3A44A

Crystal structure of hypa in the dimeric form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
137
structure length
137
Chain Sequence
HEWALADAIVRTVLDYAQREGASRVKAVRVVLGELQDVAEDIVKFAMEQLFAGTIAEGAEIEFVEEEAVFKCRNCNYEWKLKEVKDKFDERIKEDIHFIPEVVHAFLACPKCGSHDFEVVKGRGVYVAGIKIEKEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase nickel incorporation protein hypA
publication title Crystal structure of HypA, a nickel-binding metallochaperone for [NiFe] hydrogenase maturation.
pubmed doi rcsb
source organism Pyrococcus kodakaraensis
molecule tags Metal binding protein
total genus 24
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01155 HypA Hydrogenase/urease nickel incorporation, metallochaperone, hypA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3a44A02
3.30.2320.50 Alpha Beta 2-Layer Sandwich hypothetical protein PF0899 fold hypothetical protein PF0899 fold 3a44A01
3RYGA 1YUZA 1T9QA 4AR4A 1LKMA 2KN9A 1R0IA 1E8JA 1R0GA 1C09A 1T9OA 1DVBA 1SMWA 5AI3A 3A43A 1BRFA 1LTLA 5AI2A 1YV1A 2QL0A 8RXNA 5AUPA 1IRNA 6RXNA 2MS3A 1VCXA 1DX8A 2K2DA 5RXNA 1B2OA 2KKDA 4RXNA 1ZRPA 3PWFA 3PZAA 1SMMA 1QCVA 2LCQA 3RZ6A 2M4YA 3KYVA 1BE7A 1T9PA 2PVXA 1BFYA 1CAAA 3MPSA 1FHMA 1IU6A 7RXNA 1RDVA 1B71A 1BQ9A 4YWMA 2V3BB 1RDGA 4POFA 1RWDA 1FHHA 1R0FA 2DSXA 3KYYA 1R0HA 3QVDA 4AR6A 1S2ZA 3SS2A 1QYBA 1CADA 1JYBA 1B2JA 1YK4A 1LKPA 2VL6A 1S24A 5IY0A 1IU5A 1H7VA 1YUXA 3KYUA 4TPUA 1SMUA 2PYAA 4AR5A 3A44A 4POGA 2GMGA 1B13A 4AR3A 1RB9A 5AUOA 2PVEA 2RDVA 1R0JA 1NNQA 3KYWA 4K9FA 3RZTA 1IROA 2HR5A 1BQ8A 4YWLA 5AUNA 3KYXA 4ME3A 1RYTA 1YK5A 1S30A 1LKOA
chains in the Genus database with same CATH superfamily
4AHYA 1TWHL 1T9QA 4AR4A 1LKMA 1E8JA 3VPBE 3DKTA 1SMWA 1PFUA 5AI3A 5AI2A 2AYJA 1YV1A 2QL0A 4AYBP 1VCXA 4U671 3S2HL 3WWLA 3GTGL 2C6BA 4BBSL 2VUML 4A3CL 4RXNA 3PL5A 5MLC3 4A3ML 2B5ID 3S15L 1BFYA 1FHMA 1RDVA 2L0ZA 2V3BB 1WCML 4E6YA 3S14L 2XJQA 5JVG1 2DM9A 3KYYA 1R0HA 1VZGA 3SS2A 1JYBA 3GTJL 1YK4A 1LKPA 2E2HL 3K5BA 2VL6A 2YU9L 4AHZA 3GTOL 1H7VA 4ZN1B 1ODHA 2CKCA 4Y7NL 4GS7D 2PYAA 5H1Sc 3I4ML 1VZHA 3MQKB 3A44A 2NYDA 1PZXA 1Y1VL 4TVMA 