3A4MA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
236
Chain Sequence
b'DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
total genus 98
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4mA01
4D82A 1ESNA 1GL7A 2IS4A 4URWR 5EP4A 3ZZUA 1Q44A 5UKDA 1SHKA 2HEIA 4Q47A 2C9OA 2DCUA 1E9DA 4JYBA 1GDDA 2ZR9A 4B71A 3TR0A 2F3TA 4A6XA 4GBMA 4DLXA 3LXXA 4OHYA 4JVNA 3IUYA 1ZU5A 4Q4JB 4AKGA 2ZVQX 2IYYA 4LHWA 3T5GA 3X1YA 4LZZA 1AZTA 1NN1A 2GF9A 3RC8A 1JNYA 5HR5A 1ZCAA 3QF4B 3RS5A 5HPYB 5K8IA 4IDOA 3THXA 4KSBA 1A82A 2W2XA 2D62A 3DHWC 3B1VA 3QKSB 4M8NE 4LPSA 5BN5A 2JLSA 2FDCA 3DO6A 4RD1A 4JLDA 2IXGA 4OQXA 1W4AA 1QVRA 4OQLA 1XCMA 1ELOA 2ZE8A 3PR1A 3CRRA 4Z1MD 1YKSA 2QPOA 3KKOA 5DGXA 3F5FA 1H8HA 3D31A 2V9PA 2V55B 1W36D 4QBGB 4PPFA 2XITA 2ZAOA 4LRWA 3EA5A 5HE8A 4L9SA 1TADA 5H68A 4D6PA 2DFTA 2PX0A 1KDRA 5JJIA 1KYIA 1SQ5A 2QM7A 1ZM3A 2ZRCA 2ZJ8A 3SNHA 621PA 1IHUA 2IUUA 1A5TA 2D2FA 1N0VC 3AKDA 521PA 5K8LA 4TSFA 1YZUA 2IUSA 3JVVA 3OEHD 5F3WB 4A6PA 2F1HA 3QXXA 3WNDA 4W5HA 3B1XA 1EFRA 1XXHB 1IN6A 2J7PD 2RGCA 3FFBA 4V0NA 1R8QA 1TUIA 5E7IA 4URVR 1NNEA 4ZDWA 1G5TA 2OCAA 1IN4A 2C9YA 3ETLA 2PCJA 4TLBA 5FTNA 3GMTA 4EKDA 4KITB 5C1BA 3N70A 1NVVQ 4L4UA 1HA3A 1E9AA 1Q12A 1UPTA 2QAJA 3CNNA 1U8YA 2IYRA 3I92A 4KYIB 4DCNA 1ONBA 3MWLA 2O8DB 2XJ4A 4YONB 2IC5A 2J0SA 5CDFA 1CF4A 4RZXA 3VNUA 4K8OA 4L16A 4QGFA 4F7WA 3LQRA 1Z3IX 4HEJA 1HQYE 4F4IA 1VECA 5KU1A 2CHVA 2GEUA 2XB4A 1XPRA 1UAAA 3GJ8A 4CIDA 2CLCX 2HF9A 5DSZA 1Z6XA 3VAAA 2J46A 1GNPA 1GNQA 4BFVA 3CH5A 3S1AB 4A9AA 4M9ZA 4PPGA 1W46A 5DLQC 1KSHA 2KJQA 3HU1A 1VG9B 1JAHA 1E0JA 2W6IA 1SVSA 1L4YA 3GP8A 5FOWA 1G5PA 5FBQB 4XWKA 2GXQA 