  1LJR A;  2VM1 A;  1MDK A;  3FR9 A;  2X64 A;  2O87 A;  2BMX A;  4K6X A;  3ZL5 A;  3EU4 A;  5B6M A;  1PMT A;  1YZX A;  2YCD A;  5D9T A;  1ON4 A;  1ACV A;  1KTE A;  2C80 A;  1X9S B;  1OVN A;  1GUM A;  1TXX A;  4EDZ A;  2JZR A;  2CT6 A;  1GWC A;  4MCU A;  4ZBA A;  5H5S A;  4JED A;  2IN3 A;  2AAW A;  4KDU A;  1O81 A;  1VF2 A;  3EVI A;  3WT2 A;  2CZ2 A;  2NDO A;  1I9D A;  1GTA A;  4ML6 A;  1AQV A;  1X0R A;  3A5W A;  1HQO A;  2I81 A;  2F8F A;  4PUR A;  1R5P A;  4EE0 A;  1A2M A;  3EE2 A;  4K8M A;  3CBU A;  1GSS A;  2ZCT A;  4YQM A;  4V2M A;  3GKX A;  1TK0 B;  2H1G A;  4YQV A;  4TOP A;  1VF1 A;  2H71 A;  3FW2 A;  2KOK A;  1FAA A;  1A2L A;  2OBK A;  1K3O A;  5A4U A;  3F3Q A;  2K9F A;  4NAX A;  1PX6 A;  4HJ2 A;  1F9M A;  5ECR B;  4HOJ A;  4ZBD A;  2VO4 A;  2GQM A;  3ED3 A;  4IW9 A;  1TRV A;  4MJA A;  2VOC A;  3KXO A;  2DJJ A;  5JCU A;  4KE3 A;  5C00 A;  2JAC A;  1PSQ A;  5DAK B;  4KW6 A;  2YP6 A;  4PQI A;  4CW9 A;  1XZO A;  3UAP A;  1FO5 A;  3CSI A;  1A0F A;  3KZQ A;  4ULX A;  3GX0 A;  1T00 A;  4L8E A;  2H6Y A;  2WS2 A;  2LNT A;  5CRH A;  1HYU A;  2KP2 A;  3DEX A;  5J4U A;  22GS A;  5ELG A;  2FD3 A;  4XS4 B;  5KEJ A;  1GUK A;  1J0F A;  4HU7 A;  2K8V A;  5DAK A;  1V57 A;  3TOU A;  1JZD A;  3EMP A;  1HNC A;  5G5E A;  4G10 A;  4IQ1 A;  4WR4 A;  5KN2 A;  2GT6 A;  2VCT A;  5HR0 A;  1V2A A;  3FY7 A;  3KTL A;  4J56 E;  3W8S A;  3ZLP A;  3F4T A;  4Z7X A;  4OCF A;  4ZB6 A;  2AHE A;  5CRW A;  5ABR A;  3VWU A;  2FHE A;  3UMA A;  4RQX A;  3RBT A;  4EL1 A;  4EC0 A;  3O6T A;  3DD3 A;  3LYK A;  2KHP A;  5DJM A;  2R3X A;  2VLT A;  2V41 A;  3APS A;  2BTO T;  5FT3 A;  1RW1 A;  4N10 A;  3LJR A;  4POM A;  9GSS A;  3RHC A;  5KN3 A;  3F6F A;  1NW2 A;  1TK5 B;  2PER A;  3G7J A;  3ZMK A;  2VL2 C;  1EP8 A;  14GS A;  1SJ6 A;  2LRC A;  2H0H A;  1QXH A;  2QC7 A;  1ZYE A;  2HXK A;  1LBK A;  1GSQ A;  1FVJ A;  2EC4 A;  3QD9 A;  2E0Q A;  4MF5 A;  3GFK A;  3VLN A;  3RAZ A;  3UAR A;  5J9B A;  3HVX A;  5E4W A;  4OMV A;  4IJI A;  5IOX A;  5D73 A;  2IMD A;  3CRT A;  5D96 A;  1WMJ A;  3TJK A;  2GLR A;  1AUC A;  4TXO B;  2GSQ A;  2DJK A;  1MDI A;  2HSY A;  3HZ8 A;  4AF2 A;  1ABA A;  2C0D A;  4MZW A;  3IAM 2;  1DSB A;  2LV3 A;  1B9X C;  3GIX A;  2N5F A;  5CRD A;  1MD3 A;  5IPG A;  5G1L A;  2AUV A;  5CO3 A;  4HI7 A;  4DSR A;  3IRA A;  2ALB A;  3KH9 A;  2C8U A;  1PL1 A;  3DWV A;  4TXO A;  1UA5 A;  2DJ0 A;  1GP1 A;  5DDL A;  4KX4 A;  1M0U A;  2P5R A;  2RLI A;  4BL7 A;  4DVC A;  1XXU A;  2M46 A;  3I6A A;  3LSZ A;  4IKH A;  1EEM A;  2AB6 A;  2KLX A;  2I3Y A;  3VI7 A;  5J3R A;  1GH2 A;  3ME8 A;  3C73 A;  1XIY A;  1ZCP A;  3TCO A;  3D4M A;  1QMV A;  5CRG A;  1PRX A;  5DBQ A;  2L4C A;  1XOA A;  1O73 A;  1W4V A;  2GSR A; 
#chains in the Genus database with same CATH topology
 2H0G A;  2L59 A;  4MA9 A;  1GNW A;  2IFQ B;  4NWY A;  2P31 A;  5GAN D;  1R26 A;  3HA9 A;  1ML6 A;  3PGT A;  4OFT A;  1B4Q A;  2H6X A;  4ZBB A;  2OJL A;  2H1A A;  1NHY A;  1MEK A;  3Q74 A;  4CDO A;  3W6G A;  2EIO A;  3F4S A;  1IYI A;  4IQA A;  4PQ1 A;  5JWQ B;  4K7N A;  2V6K A;  3FHK A;  4OO5 A;  5F07 A;  1JHB A;  2IFQ A;  3IC4 A;  4YKG A;  2PUK C;  3GMF A;  3QR6 A;  3F63 A;  2V1M A;  3DXB A;  4NPB A;  3TJG A;  2R2J A;  4LMW A;  2X99 A;  3MDK A;  3IAS 2;  2VLU A;  4N0Z A;  2RM6 A;  5IQY A;  1K0M A;  1V40 A;  2OE1 A;  2TRX A;  2X8G A;  1TI3 A;  3LOR A;  5F05 A;  3UBK A;  2YJH A;  5IMF A;  1XVQ A;  3KMO A;  4ECJ A;  2H0I A;  3F6D A;  1V98 A;  2IME A;  1A8L A;  1EGO A;  3DKS A;  1QFN A;  1OC9 B;  3ZML A;  2HE3 A;  1O6J A;  1SKS B;  2JSY A;  1OYJ A;  2I4A A;  2CVD A;  1SK2 A;  1SL2 B;  4WF4 A;  1SD9 A;  5ECO B;  4X0X A;  2Z9S A;  3IHQ A;  2AYT A;  2A2S A;  2H19 A;  4NHZ A;  3HDC A;  3TKS A;  1XVW A;  4GSN A;  1C72 A;  1Q98 A;  4XRA A;  1ZZY A;  4MF6 A;  4IJ3 A;  5F8B A;  3VK9 A;  2J23 A;  2XBQ A;  3TB2 A;  4Q5Q A;  4PX1 A;  4KF9 A;  5IMD A;  5KN1 A;  3P8W A;  5ECI B;  2OBI A;  2R0C A;  2FWG A;  2QSI A;  4OCE A;  2H70 A;  1BED A;  1Z3E A;  3F3R A;  5DQY A;  5J5N A;  1OE8 A;  4WBR D;  3F0I A;  2GQL A;  1NM3 