1B13A 4C2M1 2PSMC 3HOXL 3GTPL 2M4VA 4JADA 4YWLA 3KYXA 1RYTA 2JA6L 5DM71 2AQCA 3S1ML 4WFN1 2NVQL 3PO3L 3RYGA 1R0IA 3V6IA 3H97A 3K7AL 5M5YL 4A3DL 1NXGA 2CKAA 2BE5D 2WB1P 5AUPA 5EIOC 1TWAL 3S1RL 2H12A 4JAEA 4A3EL 3PZAA 2LCQA 1WZ2A 3RZ6A 3LWOB 4LHLA 2A6HD 2LC0A 3NFPI 1BE7A 5AN9H 5MFZA 2R92L 5MFPA 1NXEA 1I6HL 3LWRB 4LHNA 3LWQB 1R0FA 2DSXA 4JAGA 5JVH1 2O5JD 4BY7L 3PIO1 3B0AB 2B63L 1Y1WL 2ZIXA 5DM61 1QYBA 5M3FL 4ZN3B 4A3IL 2HVYC 2E2JL 2KDXA 1S24A 3GTML 1IU5A 2NVTL 1YUXA 2M6PA 3HKZP 3P8BA 2FSYA 1R9TL 4POGA 2V0FA 2APOB 3J7Y1 4AR3A 1PFYA 2ERJA 5IP7L 5GAEc 3P2AA 2E0ZA 4AHXA 3JR7A 5GAHc 4BY1L 2AUSB 3KYWA 3HJWB 4C3HL 3LNLA 3MSUA 3RZDL 1IROA 3CQZL 3S1QL 5AUNA 2XJRA 2Y0SP 1S30A 3LPEB 1I3QL 5GAGc 2PPTA 1F4LA 2JA5L 4A3LL 1QQTA 1Z92B 1YUEA 5IP9L 2RFKB 3M4OL 1T9OA 3PKJA 1TWGL 3A43A 4B8CD 4DT0A 2XJTA 2MS3A 2JA8L 2EY4E 1DX8A 2JI1A 1B2OA 2R7ZL 4AI2A 4BBRL 3PWFA 2FT1A 1SMMA 1SFOL 3S1NL 2CR8A 3HOZL 3KYVA 1K83L 3GTLL 2PVXA 5C3EL 2A6ED 1CAAA 1OWCA 3MPSA 3S2DL 7RXNA 3GTQL 1B71A 5M3ML 3PKIA 1RDGA 1RWDA 4A3JL 1WJVA 3FKIL 3PO2L 4QIWP 3M3YL 3QVDA 1S2ZA 4EFAE 3QQCE 1CADA 1P7PA 2V0EA 3H9CA 3LWVB 4DL0E 1RYQA 4AI3A 5IY0A 5EINC 4A3GL 5MGNA 1TWCL 4UY81 3HAXC 3H9BA 2M6OA 2A69D 1OHGA 4AHWA 5GADc 3H0GL 5C4JL 4A93L 1IW7D 1RB9A 5IYBL 4V196 2A68D 3PIP1 5C4XL 5AUOA 1I50L 2RDVA 2E2IL 4C3JL 1NNQA 3S17L 3RZTA 2JA7L 2NVYL 3IU3I 4C3IL 2HR5A 1PFVA 3GTKL 1YK5A 1TWFL 2DMAA 1LKOA 3RZOL 2Z3RB 1YUZA 3HJYB 2KN9A 5FJ8L 1R0GA 2NVXL 1C09A 4XGHA 4XXBB 1DVBA 3HOYL 3WWNB 4X6AL 1BRFA 1LTLA 8RXNA 1IRNA 6RXNA 2JI2A 3FDJA 5K2ME 3H3VM 3J7Z1 2K2DA 5FLML 5RXNA 3H99A 3B08B 3ZG6A 2KKDA 1ZRPA 1QCVA 2M4YA 2PMZP 4JAFA 1T9PA 1QU3A 1OWBA 2ERSA 1IU6A 1BQ9A 4YWMA 2J9UB 4G6BA 3HOVL 4POFA 1FHHA 2XJVA 4AR6A 4AI0A 5C44L 2XJSA 5MF6A 4A3BL 3HOUL 3HOWL 1B2JA 3S16L 2XJPA 4AI1A 2XJUA 3KYUA 2C6AA 4TPUA 1SMUA 4Y52L 4AR5A 5IYCL 2PK8A 2GMGA 3I4NL 5M5XL 2Z3QB 1VZIA 5IYDL 2R93L 2PVEA 1R0JA 3E8KA 4K9FA 5M5WL 4A3FL 1BQ8A 4ME3A 3K35A 2JI3A 3LWPB 4BXXL 1PFWA 4A3KL 2WAQP
chains in the Genus database with same CATH topology
