3A4MA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 98
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4mA01
4HZUB 2ATXA 2MMGA 1RE0A 4BFSA 4C0QC 1GSIA 1D9ZA 1Z22A 1KAOA 5JLJA 1YR7A 3KJEA 1VCMA 2CVFA 3H1TA 3JVVA 3B60A 1YRAA 3B85A 2H57A 1KGDA 2QU8A 2WKRA 3DKPA 4XOIA 4Q9LA 3P20A 4DCUA 5JMTA 2F1HA 1AKEA 4MDFA 3GJ3A 4JBYA 2OILA 2A5DA 1Q44A 1QDEA 2JIZD 2ZSDA 4KBFA 2A5JA 1W36C 1BO6A 3Q72A 1HURA 4K8OA 2IL1A 1COWD 1U9IA 2JCSA 4AKIA 4R9UC 2VP9A 1E4YA 1QRAA 4R7ZA 5J4VA 2AD1A 4B2IA 1TQ4A 1D6JA 2ZI7A 1XMJA 1QHNA 4M4SA 3ND9A 1CRQA 5FOUA 2HT6A 1UBCA 2ZE6A 4UNNA 5IK2D 2HXSA 1JQJC 1YZKA 2DY1A 1W0JD 2ZS7A 4OJKA 4ZKDA 4QBHA 1FUKA 2VQSA 3DVLA 3BORA 2IYTA 4DLVA 4P32A 5GJCA 3EAQA 4HZIA 4MRSA 2HV8A 1GNRA 2ZRMA 4QBGB 2PEZA 2O8BB 1HUQA 2HJGA 1OF1A 2YV5A 1FTNA 4KXFB 3U3OA 5HCIA 1XTIA 4KJZA 4B74A 2OZEA 1RRPA 3CB4A 3IEUA 2Q9BA 2X2EA 2BBTA 1X1SA 2GNOA 2RHMA 3D3QA 1E9RA 1COWA 1W2HA 2ZVPX 3QF4A 3EASA 3ZVNA 2N1BA 3LNCA 4Z1MA 4C0BA 3S1AB 2VO1A 1GIAA 1Q12A 1HV8A 2HYDA 4Q47A 4IOLA 4ESHA 1TF2A 2JLYA 2QAGC 4DC9A 3VFDA 5AJYA 4DCSA 4URYR 3LQRA 1NN3A 2G0TA 4CVNA 3EARA 1WE2A 1XMIA 3VR2A 5KO2A 2GCOA 3OEEA 3QKTA 1PUJA 2FWRA 3QKSB 3CZQA 4BFVA 3VR3A 3X1ZA 1SVOA 2V7QA 2WWIA 1KMHB 3EZFA 3VU9B 4DHEA 2GTPA 1E2GA 2CCJA 3SHWA 1CJVC 2IUSA 4JT2A 4QM7A 1D8TA 3EWSA 4UNQA 3GLHE 3KFVA 5L3SB 4TSFA 1US8B 2F7SA 4EFMA 4Q4HB 5SZJA 1NF3A 5C2JB 4JT4A 2OFWA 2GEVA 4LC0A 3SBDA 3ZGXA 3U7HB 3UWOA 4Q9KA 1DOAA 1S3SA 3CIOA 2G1KA 4TYYA 3LW7A 1PVOA 3MD0A 4Q5IA 4CEJA 1I2DA 5HE9A 1R0WA 1WMSA 3QXSA 2EFDB 2C77A 2IYYA 1XBTA 3I73A 4IDQA 1L7VC 4D4JA 4JLJA 4BECA 4DIEA 4DLRA 3L0IB 3AVQA 3GFPA 1TF5A 4ERNA 3I5YA 5KTYA 3HYTA 4L5BA 2EFHB 4KLNA 5FBQB 3KKQA 4LBYA 2V55B 4DBLC 2BMEA 1ZM7A 2C96A 2QPOA 1QHGA 4N0EA 2H5EA 3V4FA 2J45A 4P3YA 1HH4A 1J8YF 4H9GA 2I4IA 3JZMA 1OB5A 1ZMXA 3NBYC 3MAAC 5GJWC 1OH7A 1KI6A 3SEAA 2A9KA 4Z1MD 4C0HA 5G3YA 3NKVA 4D81A 1AS2A 2C04A 3GQBA 3SYLA 4YMUA 3FHTA 4E09A 2GVZC 1N25A 2JDIA 3IKJA 3FVQA 3R9IA 3DZ8A 1E2KA 2IYQA 1E1QD 2ZE5A 4KYIB 1XFAA 3ADKA 3D6TB 1TAGA 2O0HA 3PCRB 1PLKA 5EP4A 3RAPR 3OZXA 4DLYA 1A2BA 2R44A 5KNBA 5C46F 1MR3F 2Q9AA 2OBLA 2PZGA 2R6AA 3KKMA 1IOZA 2D3WA 3GEIA 1D2MA 1GKIA 5FI0B 4ASUD 4TL9A 4ITRC 4QNMA 3B1VA 1QF9A 3CF2A 221PA 2N42A 3TUZC 2RMKA 1GL6A 4LJAA 4P4SB 3BFKA 4C0LA 2J87A 1KI8A 3AVUA 2QT0A 2VRWA 4W7SA 1KI2A 5CM9C 5AJWA 5FBLB 3KQKA 1EWRA 1MABB 4B2PA 2ZREA 1Q21A 2CL7X 1OFTA 4BRWA 5G41A 2VLIA 1FW6A 4HLUC 4URWR 1DO0A 1Q3HA 4H1UA 1CEEA 2PCJA 3H86A 1VIYA 1YE8A 4A92A 1BMFD 4UNPA 1W48A 1TU3A 4Q4AB 5EXTA 1K5DA 2VP4A 4Q4HA 5JWHA 5KNDA 2BJVA 2ZJ8A 2HXYA 4LBWA 2XOKD 4ZDWA 5CDFE 4LHVA 2GZDA 5JEDA 4Q4JA 2XSZD 3EPHA 3GLIA 4TL7A 4TLBA 3MJRA 4J0QA 3R8CA 2XAUA 1VCOA 2BMJA 1UKEA 1SXJE 3X2SA 8OHMA 5FBVB 3N70A 2JLXA 3W3AA 3AF4A 3RDPA 4MKGA 4IXNA 5DISB 2ZYVX 4GMXA 2OAP1 1L4YA 4MGZR 3I1FA 2P65A 4Q4LA 1AS0A 1OIWA 5B58C 2ZU6A 4TLAA 1KDPA 1VECA 1HE8B 3THXA 1RYFA 1TF7A 2BBSA 2XTNA 4OK6A 4AG6A 1CJKC 1RIFA 3K70B 2OXCA 4C0SA 2CJWA 1T5IA 3TW8B 3U6KA 2ZYUX 3GCGA 2Q3MA 3BFXA 3LH5A 4ON9A 3GLGA 3MWYW 5DI3A 3ZVMA 3NHBA 4RFSA 2P0EA 2W58A 4IXMA 2PZEA 1E2FA 4OJQA 5G3ZA 2QEQA 3SQXA 2FFQA 1SVIA 2G3YA 2O8FB 1WDTA 2AFHE 5DYGA 3ZIAA 5FBRB 1W46A 2D2FA 4ESVA 3VNUA 3QBVA 4M53A 721PA 4ZO4A 4MA4A 4FCWA 521PA 3BWDD 4QG7A 2GF9A 4JLBA 1JAIA 2LWIA 4D0NA 3PITA 4HUQA 3UWKA 4MRPA 3KQLA 2IEYA 1NG9A 3WMGA 1N6LA 1E0JA 1XWIA 1KY3A 3NHAA 1ELOA 3RRNA 4U7DA 2JJ1A 4DT1B 4BRUA 2F43B 1XPRA 3QXXA 1RFLA 4EQ6B 4GOKA 4M0LA 4NP6A 1ZIPA 2ZRIA 4HUTA 4O2LA 3LQQA 4TMTA 1KZGB 2EU8A 2X2FA 3LAWA 1IXZA 2F1JA 2ZSAA 1X1RA 2RKOA 3CO5A 1F60A 4QGFA 1G8YA 1SVKA 5EUMA 2CE2X 1DARA 1K8RA 5DHAA 2QTVB 3UK6A 3WYGA 3FHOA 1DAGA 2PX3A 2QN6A 1G4AE 4YMVA 2WWHA 2YWFA 3QY0A 4ZCLA 4C7OA 2GVDC 1NBMA 2BOVA 3GJ5A 2JJ8A 2KJQA 5HZHA 1KNQA 3AVWA 3GJ4A 2CLSA 4BLQA 1KI1A 2B92A 2Z83A 3NWJA 4PR0A 4DLSA 4KVGA 2ZJ5A 2GBLC 2J0SA 4TL6A 1AGRA 1G20E 4GSYA 1ZAKA 3HPQA 1OB2A 3T34A 4PHHA 3O8CA 4P33A 1E9SA 1SULA 4JZKA 5L3QB 1GL7A 4LRWA 2XXAA 1AGPA 4F4JA 1U9IC 3KUDA 3ZVRA 2AX4A 1E2EA 1TEXA 4HI0E 4KVAA 1FOEB 4YXWA 2RB4A 3HDTA 2C95A 2IF2A 1L8QA 1E9CA 3E70C 3GJ8A 3ZQ6A 1VYUA 2QT1A 3KTAB 1NJFA 2H92A 2CLCX 2VPPA 1AKYA 2C99A 4EAQA 2FPKA 3C16C 1Z6AA 3GLHA 4LYHA 1Z2AA 4XWOA 4HLQB 4RJLA 5GADl 5LB2A 1Z0KA 1ESNA 1T4GA 1G7CA 2ORWA 3B5JA 4PZZA 4BFZA 2QP3A 1M1YE 1Z6GA 2QSYA 2GXUA 1ZIOA 1Z29A 3H2YA 3MRSA 2DB3A 1J2JA 3T35A 2QAJA 5J47A 3NC0C 2WWWA 4D26A 4IRUB 4A9AA 1RRCA 1S8FA 3F5FA 4ASUA 3GLGE 2PX0A 3F0TA 2GXQA 3IQXA 4H1VA 3REGA 4YXWD 3MCAA 4GT1A 4IHQA 1N0UA 4RSGA 3IBYA 3UIEA 2WICA 2WAYA 4HUQB 5LDDC 1ZU5A 2IBMA 2OUKA 3CX8A 3AVTA 3CWZA 1QVAA 4NYIQ 2QMEA 2QM8A 3CH5A 5CYOA 1BYUA 4A4DA 2W0SA 4Z8XA 5ANRB 2MSCB 4A6XA 4MYHA 4PC6A 4F7WA 4PC1A 1KAGA 1FFHA 2J5XA 5J4HA 4XH9B 2IT1A 1ZW6A 2W83A 2Q21A 3SC3A 2B8WA 4L16A 1ODFA 3C15C 3L0PA 1UF9A 3QKRA 1F2UA 1CR1A 2NOAA 1ZNWA 1DADA 2OSBA 4RCYA 1AM4D 3IO5A 3SN6A 3A8TA 2ZR7A 4D4KA 1G3RA 4N0DA 3CR8A 1OYWA 1TQ2A 1G9XA 4C7OB 2VSOA 1DAHA 3OFND 3DM5A 3LXXA 1DTSA 2AHOA 1MO6A 2CHGA 3GEHA 3NG1A 2QUZA 4HDOB 2J9RA 