A;  6GST A;  1XCC A;  4FIW A;  1OE7 A;  4I97 A;  1WWJ A;  5G1K A;  2C0F A;  2VCQ A;  1A23 A;  1PGT A;  2F8A A;  5DJL A;  5IMA A;  4PUF C;  3GL5 A;  1RK4 A;  3CTG A;  5D8I A;  4ZB8 A;  2IWT A;  1XW9 A;  3LFL A;  2YWM A;  1WIK A;  1XWB A;  5B7C A;  1AQW A;  1ZOF A;  2KUC A;  1WJK A;  4NMU A;  2NPB A;  1PKZ A;  2YNX A;  4GSS A;  2VAF A;  2HT9 A;  3NIV A;  2B3S A;  5IPH A;  4OD7 A;  4G0K A;  1GRX A;  3IPZ A;  2YV7 A;  3KGK A;  1AC1 A;  2OKA A;  4HZ2 A;  1DE2 A;  2G2Q A;  3ZRD A;  2FUG 2;  2PPT A;  4I2T A;  4Q5N A;  1H75 A;  2B5X A;  2C0G A;  2YN1 A;  3PR8 A;  2IMF A;  3GUR A;  3KJY A;  3D6I A;  4XHM A;  3GUS A;  3KEB A;  4F9Z A;  3TRX A;  1N2A A;  1KBN A;  4POK A;  3I43 A;  4HUA A;  1BQ7 A;  4TR0 A;  4AGS A;  1SKR B;  1U88 A;  2B6M A;  2LQO A;  2HZE B;  12GS A;  4O7H A;  5B8B A;  2LTK A;  1K0C A;  4PGT A;  5CYY A;  2P0G A;  1X5D A;  2X8C A;  2HNL A;  2OE3 A;  5HR2 A;  10GS A;  4TN8 A;  4FYB A;  2L4Q A;  3M8N A;  2DJ3 A;  4GLT A;  3H1N A;  2GZP A;  4KGI A;  5JWO B;  1QQ2 A;  1SEN A;  3L4N A;  3TKS E;  2KP1 A;  4EO3 A;  2HZE A;  3VPT A;  4PUA A;  1K3Y A;  1UN2 A;  1O7U A;  4ACS A;  3QAV A;  2JAD A;  4KUN A;  2PVQ A;  2X49 A;  2YOI A;  2MMO A;  2VL3 A;  4PTS A;  2PWJ A;  4O92 A;  1IYH A;  2LJR A;  3A2X A;  3UIW A;  3HCZ A;  1JZO A;  2I9H A;  2YPM A;  4XS1 A;  5IMZ A;  4OFN A;  4OFM A;  4BWQ A;  1T1V A;  3G9B A;  4HS1 A;  4KSM A;  3DRN A;  3MWH A;  3FRC A;  4TR1 B;  2B1K A;  4I6X A;  1X5C A;  2CAI A;  5C04 A;  7GSS A;  4V1A g;  1FB6 A;  1YKC A;  2TRC P;  1MDJ A;  3FYG A;  3IK9 A;  4POL A;  1HNA A;  2AV4 A;  1XBS A;  4MZB A;  5J9C A;  1M2D A;  3RDW A;  5HQP A;  1VRS D;  5JCG A;  4XS6 A;  2WRT A;  5ECK B;  2JZS A;  5KN0 A;  2YWI A;  1A8Y A;  2CV4 A;  2GVP A;  1U3A A;  3MNG A;  2L5L A;  3RPN A;  4FO5 A;  2FCH A;  3J7Y k;  3DIE A;  4XS4 A;  4G19 A;  3DGQ A;  4BVX B;  1ERV A;  2HRN A;  3DVX A;  3EYT A;  3KH7 A;  3G7I A;  2ES7 A;  4K5R A;  6GSY A;  3QCP A;  4Z2T A;  2VD0 A;  3BJ5 A;  3N5O A;  2DLX A;  5E59 A;  2K8S A;  5DCG A;  2N5B A;  4K9Z A;  1SYR A;  4IBP A;  1THO A;  3GL3 A;  1E6B A;  4YAP A;  4GCI A;  1GSE A;  2XC2 A;  1DUG A;  1FG4 A;  1M2B A;  2V6O A;  4MH3 A;  1T3B A;  4RQR A;  1THX A;  5A4W A;  2R0P A;  2WFC A;  4KB3 A;  19GS A;  3CYN A;  1ZYQ B;  4BVX A;  4GTU A;  1TI1 A;  1ERW A;  3FR6 A;  4G0L A;  3G7Y A;  1CQG A;  3ZIV A;  4YKF A;  2L6C A;  5FHI A;  2E2G A;  2VLV A;  1K0B A;  4DEJ A;  4HQZ A;  2PMT A;  2D2Z A;  4MH2 A;  5D9V A;  3FMW A;  3SWL A;  1TU7 A;  3HJP A;  4AJ7 A;  2WCI A;  2DKI A;  2MMN A;  2ON5 A;  1U6T A;  4ZB9 A;  4BWS A;  1G7O A;  3QAG A;  5LCZ A;  2F3M A;  5EY6 A;  1F3A A;  2YAN A;  4KDX A;  4E8E A;  3ZFB A;  2OAD A;  4LLR A;  3TKP A;  4WR5 A;  5L71 A;  1GSY A;  5HR3 A;  1LU4 A;  1Z7P A;  2XPD A;  4GQF A;  1HD2 A;  3GV1 A;  1TJD A;  3L9U A;  3EWL A;  3LQ7 A;  4ISD A;  1URM A;  1XWA A;  2HLS A;  5CNW A;  4A5P A;  1GSU A;  5GST A;  2WZ9 A;  2PU9 C;  1T4Y A;  4K2D A;  2IIY A;  2L5O A;  3WYW A;  1WE0 A;  3APQ A;  3QDN A;  2IJY A;  1SJI A;  4F2I A;  4TXV A;  3F4R A;  2N5A A;  4WXT A;  1V9W A;  4ECI A;  1JLV A;  3GX8 A;  4JR6 A;  3JCM L;  1YQ1 A;  4RI7 A;  1AXD A;  3H8Q A;  6GSX A;  1QK8 A;  1EWX A;  1TRU A;  3IOS A;  5HFK A;  1AW9 A;  3C8E A;  1TW9 A;  1Y6E A;  3L9S A;  5GZZ B;  1XWC A;  4ML1 A;  4ZL8 A;  5IIZ A;  3TJB A;  2V32 A;  5AN1 A;  4L0W A;  5HFI A;  5G31 A;  2CZ3 A;  2RUE A;  2C1Y A;  2GGT A;  1GTI A;  3D4T A;  3LWA A;  1X9M B;  3MYD A;  1PD2 1;  1YEP A;  8GSS A;  6GSV A;  1SJZ A;  3H93 A;  4Q5R A;  4NHW A;  4HU9 A;  1B9Y C;  2JL4 A;  2IL3 A;  2CX3 A;  4DSS B;  2XBI A;  2PVO C;  5DVB A;  1OKD A;  3D21 A;  4QL9 A;  4G0I A;  1AAZ A;  1M7T A;  1OC3 A;  4ZIJ A;  4MPF A;  5EPF A;  4ZXG A;  2B7J A;  3UBL A;  4AJ6 A;  11GS A;  5EL8 A;  4N11 A;  1Z7R A;  2CVK A;  2R0G A;  3P7X A;  1SL1 B;  5AIV A;  1BG5 A;  2RM5 A;  3PIN A;  1EOH A;  4ICY A;  3IXR A;  3LEF A;  3CQF A;  1TDI A;  5B6N A;  4YQU A;  4TRX A;  1GLQ A;  3QOU A;  4H86 A;  1SL0 B;  2FNO A;  4K7O A;  1FHE A;  1XWG A;  1U87 A;  1XW5 A;  5IO2 A;  1HNB