4AHYA 3RYGA 1YUZA 1T9QA 4AR4A 1LKMA 2KN9A 1Z92B 1R0IA 1E8JA 3VPBE 1YUEA 1R0GA 3V6IA 1C09A 1T9OA 4XGHA 4XXBB 1DVBA 1SMWA 3PKJA 5AI3A 3WWNB 3A43A 4B8CD 1NXGA 1BRFA 1LTLA 2CKAA 2BE5D 5AI2A 2AYJA 1YV1A 2QL0A 8RXNA 5EIOC 1IRNA 6RXNA 5AUPA 4DT0A 2JI2A 2XJTA 2MS3A 5K2ME 2H12A 1VCXA 3J7Z1 4U671 1DX8A 4JAEA 2K2DA 3WWLA 5RXNA 2JI1A 2C6BA 3B08B 1B2OA 4AI2A 3ZG6A 2KKDA 4RXNA 1ZRPA 3PWFA 3PZAA 1SMMA 1QCVA 2LCQA 5MLC3 3RZ6A 2M4YA 4LHLA 2B5ID 2CR8A 2A6HD 2LC0A 3NFPI 3KYVA 4JAFA 1BE7A 1T9PA 2PVXA 1BFYA 5AN9H 1OWBA 5MFZA 2ERSA 2A6ED 1CAAA 1OWCA 3MPSA 1FHMA 5MFPA 1IU6A 7RXNA 1RDVA 1NXEA 2L0ZA 1B71A 1BQ9A 4YWMA 2J9UB 3PKIA 2V3BB 4G6BA 1RDGA 4E6YA 4POFA 4LHNA 1RWDA 1FHHA 1R0FA 2XJVA 1WJVA 2DSXA 2XJQA 5JVG1 2DM9A 3KYYA 4JAGA 1R0HA 3QVDA 5JVH1 2O5JD 4AR6A 4AI0A 1VZGA 3PIO1 1S2ZA 3B0AB 3SS2A 2XJSA 2ZIXA 1QYBA 5MF6A 3QQCE 4ZN3B 1CADA 1JYBA 5DM61 4EFAE 1B2JA 2V0EA 1YK4A 1LKPA 4DL0E 3K5BA 1RYQA 2VL6A 4AI3A 2KDXA 2XJPA 1S24A 5IY0A 5EINC 4AHZA 1IU5A 4AI1A 1H7VA 4ZN1B 2XJUA 1ODHA 5MGNA 1YUXA 2C6AA 2CKCA 2M6PA 3KYUA 4TPUA 3P8BA 1SMUA 4GS7D 2PYAA 5H1Sc 4UY81 1VZHA 4AR5A 2M6OA 3A44A 2NYDA 2A69D 4POGA 4TVMA 2GMGA 2V0FA 4AHWA 1B13A 5GADc 3J7Y1 2PSMC 4AR3A 1IW7D 1RB9A 2Z3QB 2ERJA 1VZIA 4V196 2A68D 3PIP1 5GAEc 5AUOA 2PVEA 2RDVA 3P2AA 1R0JA 4AHXA 5GAHc 1NNQA 3KYWA 2M4VA 4JADA 4K9FA 3LNLA 3MSUA 3RZTA 1IROA 3IU3I 2HR5A 1BQ8A 4YWLA 5AUNA 3KYXA 3K35A 4ME3A 1RYTA 2XJRA 1YK5A 2JI3A 1S30A 5DM71 3LPEB 5GAGc 2DMAA 2PPTA 4WFN1 1LKOA 2Z3RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYG A;  1YUZ A;  1T9Q A;  4AR4 A;  1LKM A;  2KN9 A;  1R0I A;  1E8J A;  1R0G A;  1C09 A;  1T9O A;  1DVB A;  1SMW A;  5AI3 A;  3A43 A;  1BRF A;  1LTL A;  5AI2 A;  1YV1 A;  2QL0 A;  8RXN A;  5AUP A;  1IRN A;  6RXN A;  2MS3 A;  1VCX A;  1DX8 A;  2K2D A;  5RXN A;  1B2O A;  2KKD A;  4RXN A;  1ZRP A;  3PWF A;  3PZA A;  1SMM A;  1QCV A;  2LCQ A;  3RZ6 A;  2M4Y A;  3KYV A;  1BE7 A;  1T9P A;  2PVX A;  1BFY A;  1CAA A;  3MPS A;  1FHM A;  1IU6 A;  7RXN A;  1RDV A;  1B71 A;  1BQ9 A;  4YWM A;  2V3B B;  1RDG A;  4POF A;  1RWD A;  1FHH A;  1R0F A;  2DSX A;  3KYY A;  1R0H A;  3QVD A;  4AR6 A;  1S2Z A;  3SS2 A;  1QYB A;  1CAD A;  1JYB A;  1B2J A;  1YK4 A;  1LKP A;  