2JDID 1UBFA 3RS2A 4PSVA 1NVXQ 4JLDA 5B2ZA 1XX6A 1P75A 2AFIE 2YVUA 3P1JA 1IBRA 1U8AA 4TYWA 4QNRA 4LYFA 3QXJA 5E7MA 3TRFA 1E69A 1JR3E 2C9CA 4LY6A 4DEXA 2PJRA 2WJYA 3H0KA 4KBGA 1LW7A 3TR0A 3H84A 1UDXA 2V8OA 4MYUA 1P60A 2QP4A 2JLUA 2ZJZA 2UZ3A 3THWB 3PFIA 5C4MA 4LV6A 2ANCA 5CM8B 2QY9A 1OXVA 3AKYA 3QI2A 4BZXA 3LXRA 1YZTA 1DAKA 3C14C 5BN5A 3UG6A 3VQTA 3A1WA 1OV4A 1I2MA 1A2KC 4CIDA 4PZYA 2NZ8A 4HDQB 2ZR9A 4JLPA 1WBDA 2EFCB 2OESA 2F1RA 4YMWA 1GKYA 5JJKA 1U0LA 4A8JB 4XIGS 2GBLA 4WOPA 2AXNA 1LNZA 1SXJB 3B1ZA 1NMYA 4R98A 3OIUA 4HAVA 2E87A 2WIAA 5H8WA 1QVRA 4AK9A 4EJSA 4OYHA 1DAEA 2AR7A 4A0HA 2A7QA 1KI9A 3ADCA 1E99A 4L15A 2MSDB 4ZV4A 5AUPB 3GLFE 3I8SA 2R8RA 3DO6A 1BS1A 4CT5A 2YNMA 4JBXA 4RVCA 3LFUA 4NYJQ 1GWNA 2IXGA 1NLYA 1UKYA 1EX7A 3OEHD 1YZQA 3DMDA 5M04A 4PAMA 2ZJBA 1R5BA 2QRNA 3DKVA 2QTHA 4LCBA 1S0UA 2ZI9A 2PH1A 3LX8A 3KQNA 1IJFA 4OKSA 5FUVA 4JVSB 4FWTA 3RS0A 5AUQA 4V02A 2QMUA 4GP7A 1RYHA 1GRRA 3W8RA 3CW2A 4B48A 1T0JB 5JHHB 1R4AA 4Q1FA 3GPLA 2FFBA 3BOSA 4FN5A 4OHYA 3U3RA 1C1YA 2BCJQ 4JVMA 4YC7A 5F3WB 3OHMA 3I92A 3BH6A 3AKCA 1Y63A 3LBIA 2OG2A 1Z0AA 2A30A 1FTSA 1Z83A 4LV8B 1YJ5A 1WXQA 1P72A 3WY9A 5KSOA 4RD1A 1ONBA 3W3ZB 3G82C 4NCNA 1T91A 4D2IA 2BKUA 4M9SA 1E98A 1VTKA 4G3XA 2Q3FA 3EWAA 1E0KA 4JL5A 2IXFA 3K9LA 1OFHA 3IHLA 4ZI3A 3PV0A 3U4QA 3X1XA 2XJ9A 2V54A 3HU3A 4LUCA 2IUUA 4B6EA 4DDVA 4IDHA 5JCPA 3ADBA 1GM5A 3QG5A 2ZANA 1G8FA 3L8YA 4TTPA 3UKDA 2GWHA 2RGDA 2CEAA 1KJZA 4ARZB 2BEKA 1G291 3QG1A 2C2HA 2WWGA 1S9DA 2PCLA 2YZ2A 3FPAA 5AUOB 4II7A 3WXMA 1N6KA 3NBZC 4Q00A 4B3GA 1ZD9A 1W1WA 2JLQA 4LJ6A 4XJXA 4JYCA 3P26A 4ZIRA 3FTQA 4UKDA 3QVVA 4RCZA 3KJHA 4X8LA 1HQYE 1E96A 1TMKA 4N1AA 1PZNA 1XMSA 3QUSA 1OIVA 2ORVA 2ZROA 2OEPA 4JBWA 5FOWA 4DLWA 4HB2A 1EX6A 1JNYA 1CXZA 2QM7A 4AKGA 4LSGA 3RRYA 3A4NA 6Q21A 5JSZA 4FMDF 2CL6X 2D7DA 4JVLA 5KSPA 4V0LA 4MUBA 2IYLD 4NYMQ 4A2PA 3K1JA 3SYKA 2ZEJA 4D4LA 3BRWD 4JLKA 1JPJA 4AYXA 4B43A 1NNEA 4BZPA 2OCBA 1XU4A 2A2ZA 3BB4A 3JZAA 3MLEA 4TYNA 4A0GA 2TMKA 3A1SA 1ZRHA 2B7CA 4DVGA 2VF7A 1SKYB 1CF4A 3HJNA 2QQ0A 1Q0UA 3GLGB 4CEHA 1V43A 2ZJYA 1D9XA 4JL6A 3A6PC 3K9NA 2ODBA 2RH5A 3IUYA 5CLQA 5FUWA 2OFOA 4DB2A 421PA 1N6OA 2WPDA 3GD7A 1CR0A 1Z0JA 1U90A 3PUWA 4GZMA 5JWRA 3THYA 5AJVB 3V4RA 3SHFA 4GI7A 4LBVA 5BXQC 2IC5A 2WJGA 1TEVA 2WAXA 5EE5B 5JJIA 1NLZA 1GVNB 4PPQA 3LW8A 3CRVA 3ZJYA 1QHHB 4Q7LA 2XGJA 4RZXA 4DUGD 1MH1A 2B8TA 4M1SA 1W36D 3AQ4A 1IN5A 3SJAA 4KITB 3T12A 1T3HA 4KI0A 4B44A 2IHBA 4B76A 2J41A 3Q7PA 1D5CA 2WJIA 1KI3A 1ZJ6A 3REFA 1E6CA 3MWJA 2HYIC 1QBKC 2GRJA 1G7RA 2O8CB 4R71A 2W2TA 2JGNA 4DIDA 3IHWA 1R8SA 4KYUA 4TMKA 3E5HA 3RC3A 4B73A 3LV8A 1R0YA 3LY5A 3U7GA 4BFUA 1DG3A 3AUXA 2WJVA 4IOKA 5L3VA 2QL6A 4F93B 1CR2A 1BMFA 2D2EA 4PPFA 4OI4A 1J7KA 3IILA 2ERXA 5D3MA 1UFQA 1XJQA 3X1YA 3WMEA 2DFNA 4PHGA 2QBYA 3R20A 2ASEA 1R8QA 3B6EA 3Q8XB 3U7EB 5DN6D 3EA5A 4URZR 4B35A 2PL3A 2ZRCA 3SBEA 4NH0A 2PJZA 2VSXA 2ZM5A 4TSFD 4AYTA 3IQWA 1MT0A 2XEXA 3EZ7A 4XWAA 3TH5A 3WNDA 4B34A 2GJ9A 4MRVA 3WRXC 3LRPA 4DKXA 5CB8A 2ZRGA 4QJ4A 1NSTA 3QXHA 1R0XA 1P7CA 1W0JA 4LOAA 4C0AC 1W47A 2CNWD 3ETLA 2C8VA 2QTFA 2QRZA 4WZ6A 3P4YA 4DWJA 3CR7A 1SQ5A 1G16A 2AK3A 3SU8A 2AKAB 3W9YA 3WNCA 2I1QA 2J7KA 1FP6A 1Z0FA 3QXCA 2H18A 4KHZA 4RKFA 5EZ5A 4DSUA 3PJRA 2XTZA 4GFDA 4LC1A 2IYSA 1LB1B 1KY2A 3PEWA 3CRW1 2YYZA 2P2LA 5BWMA 3BXZA 1Z06A 3VR6A 1ZYUA 1N6IA 2C9OA 1R2QA 2JLSA 2A78A 2IYVA 3AUYA 2QNRA 3X1DA 1KMQA 2FV8A 3QKSA 2D4HA 2R2AA 2BV3A 2J3EA 2YWHA 4A15A 4KFSA 1G18A 1G5TA 1UM8A 2AN9A 2HLDD 2EFEB 2FFHA 3TQCA 3RWMB 2HCBA 1HT1E 2IYXA 2DPXA 3KX2A 3FFAA 5CITA 3ZDQA 3W90A 3UG7A 3AGQA 1V5WA 1NN5A 4LJ7A 1WQ1R 2EFGA 3LA6A 1H8HA 1J90A 1JALA 1U0JA 3A1VA 5BN4A 3FKSD 1XTSA 1KMHA 4Q66C 3UPUA 4DUGA 3MMPA 5IDVA 1S2MA 4IVQA 4PC3A 5JCZA 3ICEA 5EQTA 3UMFA 3O47A 2FJUA 3VAAA 2Z6VA 1EFUA 1MO4A 2PLFA 2RGBA 1Z08A 1JEDA 2RGAA 4BFWA 3O8DA 4P4SA 1F2TA 1T0HB 4XSGA 1KZ7B 1E9FA 2CVHA 5BYJA 2BKEA 1TQ6A 2QAGA 3A1UA 4OQMA 1YR8A 1N0VC 3K0EA 3AKEA 2YHSA 2HF9A 4OL0A 5DGXA 4QJ5A 3RYTC 3CKLA 3IPYA 3DZDA 5LBIA 3ZS9A 4ZCMA 2W2VA 2NPFA 3DM9B 1MOZA 2D62A 2G77B 4M1MA 4HAXA 2P6RA 3QPUA 3VX3A 2ZRKA 1E1RD 3BAFA 3T15A 2WWYA 1ZVQA 3GFOA 3NBFA 3HYRA 3SI7A 3QQ5A 2IS1A 3CONA 2V4ZA 4ABYA 1LS6A 5HKKA 3B78A 4BLRA 2V1XA 4UXIA 2FEMA 3QEOA 1D2EA 2FPMA 2BWJA 1RRGA 4AIIA 2CE7A 4TZ0A 4NYIR 2VBCA 1TNDA 3SJBA 4B3DA 4ZPXA 1IHUA 1TADA 2E1RA 3AVYA 3NEYA 1W4RA 2ZE7A 1W44A 2NO7A 4ACBA 1I4TD 1T3SA 1DVRA 1NY5A 2PEYA 1ESMA 1ZC4A 1F5NA 4C2UA 1ZINA 4QGGA 4DXAA 2VP5A 2IYWA 4OQLA 1XXHB 4LJ4A 2WWXA 3FMOB 4I1OA 4Q21A 4QGHA 1W4CA 5TVKA 3TVDA 2C98A 4RZUA 4RD2A 3TE6A 1DAMA 2WSSD 4DLZA 1NSFA 1EXMA 3MWKA 1P2SA 4A0FA 1E2LA 1N0WA 3HWSA 4IVRA 5IF9A 1GTVA 4WBSA 1HQCA 3B9QA 1ZM3A 4Z8YA 2Q9CA 2IEZA 3OEED 2W6JD 2GK6A 5AK0A 1NKTA 3CF6R 2JIZA 3PUVA 4LJ8A 3VHXA 2F9LA 2YWEA 3LVRE 2ZRLA 2HCJB 4C30A 2REOA 5EXPA 4FI3C 2ZUDA 1OFUX 3QE0A 3CPJB 4PO9A 5J4YA 3R9XA 3VHLB 3LLMA 4FD2A 2BM1A 2FZLA 2DYKA 5FTMA 4C0JA 1YRBA 5JZVA 2FX3A 1EESA 1W49A 4HDCA 5FTKA 5FOXA 1IJEA 2R62A 3OEHA 2WZQA 1GITA 5EUQB 2CLDX 2OT3B 3C8UA 3IEVA 