4Q4HB 3W6PA 4B2LA 1S9DA 2XTZA 2P5SA 5AUPB 5EUQB 4RZ3A 1RE0A 4JBYA 4A8JA 4MYCA 4HLQB 2F9LA 1F2TB 2BKEA 4TTQA 5KNBA 1MO3A 2YWFA 3K0CA 3L43A 1QBKC 3Q3JB 4NYMR 5DI3A 2FV8A 3TR5A 1WQ1R 2NO9A 1T9HA 4PSVA 3C14C 2PX3A 1NLZA 3AP1A 4PSAA 4BECA 3W5JA 4GT1A 1PZNA 3T06B 2QT0A 4PXAA 1QG4A 3IILA 4DZZA 4I1VA 1P75A 1SVOA 2QN6A 2O8EA 5IF9A 5JI3E 3BFVA 1N5IA 4KU4A 1T91A 3SHWA 4HYYA 3RSLA 2OBNA 3QXJA 2QSYA 4PAOA 5GVRA 2NPFA 3UMSA 2JJ1A 4K81B 1JEEA 1DADA 1IQPA 5TMPA 3SHFA 4YDSA 3W90A 3VNVA 1U0LA 4BQSA 1FTSA 2V7QD 4Q4AB 2P5TB 2YC2C 1OFHA 1G7RA 2L0XA 2JIZD 2WVJA 3EA0A 3OEEA 4NDZA 5DHAA 1Y63A 2HLDD 3KFXA 4Q21A 1XCPA 1FMJA 2R65A 3WHKA 3I61A 5H8WA 1BYUA 1YR8A 2QAGC 1JJVA 5TDHA 4ZIRB 5AJYA 4LPKA 5CYPA 3UMRA 4PFSA 2QMEA 1AN0A 4AYTA 1CKEA 2H8KA 2NIPA 4RD4A 2J5XA 3NBXX 4JLJA 1NVXQ 1ZD1A 4JLNA 3U44A 2I1QA 4D80A 4M1SA 3B9QA 4BUJA 3GJ4A 3X1WA 4RKEA 4EPTA 5FTMA 3WNBA 4NYJR 5HZHA 1DELA 4ITRC 3TW8B 4DLYA 2X2EA 5C46F 2OILA 4N3NA 1KDOA 4WIAA 1OH6A 4DDVA 1XX6A 4KLZA 5HCIA 2PCLA 1V5WA 2BVNA 3KZ1E 2RGEA 4B3CA 2D7DA 1XU4A 3EAQA 1D2NA 3EIHA 2DFNA 5SZIA 3H0KA 2C78A 3VQTA 4B33A 1E2JA 2YV5A 4LBZA 3TUJC 2NPIA 1ZRHA 3BFKA 4JSTA 1J2JA 1B23P 3ZZTA 1GRRA 3SBEA 3VMFA 2IYSA 2J7KA 4KV9A 5JI2E 2NOAA 2QMHA 4FINA 3NDBB 1KSFX 4P4SB 3VKGA 2ZJBA 2FX3A 1E9EA 2W6ID 1O3YA 3RDPA 1HYQA 2VSOA 5C4GB 5KYKA 4QOSA 4PHTA 3AF4A 1MOZA 1RPZA 2VP0A 4ZI3A 1YQTA 3CNOA 1X6VA 1GITA 2RAPA 1X8JA 4D2IA 4ZO4A 2ZEJA 4G01B 2CK3D 5DH9A 4RCZA 4DC9A 1EX6A 1E4YA 2PT7A 1G21E 1G20E 4QFMA 4WZBE 2AD1A 1W36B 3LLUA 5LDDC 4CEJA 3BB4A 4OK5A 3DPUA 1E9CA 1JI0A 1F5NA 1I4DD 2WKQA 2ZUBA 4HZUA 3B13B 2Q6TA 3WRYC 3WXMA 4D4KA 1P9WA 1I4TD 1G1MA 5DI3B 3SJBA 1DTSA 