A;  3IE3 A;  4I2U A;  2GQK A;  18GS A;  3GHA A;  3M1G A;  2LS5 A;  3GSS A;  3FZA A;  3FK8 A;  4MK3 A;  5CP1 A;  2ZUP A;  2H1B A;  4MAB A;  3O76 A;  4N30 A;  3WGD A;  4IS0 A;  5G30 A;  3O3T A;  3GYK A;  2DIY A;  2GZY A;  2OE0 A;  4MZC A;  4X1U A;  4JBB A;  4F03 A;  3HVN A;  3A5I A;  3Q18 A;  5F0G A;  1EGR A;  2B5Y A;  1GL8 A;  2VL9 A;  5BRT A;  1S3C A;  3HVV A;  1MD4 A;  5FWG A;  1EV9 A;  3CXG A;  3TKQ A;  2DBC A;  4EIQ A;  4L0U A;  5GAP D;  2GST A;  1OC9 A;  3LXZ A;  3P90 A;  3D22 A;  1X5E A;  4QQ7 A;  1Q4J A;  2MBS A;  2PGT A;  3QAW A;  4KAE A;  3GKN A;  3R2Q A;  4RUV A;  3KP8 A;  4HJM A;  1QUW A;  3ME7 A;  4K7I A;  4TVE A;  4EDY A;  4V2N A;  1JLW A;  5CAX A;  4K0G A;  4TW5 A;  4MLY A;  2VCZ A;  2X8H A;  5H5R A;  2B5E A;  4IEL A;  3PH9 A;  4G2E A;  3M0F A;  1TKD B;  2H72 A;  1QGV A;  4WEY A;  3U6V A;  1PL2 A;  2FWH A;  3CSH A;  4OWY A;  4YH2 A;  2CVB A;  3M9K A;  4WKW A;  3VI5 A;  1V58 A;  6GSW A;  3ZFL A;  3Q6O A;  2B1L A;  1E2Y A;  3H79 A;  5AIS A;  2HSH A;  4PXO A;  2LNS A;  2C3Q A;  1PN0 A;  3K8N A;  3HVS A;  3GA4 A;  1K3L A;  4EKZ A;  1USB A;  4ECC A;  1RQM A;  1ZMA A;  3QPM A;  3VFI A;  4K1F A;  2QKE A;  4LMV A;  1BYE A;  1GTU A;  3DYR A;  4O32 A;  2R37 A;  4GXZ A;  1DE1 A;  5JWR B;  4CY8 A;  4WBJ A;  5ECM B;  2VM2 A;  3TRP A;  3A3T A;  3GN3 A;  4IN0 A;  5ECP B;  2FA4 A;  2DML A;  3RPP A;  3R3E A;  1A0R P;  2V2G A;  1G0T A;  3UOM A;  1T7P B;  1GSF A;  1G6W A;  1Z6N A;  3EC3 A;  2GT5 A;  2H75 A;  3UEM A;  2C3N A;  2VL2 A;  3HZ4 A;  2YZH A;  3HD5 A;  1PKW A;  3F9U A;  3TJJ A;  3ZZX A;  4WET A;  4FYC A;  13GS A;  4MNN A;  3WGX A;  1ZYN A;  2MZC A;  2WUL A;  1K0O A;  4XCS A;  2CQ9 A;  4HQS A;  3FKF A;  4JR4 A;  1Z9H A;  2RII A;  4MJB A;  4EF0 A;  3ZTL A;  1OC8 A;  2K18 A;  2XHF A;  1KNG A;  3IK7 A;  4EXJ A;  3L0H A;  1ILO A;  1BX9 A;  5IOW A;  3KMN A;  4Z2R A;  1EZK A;  1WPI A;  4IVF A;  4AJ8 A;  3VWV A;  2YJ7 A;  4JU5 A;  3CSJ A;  5A4V A;  1PX7 A;  3TJF A;  5IMV A;  3KIJ A;  1M9A A;  3ZVJ A;  3E3E A;  4TKY A;  2LKU A;  2VCW A;  3OR5 A;  2O8V B;  3NOF A;  1EP7 A;  5GSS A;  1K0D A;  1VF3 A;  2REM A;  5D9X A;  2LST A;  3H4K A;  3TDG A;  1S3A A;  2LRT A;  3BOA A;  3ERG A;  2GZZ A;  2GTU A;  1YF0 A;  4L5L A;  5BMU A;  1GTB A;  4JE1 A;  2MYG A;  4F82 A;  2PBJ A;  2DSA A;  4MJE A;  4KDY A;  4N0V A;  1M9B A;  4FQU A;  4KA0 A;  2OA7 A;  1OAZ A;  1W89 A;  1EV4 A;  2B7K A;  1NSW A;  1WRY A;  4KCA A;  4GST A;  2AJQ B;  3KCM A;  3RHB A;  5H5Q A;  3F8U A;  4V2L A;  2LUS A;  1F37 A;  1FVK A;  2O89 A;  4X43 A;  4QL7 A;  2E2M A;  3TKS C;  2QA2 A;  3MAK A;  5A5K A;  4HEA 2;  3M3M A;  2A2R A;  2WB9 A;  3L78 A;  1JZR A;  1I5G A;  3CTF A;  2NBS A;  2IPA A;  2HFD A;  3A2W A;  4NXI A;  4POB A;  3CRU A;  4CHS A;  3VUR A;  1AIU A;  2WGR A;  1M99 A;  3GTU B;  1TK8 B;  4LL1 B;  3VWW A;  3UJ1 A;  4KSO A;  3C71 A;  3SBC A;  5CRE A;  3TOT A;  1VGL A;  1T8E B;  4GF0 A;  1WOU A;  2TIR A;  3N9J A;  4LA1 A;  4PNG A;  1YDK A;  1S3R A;  1B8X A;  5D93 A;  3U5R E;  3TRQ A;  2HRF A;  3GH9 A;  4TR1 A;  2K6V A;  3HXS A;  5B8A A;  1O8X A;  3BBY A;  1ERU A;  5J41 A;  4GQC A;  2GSS A;  3IA1 A;  1R5A A;  1XOB A;  3ZIJ A;  3GTU A;  16GS A;  4ECB A;  1NHO A;  6GSU A;  3GST A;  2YWN A;  1CQH A;  2HSM A;  3ERW A;  5IO0 A;  2R6K A;  3LYP A;  1YEX A;  2A4V A;  1XPV A;  2JZT A;  2OAC A;  1TTZ A;  1T4Z A;  4USS A;  2IMK A;  3GNJ A;  5ELA A;  3C1S A;  1FOV A;  3HHV A;  1TU8 A;  2VIM A;  4Z2U A;  4FYU A;  2F9S A;  4ID0 A;  5KOW A;  1XG8 A;  3GKK A;  5F06 A;  1X9W B;  4D73 B;  4PQH A;  2H76 A;  17GS A;  2M72 A;  4J2F A;  1ERT A;  1PA3 A;  1JZW A;  2P5Q A;  2FY6 A;  3D5J A;  2F51 A;  5AGY A;  3FZ5 A;  4IGJ A;  1YF1 A;  2X4A A;  3LGC A;  5IMC A;  5COH A;  1S3D A;  3HY2 A;  3TUE A;  2LEG A;  3GRX A;  1U3I A;  1M3I A;  3P2A A;  3IDV A;  3DML A;  4O5R A;  4D73 A;  3E9J B;  4MJC A;  3HYP A;  5G5F A;  2VCX A;  3D0Z A;  5ENU A;  4YAV A;  2LQQ A;  2HYX A;  2C0E A;  2L6D A;  4KH7 A;  2GS3 A;  5ECL B;  1N8J A;  2C3T A;  2FA8 A;  4TR3 A;  1TP9 A;  5G2Z A;  4HZ4 A;  1A2J A;  4MF7 