5TARA 1HYQA 1GZSA 3THXB 2ECKA 4A2QA 4D82A 4G5RA 5J5CA 2CL0X 2FU5C 1SZPA 1KO7A 1O3YA 2OM2A 1PLLA 5DI3B 1W36B 4LJ5A 4E22A 4DDUA 5A5GA 3UMRA 2GEUA 3GP8A 1KDRA 4EFNA 4BEJA 4M9ZA 2GXSA 1YR6A 2X19A 4HB3A 5IK2A 2GJ8A 2GJAA 2CCKA 1ZD8A 1T3LA 1N6NA 4S35A 1M8PA 1G7TA 4GOXA 5CYPA 1EFRD 3JVUA 3LD9A 3U44A 1II9A 5DSZA 4QGAA 1KJYA 3BS4A 5L3QA 4OBEA 1A82A 2XXAB 3EW9A 1EFHA 2A5GA 1XEFA 2FEOA 2IWRA 3E2IA 4LK2A 3CPHA 3SJZA 2A5YB 4ZIRB 1NIPA 2IYUA 4IW3B 4MYCA 5DI9A 1XCPA 2FMXA 4I99A 5K8IA 1HEIA 2P67A 3UXMA 1U2RA 2WPDD 3CRMA 1X6VA 2XNDD 2GJKA 2Z43A 3CNNA 3WHKA 1KSGA 3E1SA 3K9GA 3X1WA 1NN0A 4G5SA 4URUR 1Q1EA 1G6OA 4IDOA 4BGDA 3B8HA 4O0MA 2XNSA 1FQKA 5CIQA 1XEXB 1E4VA 4K81B 5J4KA 5FL7A 4Z54A 4IFBA 4F92B 3FWYA 1M34E 2BEJA 2DFKB 2BMDA 2ZRAA 5ELXA 3QF4B 2WJHA 1SHKA 2DHRA 1NVVQ 3FGNA 4JSTA 1B0UA 1W4BA 2WSSA 1NKSA 1JR3D 1G8HA 3WBKA 1TU4A 4TWZA 4V0OA 4OI1A 1C9KA 1CBUA 4CEHB 3TW4A 2CK3A 2IA5A 2HF8A 2IXEA 4FMCF 4IKEA 2KBFA 3J81k 2FDCA 1GUAA 1SKQA 2GCOB 4PQYA 2CXXA 3B1WA 4PQRA 2PMKA 3PUXA 5FBWB 2P5TB 4ILEA 1G41A 2ZI6A 3EC1A 3KTAA 3THOA 3P32A 5FPYA 4WZAE 4XVRA 1XDBA 2O5VA 1Z5ZA 3CNOA 2WIBA 1RJ9A 5HKKD 4G5GA 3R9WA 5FFMA 5FUXA 4HLCA 1G17A 5B30A 4L9SA 1NI3A 4DB4A 2P6UA 1S96A 4CF7A 4Y0AA 2ZRDA 4X8OA 5JSZB 2WMNB 2KE5A 1OXUA 3FE2A 3VTKA 2R6DA 4QOSA 5KDOA 1ZP6A 2J0UB 3AP3A 4GOJA 3DEFA 4CRWB 4E5UA 2I3BA 3NC1C 4XVQA 4BLOA 4FMCB 1W7AA 2V6IA 3OIWA 1XNJA 3SFVA 2ZSEA 5IHPA 4OK5A 1E2NA 5CJPA 2LKCA 4JLAA 1TUIA 5F9HA 4PAOA 4ZKEA 4LX0A 3PENA 4NDZA 4C3ZA 2P6NA 1E0AA 4G01B 4PC7A 2GHIA 4XD7D 5KPDA 1R10A 4PPGA 2AWOA 3CX7A 4F38A 3VKGA 4GPTA 5KDDA 2GAAA 2NZJA 5EE9A 1Q22A 2VP2A 5UKDA 2ZPTX 1WBBA 4JVNA 3FYHA 3IO3A 3C7KA 4QHSA 5FR1A 5JFGA 3BH0A 1WA5A 2HT1A 2QMHA 1SXJA 2XNDA 3RWOA 4TMXA 4YLGA 3HU2A 4KCGA 3V9PA 1XEXA 3ZH9B 4BPBA 1DEKA 3GJ7A 4TZ6A 4IDNA 2ZRFA 4LHWA 4MKIA 1KO8A 1IY1A 2VHTA 1KDTA 1YZLA 2WKPA 1G5PA 1XRJA 2IF0A 1Z63A 4LZZA 1XXHE 1YZNA 3C5HA 3ZYCA 4UNRA 2JA1A 2QE7A 5E7IA 4M21A 4OHZA 3EPKA 1KKMA 3VX4A 1U98A 3K09C 2WM9B 1M6NA 4NE2A 5H1YA 5GVSA 1RC8A 5FOSA 4WIAA 4NMMA 4QKQA 1YZGA 2R6FA 4OQFA 4E03A 1M7GA 2EYQA 4PC2A 5HCNA 4N3NA 4D0GA 1OH6A 3ICQB 1FL9A 4TT3A 1KSJA 5LPNA 4V0MA 1NBME 1YR9A 1X8JA 4BUJA 3CLVA 1KIMA 2JJ2D 3D31A 1ZNZA 5J40A 3T1VA 3BIFA 3RHFA 3QEJA 1R6BX 1IN6A 3SOPA 2ZS9A 2XZPA 1H65A 1EWQA 2GXAA 1Z07A 1BYIA 1FX0B 1AN0A 4W5JA 3D7MA 1TTTA 1J99A 4EPYA 1VHLA 3HU1A 4Q4JB 4RZ3A 4WAUA 4HZUA 2ZI3A 5FOTA 5GJVC 2ZITA 5DO9A 4KFUA 3L0OA 1RPZA 2QPAA 2J0UA 3TAHA 1Q57A 3RABA 1E1QA 2JJ1D 5EJEA 2FSGA 4Q1AA 3M4YA 4LJ9A 4PXAA 3UMSA 2OLKA 2FSIA 1YZUA 4HAUA 3TGPA 1ZM4A 2V7QD 4WVFA 1S3GA 3SQWA 1TUEA 1M74A 1J8MF 4PANA 2W6JA 3TSOA 1QG2A 4ZI2A 1N3BA 1G7SA 3VKHA 2EYUA 1BOFA 4B3FX 4M1WA 2YC2C 1H8HD 3L8ZA 1KNXA 3LBHA 4U02A 1OKKD 2QORA 1CKEA 1KJWA 1M2OB 2KWIA 4GBMA 4WW0A 5JS7A 2R9VA 2ZS8A 1DE0A 1OFIA 2P5SA 3Q5EA 5GVRA 2VSFA 1P9WA 4QXAA 5DE3A 3RSOA 3RNLA 4Q9JA 3M0EA 4CT4B 1AZSC 2J7PA 3MGCA 1XTKA 1NY6A 4QHTA 2YKGA 2XB4A 4RD4A 3BGWA 4JL8A 4P4UA 1SXJD 1XXHA 3RVBA 4DSTA 4IOJA 4M1KA 4HEJA 2DWPA 1GFIA 3TMKA 1IN7A 3DDCA 1VG0B 5EXXA 1WB9A 1NVVR 1QHIA 2ZRBA 4Q01A 5EXSA 5KHOC 5CLLA 1CS4C 5KU1A 4Q48A 1G6HA 4U5XA 3W6PA 1FMJA 1Z0DA 3KXIA 2CHVA 4FIDA 4UJ3A 1E2PA 1U0HC 3I8XA 2C5LA 3T5DA 3WBJA 2ZI5A 4C0KA 1GILA 3OIVA 2ONJA 3L0SA 1XMVA 2LCFA 1IXRC 3CF0A 2IYRA 3ZZUA 1JBKA 3KFXA 4ZDKA 1G8PA 4MQBA 2D74A 2HLDA 1NL3A 3OF5A 5FTLA 1CIPA 3RANA 5AR1A 1OH5A 1G21E 1KK0A 4X8MA 5F9FA 4A82A 2EW1A 5P21A 2DFLA 1D2NA 1YQTA 5CIWA 1Q1ZA 2CMKA 3SR0A 3W6NA 5K8TA 4HAYA 1Z6YA 4TQAA 1PJRA 4V0ME 2IHYA 4O3MA 2VHQA 3FKSA 2AWNA 2R6CA 1Q1BA 1Z6TA 4Q7JB 2QP9X 4CEIA 3EA0A 2AXPA 3ADDA 1LVGA 4MGKR 1G3QA 5FPTA 1II8A 2P3SA 1IM2A 1DG1G 5FR2A 1E3MA 2AD5A 5B57C 1X8LA 5DNYB 2FA9A 2FSFA 2KI5A 3MFYA 3KB1A 3PEYA 3A4MA 1ZUNB 3QPWA 1S9HA 3GLHB 5F2EA 4LYJA 2IW3A 1IXSB 5KDLA 3ZLJA 4CZ2A 1OXXK 4I1SA 3CNLA 1N5KA 4MKFA 2B7BA 1NVWQ 1P9RA 2XJ4A 3B9PA 3HPRA 4BZQA 1LY1A 5JHGB 1ZCBA 2O8EB 3KKPA 2WSMA 1NMZA 3FHCB 1SVSA 5JWOA 5FTJA 1I4LD 1XEWY 1R7RA 5HE8A 5KOYA 1F6BA 3PVSA 3BFVA 3C5CA 3I32A 1P4SA 4P4TA 1GOTA 5FL3A 3Q9LA 3ZQJA 2ZRNA 3CM0A 1AA9A 3TNFA 3NEJA 4LJYA 3QOFA 5KYKA 1ZBDA 4B2LA 1FZQA 3K0CC 2D06A 3LX5A 2RAPA 2H8KA 1Q1QA 4PO1A 2FNAA 4PHFA 2IWHA 4AURA 3RLFA 2W0MA 1H8EA 4CDGA 3EPJA 1FNMA 3WP1B 3THYB 2WBLC 2PMDA 3Q3JB 4DCNA 4LHXA 3CRRA 5C18A 4JYBA 4AG5A 1G1MA 2RGNA 3N2IA 4TLDA 4EFLA 1QZXA 1XTQA 1XPOA 1RVDA 2O8CA 121PA 2VL7A 4TTQA 5B64A 1NG1A 2HUPA 4QC2A 4A1FA 3IDQA 1AQYA 3CUEF 5JI3E 2AKYA 4JLMA 4G5QA 2OCYC 1OT3A 3ND8A 2WKQA 4TQ9A 3TLXA 4EKDA 1G8GA 4FWIB 4I4LA 3RS4A 3W5IA 3KXLA 3R7WB 5H68A 5D3MB 2VF8A 1ETUA 1OXTA 2GA8A 5AUNB 2QBYB 2F3RA 2YINC 2ZU0C 1G3IA 4FMDB 5KSYA 5E7JA 2AK2A 5BQ5A 3U44B 1T5LA 3LBNA 3B13B 2OV2A 4BE7B 2GZAA 1RW4A 2AL7A 4EPRA 3P4XA 4QBFA 4YONB 3VMFA 1JECA 2IX3A 3DHWC 3GLFB 2FN4A 3ZZ0A 4JSYA 5JBQA 4BLSA 3FMIA 2IS2A 5EE3A 2FE4A 3QF7A 1G64A 3AP2A 2WWFA 1AZTA 1CJMA 2RCNA 3AF2A 3KXKA 4JLNA 3WNBA 2XZLA 1VG8A 3BBPA 1OIXA 4NCHA 2VP6A 2ZAOA 1F2TB 2XZOA 1XTJA 1XD9A 2IUTA 4OQXA 1CJUC 2GK7A 2ZIAA 4Q02A 5G53C 