2VL6 A;  1S24 A;  5IY0 A;  1IU5 A;  1H7V A;  1YUX A;  3KYU A;  4TPU A;  1SMU A;  2PYA A;  4AR5 A;  3A44 A;  4POG A;  2GMG A;  1B13 A;  4AR3 A;  1RB9 A;  5AUO A;  2PVE A;  2RDV A;  1R0J A;  1NNQ A;  3KYW A;  4K9F A;  3RZT A;  1IRO A;  2HR5 A;  1BQ8 A;  4YWL A;  5AUN A;  3KYX A;  4ME3 A;  1RYT A;  1YK5 A;  1S30 A;  1LKO A; 
#chains in the Genus database with same CATH topology
 4AHY A;  1TWH L;  1T9Q A;  4AR4 A;  1LKM A;  1E8J A;  3VPB E;  3DKT A;  1SMW A;  1PFU A;  5AI3 A;  5AI2 A;  2AYJ A;  1YV1 A;  2QL0 A;  4AYB P;  1VCX A;  4U67 1;  3S2H L;  3WWL A;  3GTG L;  2C6B A;  4BBS L;  2VUM L;  4A3C L;  4RXN A;  3PL5 A;  5MLC 3;  4A3M L;  2B5I D;  3S15 L;  1BFY A;  1FHM A;  1RDV A;  2L0Z A;  2V3B B;  1WCM L;  4E6Y A;  3S14 L;  2XJQ A;  5JVG 1;  2DM9 A;  3KYY A;  1R0H A;  1VZG A;  3SS2 A;  1JYB A;  3GTJ L;  1YK4 A;  1LKP A;  2E2H L;  3K5B A;  2VL6 A;  2YU9 L;  4AHZ A;  3GTO L;  1H7V A;  4ZN1 B;  1ODH A;  2CKC A;  4Y7N L;  4GS7 D;  2PYA A;  5H1S c;  3I4M L;  1VZH A;  3MQK B;  3A44 A;  2NYD A;  1PZX A;  1Y1V L;  4TVM A;  1B13 A;  4C2M 1;  2PSM C;  3HOX L;  3GTP L;  2M4V A;  4JAD A;  4YWL A;  3KYX A;  1RYT A;  2JA6 L;  5DM7 1;  2AQC A;  3S1M L;  4WFN 1;  2NVQ L;  3PO3 L;  3RYG A;  1R0I A;  3V6I A;  3H97 A;  3K7A L;  5M5Y L;  4A3D L;  1NXG A;  2CKA A;  2BE5 D;  2WB1 P;  5AUP A;  5EIO C;  1TWA L;  3S1R L;  2H12 A;  4JAE A;  4A3E L;  3PZA A;  2LCQ A;  1WZ2 A;  3RZ6 A;  3LWO B;  4LHL A;  2A6H D;  2LC0 A;  3NFP I;  1BE7 A;  5AN9 H;  5MFZ A;  2R92 L;  5MFP A;  1NXE A;  1I6H L;  3LWR B;  4LHN A;  3LWQ B;  1R0F A;  2DSX A;  4JAG A;  5JVH 1;  2O5J D;  4BY7 L;  3PIO 1;  3B0A B;  2B63 L;  1Y1W L;  2ZIX A;  5DM6 1;  1QYB A;  5M3F L;  4ZN3 B;  4A3I L;  2HVY C;  2E2J L;  2KDX A;  1S24 A;  3GTM L;  1IU5 A;  2NVT L;  1YUX A;  2M6P A;  3HKZ P;  3P8B A;  2FSY A;  1R9T L;  4POG A;  2V0F A;  2APO B;  3J7Y 1;  4AR3 A;  1PFY A;  2ERJ A;  5IP7 L;  5GAE c;  3P2A A;  2E0Z A;  4AHX A;  3JR7 A;  5GAH c;  4BY1 L;  2AUS B;  3KYW A;  3HJW B;  4C3H L;  3LNL A;  3MSU A;  3RZD L;  1IRO A;  3CQZ L;  3S1Q L;  5AUN A;  2XJR A;  2Y0S P;  1S30 A;  3LPE