A;  2FWE A;  3UVT A;  4JRR A;  4BL7 B;  4IP1 A;  1M2A A;  3Q19 A;  1K0N A;  4EUY A;  3VPQ A;  2R5G A;  1A24 A;  2C4J A;  1Y25 A;  2DMM A;  1FW1 A;  3W8J A;  3ERF A;  3NZN A;  1WP0 A;  3UVH A;  3FZ9 A;  1FOH A;  2JSZ A;  1F6M C;  1ST9 A;  20GS A;  1K0A A;  2CA8 A;  3V1W A;  1J08 A;  2MMA A;  2HZF A;  1ZYP A;  4MMM A;  3WD6 A;  4MDC A;  1TRS A;  2QA1 A;  2E7P A;  4MPG A;  5ID2 B;  2LRN A;  4NV2 A;  1VF4 A;  4P3Y B;  4FH8 A;  5HFG A;  3VWX A;  2H01 A;  3ZVJ D;  2H66 A;  2MBT A;  3IHG A;  3QFB C;  3J7Y b;  3ZYW A;  1O85 A;  2H30 A;  3HKR A;  1TOF A;  2ZNM A;  2JU5 A;  1JFU A;  2DC5 A;  1H4O A;  3S9F A;  2O85 A;  1GLP A;  4XRD A;  5DQS A;  2WDU A;  3HJM A;  3I9V 2;  3US3 A;  4KND A;  3LXT A;  4XTS A;  3KP9 A;  3HJO A;  4EIP A;  1UC7 A;  5IM9 A;  5ID2 A;  3GH6 A;  3BCK A;  2H8L A;  2H73 A;  1EEJ A;  3LG6 A;  5ECN B;  1F2E A;  2J9H A;  3ZIT A;  2FLS A;  3AY8 A;  4I5Q A;  3WT1 A;  2BJX A;  4DSS A;  2LJA A;  2M80 A;  1BAY A;  1F3B A;  4F0B A;  1GUH A;  5JCW A;  5ECH B;  1PN9 A;  5LNK e;  2XPE A;  5EVO A;  2HI7 A;  1SYX A;  4XIH A;  6GSS A;  4BA7 A;  1SK0 A;  4IP6 A;  5AIX A;  3QMX A;  3KD0 A;  4MP4 A;  1Z5Y E;  1XWK A;  2H1D A;  1AQX A;  1SD8 A;  2CX4 A;  2DIZ A;  4ILF A;  4NV5 A;  1BJX A;  1OKT A;  4I8B A;  1MTC A;  4J57 E;  3CMI A;  3MIX A;  4JZQ A;  4V1A p;  3EMX A;  3C1R A;  2ON7 A;  1KEB A;  4GRF A;  4BVY B;  1GSD A;  1O8W A;  4Q5F A;  5DAL B;  4BPY A;  4RI6 A;  4G9H A;  1SU9 A;  2QGV A;  5HR1 A;  1FB0 A;  3L9V A;  2G0F A;  5D9W A;  2EIQ A;  3KM6 A;  3IV4 A;  3FEU A;  4KCE A;  1J9B A;  1ZL9 A;  3IBH A;  4DSQ A;  4F0C A;  2FGX A;  1B4P A;  4LL4 B;  2DJ1 A;  2VCV A;  5INY A;  4ZL7 A;  1YJ6 A;  1YY7 A;  4EVM A;  2YV9 A;  4BVY A;  1YKA A;  3APO A;  5DAL A;  4ZL9 A;  3MSZ A;  2PN8 A;  3E0U A;  5LD0 A;  2NVL A;  3C7M A;  2L57 A;  5ECQ B;  1PQN A;  3A2V A;  2HRA A;  1G7E A;  2O7K A;  3I69 A;  4K0N A;  4O5Q A;  5DCH A;  4GWR A;  1R7H A;  1G6Y A;  2R4V A;  3GKM A;  4PNF A;  3QFA C;  2IMI A;  3ZRE A;  3WGE A;  3FZ4 A;  4OO4 A;  2EIR A;  1TRW A;  4E8H A;  3BD2 A;  2H74 A;  1ZGN A;  3DVW A;  4ZIL A;  2DJ2 A;  2H6Z A;  3EUR A;  3IR4 A;  1R4W A;  4L5O A;  4TR4 A;  3KTB A;  1GNE A;  1SK1 A;  3UL3 A;  1Z6M A;  1XFL A;  2YZU A;  2VD1 A;  2UZ8 A;  1B48 A;  2NTO A;  2FWF A;  2RUF A;  1SKW B;  2MMZ A;  2GDR A;  3TKR A;  4HDE A;  1EOG A;  4IHU A;  2CAQ A;  1DBY A;  1UVZ A;  2WJU A;  2YWO A;  1XW6 A;  3M9J A;  2LJK A;  1GUL A;  3EIN A;  4WF5 A;  2I1U A;  3BCI A;  3TGZ A;  2VUP A;  3ISO A;  3EU3 A;  3FR3 A;  4X4J A;  5ECS A;  1LJR A;  2VM1 A;  1MDK A;  3FR9 A;  2X64 A;  4CY6 A;  2O87 A;  2BMX A;  4K6X A;  3ZL5 A;  3EU4 A;  5B6M A;  1PMT A;  1YZX A;  2YCD A;  5D9T A;  1ON4 A;  1ACV A;  1KTE A;  2C80 A;  1X9S B;  1OVN A;  1GUM A;  1TXX A;  4EDZ A;  2JZR A;  2CT6 A;  4BIK A;  1GWC A;  4MCU A;  4ZBA A;  4K2X A;  5H5S A;  4JED A;  2IN3 A;  2AAW A;  4KDU A;  1O81 A;  1VF2 A;  3EVI A;  4HSC X;  3WT2 A;  2CZ2 A;  2NDO A;  1I9D A;  1GTA A;  4ML6 A;  1AQV A;  1X0R A;  3A5W A;  1HQO A;  2I81 A;  2F8F A;  4PUR A;  1R5P A;  4EE0 A;  1M3J A;  1A2M A;  2A4H A;  3EE2 A;  4K8M A;  2HRK A;  3CBU A;  1GSS A;  2ZCT A;  4YQM A;  1PFO A;  4V2M A;  3GKX A;  1TK0 B;  2H1G A;  4YQV A;  4TOP A;  1VF1 A;  2H71 A;  3FW2 A;  2KOK A;  3IC8 A;  1FAA A;  1A2L A;  2OBK A;  1K3O A;  5A4U A;  3F3Q A;  2K9F A;  4NAX A;  1PX6 A;  4HJ2 A;  1F9M A;  5ECR B;  4HOJ A;  4O5U A;  4ZBD A;  2VO4 A;  2GQM A;  3ED3 A;  4IW9 A;  1TRV A;  4MJA A;  2VOC A;  3KXO A;  2DJJ A;  5JCU A;  4KE3 A;  5C00 A;  2JAC A;  1PSQ A;  5DAK B;  4KW6 A;  2YP6 A;  4PQI A;  4CW9 A;  1XZO A;  3UAP A;  1FO5 A;  3CSI A;  1A0F A;  3KZQ A;  4ULX A;  3GX0 A;  1T00 A;  4L8E A;  2H6Y A;  2WS2 A;  2LNT A;  5CRH A;  1HYU A;  2KP2 A;  3DEX A;  5J4U A;  22GS A;  5ELG A;  2FD3 A;  4XS4 B;  5KEJ A;  1GUK A;  1J0F A;  4HU7 A;  2K8V A;  5DAK A;  1V57 A;  3TOU A;  1JZD A;  3EMP A;  1HNC A;  5G5E A;  4G10 A;  4IQ1 A;  4WR4 A;  5KN2 A;  2GT6 A;  2VCT A;  5HR0 A;  1V2A A;  3FY7 A;  3KTL A;  4J56 E;  3W8S A;  3ZLP A;  3F4T A;  