4V03A 2VTKA 2ODNA 1VHTA 3LWNA 4X8HA 1A5TA 2VYFA 2V6JA 2O8FA 4EJSB 4KLZA 4W5HA 3G0HA 4XVUA 1T8UA 1YKSA 1JPNA 3QENA 4JKIA 4Q7KA 1IN4A 3TQFA 4B71A 3AEZA 4LPSA 2GAOA 3SJCA 3DPUA 3NVAA 4GZLA 2WJJA 3CZPA 5FI1B 1OW3B 4HYYA 4DDWA 3U6BA 1P2UA 1P2TA 3K09A 1UJ2A 1QHYA 1AQUA 4PTLA 1A7JA 3A1TA 3OE7A 3BB1A 1E32A 1P61B 2JLVA 4URVR 2ZJ2A 4TMVA 4UJ5A 3UANA 4QRHA 3OE7D 4OI0A 2FOLA 2GCNA 2YOGA 3QVUA 1EFRA 2G0NA 1FNNA 4Y0VA 2QPTA 1S1MA 2WV9A 3CX6A 1BH2A 2ZUCA 1II0A 2A3RA 3LDAA 2Q6TA 1Q20A 2BCGY 3AV0B 1W5SA 2G1JA 4FCTA 3ZVLA 4B33A 3I5XA 1VCNA 1MRSA 4JJZA 2RHDA 4B75A 4BWYA 2YOHA 3PG5A 4OK3A 3U61B 2Z0MA 3ZD6A 3C41J 3W34A 3G5UA 2QAGB 4D0LB 2Q0HA 4JLVA 4EPTA 1VMAA 2FGKA 2REXB 1UEJA 5EE1A 1ZU4A 3RRZA 2O8DB 2FH5B 2WOJA 3EIEA 4LYAA 4PX9A 3VU9A 3EG5A 3SE0A 1OLOA 3BE4A 4TL8A 4MDEA 3SDZA 3AVVA 4WXRA 1Z47A 1XTRA 2QMOA 1OSNA 3KJGA 2FFAA 4ZDIA 2FF7A 3BERA 4GRAA 1US8A 4NHOA 1C4OA 4DRZA 2DBYA 1N5JA 4LDJA 4DCTA 4TLEA 1Y3AA 1FX0A 1NN1A 2HDNB 2FSHA 1OH8A 3NTUA 4LBZA 2UKDA 5DN6A 4LPKA 1GNPA 1GP2A 1CJTC 3U3JA 3GJ6A 4XTCS 3W8NA 4TN1A 5DHFA 3KKOA 4C2TA 1CULC 2MSEB 1OHHA 1W0KD 1YU9A 5L3SA 1KI4A 3L43A 3W6OA 1QG4A 3I72A 3RSLA 5DH9A 4TMZA 3U2QA 1SKYE 4MGIR 2H17A 2Y8EA 4NCIA 1IN8A 3B2EA 3U7FB 4PZLA 4B3XA 3BK7A 2REBA 1CRPA 2BDTA 4US1R 3NXSA 1N5LA 1DAIA 4JMPA 4MGYR 4KFRA 1LFDB 4M2LA 2DWOA 1N6PA 1HA3A 4KO8A 1NJGA 4ACAA 1A4RA 1GRQA 3BH7A 3GJ0A 1J70A 2ZRJA 3CBQA 621PA 4WA7A 1Z0IA 1P73A 1XD2B 2JASA 2OAQ1 2NGRA 3NIBA 4IDPA 3ZIAD 4YQFA 1Q3TA 3GJXC 2XSZA 3Q85A 1XEWX 2ERYA 4AKHA 2F55A 1G19A 1KHTA 2ZJAA 4NONA 4YMSA 5FPSA 1O87A 3K8YA 3QPVA 3FKQA 2B6HA 4EJSC 5TMPA 3WP0A 5BYKA 4NZYA 2ZE8A 3DMNA 5BW8A 3T06B 4O25A 1KDOA 5HPYB 1G4UR 4US0R 4BFYA 2R6GA 3WYFA 3NDBB 1CU1A 4WZBE 1F2UB 1JI0A 4B47A 2YWGA 1W4AA 1JB1A 2ODEA 1Z2CA 4M1OA 1S4QA 4RD6A 1UDWA 1EFCA 1E2HA 3SFZA 2NMVA 4W9MC 1K5GA 4AC9A 3DL0A 1VCIA 4RKEA 5IRCD 3BB3A 4EPXA 3PEVA 3AF3A 5SZIA 2QG6A 4B32A 4BLTA 4A36A 1NBMD 2YC4C 1E9AA 2E9SA 3K70C 4CEJB 1G5RA 1KO5A 1XCGB 2NO0A 4Q03A 4U00A 2O8DA 4RD0A 3I61A 1BIFA 1KK1A 4YDSA 2BBOA 1DS6A 4OHWA 4L9WA 1ANKA 5H70A 3U3KA 4YMTA 1E2IA 2X8AA 4MRRA 3K0AA 3MSXA 5EP3A 3TUJC 1G3MA 2HJVA 2OCPA 3HR8A 2ATVA 1K6MA 1E79A 1IONA 4AD8A 2ZRHA 1E9EA 1KKLA 4L8GA 1OXSC 5FPHA 3RS5A 2ZUBA 4TYQA 1VYTA 1IAQA 1MABA 1HY3A 4IEEA 1JEEA 4GNKA 4NCJA 821PA 4URXR 1IY2A 1KSHA 3C4JA 1LF5A 3K0FB 3PXGA 1E2MA 1HE1C 2QENA 3AB3A 3ZS8A 2NIPA 2ZI4A 3N2EA 2HEIA 4DLXA 2H7VA 3VNVA 1CTQA 3MJHA 5HTKA 2W6IA 4KU4A 4CW7A 3H4MA 3PUZA 2GETA 3CWQA 1CR4A 4QL3A 2PZFA 3PIRA 1U8YA 5TXGA 2ZYTX 3M6AA 4EPWA 1I4DD 1WF3A 3A58B 4NCKA 5DYIA 2J0VA 4F4IA 2GEDA 3QKUA 1GNQA 3K53A 2FG5A 5JI2E 3U5ZB 5JJLA 3AM1A 3ZZTA 1E1RA 4EUNA 1B23P 3K0CA 1E94E 4D25A 1ZM9A 2NO6A 1F3OA 3FMPB 3SZRA 3O8RA 5KSZA 4QHYA 2BIFA 3L2OB 2PT5A 1II8B 4AI6A 5FTNA 4KV9A 2CBZA 4HAWA 4V0KA 2O8EA 5EE0A 1N6RA 1KTVA 1DAFA 4MH0R 4US2R 4GDFA 4I1UA 1SGWA 2VH5R 1JAHA 3RS3A 4B3CA 4C9BA 3B7GA 2ZTSA 3LVQE 3AGPA 2PBRA 2QROA 4FMBB 2ZR0A 4KFTA 1SVLA 4POAA 3VR4A 4IFEA 4RFSB 2ZJOA 3K9HA 1XJCA 1ZUIA 4JKYA 4LI0A 4LV5B 3R8FA 2VHUA 5F98A 3L82B 4DDTA 4WXPA 2J7PD 4FXPA 2OE2A 2C03A 1MV5A 4I81A 2DFTA 4PO8A 2ZSFA 4BASA 1HT2E 2ZETA 4CGZA 5L3RA 3D8BA 3KQHA 1U81A 2ZAMA 4S2EA 2OO7A 5FUYA 4AWXA 1U99A 1KYIA 3FFBA 4P0TA 3PUYA 1RJ9B 2Z5FA 3TKLA 4BFTA 2IS4A 2BJWA 1W0KA 2O52A 3GEEA 1RRFA 4M22A 1TX4B 2XTMA 1N6HA 4Q7MB 4NTZA 1XP8A 4R2IA 3TAUA 4M1TA 1W2GA 4GP6A 2XB2A 3GLIE 1HTWA 2WTUA 1T9HA 2K5UA 1CLUA 2ORIA 1CP2A 4PQFA 4HLUA 3B1YA 1SVWA 3KJIA 4GL2A 4FCVA 1VG9B 2OXRA 5CDFA 1KO4A 1SXJC 1E0SA 3T1QA 2JATA 2ZQ5A 5HR5A 2Q3HA 2VA8A 3RRMA 1NVUQ 1R5NA 3I3SR 4MYTA 4PFSA 5CJ2A 3TR5A 3GFTA 4LGMA 4ARZA 2JLZA 4KODA 3VKWA 5JEEA 5KUTA 1P9NA 3AF1A 4G1UC 4DLUA 4GMDA 2WVJA 4QBIA 3AKDA 3R7WA 3VR5A 2YOFA 4HB0A 4MUAA 5AJXA 1VPLA 4NYJR 3VR1A 4EDHA 4EPVA 4LWZA 2XOKA 5BN3A 1QHSA 1MO5A 3HR7A 3IIMA 2XX3A 1GL9B 4CYMA 4NBSA 2Z4RA 4IEIA 1DPFA 2JJ2A 3UATA 1WCV1 4A6PA 3OIYA 5CB6A 2CHQA 1X8KA 2QA5A 4XTRA 2N46A 4RD3A 4PSKA 1EFTA 3TK1A 4DT1A 4DSOA 3W5JA 3MUFA 1TL7C 3U3MA 2O8BA 3FOZA 1LF0A 3EC2A 4OQNA 3V00A 5IT5A 2OBMA 2H1LA 4NPHA 2FPLA 2ODWA 2ONKA 4OHXA 3GMTA 2BBWA 3SS8A 2RGCA 1LTQA 2X1VA 1W5TA 4D4MA 4AY2A 2J1LA 3K0SA 4QJ3A 2ANBA 2EWWA 1DELA 3IPXA 2V1UA 2G9NA 2GF0A 2Z4SA 4KAXA 2LKDA 4UNSA 5SZKB 4F91B 3QBTA 2UZIR 2F3TA 1JJ7A 3P27A 4TYPA 4Q1CA 1T6NA 2B21A 1UKVY 4Q9HA 4TMWA 1KI7A 2BM0A 1M7HA 5E95A 1M7BA 1U8ZA 3I4LA 5LB4A 3EZ2A 1OKKA 2RGEA 5TB5A 1NMXA 3OAAA 1SVMA 1P6XA 2NPIA 5AJZA 4LHZA 2CK3D 3ASZA 3BJIC 5KPJA 2ZXUA 4HB4A 2JEOA 1X3SA 3ONWA 3AVOA 1H8ED 3KDSE 2L0XA 4NU0A 1GKUB 3T1TA 2D7CA 4JLOA 1ZD1A 1GG2A 1NIJA 3OESA 4TT3D 2NO9A 4E07A 4FW9A 1KO1A 2GZHA 1PLJA 1AJEA 3PEUA 2QSZA 2VIIA 3EIHA 1E2QA 2GILA 3QKRB 3GLFA 3ECCA 2OBNA 4NYMR 2NO1A 1PUIA 4JS0A 3TVTA 1MO3A 1XZQA 2G88A 3TSWA 3B82A 1LS1A 3WHLA 4IJMA 3KB2A 1OHHD 3QNUA 2ZYWX 1UBEA 3EX7C 1AIPA 4RZ2A 5FOVA 3WRYC 2DCUA 4Q1DA 3THWA 2V3CC 3TIFA 3TBKA 4C4PA 5DLQC 1ZC3A 3FDIA 3NH6A 3T1OA 2QQEA 1FP7A 3TSZA 3ASYA 4HAZA 4KSCA 4O2RA 1E9DA 1DO2A 1IY0A 1RZ3A 2OCAA 5FH9A 2VHJA 5K8LA 