1KSGA 3GLFA 1DAHA 1R2QA 3BOSA 3OF5A 5TV2A 1EFRD 3B1ZA 3IDQA 4Q9LA 3GLIB 3WMEA 3UWOA 3MCAA 3UWKA 2V4ZA 1NF3A 4LOAA 2EFGA 1KI3A 3QPUA 3ZQ6A 5JBQA 3EPHA 3DMNA 4V02A 1RRGA 1P62B 1F48A 3KB2A 4RCYA 2JDID 4CF7A 4HZUB 2CLSA 5D3MA 3DM5A 3UXMA 5KPDA 1E2MA 4MGZR 4W9MC 1R0ZA 2R2AA 1KI8A 1X1RA 4B75A 2CHQA 3ZJYA 1NY6A 4HDOB 1M7GA 4OI0A 3I3SR 2XNSA 4DUGA 5EXXA 4B2PA 3DM9B 2KWIA 4A2WA 1OLOA 1KI1A 3KJEA 2Z43A 3TUZC 3WYFA 4Z1MA 1Z6GA 3AF0A 1GOTA 1XMSA 2OFWA 4OHWA 4KBGA 4JT4A 1S3SA 2V3CC 2IT1A 2ANBA 1AKYA 3PITA 2JLVA 5J4HA 3KXLA 3W3ZB 2ZJAA 3TNFA 4HZIA 3N2IA 4JS0A 2KE5A 1E1QD 2VYFA 3ZIAA 2XB2A 1RZ3A 3QVVA 3CZPA 1W48A 3FKQA 2X77A 4LCBA 1OSNA 1X3SA 4TQUS 4NYIR 1XD8A 2NTYC 1KZGB 3K09A 4JMPA 1OHHD 4TYWA 1VCIA 4V0ME 3I72A 1H65A 4JVMA 4LJYA 3X1DA 2FF7A 1XF9A 4KCGA 1KI6B 3EWAA 1E98A 1JALA 1GKUB 1XD2A 2YOHA 3SQXA 5FOUA 3KQLA 3H4MA 3N5CA 4JKYA 1DPFA 2WZQA 2YVUA 1VKJA 1FFHA 2QQEA 4JL8A 2REXB 3B9PA 4YQFA 5BXQC 3OHMA 2OZEA 1NLYA 2ZJ5A 2A2ZA 3G82C 4BLOA 2KSQA 1G7CA 3K9GA 1JPJA 2IHYA 1P4SA 2IW3A 5G53C 1E0KA 1HH4A 2VF8A 1NSFA 3CPHA 3WMFA 4EFLA 3VU9B 1G8FA 4TLEA 4BFXA 1YHNA 4M9XA 3AVXA 2HJVA 1OHHA 3VR6A 1WP9A 1WE2A 2O5VA 1IJFA 2OG2A 1KO4A 1NVUQ 1R8SA 1JBKA 1GSIA 4M2LA 1V43A 5B57C 2R8RA 2IWRA 1CR0A 3GJ7A 2GETA 5BW8A 1UKYA 1NBME 3EZ2A 4NCIA 3VR2A 2XOKA 4Q1EA 4EJSA 1KAGA 3AH8A 4AKHA 3CWQA 1E3MA 2PT5A 3ZDQA 3BC1A 5HE9A 2F6RA 1RRFA 2FSGA 2QEQA 3QKSA 2ZJYA 1CEEA 4C0KA 4K46A 2ZSAA 1KNQA 4S2EA 4TL7A 1Q1QA 5EE9A 3TH5A 5JRJA 4BWYA 5EE0A 2Y8EA 3T1VA 3A4LA 1LFDB 2W83A 3R9WA 4LX0A 4CEHB 1W5TA 3K0CC 2WICA 1W47A 4P32A 4C0BA 2ZE5A 2QP9X 1Z29A 4DBLC 3K70B 1ZU4A 4WOPA 2H18A 3CRMA 3ND9A 4AIIA 4QM6A 4JSYA 