3EPT A;  4Z7X A;  4OCF A;  4ZB6 A;  2AHE A;  5CRW A;  5ABR A;  3VWU A;  2FHE A;  3UMA A;  4RQX A;  3RBT A;  4EL1 A;  4EC0 A;  3O6T A;  3DD3 A;  3LYK A;  2KHP A;  5DJM A;  2R3X A;  2VLT A;  2V41 A;  3APS A;  2BTO T;  5FT3 A;  1RW1 A;  4N10 A;  3LJR A;  4POM A;  9GSS A;  3RHC A;  5KN3 A;  3F6F A;  1NW2 A;  1TK5 B;  2PER A;  3G7J A;  3ZMK A;  2VL2 C;  1EP8 A;  3LW9 A;  14GS A;  1SJ6 A;  2LRC A;  2H0H A;  1QXH A;  2QC7 A;  1ZYE A;  2HXK A;  1LBK A;  1GSQ A;  1FVJ A;  2EC4 A;  3QD9 A;  2E0Q A;  4MF5 A;  3GFK A;  3VLN A;  3RAZ A;  3UAR A;  5J9B A;  3HVX A;  5E4W A;  4OMV A;  4IJI A;  5IOX A;  5D73 A;  2IMD A;  3CRT A;  5D96 A;  1WMJ A;  3TJK A;  2GLR A;  1AUC A;  4TXO B;  2GSQ A;  2DJK A;  1MDI A;  2HSY A;  3HZ8 A;  4AF2 A;  1ABA A;  2C0D A;  4MZW A;  3IAM 2;  1DSB A;  2LV3 A;  1B9X C;  3GIX A;  2N5F A;  5CRD A;  1MD3 A;  5IPG A;  5G1L A;  2AUV A;  5CO3 A;  4HI7 A;  4DSR A;  3IRA A;  2ALB A;  2A2P A;  3KH9 A;  2C8U A;  1PL1 A;  3DWV A;  4TXO A;  1UA5 A;  2DJ0 A;  1GP1 A;  5DDL A;  4KX4 A;  1M0U A;  2P5R A;  2RLI A;  4BL7 A;  4DVC A;  1XXU A;  2M46 A;  3I6A A;  3LSZ A;  2DKH A;  4IKH A;  1EEM A;  2AB6 A;  2KLX A;  2I3Y A;  3VI7 A;  5J3R A;  5KOX A;  1GH2 A;  3PPU A;  3ME8 A;  3C73 A;  4K5S A;  1XIY A;  1ZCP A;  3TCO A;  3D4M A;  1QMV A;  5CRG A;  1PRX A;  5DBQ A;  2L4C A;  1XOA A;  1O73 A;  1W4V A;  2GSR A; 
#chains in the Genus database with same CATH homology
 2H0G A;  2L59 A;  4MA9 A;  1GNW A;  2IFQ B;  4NWY A;  2P31 A;  5GAN D;  1R26 A;  3HA9 A;  1ML6 A;  3PGT A;  4OFT A;  1B4Q A;  2H6X A;  4ZBB A;  2OJL A;  2H1A A;  1NHY A;  1MEK A;  3Q74 A;  4CDO A;  3W6G A;  2EIO A;  3F4S A;  1IYI A;  4IQA A;  4PQ1 A;  5JWQ B;  4K7N A;  2V6K A;  3FHK A;  4OO5 A;  5F07 A;  1JHB A;  2IFQ A;  3IC4 A;  4YKG A;  2PUK C;  3GMF A;  3QR6 A;  3F63 A;  2V1M A;  3DXB A;  4NPB A;  3TJG A;  2R2J A;  4LMW A;  2X99 A;  3MDK A;  3IAS 2;  2VLU A;  4N0Z A;  2RM6 A;  5IQY A;  1K0M A;  1V40 A;  2OE1 A;  2TRX A;  2X8G A;  1TI3 A;  3LOR A;  5F05 A;  3UBK A;  2YJH A;  5IMF A;  1XVQ A;  3KMO A;  4ECJ A;  2H0I A;  3F6D A;  1V98 A;  2IME A;  1A8L A;  1EGO A;  3DKS A;  1QFN A;  1OC9 B;  3ZML A;  2HE3 A;  1O6J A;  1SKS B;  2JSY A;  1OYJ A;  2I4A A;  2CVD A;  1SK2 A;  1SL2 B;  4WF4 A;  1SD9 A;  5ECO B;  4X0X A;  2Z9S A;  3IHQ A;  2AYT A;  2A2S A;  2H19 A;  4NHZ A;  3HDC A;  3TKS A;  1XVW A;  4GSN A;  1C72 A;  1Q98 A;  4XRA A;  1ZZY A;  4MF6 A;  4IJ3 A;  5F8B A;  3VK9 A;  2J23 A;  2XBQ A;  3TB2 A;  4Q5Q A;  4PX1 A;  4KF9 A;  5IMD A;  5KN1 A;  3P8W A;  5ECI B;  2OBI A;  2R0C A;  2FWG A;  2QSI A;  4OCE A;  2H70 A;  1BED A;  1Z3E A;  3F3R A;  5DQY A;  5J5N A;  1OE8 A;  4WBR D;  3F0I A;  2GQL A;  1NM3 A;  6GST A;  1XCC A;  4FIW A;  1OE7 A;  4I97 A;  1WWJ A;  5G1K A;  2C0F A;  2VCQ A;  1A23 A;  1PGT A;  2F8A A;  5DJL A;  5IMA A;  4PUF C;  3GL5 A;  1RK4 A;  3CTG A;  5D8I A;  4ZB8 A;  2IWT A;  1XW9 A;  3LFL A;  2YWM A;  1WIK A;  1XWB A;  5B7C A;  1AQW A;  1ZOF A;  2KUC A;  1WJK A;  4NMU A;  2NPB A;  1PKZ A;  2YNX A;  4GSS A;  2VAF A;  2HT9 A;  3NIV A;  2B3S A;  5IPH A;  4OD7 A;  4G0K A;  1GRX A;  3IPZ A;  2YV7 A;  3KGK A;  1AC1 A;  2OKA A;  4HZ2 A;  1DE2 A;  2G2Q A;  3ZRD A;  2FUG 2;  2PPT A;  4I2T A;  4Q5N A;  1H75 A;  2B5X A;  2C0G A;  2YN1 A;  3PR8 A;  2IMF A;  3GUR A;  3KJY A;  3D6I A;  4XHM A;  3GUS A;  3KEB A;  4F9Z A;  3TRX A;  1N2A A;  1KBN A;  4POK A;  3I43 A;  4HUA A;  1BQ7 A;  4TR0 A;  4AGS A;  1SKR B;  1U88 A;  2B6M A;  2LQO A;  2HZE B;  12GS A;  4O7H A;  5B8B A;  2LTK A;  1K0C A;  4PGT A;  5CYY A;  2P0G A;  1X5D A;  2X8C A;  2HNL A;  2OE3 A;  5HR2 A;  10GS A;  4TN8 A;  4FYB A;  2L4Q A;  3M8N A;  2DJ3 A;  4GLT A;  3H1N A;  2GZP A;  4KGI A;  5JWO B;  1QQ2 A;  1SEN A;  3L4N A;  3TKS E;  2KP1 A;  4EO3 A;  2HZE A;  3VPT A;  4PUA A;  1K3Y A;  1UN2 A;  1O7U A;  4ACS A;  3QAV A;  2JAD A;  4KUN A;  2PVQ A;  2X49 A;  2YOI A;  2MMO A;  2VL3 A;  4PTS A;  2PWJ A;  4O92 A;  1IYH A;  2LJR A;  3A2X A;  3UIW A;  3HCZ A;  1JZO A;  2I9H A;  2YPM A;  4XS1 A;  5IMZ A;  4OFN A;  