4R2HA 1N5IA 2A5FA 2EWVA 4OHVA 4W5WA 4DCVA 2NQ2C 1JXMA 1OJLA 4UQOA 4P31A 4Q4AA 4AKEA 2VEDA 5LD2C 1GAJA 3I62A 4BQSA 2W00A 4UXJA 2DR3A 3EZ9A 2RGGA 3WYAA 2H16A 2ZRPA 4XD7A 3AVXA 1EG7A 1G3UA 1JJVA 4XWKA 2SHKA 4Q1EA 3KUCA 2KSQA 3AP1A 3N5CA 2J59A 4ZCIA 2MMCA 4AYWA 2IK8A 3NH9A 2ZVQX 1KI6B 4PPNA 4I1VA 5A4JA 3A36A 2O0KA 1UKZA 3HP1A 3LO5A 5GJBA 2JLRA 2YJTD 3F8TA 4A8JA 4MITA 1T8TA 5FPKA 3A37A 3DOEA 2FZ4A 5TY0A 1GRNA 1E79D 5L8VA 4DZZA 3SYNA 1MKYA 1NRJB 2W6ID 5LD2B 2UVQA 1R0ZA 2CJWB 4OI2A 2CDNA 1XJ0A 1NP6A 1ZNYA 2GESA 2GCPA 4K46A 5AWFC 2RGNC 1PV4A 2O0JA 1FPMA 2ZSBA 1R5OA 2QGZA 1Z8FA 3FMFA 5CK4A 1VYVA 4D80A 3EPLA 2C78A 4MRNA 1S1CA 3M1IA 1TQDA 1F48A 1VKJA 1JR6A 3NDPA 1XZPA 3OAAD 4DEYA 5D3QA 1U94A 4IOMA 2CNWA 2NG1A 4A2WA 1JQLB 1ZUHA 1NLFA 4V0NA 2KB0A 2QE7D 4ZDJA 1Z6XA 2OLJA 2JLWA 5EP1A 4CEIB 3IBGA 2F43A 2V9PA 3EIQA 4HLDA 5C4GB 1VIAA 1WP9A 2GKSA 3O8BA 1JR3A 1VG1A 1UPTA 2FGJA 4A0RA 5E3HA 1DBSA 4UXHA 3U4QB 4M8NE 3KL4A 1E9BA 3U60B 4TTRA 1VDZA 2QZ4A 3CRQA 1EK0A 2F6RA 2F1IA 3GLIB 3QSYA 3A4LA 2VP0A 4B6FA 1X86B 2G6BA 2J46A 4D6PA 2J0QA 1XD2A 5JRZA 3LLUA 3F3YA 3AH8A 3K0AB 3QIAA 1E2DA 4L4UA 5G40A 2NTYC 1JXOA 2WOOA 1KOFA 2DWQA 3ZD7A 1TPZA 1FMLA 1XD8A 3Q7QA 1L2TA 4Q9IA 3AVPA 4TQUS 3PQCA 1IQPA 2QGNA 2CCGA 5EP2A 3AF0A 4M9QA 2GDJA 1AS3A 4HSEA 1Z3IX 4YDHB 4Q1BA 1N2CE 3Q5DA 3B1XA 1OPXA 4RY2A 1LV7A 1KK3A 3MWLA 4HATA 1ZCAA 3QJYA 4BFXA 1FUUA 4JIMA 1E2JA 2IS6A 5A0FA 5SZHB 4NKRA 4EIWA 4EQ6A 3RC8A 2EQBA 2I1VB 2QI9C 1OYYA 2BMFA 1UBGA 4MKHA 2G83A 2F9MA 2PT7A 1EGAA 4Z51A 4F4CA 4PHTA 4TLCA 5JECA 2BHRA 4Q19A 2JAQA 2W2XA 1XCMA 2WHXA 3BC1A 4IVPA 1AK2A 1GDDA 3TUIC 2BVNA 3WMFA 4DLTA 5K8UA 5J4LA 1XF9A 4G0NA 3DOFA 1YVDA 4PSAA 3TJZA 3KQUA 1UEIA 1UAAA 2BC9A 1FQJA 1WRBA 3BD9A 3K70D 1SHZA 4NL4H 1ZM2A 3CPEA 4B3BA 4DSNA 2VHCA 4QM6A 3RS7A 3FB4A 1XPUA 3T61A 3OFNA 5TV2A 5C1BA 5EZ6B 1P5ZB 3NBXX 3PR1A 3S1AA 1QHXA 5KNCA 3EZ6A 2R65A 4DJTA 4A8JC 1Z28A 5DIFA 4KSBA 3SNHA 1RKBA 2RGXA 4BEBA 3EXAA 1P2VA 3KZ1E 2WMOB 3IIKA 3K0FA 4Q18A 2XITA 1MRNA 3CH4B 4G5OA 5E4FA 5HZKA 1BKDR 3MG9A 5CK5A 2X77A 1ZNXA 4QFMA 4BLPA 5JS8A 2OFXA 3IIJA 2PLRA 1P3JA 4FINA 1KK2A 5FL7D 2C9YA 1XB2A 1UADA 4M9XA 2KBEA 1L4UA 1YHNA 1KSFX 4XSHA 4PAQA 3KKNA 3T5GA 1QHHA 3IGFA 4JJKA 2EVWX 4LHYA 4M1YA 1OE0A 2GJSA 2OHFA 5TDHA 5JRJA 1A1VA 4RFVA 1P62B 2IYZA
chains in the Genus database with same CATH superfamily
4FB4A 2ZT6A 2PBPA 1C7ZA 4HZUB 3BGVA 4C0QC 3D3JA 1L5RA 1D9ZA 3ER8A 4XWTA 1F51E 1KAOA 3E4CA 1XJ5A 3HGMA 1QIMA 3P52A 3L7AA 2JFQA 4IGAA 4ZAXA 3VDQA 3DLHA 3JVVA 3G9ZA 3I2JA 3K4QA 2V7VA 2XQFA 1YRAA 3B85A 2AF4C 2PQMA 3JYLA 1KGDA 3DKPA 3WRXA 3JD3A 5JMTA 1QX4A 1TZ2A 4MDFA 3GJ3A 4JBYA 2X9NA 1B6GA 1Q77A 3EMVA 4I3GA 2B6NA 4P4NA 1QDEA 1JYSA 1UANA 2FX2A 3PYLA 4GYYA 4AUEA 1TJYA 1BO6A 4LY9A 2DQSA 5KREA 4P58A 3HEMA 4Z9BA 4A2CA 8GPBA 3IJPA 3INYA 5ESWA 2WUEA 3Q3CA 3H8SA 4EITA 4R9UC 4E94A 5JBXA 1FRQA 2AD1A 4H0CA 3H13A 1ADFA 1B6SA 1L4NA 3EH2A 4BQRA 3L5OA 5I8PA 3QPBA 3TJRA 4M4SA 3IRVA 3GHHA 5LFAA 1Z34A 4WUVA 2P2DA 1KEEA 4L5JA 4TLMB 4UNNA 2X14A 3EF3A 3C6QA 1INLA 3JTMA 3AJRA 4GXRA 4CKXA 4I4TF 2VQSA 3C7CB 2JI4A 1Y4DE 4ND6A 5JW6A 2PMWB 1AZWA 3CG4A 4P32A 2CFSA 1SY7A 3IP3A 4JI7B 2PKXA 3L3BA 3HL4A 3VGJA 4HZIA 4LISA 1T25A 1FU8A 4OTZA 5EIWA 2PEZA 1DLJA 3C1OA 4ZZ0A 1HUQA 4WGGA 1VGQA 3KC2A 4KXFB 3WBBA 1XTIA 4JI1B 5C8DA 5FX2A 3L04A 1P2DA 3CB4A 3NWOA 1OTXA 3IEUA 3IPAA 1X1QA 2J31A 2JF0A 2X2EA 3GGCA 3QF4A 1X1SA 5E3JA 2RHMA 2HWWA 1E9RA 1COWA 1GZ4A 5AI8A 3T3EA 3WMWA 1IIRA 1C3VA 1DTWA 2IOFA 2RKWA 5F64A 4NPAA 3MUEA 3UK0A 3ID6C 4E2ZA 1Z8HA 1EFAA 1Q12A 2HYDA 4YHHB 4IOLA 2UZ4A 3FWKA 1ENZA 2WP8J 3L6EA 1GTZA 1SPXA 2GBFA 3N2GA 4URYR 3LQRA 2G0TA 4NG4A 3TWOA 3EWIA 3R3ZA 1JSZA 1XMIA 2JGIA 1EUDA 1KETA 4BE9A 2GCOA 4R54A 4FNMA 2YH2A 3ZE9A 2FWRA 1DFGA 3QKSB 3AI2A 3C3CA 1PEKE 5AHOA 2ORYA 2DPHA 2YWJA 4KO2S 1KMHB 4DHEA 3Q4GA 1BRTA 1Q0SA 4KIJA 1CJVC 2JAHA 1D8TA 3EWSA 4C5CA 4YJFB 2EKBA 2VPWA 3BKWA 4OFBA 3SLRA 1Y6FA 2DPGA 2HA6A 4PW0A 4M6WA 3Q9NA 1LPNA 1ZGGA 5E6RA 4MVJE 3ND6A 3PF8A 4R2JA 4ZVQA 4B7CA 4TXNA 5CCDA 2VREA 3PL1A 1DV2A 2BH2A 3KOYA 5G0WA 3P9KA 2OFWA 1JWBB 2GEVA 1QZZA 4LC0A 3SBDA 2IQIA 3UWOA 1DOAA 5LQNA 3U7HB 3JY6A 1Y8CA 2HIMA 3UUFA 5ADUS 4ELSA 3MD0A 4EW1A 2ISQA 3IPCA 1R0WA 5KYNA 4LHSA 2E4ZA 3ITNA 4AZSA 3GU3A 4BVKA 1XBTA 3JTEA 1NNUA 5CG2A 3D7KA 1GG9A 4GPEA 3SXJA 2B25A 2MOKA 3EOBI 2HN9A 1JHPA 3Q15C 2OCXA 1TKAA 4J0IA 2ZLBA 2D1FA 3E0QA 3L0IB 1SR8A 5AHWA 3NYWA 4KLNA 5DHRA 4RLHA 2WB4A 4EF4A 2ZBFA 4PICA 1MCZA 4D9FA 2V55B 5HYVA 3ZLTA 4OF4A 3HCNA 5EOVA 5EIFA 1SOMA 1G98A 3QK8A 5AI6A 3D3WB 4UBJA 2J45A 5BMOA 2H1OA 1IN1A 4RELA 1DXYA 2ZIZA 5DKFA 4B3TB 2QD1A 4MWDA 5IARA 3SEAA 4Z1MD 1UXKA 3CZ4A 1S7CA 3QLUC 2GEFA 5G0TA 4EHDA 4YMUA 1WPRA 1JR2A 3WDLA 3QYJA 4E09A 5IDWA 2IU4A 3DMYA 3DZ8A 1E2KA 2W2MA 5LZ8A 4KYIB 3KR1A 5FEMA 3DBRB 1CS0B 4HEQA 1NMSA 1TAGA 1L8OA 3BQ9A 1UC5B 3OZFA 3OY2A 3TD6A 2EGGA 5ALHA 1NI4B 1PVVA 1QLWA 1JDPA 3DWEX 3OZXA 4Z86A 1FIUA 1FEZA 2BFPA 3M3DA 2Y9MB 4R16A 1MDBA 2R6AA 2XRFA 1XPJA 2A0KA 3FETA 4I5FA 4J1TA 2CJXA 2BEUB 5L3ZA 5B1YA 4ADSG 