1W44A 2PZEA 4D25A 2GJSA 1CS4C 2IA5A 1KIMA 3FHCB 1KJZA 4R7ZA 4C30A 2ZI5A 2IWHA 4DEYA 3QG1A 3K0AA 4DSNA 4IEEA 1Q1EA 1AM4D 3Q7PA 1K5GA 3BFXA 4PTLA 5AUQA 3AVTA 3RWMB 1MABA 2X19A 4IEIA 4JLKA 3T61A 4MYHA 3QBVA 4R71A 1L8QA 2GCOB 2QP4A 3NKVA 1G4AE 1EG7A 4UNPA 2ZVPX 1T5LA 3UATA 2ZS7A 4M9QA 1GRNA 3RSOA 1Z08A 4NYMQ 1QHXA 1XNJA 2YHSA 3IHLA 3DZDA 3V00A 1K5DA 4JLVA 2IUTA 4GDFA 1NMZA 4ARZA 2IS1A 4LYAA 3Q9LA 2O8FA 3KUCA 1J8MF 2FFAA 2JLQA 1DS6A 1F2TA 2J0VA 4CZ2A 1EFHA 4C0HA 1P2UA 1XDBA 1QG2A 3CRQA 421PA 1XJCA 2NZ8A 5DNYB 1P72A 1QVAA 2AN9A 2XJ9A 2C04A 3RWOA 5JCZA 2XXAA 2B7BA 1EGAA 3BE4A 3PQCA 3A6PC 3FVQA 3RABA 1E69A 2O8EB 5K8UA 1VYUA 1JPNA 2Z4SA 2GZHA 2GJKA 4KJZA 4AG6A 3PEWA 1PV4A 3GD7A 4LHVA 1KMHB 2IYLD 5D3MB 2VQSA 3FGNA 3IIJA 4LJ8A 2F7SA 2RKOA 1AK2A 1ZM7A 1R7RA 2XNDD 1VG1A 1CJMA 2YINC 4URUR 3QPWA 3MRSA 3GLHE 2ZE7A 4MRNA 2V6JA 2WJJA 4HLDA 4ZKEA 2XXAB 1JJ7A 4DWJA 3LXRA 4DLSA 5E7MA 2PMDA 2XGJA 4EPYA 1TF5A 2ZRBA 1AGRA 4M0LA 4BFSA 1IXSB 1KNXA 2DWOA 3NG1A 4B32A 3GLIE 1W7AA 2FZ4A 4OHXA 2DB3A 3LBIA 5EZ5A 1DAMA 3E2IA 3MMPA 1BH2A 1G16A 4JL5A 1ZCBA 4A2PA 1KZ7B 3QKRA 5AWFC 2ZM5A 3K70D 2VP9A 1U0JA 1X86B 2JGNA 3A1TA 2IYVA 4OJKA 4LJ4A 2RGNA 1J8YF 3LY5A 3GEEA 2HDNB 4KO8A 4RD3A 2QGZA 1N6KA 1W5SA 2UZ3A 2HF8A 3EG5A 1X1SA 2PZFA 1MR3F 2WIBA 4GSYA 4OYHA 3TAUA 2R62A 1VMAA 3R8FA 1KK2A 3SBDA 1BKDR 2FZLA 2HCBA 1CJVC 2Z5FA 1UBEA 3C41J 2EFEB 3C8UA 4RD2A 4PSKA 5CM9C 5SZJA 2VO1A 2GAAA 3PVSA 2EW1A 1N6IA 1IN7A 1MT0A 3K70C 3FMFA 3E70C 4P4TA 2OCYC 2WWGA 1KGDA 4HLCA 4EJSB 4M1WA 1H8HD 4TYNA 4PC2A 3VR4A 3K53A 1JECA 2WWWA 1QF9A 1ZIOA 4BLQA 4GMDA 2DYKA 3CH4B 1SXJD 2C2HA 1NKSA 2ATXA 1Z0JA 2R6CA 2VIIA 3THYA 