4OFM A;  4BWQ A;  1T1V A;  3G9B A;  4HS1 A;  4KSM A;  3DRN A;  3MWH A;  3FRC A;  4TR1 B;  2B1K A;  4I6X A;  1X5C A;  2CAI A;  5C04 A;  7GSS A;  4V1A g;  1FB6 A;  1YKC A;  2TRC P;  1MDJ A;  3FYG A;  3IK9 A;  4POL A;  1HNA A;  2AV4 A;  1XBS A;  4MZB A;  5J9C A;  1M2D A;  3RDW A;  5HQP A;  1VRS D;  5JCG A;  4XS6 A;  2WRT A;  5ECK B;  2JZS A;  5KN0 A;  2YWI A;  1A8Y A;  2CV4 A;  2GVP A;  1U3A A;  3MNG A;  2L5L A;  3RPN A;  4FO5 A;  2FCH A;  3J7Y k;  3DIE A;  4XS4 A;  4G19 A;  3DGQ A;  4BVX B;  1ERV A;  2HRN A;  3DVX A;  3EYT A;  3KH7 A;  3G7I A;  2ES7 A;  4K5R A;  6GSY A;  3QCP A;  4Z2T A;  2VD0 A;  3BJ5 A;  3N5O A;  2DLX A;  5E59 A;  2K8S A;  5DCG A;  2N5B A;  4K9Z A;  1SYR A;  4IBP A;  1THO A;  3GL3 A;  1E6B A;  4YAP A;  4GCI A;  1GSE A;  2XC2 A;  1DUG A;  1FG4 A;  1M2B A;  2V6O A;  4MH3 A;  1T3B A;  4RQR A;  1THX A;  5A4W A;  2R0P A;  2WFC A;  4KB3 A;  19GS A;  3CYN A;  1ZYQ B;  4BVX A;  4GTU A;  1TI1 A;  1ERW A;  3FR6 A;  4G0L A;  3G7Y A;  1CQG A;  3ZIV A;  4YKF A;  2L6C A;  5FHI A;  2E2G A;  2VLV A;  1K0B A;  4DEJ A;  4HQZ A;  2PMT A;  2D2Z A;  4MH2 A;  5D9V A;  3FMW A;  3SWL A;  1TU7 A;  3HJP A;  4AJ7 A;  2WCI A;  2DKI A;  2MMN A;  2ON5 A;  1U6T A;  4ZB9 A;  4BWS A;  1G7O A;  3QAG A;  5LCZ A;  2F3M A;  5EY6 A;  1F3A A;  2YAN A;  4KDX A;  4E8E A;  3ZFB A;  2OAD A;  4LLR A;  3TKP A;  4WR5 A;  5L71 A;  1GSY A;  5HR3 A;  1LU4 A;  1Z7P A;  2XPD A;  4GQF A;  1HD2 A;  3GV1 A;  1TJD A;  3L9U A;  3EWL A;  3LQ7 A;  4ISD A;  1URM A;  1XWA A;  2HLS A;  5CNW A;  4A5P A;  1GSU A;  5GST A;  2WZ9 A;  2PU9 C;  1T4Y A;  4K2D A;  2IIY A;  2L5O A;  3WYW A;  1WE0 A;  3APQ A;  3QDN A;  2IJY A;  1SJI A;  4F2I A;  4TXV A;  3F4R A;  2N5A A;  4WXT A;  1V9W A;  4ECI A;  1JLV A;  3GX8 A;  4JR6 A;  3JCM L;  1YQ1 A;  4RI7 A;  1AXD A;  3H8Q A;  6GSX A;  1QK8 A;  1EWX A;  1TRU A;  3IOS A;  5HFK A;  1AW9 A;  3C8E A;  1TW9 A;  1Y6E A;  3L9S A;  5GZZ B;  1XWC A;  4ML1 A;  4ZL8 A;  5IIZ A;  3TJB A;  2V32 A;  5AN1 A;  4L0W A;  5HFI A;  5G31 A;  2CZ3 A;  2RUE A;  2C1Y A;  2GGT A;  1GTI A;  3D4T A;  3LWA A;  1X9M B;  3MYD A;  1PD2 1;  1YEP A;  8GSS A;  6GSV A;  1SJZ A;  3H93 A;  4Q5R A;  4NHW A;  4HU9 A;  1B9Y C;  2JL4 A;  2IL3 A;  2CX3 A;  4DSS B;  2XBI A;  2PVO C;  5DVB A;  1OKD A;  3D21 A;  4QL9 A;  4G0I A;  1AAZ A;  1M7T A;  1OC3 A;  4ZIJ A;  4MPF A;  5EPF A;  4ZXG A;  2B7J A;  3UBL A;  4AJ6 A;  11GS A;  5EL8 A;  4N11 A;  1Z7R A;  2CVK A;  2R0G A;  3P7X A;  1SL1 B;  5AIV A;  1BG5 A;  2RM5 A;  3PIN A;  1EOH A;  4ICY A;  3IXR A;  3LEF A;  1TDI A;  5B6N A;  4YQU A;  4TRX A;  1GLQ A;  3QOU A;  4H86 A;  1SL0 B;  2FNO A;  4K7O A;  1FHE A;  1XWG A;  1U87 A;  1XW5 A;  5IO2 A;  1HNB A;  3IE3 A;  4I2U A;  2GQK A;  18GS A;  3GHA A;  3M1G A;  2LS5 A;  3GSS A;  3FZA A;  3FK8 A;  4MK3 A;  5CP1 A;  2ZUP A;  2H1B A;  4MAB A;  3O76 A;  4N30 A;  3WGD A;  4IS0 A;  5G30 A;  3O3T A;  3GYK A;  2DIY A;  2GZY A;  2OE0 A;  4MZC A;  4X1U A;  4JBB A;  4F03 A;  3A5I A;  3Q18 A;  5F0G A;  1EGR A;  2B5Y A;  1GL8 A;  2VL9 A;  5BRT A;  1S3C A;  3HVV A;  1MD4 A;  5FWG A;  1EV9 A;  3CXG A;  3TKQ A;  2DBC A;  4EIQ A;  4L0U A;  5GAP D;  2GST A;  1OC9 A;  3LXZ A;  3P90 A;  3D22 A;  1X5E A;  4QQ7 A;  1Q4J A;  2MBS A;  2PGT A;  3QAW A;  4KAE A;  3GKN A;  3R2Q A;  4RUV A;  3KP8 A;  4HJM A;  1QUW A;  3ME7 A;  4K7I A;  4TVE A;  4EDY A;  4V2N A;  1JLW A;  5CAX A;  4K0G A;  4TW5 A;  4MLY A;  2VCZ A;  2X8H A;  5H5R A;  2B5E A;  4IEL A;  3PH9 A;  4G2E A;  3M0F A;  1TKD B;  2H72 A;  1QGV A;  4WEY A;  3U6V A;  1PL2 A;  2FWH A;  3CSH A;  4OWY A;  4YH2 A;  2CVB A;  3M9K A;  4WKW A;  3VI5 A;  1V58 A;  6GSW A;  3ZFL A;  3Q6O A;  2B1L A;  1E2Y A;  3H79 A;  5AIS A;  2HSH A;  4PXO A;  2LNS A;  2C3Q A;  1PN0 A;  3K8N A;  3HVS A;  3GA4 A;  1K3L A;  4EKZ A;  1USB A;  4ECC A;  1RQM A;  1ZMA A;  3QPM A;  3VFI A;  4K1F A;  2QKE A;  4LMV A;  1BYE A;  1GTU A;  3DYR A;  4O32 A;  2R37 A;  4GXZ A;  1DE1 A;  5JWR B;  4CY8 A;  4WBJ A;  5ECM B;  2VM2 A;  3TRP A;  3A3T A;  3GN3 A;  4IN0 A;  5ECP B;  2FA4 A;  2DML A;  