B;  1I3Q L;  5GAG c;  2PPT A;  1F4L A;  2JA5 L;  4A3L L;  1QQT A;  1Z92 B;  1YUE A;  5IP9 L;  2RFK B;  3M4O L;  1T9O A;  3PKJ A;  1TWG L;  3A43 A;  4B8C D;  4DT0 A;  2XJT A;  2MS3 A;  2JA8 L;  2EY4 E;  1DX8 A;  2JI1 A;  1B2O A;  2R7Z L;  4AI2 A;  4BBR L;  3PWF A;  2FT1 A;  1SMM A;  1SFO L;  3S1N L;  2CR8 A;  3HOZ L;  3KYV A;  1K83 L;  3GTL L;  2PVX A;  5C3E L;  2A6E D;  1CAA A;  1OWC A;  3MPS A;  3S2D L;  7RXN A;  3GTQ L;  1B71 A;  5M3M L;  3PKI A;  1RDG A;  1RWD A;  4A3J L;  1WJV A;  3FKI L;  3PO2 L;  4QIW P;  3M3Y L;  3QVD A;  1S2Z A;  4EFA E;  3QQC E;  1CAD A;  1P7P A;  2V0E A;  3H9C A;  3LWV B;  4DL0 E;  1RYQ A;  4AI3 A;  5IY0 A;  5EIN C;  4A3G L;  5MGN A;  1TWC L;  4UY8 1;  3HAX C;  3H9B A;  2M6O A;  2A69 D;  1OHG A;  4AHW A;  5GAD c;  3H0G L;  5C4J L;  4A93 L;  1IW7 D;  1RB9 A;  5IYB L;  4V19 6;  2A68 D;  3PIP 1;  5C4X L;  5AUO A;  1I50 L;  2RDV A;  2E2I L;  4C3J L;  1NNQ A;  3S17 L;  3RZT A;  2JA7 L;  2NVY L;  3IU3 I;  4C3I L;  2HR5 A;  1PFV A;  3GTK L;  1YK5 A;  1TWF L;  2DMA A;  1LKO A;  3RZO L;  2Z3R B;  1YUZ A;  3HJY B;  2KN9 A;  5FJ8 L;  1R0G A;  2NVX L;  1C09 A;  4XGH A;  4XXB B;  1DVB A;  3HOY L;  3WWN B;  4X6A L;  1BRF A;  1LTL A;  8RXN A;  1IRN A;  6RXN A;  2JI2 A;  3FDJ A;  5K2M E;  3H3V M;  3J7Z 1;  2K2D A;  5FLM L;  5RXN A;  3H99 A;  3B08 B;  3ZG6 A;  2KKD A;  1ZRP A;  1QCV A;  2M4Y A;  2PMZ P;  4JAF A;  1T9P A;  1QU3 A;  1OWB A;  2ERS A;  1IU6 A;  1BQ9 A;  4YWM A;  2J9U B;  4G6B A;  3HOV L;  4POF A;  1FHH A;  2XJV A;  4AR6 A;  4AI0 A;  5C44 L;  2XJS A;  5MF6 A;  4A3B L;  3HOU L;  3HOW L;  1B2J A;  3S16 L;  2XJP A;  4AI1 A;  2XJU A;  3KYU A;  2C6A A;  4TPU A;  1SMU A;  4Y52 L;  4AR5 A;  5IYC L;  2PK8 A;  2GMG A;  3I4N L;  5M5X L;  2Z3Q B;  1VZI A;  5IYD L;  2R93 L;  2PVE A;  1R0J A;  3E8K A;  4K9F A;  5M5W L;  4A3F L;  1BQ8 A;  4ME3 A;  3K35 A;  2JI3 A;  3LWP B;  4BXX L;  1PFW A;  4A3K L;  2WAQ P; 
#chains in the Genus database with same CATH homology