1GKIA 2ROQA 3GAFA 1VSVA 3NT5A 4TL9A 5IEBA 1RWBA 4ASUD 4ZTBA 5LA6F 3UHOA 4U3JB 4R1UA 3CF2A 2N42A 4MCIA 2WHPA 4XB6B 1GL6A 4K87A 1ZRNA 2BD0A 1QZTA 4LDRA 2BRUA 2V0CA 2F4VB 5IHXA 1F12A 1KAEA 3UOGA 1KH2A 1DKPA 1KI2A 5JLAA 4QIHA 3OSZA 3ZHSA 2ECQA 3KQKA 1KMCA 3PPWA 2X0IA 1XQWA 3AFOA 3ELBA 3GEMA 4Q12A 4B2PA 1IG0A 1TYZA 5G41A 1HQKA 4FS3A 5G1PA 2P69A 4URWR 1DO0A 1ADCA 1Q3HA 1CY8A 4WLOA 5IYZF 3HKEA 5CXQA 4ETMA 1NZFA 4R84A 4RHFA 3FVWA 2AS0A 2G9QA 3Q8LA 1L4BA 4B6RA 3UKJA 1JA1A 1KQOA 2QLMA 4OHMA 1KWGA 1RM5A 2ZJ8A 2VTBB 1IBLB 2EIXA 3IAUA 4JVOA 4LBWA 2XOKD 2FKNA 2UYOA 3T7KA 1V7PC 4HDAA 1T5HX 1WXIA 1R8XA 1J5XA 2GZDA 2Z2ZA 4Q4JA 4ZQIA 1X2BA 3GLIA 2GRUA 3IEPA 5ITVA 2C94A 5JMPA 2WHYA 2FAXA 3F46A 3B7PA 3BCHA 2D59A 3QEMA 2VYVD 3GEGA 2FE1A 5J1TB 4XPZA 8OHMA 3W3AA 3AF4A 3RDPA 1QF7A 4DE5A 2WU4A 3NGMA 4HNUA 2E0IA 2OAP1 1L4YA 3I1FA 1X9HA 4GUAA 1OIWA 3IHTA 4IY1A 4LDNA 2IJGX 2ZU6A 4YFVA 3AHCA 1W9MA 2LXNA 2D54A 1RYFA 2BI7A 1N2SA 2ZRQA 4G0MA 4R1PA 2Q7OE 4AG6A 3PDHA 4L5YA 3Q1TA 4LXIA 1MB2A 3LCCA 4EL5A 4P3PA 2Q3MA 3BFXA 3GRUA 4ON9A 1DBQA 1NFRA 3FBGA 4QU8A 3GCXA 1F4LA 3DE2X 4MQFB 4B6SA 1L7EA 3BCSA 3EA4A 1SVIA 2G3YA 3P2IA 3WFIA 1B76A 2BTEA 1WDTA 3ZIAA 4R8VA 5LCXA 5J2UF 1W46A 4UVGA 3KG2A 1I5EA 5K2OA 1ZGCA 4FCWA 521PA 3R76A 3EY9A 2LWIA 1V1MB 3BRCA 3DAHA 5AICA 3SICE 2O1WA 1T4DA 2IEYA 3A14A 1N78A 3KZCA 3II6X 4U7DA 2EW2A 3BQNB 4RVSA 2D5AA 1RBQA 4DT1B 1P1CA 4PSCA 2I6GA 3EXIA 4X61A 5THXA 1XPRA 2GSDA 3F90A 3QXXA 4PCAA 4QATA 4EQ6B 1FJGB 5JS1A 1ZIPA 4HUTA 4RULA 1KEZA 5T3UA 2VNAA 1KZGB 3OZSA 2EU8A 4P7BA 1OXMA 1SHLA 8ATCA 1DQPA 2F1JA 3CH7A 2O2CA 4UDXX 4FT2A 2D7JA 4AF6A 4KW7A 5EUMA 1X92A 3UK6A 2QTVB 2R8YA 3KO8A 3IOMA 2IHJA 3OZWA 3WGOA 1BW9B 3S2YA 3FPCA 3PHCA 3OX4A 1DAGA 3DLPX 3W79A 3AR2A 2DTDA 2QN6A 2FUG6 4YMVA 2Q7DA 4J8PA 1ZLYA 4ZYUA 2B5VA 3DZFA 3JASB 4WK2B 4ZCLA 5IFKA 2GVDC 4RH1A 2P62A 1P5FA 2KJQA 5A1JA 1KNQA 3RFXA 3AVWA 5K6AC 4X90A 3L06A 4C4TA 4KVGA 3QMWA 5LJLA 1U2PA 3NHKA 1NW3A 4IIUA 3ZOKA 3T34A 2H2FA 4B4DA 2YBEA 5DK4A 5DRYA 3ZNPA 1N5OX 1MXFA 3PGLA 1JHAA 2AN3A 3D8RA 1YD7A 3HN6A 1D6NA 4CFZA 3L7IA 1LSSA 4JBHA 3KUDA 4ZWNA 4BNJA 1A5BB 4K3VA 1PFQA 3R0VA 2J5RA 3HDTA 5G2OA 3FLAA 1GXSB 4R9NA 3HCOA 2A8YA 1VA4A 5IDQA 4KQJA 1Z8NA 3JQGA 5JOQA 5D5QA 1JFTA 5CT6A 3WNVA 1LBEA 4PXYA 4PZ9A 2H92A 3GNQA 4MW1A 1O96A 2C99A 3U0BA 4N5HX 3MTAA 4EAQA 5KAMA 5GADl 1OY1A 4BNTA 5LB2A 2A88A 4MW5A 1QIJA 2P1RA 3VZRA 1JLLA 2GUWA 2KX7A 2QTWB 3L4SO 1V11A 1ZIOA 2QSYA 3ZDCA 3MRSA 2YRXA 4IZBA 1K88A 1KJQA 2DB3A 4EYEA 3NC0C 2WWWA 5AVZA 1KVUA 4DDHA 2LDBA 4HR7A 2P90A 1LJ8A 2XPCA 2GXQA 3F0TA 3I01M 4HWTA 3V4LA 2XAAA 5A9TA 4ZQEA 3IBYA 3UIEA 3OKAA 2PLWA 4HUQB 4MJXA 3TFOA 5KQMA 1ZU5A 4ZOEA 2OUKA 3CSUA 4AFNA 4KXVA 3AVTA 5I7EA 2QLFA 4RVGA 1QVAA 4UCXA 3NBUA 5ALLA 3U7IA 4FYIA 2QMEA 4UDYX 1Q7EA 5CYOA 4ZV7A 3V8EA 2FEKA 4A4DA 4N76A 1KYTA 1BNCA 1ZICA 4EA8A 5A7HA 2MSCB 4MYHA 2I2XB 2RH4A 4LV8B 4MMXB 4PC6A 1CLEA 3MBIA 1PHPA 3CRZA 3W5HA 4PC1A 1KAGA 1H3EA 4QRDA 1FPQA 5J2TF 5J4HA 2PT6A 1ZW6A 2DPMA 1VGRA 2Q21A 5IN5A 1FFEA 4L16A 3L1IA 4HMQA 4YVFA 3U7JA 1M2WA 1UF9A 3TEMA 1ZNWA 4KJXA 3OD5A 2OSBA 3VTZA 2QS9A 3INTA 2HW8A 1MQ9A 1K7EB 1YDEA 4IDFA 4J16C 2C29D 5BSEA 1V96A 3DKRA 1P45A 4N0DA 1QRSA 5D00A 1SEVA 1EVZA 1SOWA 1CR6A 3H5WA 5ALXA 4AW9A 4GMKA 5E2BA 1FFCA 3B53X 4C7OB 2N1MA 1H85A 2YXLA 3OFND 4RSMA 3IT3A 4FJWD 2IP1A 3LXXA 1YQGA 1ZXBA 1Q0HA 2ATEA 2BGJA 4I4NA 4MVJI 3SBXA 4G0ZA 5IH7A 1QR6A 3TDKA 1FVOA 1MO6A 1S89A 3GEHA 4HX9A 2XTJA 3NG1A 2QUZA 5IJZA 3WOVA 2CDAA 4QXOA 1UBFA 1FDVA 3V8PA 3WTBA 4DR5B 2A33A 1Z2EA 1BROA 1LEHA 3P1JA 4LZOA 5H02A 1YS9A 1V39A 1PR1A 3AU9A 4U39A 5KWEA 4ALJA 4MVJF 4GKAA 4KR9A 4RAQA 1JR3E 4LY6A 3QNWA 4GEGA 5AW6A 5K8VA 2WJYA 3OC6A 4UDNA 2PJRA 3TR0A 2CVQA 3H84A 5IC5A 1CETA 2FW6A 2QP4A 2QRJA 3LZDA 2E5FA 2NYRA 4PX2A 4U2KA 3THWB 5AVVA 5CA1A 4HQFA 2VAWA 4X1IA 3W2IA 5HOQA 3RT7A 1OXVA 5REQB 1ZNQO 1DJLA 1HE5A 5BN5A 3JZIA 3WLFA 3A1WA 2YQZA 3DXZA 4NAVA 1Y9DA 1W1UA 2P40A 4Z7JA 2IH2A 1L0BA 3GROA 3QKIA 5HBRA 4HDQB 1T4CB 2VRCD 2ZR9A 1J8QA 4I1PA 3E22B 2F1RA 4YMWA 1CUHA 2FRDA 1L9XA 3SMQA 1ECLA 2FPIA 3TRKA 1NBHA 1U0LA 1GDHA 4HJXA 4A8JB 1JYEA 2GBLA 3WLNA 1E18A 2XWJI 3EXFA 3MTJA 3PT9A 3I23A 1E3EA 4BVEA 2XOXA 1QRRA 1PEAA 4MI6A 5C8VA 4JNKA 4DMCA 5K3AA 5TJHA 1LPMA 1WHSB 2EG5A 1QVRA 1EK5A 2BFMA 4EJSA 4MYDA 3L84A 2I33A 4QUIA 1OC4A 2VJAA 2A7QA 3IR5A 4ZU3A 5DZSA 5CPFA 1CE8B 4CE6A 2OGTA 1KI9A 3ADCA 4EVRA 1UX4A 4UD2A 1H5UA 4YAUA 2MSDB 1W8IA 4YA6A 1IB0A 4ZV4A 3N3BC 1U04A 4O8ZA 3T89A 1E7RA 3W5DA 3GLFE 3ZCRA 3RSQA 4RH0A 2R8RA 4ZGWA 3NASA 4CT5A 5I47A 4LDPA 3WB1A 2IHUA 4NYJQ 3WRWA 3QITA 1CWUA 1EX7A 1K8ZB 1ISRA 3JAKB 4IQFA 1R5BA 3L41A 4FEGA 3T7EA 4ZVOA 1YIAA 1K4MA 1B14A 4FSDA 2I3AA 3DAYA 3Q7EA 4QYTA 3ICCA 5EZQA 3HKDA 1RJEA 3LX8A 4HQOA 1IJFA 4OKSA 4JVSB 3RS0A 3O9VA 3FPJA 4RKYA 1JI3A 3GK3A 1X87A 2IEXA 1B8VA 5IBQA 4OYYA 1R4AA 4Q1FA 2PD4A 3H2IA 3D0OA 4FN5A 3EJ6A 5LQSA 2L42A 3U3RA 1HPLA 2BCJQ 4JVMA 2QG9A 1IMOA 4MA5A 1MP0A 3AIMA 3BH6A 1Y63A 2P7HA 3LBIA 4G0OA 3TNLA 4DNOA 5AW4A 5AVTA 4CN8A 1SUAA 1UJMA 2CHEA 