3RPP A;  3R3E A;  1A0R P;  2V2G A;  1G0T A;  3UOM A;  1T7P B;  1GSF A;  1G6W A;  1Z6N A;  3EC3 A;  2GT5 A;  2H75 A;  3UEM A;  2C3N A;  2VL2 A;  3HZ4 A;  2YZH A;  3HD5 A;  1PKW A;  3F9U A;  3TJJ A;  3ZZX A;  4WET A;  4FYC A;  13GS A;  4MNN A;  3WGX A;  1ZYN A;  2MZC A;  2WUL A;  1K0O A;  4XCS A;  2CQ9 A;  4HQS A;  3FKF A;  4JR4 A;  1Z9H A;  2RII A;  4MJB A;  4EF0 A;  3ZTL A;  1OC8 A;  2K18 A;  2XHF A;  1KNG A;  3IK7 A;  4EXJ A;  3L0H A;  1ILO A;  1BX9 A;  5IOW A;  3KMN A;  4Z2R A;  1EZK A;  1WPI A;  4IVF A;  4AJ8 A;  3VWV A;  2YJ7 A;  4JU5 A;  3CSJ A;  5A4V A;  1PX7 A;  3TJF A;  5IMV A;  3KIJ A;  1M9A A;  3ZVJ A;  3E3E A;  4TKY A;  2LKU A;  2VCW A;  3OR5 A;  2O8V B;  3NOF A;  1EP7 A;  5GSS A;  1K0D A;  1VF3 A;  2REM A;  5D9X A;  2LST A;  3H4K A;  3TDG A;  1S3A A;  2LRT A;  3BOA A;  3ERG A;  2GZZ A;  2GTU A;  1YF0 A;  4L5L A;  5BMU A;  1GTB A;  4JE1 A;  2MYG A;  4F82 A;  2PBJ A;  2DSA A;  4MJE A;  4KDY A;  4N0V A;  1M9B A;  4FQU A;  4KA0 A;  2OA7 A;  1OAZ A;  1W89 A;  1EV4 A;  2B7K A;  1NSW A;  1WRY A;  4KCA A;  4GST A;  2AJQ B;  3KCM A;  3RHB A;  5H5Q A;  3F8U A;  4V2L A;  2LUS A;  1F37 A;  1FVK A;  2O89 A;  4X43 A;  4QL7 A;  2E2M A;  3TKS C;  2QA2 A;  3MAK A;  5A5K A;  4HEA 2;  3M3M A;  2A2R A;  2WB9 A;  3L78 A;  1JZR A;  1I5G A;  3CTF A;  2NBS A;  2IPA A;  2HFD A;  3A2W A;  4NXI A;  4POB A;  3CRU A;  4CHS A;  3VUR A;  1AIU A;  2WGR A;  1M99 A;  3GTU B;  1TK8 B;  4LL1 B;  3VWW A;  3UJ1 A;  4KSO A;  3C71 A;  3SBC A;  5CRE A;  3TOT A;  1VGL A;  1T8E B;  4GF0 A;  1WOU A;  2TIR A;  3N9J A;  4LA1 A;  4PNG A;  1YDK A;  1B8X A;  5D93 A;  3U5R E;  3TRQ A;  2HRF A;  3GH9 A;  4TR1 A;  2K6V A;  3HXS A;  5B8A A;  1O8X A;  3BBY A;  1ERU A;  5J41 A;  4GQC A;  2GSS A;  3IA1 A;  1R5A A;  1XOB A;  3ZIJ A;  3GTU A;  16GS A;  4ECB A;  1NHO A;  6GSU A;  3GST A;  2YWN A;  1CQH A;  2HSM A;  3ERW A;  5IO0 A;  2R6K A;  3LYP A;  1YEX A;  2A4V A;  1XPV A;  2JZT A;  2OAC A;  1TTZ A;  1T4Z A;  4USS A;  2IMK A;  3GNJ A;  5ELA A;  3C1S A;  1FOV A;  3HHV A;  1TU8 A;  2VIM A;  4Z2U A;  4FYU A;  2F9S A;  4ID0 A;  5KOW A;  3GKK A;  5F06 A;  1X9W B;  4D73 B;  4PQH A;  2H76 A;  17GS A;  2M72 A;  4J2F A;  1ERT A;  1PA3 A;  1JZW A;  2P5Q A;  2FY6 A;  3D5J A;  2F51 A;  5AGY A;  3FZ5 A;  4IGJ A;  1YF1 A;  2X4A A;  3LGC A;  5IMC A;  5COH A;  1S3D A;  3HY2 A;  3TUE A;  2LEG A;  3GRX A;  1U3I A;  3P2A A;  3IDV A;  3DML A;  4O5R A;  4D73 A;  3E9J B;  4MJC A;  3HYP A;  5G5F A;  2VCX A;  3D0Z A;  5ENU A;  4YAV A;  2LQQ A;  2HYX A;  2C0E A;  2L6D A;  4KH7 A;  2GS3 A;  5ECL B;  1N8J A;  2C3T A;  2FA8 A;  4TR3 A;  1TP9 A;  5G2Z A;  4HZ4 A;  1A2J A;  4MF7 A;  2FWE A;  3UVT A;  4JRR A;  4BL7 B;  4IP1 A;  1M2A A;  3Q19 A;  1K0N A;  4EUY A;  3VPQ A;  2R5G A;  1A24 A;  2C4J A;  1Y25 A;  2DMM A;  1FW1 A;  3W8J A;  3ERF A;  3NZN A;  1WP0 A;  3UVH A;  3FZ9 A;  1FOH A;  2JSZ A;  1F6M C;  1ST9 A;  20GS A;  1K0A A;  2CA8 A;  3V1W A;  1J08 A;  2MMA A;  2HZF A;  1ZYP A;  4MMM A;  3WD6 A;  4MDC A;  1TRS A;  2QA1 A;  2E7P A;  4MPG A;  5ID2 B;  2LRN A;  4NV2 A;  1VF4 A;  4P3Y B;  4FH8 A;  5HFG A;  3VWX A;  2H01 A;  3ZVJ D;  2H66 A;  2MBT A;  3IHG A;  3QFB C;  3J7Y b;  3ZYW A;  1O85 A;  2H30 A;  3HKR A;  1TOF A;  2ZNM A;  2JU5 A;  1JFU A;  2DC5 A;  1H4O A;  3S9F A;  2O85 A;  1GLP A;  4XRD A;  5DQS A;  2WDU A;  3HJM A;  3I9V 2;  3US3 A;  4KND A;  3LXT A;  4XTS A;  3KP9 A;  3HJO A;  4EIP A;  1UC7 A;  5IM9 A;  5ID2 A;  3GH6 A;  3BCK A;  2H8L A;  2H73 A;  1EEJ A;  3LG6 A;  5ECN B;  1F2E A;  2J9H A;  3ZIT A;  2FLS A;  3AY8 A;  4I5Q A;  3WT1 A;  2BJX A;  4DSS A;  2LJA A;  2M80 A;  1BAY A;  1F3B A;  4F0B A;  1GUH A;  5JCW A;  5ECH B;  1PN9 A;  5LNK e;  2XPE A;  5EVO A;  2HI7 A;  1SYX A;  4XIH A;  6GSS A;  4BA7 A;  1SK0 A;  4IP6 A;  5AIX A;  3QMX A;  3KD0 A;  4MP4 A;  1Z5Y E;  1XWK A;  2H1D A;  1AQX A;  1SD8 A;  2CX4 A;  2DIZ A;  4ILF A;  4NV5 A;  1BJX A;  1OKT A;  4I8B A;  1MTC A;  4J57 E;  3CMI A;  3MIX A;  4JZQ A;  4V1A p;  3EMX A;  3C1R A;  2ON7 A;  1KEB A;  4GRF A;  4BVY B;  1GSD