 4AHY A;  3RYG A;  1YUZ A;  1T9Q A;  4AR4 A;  1LKM A;  2KN9 A;  1Z92 B;  1R0I A;  1E8J A;  3VPB E;  1YUE A;  1R0G A;  3V6I A;  1C09 A;  1T9O A;  4XGH A;  4XXB B;  1DVB A;  1SMW A;  3PKJ A;  5AI3 A;  3WWN B;  3A43 A;  4B8C D;  1NXG A;  1BRF A;  1LTL A;  2CKA A;  2BE5 D;  5AI2 A;  2AYJ A;  1YV1 A;  2QL0 A;  8RXN A;  5EIO C;  1IRN A;  6RXN A;  5AUP A;  4DT0 A;  2JI2 A;  2XJT A;  2MS3 A;  5K2M E;  2H12 A;  1VCX A;  3J7Z 1;  4U67 1;  1DX8 A;  4JAE A;  2K2D A;  3WWL A;  5RXN A;  2JI1 A;  2C6B A;  3B08 B;  1B2O A;  4AI2 A;  3ZG6 A;  2KKD A;  4RXN A;  1ZRP A;  3PWF A;  3PZA A;  1SMM A;  1QCV A;  2LCQ A;  5MLC 3;  3RZ6 A;  2M4Y A;  4LHL A;  2B5I D;  2CR8 A;  2A6H D;  2LC0 A;  3NFP I;  3KYV A;  4JAF A;  1BE7 A;  1T9P A;  2PVX A;  1BFY A;  5AN9 H;  1OWB A;  5MFZ A;  2ERS A;  2A6E D;  1CAA A;  1OWC A;  3MPS A;  1FHM A;  5MFP A;  1IU6 A;  7RXN A;  1RDV A;  1NXE A;  2L0Z A;  1B71 A;  1BQ9 A;  4YWM A;  2J9U B;  3PKI A;  2V3B B;  4G6B A;  1RDG A;  4E6Y A;  4POF A;  4LHN A;  1RWD A;  1FHH A;  1R0F A;  2XJV A;  1WJV A;  2DSX A;  2XJQ A;  5JVG 1;  2DM9 A;  3KYY A;  4JAG A;  1R0H A;  3QVD A;  5JVH 1;  2O5J D;  4AR6 A;  4AI0 A;  1VZG A;  3PIO 1;  1S2Z A;  3B0A B;  3SS2 A;  2XJS A;  2ZIX A;  1QYB A;  5MF6 A;  3QQC E;  4ZN3 B;  1CAD A;  1JYB A;  5DM6 1;  4EFA E;  1B2J A;  2V0E A;  1YK4 A;  1LKP A;  4DL0 E;  3K5B A;  1RYQ A;  2VL6 A;  4AI3 A;  2KDX A;  2XJP A;  1S24 A;  5IY0 A;  5EIN C;  4AHZ A;  1IU5 A;  4AI1 A;  1H7V A;  4ZN1 B;  2XJU A;  1ODH A;  5MGN A;  1YUX A;  2C6A A;  2CKC A;  2M6P A;  3KYU A;  4TPU A;  3P8B A;  1SMU A;  4GS7 D;  2PYA A;  5H1S c;  4UY8 1;  1VZH A;  4AR5 A;  2M6O A;  3A44 A;  2NYD A;  2A69 D;  4POG A;  4TVM A;  2GMG A;  2V0F A;  4AHW A;  1B13 A;  5GAD c;  3J7Y 1;  2PSM C;  4AR3 A;  1IW7 D;  1RB9 A;  2Z3Q B;  2ERJ A;  1VZI A;  4V19 6;  2A68 D;  3PIP 1;  5GAE c;  5AUO A;  2PVE A;  2RDV A;  3P2A A;  1R0J A;  4AHX A;  5GAH c;  1NNQ A;  3KYW A;  2M4V A;  4JAD A;  4K9F A;  3LNL A;  3MSU A;  3RZT A;  1IRO A;  3IU3 I;  2HR5 A;  1BQ8 A;  4YWL A;  5AUN A;  3KYX A;  3K35 A;  4ME3 A;  1RYT A;  2XJR A;  1YK5 A;  2JI3 A;  1S30 A;  5DM7 1;  3LPE B;  5GAG c;  2DMA A;  2PPT A;  4WFN 1;  1LKO A;  2Z3R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...