1UM9A 2O3RA 4G26A 4H7IA 1WXQA 1XIVA 1Z17A 1ZK4A 2QN7A 3JCZA 2OYRA 5BWLA 2RHBA 1TC2A 5KNLA 3ZV6A 3G82C 4NCNA 1K3TA 5IAAA 2G70A 3HDVA 2Y67A 2ZIGA 3TNJA 4B3RB 3DV0B 4CL0A 1XV5A 2BKUA 5CHYA 2C00A 3IKLA 5EZYB 2Q3FA 2RGWA 4BNDB 1A8PA 5ALTA 4QWMA 2IXFA 5F23A 1BWQA 3NTLA 3IHLA 1MOPA 4RIFA 1Y3FE 1OU0A 1YR2A 2NAFA 2IY7A 2XJ9A 4LUCA 4YROA 4ZEWA 2HCTA 2OXTA 4ZMSA 2ZWOA 1U3WA 2D5CA 3HJCA 5JCPA 1GM5A 1SJ9A 5FO1A 4ZO9A 1FE8A 2ZUWA 4Q0MA 4CBVA 4ZVNA 4FM9A 1KJZA 1C30A 4EEXA 4YFYA 1XA4A 1N4AA 2PPVA 1P91A 2B7LA 3FPAA 4NU8X 3NUQA 5T5QA 3CE6A 4II7A 3WXMA 1L7RA 2XY4A 1N6KA 1E92A 5AI5A 1VJCA 5MN5A 3EODA 1NATA 1C0EA 1PR5A 2ZWIA 3FTQA 4UKDA 4RCZA 2Z04A 5EFOA 3EQ6A 3P7MA 1AXRA 1DSSG 4MVJH 6REQB 1U0RA 1WDLA 1U8TA 5CX1A 1ECPA 2R2GA 2A35A 1XMSA 3I37X 3I4CA 4OHUA 5DGCA 4XGNA 2CY0A 5AHKA 4HGZA 3WGUA 5JFTA 4ZI7F 4YMLA 4RTKA 3MQ2A 1PAUA 2OR3A 2FZWA 2QDXA 3UQZA 3LE8A 4B5LA 4X84A 5IBPA 1JNYA 3B2QA 4XVCA 3RRYA 4H3VA 4I6JA 5AESA 4EOGA 4JVLA 1GRCA 4NHEA 2IV7A 4MUEA 4PV7A 3R6GA 4MUBA 1NXOA 3MGAA 4OYLA 4LTNA 2KPOA 4EY8A 3K1JA 5P8WA 1KQ3A 3BRWD 1SU7A 3G0GA 1JPJA 2VJMA 4B43A 4TGLA 3VJMA 1NNEA 1NOIA 1JVNA 2OCBA 3OOJA 4M9CA 1C4WA 4TZTA 2YJGA 3C3YA 3JZAA 3MLEA 4UE3S 3ECAA 5C5EA 3O0TA 3RUFA 3DDHA 1SKYB 3HJNA 2QQ0A 1B73A 5EHQA 5BT9A 5BSMA 4CEHA 1QAMA 5AIAA 1PD1A 3FCUB 4DJAA 1GKLA 1WPQA 4D3YA 2Y1FA 3U9SA 3K9NA 2ODBA 2MDTA 1X7WA 3IUYA 3KYIB 4UU8A 5EMKA 1KQNA 3VAZA 1MMFB 4MXDA 3VTAA 421PA 5AI9A 5COBA 2W2OA 3THYA 5AJVB 3V4RA 5E4TA 2XYVA 5EFZA 3MTQA 1F4VA 1HE2A 4JUCA 4KQHA 2JB9A 4PGGA 2IC5A 1H6AA 2WVGA 2ZCVA 3WWEA 1Z33A 2ZYGA 4FS8A 4A0QA 5JJIA 3EXHC 2ZUVA 3CRVA 1RI3A 1PVDA 1A9RA 2XVXA 4YLEA 1MH1A 3WLTA 2B8TA 1J4AA 1CVLA 2H31A 2XMCA 2QWXA 4GOMD 1QCYA 3LUKA 4H3KB 4M1SA 4MS3B 4Z0HO 4QG3A 1B0ZA 3SGLA 3V2GA 1LBSA 1X7ZB 4KI0A 4YUAA 4FQ8A 9LDTA 3CKYA 1JMYA 4B76A 2G1UA 2O8NA 2VZ9A 3Q7PA 4TTTS 1I80A 3FBWA 1D5CA 5I7HA 4YCCA 2GGSA 4HVTA 4O4HB 4C05A 3W8IB 2O8CB 1U3TA 2R3SA 1BW9A 4BP3A 4CR7A 2JGNA 1MF7A 4FJ1A 1R8SA 4K9RA 4EA9A 4QLAA 4IQ8A 2H7CA 3OX2A 5CFLA 5FWAA 1BTOA 2EWMA 4BFUA 1DG3A 1DNPA 3IPLA 1WD5A 3TQOA 4TS1A 5CFMA 4PPFA 1HI9A 2QOEA 4OI4A 3H99A 4HGQA 3L0DA 1DBVO 2ERXA 4BKQA 1XJQA 3GAZA 4JKOA 4FLMA 1J8FA 1YZFA 1O94D 2DFNA 3MTGA 3R20A 4J1QA 4UU0A 3TXYA 2P1DA 4TV9F 5T41A 3ZC3A 5EIXA 1E5XA 3OUUA 2HHAA 1BS2A 2W2KA 3EA5A 1NQUA 1QC5A 3DL7A 1K08A 4LZNA 2VSXA 1NVBA 5HUHA 4D8XA 2EZ8A 1HO3A 1ULUA 3PJDA 4DYDA 2XEXA 5EJ5A 1UJ4A 3ZPXA 5BV2P 1NJ5A 1V5IA 4EGSA 3FLBA 3OZCA 1FLNA 3UJPA 4C08A 3LRPA 3NDRA 2NXCA 3COPA 4KRXA 1P4AA 3DS8A 4QJ4A 1ORIA 1GXSA 1XMPA 2OPBA 1W0JA 1P7CA 4LOAA 5CBPB 1Q7GA 4LJLA 3NTRA 3MTDA 4WZ6A 3RVKA 4EUSA 3CR7A 4R31A 1SQ5A 1NF2A 1SCKA 2HX1A 4DG5A 4KLAA 4UTOA 1KMNA 2DZDA 2V6BA 2QX8A 3B6MA 2Q49A 3D7RA 3LIIA 4TWIA 4AN1A 2Z9CA 4DSUA 3TS1A 3DWGA 5EZ5A 5K09A 4LC1A 1M34B 2IYSA 4NOJA 4NV0A 4YRMA 3CRW1 1RKQA 4G1VA 4P2GA 4AZ0B 1GNSA 1NJ8A 1I5RA 1ZYUA 4KB5A 3S2SA 5D1NA 4RIGA 3RFUA 3KSUA 4UUPA 4OJNA 3JR3A 4NFSA 1UC8A 3FPGA 2HA2A 2A78A 3NIWA 4NBLA 4UUOA 3VVBA 4OFXA 3AUYA 2C3UA 3C0KA 1KMQA 2GHRA 1K1EA 1ISGA 1ECFA 3VZBA 3PSAA 5B1EA 3CMMA 1NQWA 1UBUS 1Y89A 1OD6A 2GZ2A 3B1FA 2VXYA 4TTJA 3UT6A 4A15A 3P9SA 4OAOA 2EFEB 2FFHA 3W9SA 1QV9A 1JA0A 1YU6A 4IUYA 5CT9A 3V4OA 3ZDEA 4EB3A 1H05A 3W90A 3AL3A 1UWLA 3H2BA 4LYEA 1V5WA 3G6WA 4EKEA 1F6WA 4LJ7A 4DW8A 3DE7X 3RVLA 3UCXA 1XVVA 3AYZB 3Q2OA 4GMFA 1DIBA 2ADOA 3U37A 3EVAA 3CINA 3D1LA 4K6KA 4MQ5A 3T6KA 4DMRA 2PZBA 4AF7A 3CLRC 4L8LA 1NYLA 1T2FA 1MZVA 2PZMA 3H5RA 4L4XA 5JCZA 4FDTA 1LDGA 1QFXA 4PIMA 4TZKA 1Y6GA 3UMFA 2HUNA 2VQEB 3H81A 1U5BB 3VAAA 1SD5A 5JJ5A 1F6DA 7MHTA 2DT5A 1Z08A 5KYVA 2RGAA 4P4SA 4E0BA 1ABFA 1R0KA 1E9FA 2CLIB 3DXFA 4Q3OA 3L8EA 4TKVB 1YDWA 5BYJA 2BKEA 1TQ6A 2QAGA 4JJEA 5IKMA 1G21A 2C82A 4Y6SA 3HYLA 3ROZA 2Z2YA 1YQ9A 1XTBA 2I4RA 1Z82A 3CKLA 3IPYA 5DHUA 5IAGA 4FDAA 3DM9B 4OIFA 1Q5PA 2AOVA 2VRNA 1NJ6A 1W73A 2GFQA 2R4QA 4ZEMA 2MWMA 4M1MA 3I6MA 2YHBA 4HAXA 4X92A 1U2TA 3HHPA 5BV8A 3OJ0A 3VX3A 3KBBA 4EHAA 4CKWB 1D03A 4R0MA 4RVFA 4ZYVA 2QJOA 1CY1A 4EGJA 1KR2A 1ZVQA 5CHEA 4ZOCA 1F1BA 3H9EO 1EB8A 3QQ5A 3CONA 4R8LA 2V4ZA 3GGJA 3IALA 5IZ4A 1LS6A 3HACA 10MHA 1Z38A 3G02A 4X5OA 1WKVA 4UXIA 1D2EA 2QD4A 2P6OA 3Q6IA 4MV6A 3D4IA 4E11A 4Z9FA 1I0ZA 3OZAA 2VBCA 4K2NA 3CO0S 4E13A 2R5NA 4H27A 4B3DA 3M6FA 5CVTA 2LUOA 2J5QA 2I91A 3RTAA 2FSUA 3THRA 1TADA 2JFFA 3SPXA 5A7FA 4N5NA 3EY4A 2PD3A 4XM1A 3FYSA 3F7OA 5BSWA 5ICFA 3E6AA 2D4AA 1U2GA 1AB6A 3GPDG 3D4BA 3FPBA 2NO7A 2X23A 1I4TD 2ZBDA 1OX4B 3V8RA 4D5GA 1ZC4A 5ECWA 4C2UA 1ZINA 3VR6D 1EJBA 4OQLA 4I4CA 4LJ4A 1AK9A 4WJZA 1R6VA 2WWXA 2H0RA 4TTIA 3EXHA 1W4CA 3IRBA 4QUGA 5ALKA 4CL2A 3C6MA 1DAMA 1YB1A 2Q5FA 2WSSD 3D6JA 1EXMA 3GRKA 3JQ7B 1P2SA 4LSZA 3QE4A 1ABEA 5K4GA 4OOEA 1WMBA 2WHRA 4CDMA 2ZZMA 3DT8A 3Q41A 1NC1A 2AOTA 5DYYA 2A5LA 1ZM3A 2HRCA 3OEED 2FWIA 2RGRA 2W6JD 5AK0A 5LLDA 2HNBA 4KXXA 1EH5A 3CF6R 1YT5A 4EPVA 2CLEB 5KVSA 4ZODA 5JXGA 3VHXA 2F9LA 2W8ZA 2YWEA 3EAGA 2ZRLA 2HCJB 3O90A 4DDUA 4YXFA 2C4HA 5EXPA 3RS9A 3MGBA 3U4AA 2ZUUA 3OM1A 3QE0A 5JSUA 2CHUA 1M2NA 5AJUA 3DHNA 