A;  1O8W A;  4Q5F A;  5DAL B;  4BPY A;  4RI6 A;  4G9H A;  1SU9 A;  2QGV A;  5HR1 A;  1FB0 A;  3L9V A;  2G0F A;  5D9W A;  2EIQ A;  3KM6 A;  3IV4 A;  3FEU A;  4KCE A;  1J9B A;  1ZL9 A;  3IBH A;  4DSQ A;  4F0C A;  2FGX A;  1B4P A;  4LL4 B;  2DJ1 A;  2VCV A;  5INY A;  4ZL7 A;  1YJ6 A;  1YY7 A;  4EVM A;  2YV9 A;  4BVY A;  1YKA A;  3APO A;  5DAL A;  4ZL9 A;  3MSZ A;  2PN8 A;  3E0U A;  5LD0 A;  2NVL A;  3C7M A;  2L57 A;  5ECQ B;  1PQN A;  3A2V A;  2HRA A;  1G7E A;  2O7K A;  3I69 A;  4K0N A;  4O5Q A;  5DCH A;  4GWR A;  1R7H A;  1G6Y A;  2R4V A;  3GKM A;  4PNF A;  3QFA C;  2IMI A;  3ZRE A;  3WGE A;  3FZ4 A;  4OO4 A;  2EIR A;  1TRW A;  4E8H A;  3BD2 A;  2H74 A;  1ZGN A;  3DVW A;  4ZIL A;  2DJ2 A;  2H6Z A;  3EUR A;  3IR4 A;  1R4W A;  4L5O A;  4TR4 A;  3KTB A;  1GNE A;  1SK1 A;  3UL3 A;  1Z6M A;  1XFL A;  2YZU A;  2VD1 A;  2UZ8 A;  1B48 A;  2NTO A;  2FWF A;  2RUF A;  1SKW B;  2MMZ A;  2GDR A;  3TKR A;  4HDE A;  1EOG A;  4IHU A;  2CAQ A;  1DBY A;  1UVZ A;  2WJU A;  2YWO A;  1XW6 A;  3M9J A;  2LJK A;  1GUL A;  3EIN A;  4WF5 A;  2I1U A;  3BCI A;  3TGZ A;  2VUP A;  3ISO A;  3EU3 A;  3FR3 A;  4X4J A;  5ECS A;  1LJR A;  2VM1 A;  1MDK A;  3FR9 A;  2X64 A;  4CY6 A;  2O87 A;  2BMX A;  4K6X A;  3ZL5 A;  3EU4 A;  5B6M A;  1PMT A;  1YZX A;  2YCD A;  5D9T A;  1ON4 A;  1ACV A;  1KTE A;  2C80 A;  1X9S B;  1OVN A;  1GUM A;  1TXX A;  4EDZ A;  2JZR A;  2CT6 A;  1GWC A;  4MCU A;  4ZBA A;  4K2X A;  5H5S A;  4JED A;  2IN3 A;  2AAW A;  4KDU A;  1O81 A;  1VF2 A;  3EVI A;  3WT2 A;  2CZ2 A;  2NDO A;  1I9D A;  1GTA A;  4ML6 A;  1AQV A;  1X0R A;  3A5W A;  1HQO A;  2I81 A;  2F8F A;  4PUR A;  1R5P A;  4EE0 A;  1A2M A;  2A4H A;  3EE2 A;  4K8M A;  2HRK A;  3CBU A;  1GSS A;  2ZCT A;  4YQM A;  4V2M A;  3GKX A;  1TK0 B;  2H1G A;  4YQV A;  4TOP A;  1VF1 A;  2H71 A;  3FW2 A;  2KOK A;  3IC8 A;  1FAA A;  1A2L A;  2OBK A;  1K3O A;  5A4U A;  3F3Q A;  2K9F A;  4NAX A;  1PX6 A;  4HJ2 A;  1F9M A;  5ECR B;  4HOJ A;  4O5U A;  4ZBD A;  2VO4 A;  2GQM A;  3ED3 A;  4IW9 A;  1TRV A;  4MJA A;  2VOC A;  3KXO A;  2DJJ A;  5JCU A;  4KE3 A;  5C00 A;  2JAC A;  1PSQ A;  5DAK B;  4KW6 A;  2YP6 A;  4PQI A;  4CW9 A;  1XZO A;  3UAP A;  1FO5 A;  3CSI A;  1A0F A;  3KZQ A;  4ULX A;  3GX0 A;  1T00 A;  4L8E A;  2H6Y A;  2WS2 A;  2LNT A;  5CRH A;  1HYU A;  2KP2 A;  3DEX A;  5J4U A;  22GS A;  5ELG A;  2FD3 A;  4XS4 B;  5KEJ A;  1GUK A;  1J0F A;  4HU7 A;  2K8V A;  5DAK A;  1V57 A;  3TOU A;  1JZD A;  3EMP A;  1HNC A;  5G5E A;  4G10 A;  4IQ1 A;  4WR4 A;  5KN2 A;  2GT6 A;  2VCT A;  5HR0 A;  1V2A A;  3FY7 A;  3KTL A;  4J56 E;  3W8S A;  3ZLP A;  3F4T A;  3EPT A;  4Z7X A;  4OCF A;  4ZB6 A;  2AHE A;  5CRW A;  5ABR A;  3VWU A;  2FHE A;  3UMA A;  4RQX A;  3RBT A;  4EL1 A;  4EC0 A;  3O6T A;  3DD3 A;  3LYK A;  2KHP A;  5DJM A;  2R3X A;  2VLT A;  2V41 A;  3APS A;  2BTO T;  5FT3 A;  1RW1 A;  4N10 A;  3LJR A;  4POM A;  9GSS A;  3RHC A;  5KN3 A;  3F6F A;  1NW2 A;  1TK5 B;  2PER A;  3G7J A;  3ZMK A;  2VL2 C;  1EP8 A;  3LW9 A;  14GS A;  1SJ6 A;  2LRC A;  2H0H A;  1QXH A;  2QC7 A;  1ZYE A;  2HXK A;  1LBK A;  1GSQ A;  1FVJ A;  2EC4 A;  3QD9 A;  2E0Q A;  4MF5 A;  3GFK A;  3VLN A;  3RAZ A;  3UAR A;  5J9B A;  3HVX A;  5E4W A;  4OMV A;  4IJI A;  5IOX A;  5D73 A;  2IMD A;  3CRT A;  5D96 A;  1WMJ A;  3TJK A;  2GLR A;  1AUC A;  4TXO B;  2GSQ A;  2DJK A;  1MDI A;  2HSY A;  3HZ8 A;  4AF2 A;  1ABA A;  2C0D A;  4MZW A;  3IAM 2;  1DSB A;  2LV3 A;  1B9X C;  3GIX A;  2N5F A;  5CRD A;  1MD3 A;  5IPG A;  5G1L A;  2AUV A;  5CO3 A;  4HI7 A;  4DSR A;  3IRA A;  2ALB A;  2A2P A;  3KH9 A;  2C8U A;  1PL1 A;  3DWV A;  4TXO A;  1UA5 A;  2DJ0 A;  1GP1 A;  5DDL A;  4KX4 A;  1M0U A;  2P5R A;  2RLI A;  4BL7 A;  4DVC A;  1XXU A;  2M46 A;  3I6A A;  3LSZ A;  2DKH A;  4IKH A;  1EEM A;  2AB6 A;  2KLX A;  2I3Y A;  3VI7 A;  5J3R A;  5KOX A;  1GH2 A;  3PPU A;  3ME8 A;  3C73 A;  4K5S A;  1XIY A;  1ZCP A;  3TCO A;  3D4M A;  1QMV A;  5CRG A;  1PRX A;  5DBQ A;  2L4C A;  1XOA A;  1O73 A;  1W4V A;  2GSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...