1G8AA 3I52A 4CMBA 4OFWA 3ROTA 3LLMA 3VHLB 3U9TA 4BBAA 2FZLA 3V2UA 3S4YA 1XZNA 1QLJA 4KE6A 4XZ3A 4UUNA 1JFRA 3LWDA 5JZVA 3H5AA 2P9JA 5LOVF 5FOXA 2R62A 4IDBA 2YRWA 4ZC1A 1GQQA 4RTNA 4F5DA 2OT3B 2VSQA 2Z3WA 4GP9A 1ZR2A 5TARA 3FAZA 3VZPA 2AKEA 4FYHA 1GZSA 4N7MA 1U2DA 4UQPA 1WMEA 3ZWKA 3RG2A 3E61A 4D82A 4KP7A 4G5RA 2PUVA 2O2SA 4CM8B 4DDMA 4D46A 2MR6A 3N2KA 4QDOA 1DJOA 1R6TA 2O0LA 4B17A 1RQXA 1J0CA 2XNHA 3QQPA 4S12A 1FS5A 3ZHRA 5A5GA 2ZM6B 2PGJA 3UMRA 3FCSB 5LP6C 3C3JA 3GP8A 1IZZA 4BEJA 1ZGHA 4AJLA 2VOJA 2P9BA 3A1DA 4LI3X 2CCKA 5BNIA 1T3LA 1N6NA 2VDLB 2BJHA 1ISFA 5AYVA 2GLXA 4GOXA 5ENZA 5FF9A 2XXJA 4R3NA 2IEBA 2WU1A 1I3KA 2WT9A 2MYPA 3OZIA 2A9OA 2O20A 3AC0A 1II9A 3TNDA 3ESCA 5HXAA 1EFPB 2CZQA 3BS4A 1OTYA 4MCJA 4OBEA 3SOZA 3WI7A 4J0FA 3WLMA 7ADHA 4L51A 1XEFA 1SQ6A 2XUJA 5HG0A 1QH0A 3E2IA 4MIKA 4LK2A 4G09A 3CZ5A 1VL6A 2A5YB 4UMVA 4NPCA 1VDMA 1MNQA 1XZAA 1TK9A 4RSRA 3SP1A 2IYUA 2EP5A 1QDLB 2NU6B 5DI9A 4ENTA 1QGOA 4LQDA 1L5HB 1RT9A 3HUFA 1Y5IA 2FLWA 4BPRA 4KOEC 3HRKA 3R7SA 2IHTA 2XNDD 4HVCA 3ZNNA 1KSGA 1L6RA 4IR7A 4QUEA 1P1HA 4URUR 2UYQA 3EVBA 3NYIA 4UVHA 2L18A 2EX4A 4ZT7A 4BGDA 4JBLA 4L5CA 1ECBA 1DXQA 1GNVA 4HWPA 4O0MA 4S0XA 2XNSA 1FQKA 4V3BA 1XLUA 5TJ9A 5JFOA 2J09A 3P96A 4JELA 4IFBA 1WP4A 5IU6A 2WTEA 3DE4X 3HFSA 2BEJA 2ZRAA 5ELXA 2G71A 5TS3A 1R4NB 2DHRA 1NVVQ 2G28A 2RG1A 4JSTA 3D3EA 3G79A 3L7NA 4ZXPA 1U7PA 3U13A 1TMGE 5DEIA 3CN9A 4OLFA 4ZRDA 5FWDA 2QTNA 4U8HA 1X42A 1J09A 5KTTA 3PC3A 1CQWA 2REQB 3K2QA 5HDQA 1EGHA 2V7EA 4CEHB 1TIPA 4HAOA 3TW4A 2BUAA 2CK3A 4HS9A 4FB5A 3T5PA 2HF8A 3MYYA 4K88A 5EI5A 5KTSA 4DV7B 3Q0TA 2PVSA 3EXG2 1ZZEA 1TM2A 1OZFA 3DULA 5C8XA 3GN1A 3NT2A 1MFPA 3LUPA 4ECAA 4JENA 4RLFA 3WKBA 4MJ3A 4R8KA 3BCUA 3ESAA 3THOA 2DETA 3NANA 3OIFA 4D9IA 4OXKA 1MC5A 2BFDA 3DBIA 5HQTA 1Z5ZA 4YJDA 4GR5A 1C7QA 4JB0A 1T3TA 5FA8A 4CM3A 1IH8A 4G5GA 3DQQA 2PRIA 5E1OA 1W76A 5FFMA 3WGIA 1BS9A 8MHTA 2C4NA 2P6UA 4H6WA 4LKOA 3U4MA 2MYUA 4Y0AA 2ZRDA 2CMDA 5FUBA 1LPBB 2AQIA 2WMNB 1YJXA 3R75A 3ZGYA 4GF5A 1NVFA 2R6DA 3E7DA 1QHEA 3LUDA 4GOJA 4E5UA 1QANA 4H31A 5DX8A 4N65A 2I3BA 4MV0A 3NC1C 4WASA 3L8IA 1GZ6A 2PQ6A 2EEPA 4E2WA 1AHIA 4KI7A 2HIHA 2WYUA 4YAJA 1UK7A 3H6GA 3UJ6A 4RABA 1DDGA 2AI3A 4RORA 1T8SA 2WNIA 3Q3EA 1KRWA 3E58A 2X8JA 4U8GA 2JIRA 2LKCA 2QYHA 4JLAA 4UU1A 3WO1A 2OY0A 1GGMA 3PENA 4NDZA 4C3ZA 5MDHA 2P6NA 5JG7A 4WN9B 1E0AA 4EMTA 2AR0A 4ZQCB 5KPDA 1R10A 2BZ1A 2NUPA 3ESRA 4REQA 5D2CA 1EXWA 4NENB 3VKGA 4GPTA 5HDBB 3PE4A 3KIPA 1OFUA 2NZJA 2W2KB 1E66A 2O0MA 2QRMA 3MTBA 4FJ0A 4NECA 2VP2A 5HF8A 4ZAFA 4LXGA 4YRCA 3M49A 3RSSA 1FA9A 3VHRA 3IO3A 1VM6A 3C7KA 3OZTA 1FJ2A 2EEZA 1EUQA 2JCGA 5KVQA 2B1JA 1MEJA 4DC1A 2HWKA 2HT1A 1JXZA 5LOVA 3GG2A 1SXJA 4F72A 2CXSA 3BA6A 4KQWA 5TGDA 3HU2A 2H51A 3HJFA 4P83A 1LK7A 1Y1KE 3S27A 3CTMA 2BGLA 3CBGA 3OD1A 1OX5A 3ZH9B 1DEKA 3GJ7A 2VPXA 4MUFA 5AKXA 2DC1A 3AHDA 3OCUA 4IDNA 2ZRFA 2HDHA 4LOIA 4X63A 5ADHA 5JJBA 5DWDA 3M83A 2G04A 5HUQA 1EXNA 3DNPA 4X1OA 5JDIA 3O2NA 1EX1A 4IINA 1G5PA 1Z63A 2C2OA 4LZZA 3L7BA 2VAMA 1HYGA 3NCHA 2PWBA 4GWLA 1BGVA 3ZYCA 1X7HA 4EJFA 3HZZA 4MLZA 5KI6A 2Q5OA 3PNOA 6LDHA 2QE7A 3NOOA 1WLSA 5L40A 3VX4A 4B81A 3SIPA 2GSWA 2YFHA 5H1YA 1RC8A 1IXKA 4FOTA 4GKKB 1X1AA 2H4ZA 2V5VA 4QKQA 1SBHA 1E5VA 1EFDN 2R6FA 3IUSA 4OQFA 4RPGA 2ID4A 2EYQA 3FD8A 2XUDA 1Q6ZA 5C9GA 1FL9A 1PZMA 1YTLA 4UPDA 4TT3A 5D86A 1KSJA 4EY4A 1P9LA 3AU8A 4JB2A 4K3WA 1NBME 3K4HA 4QDZA 1UPUA 5A06A 5IZCC 1ZRMA 4GPAA 4CM7A 3QVTA 5JAZA 3GVIA 3I1JA 5J40A 5EYPB 1I3NA 1NM5C 1CY2A 1O7JA 2WWVD 1RXUA 4QOEA 1I5OA 2JKYA 2O59A 2XZPA 3VVMA 3FDZA 1KMIY 3OPMA 1BYIA 1OTHA 3JATA 3RT9A 4L8FA 4W5JA 1U65A 1Z37A 3A04A 2XHZA 3D7MA 1G5FA 4P81A 3RVQA 2DX7A 3TQTA 4WAUA 4HZUA 1YUNA 5FOTA 5GJVC 2AFHB 1A97A 2O07A 5DO9A 3S8MA 1HZDA 3I6YA 4L1KA 4FFLA 1O6ZA 3R7LA 3KVOA 1RJNA 1OVMA 2ZSJA 3V7UA 2WIKA 1RPZA 3FDJA 3HWRA 4QUKA 2JJ1D 4KQGA 3QFCA 4G24A 3GRZA 2YHIB 4PZDA 4EYOA 4OHOA 3HBMA 3QELA 2PQ0A 2VK2A 4HAUA 5CGQB 4L74A 5ALFA 1JHYA 2V7QD 3TGPA 2XCRB 2CSXA 2W90A 1TUEA 3IMEA 1J8MF 4MV7A 4QDUA 3TSOA 2CFOA 2PS1A 3FDUA 2C9DA 3HRXA 3MYRA 5CRIA 2GEJA 2BAGA 2Z9BA 1D0IA 2XRMA 5K0NA 1UT5A 1H8HD 1WQ4A 3L8ZA 4MPPA 1KNXA 1USKA 3LBHA 4U02A 2AR9A 1UZMA 3RIEA 3AI3A 5DBGA 2OV8A 5ICSA 2WLSA 3R5KA 2I54A 4GBMA 3T7CA 4ETIA 2DSTA 1TVCA 3GX1A 4RHEA 1JTVA 5DTQA 2VSFA 5EHXA 3KV3O 1Z74A 4B8YA 1BHJA 1OA0A 2C88A 3RNLA 3CCCA 2X3YA 4MB6A 4QX6A 1U0TA 2WDZA 4MB2A 1KAHA 1CRLA 3MGCA 3KVYA 3OI7A 3EOAI 1QQ5A 3DMFA 3M2PA 3DUWA 3X1MA 4RD4A 1IHXA 2BL4A 13PKA 4J6FA 5GINE 1FP4B 4JJ4A 1FYWA 3S99A 3ZI4A 4TUYB 2XYQA 2WR8A 1GFIA 3TMKA 1YOVA 5DNVA 4I50B 3TOZA 1PV1A 3FYDA 3QUAA 4YPFA 1WB9A 2W2LD 4IHKA 4R3WA 3WLHA 5KU1A 2NV0A 1AQJA 1LJLA 4Q48A 1G6HA 3WKDA 4KN6A 3W6PA 5KYXA 2WQ7A 3HLTA 1QRTA 4JI4B 1XRSB 4FIDA 4W5QA 2ZT7A 2R00C 1MT3A 5EGNA 3RIXA 4CTJA 1W25A 2ZXEA 1TO1E 5A71A 2WF5A 3WBJA 1I51A 3F96A 1IYZA 1GILA 4C22A 1A4IA 2LCFA 2JVJA 3X3HA 3CF0A 2ESRA 1HYEA 2CL5A 2OQ2A 2HU5A 3ZZUA 4QTYA 2SBTA 3USCS 5IS2A 1NL3A 2A67A 3OF5A 3HY6A 3QZUA 5FTLA 2JANA 1CIPA 3RANA 5AR1A 1OH5A 4INJA 4A82A