1GVNB 1HE8B 1KI2A 1E96A 1XBTA 1NRJB 2FGKA 4GZMA 1T4GA 4S35A 2BMDA 4MRSA 2DBYA 5DN6D 2R6GA 4KVAA 2P2LA 1KTVA 4PZZA 2J1LA 4CVNA 2C98A 1MKYA 2OLKA 2GWHA 3W6NA 2Q9AA 1BMFD 3U7FB 4RZUA 1NN0A 2FNAA 1OV4A 3U7EB 2JLYA 1Z0AA 2DFLA 5B58C 1JXMA 5FUVA 5L8VA 2BDTA 5KDLA 3FHOA 3ZH9B 3PUXA 4DLTA 3EC2A 2HLDA 3NIBA 3ZYCA 1VCMA 2GJ9A 2ORWA 3THYB 3UK6A 3KJGA 3LVQE 4A4DA 3NH6A 5J4VA 4TMKA 1IONA 3ZD6A 1FX0B 1ZM2A 5IK2A 1N5KA 3HPQA 3B6EA 2ONJA 4AY2A 2CE7A 1NN5A 5FR1A 1YZKA 5EE3A 5GJVC 2WAXA 5JZVA 2QMOA 1DG3A 1ZM9A 2BIFA 3W9YA 3BH0A 3AGPA 3I8XA 1RRPA 5CIWA 4B3XA 3A8TA 2DWQA 2O8BB 4G5OA 3CKLA 4LJ5A 3W3AA 3QBTA 4MRPA 4KODA 4PQRA 2AXPA 4B2IA 1WB9A 3ZS9A 2P6RA 1AJEA 3PUWA 4NYJQ 1TQ4A 1RFLA 1L4UA 1OFIA 3EASA 4XVRA 5FOXA 4A0HA 3VHLB 2RGAA 1BOFA 3DL0A 3AP2A 1AKEA 3DEFA 3H1TA 1TTTA 2ZI6A 2H1LA 1W49A 2CXXA 3B8HA 3DVLA 3HDTA 3AKEA 2C99A 1OIWA 3EPJA 1P73A 4R2HA 1Z6AA 4Q4AA 4XIGS 3JZAA 3P26A 3O8RA 1JQLB 3GJ6A 2GZDA 1YZGA 3W5IA 1DBSA 3G5UA 1P5ZB 2W0MA 3CF6R 3EC1A 4MUBA 1OT3A 5FPKA 3PUVA 5EXPA 2OEPA 2QM8A 3QOFA 3UG6A 4M9SA 4OHZA 2YKGA 4EUNA 1HEIA 2XSZD 2YNMA 2ZRIA 4EFMA 1Z5ZA 2REOA 3BXZA 2G0TA 2BHRA 1ZUNB 1YR9A 2IYXA 4Q01A 5EXSA 3U6BA 3MWKA 2AR7A 4KXFB 2FWRA 1T3LA 4YLGA 5HZKA 2FGJA 1SVLA 2W6JA 5EP1A 1KK3A 4LDJA 1OXSC 2IX3A 4TT3A 4TMXA 4URXR 2NZJA 4TMZA 4IXNA 5DN6A 4PPQA 2J3EA 3MSXA 4IXMA 4PC6A 4HAZA 4A82A 3GLHB 3K0EA 2XEXA 4BLTA 1N6LA 2WIAA 2D74A 2CMKA 2LKCA 3CF2A 4LYFA 2V7QA 2JCSA 3TQFA 2ZYTX 4DLZA 4QRHA 3C7KA 4BZPA 1UKEA 1KMQA 2IXEA 4GOKA 4E22A 3KQNA 5HKKD 3U5ZB 3BRWD 2OAP1 3K09C 4JYCA 4XOIA 2F1JA 3KX2A 1DAEA 3P1JA 4ILEA 4LC0A 5TARA 3R9IA 5IDVA 1GG2A 3P27A 4YXWD 1E2QA 1P9RA 5G41A 3P4YA 5CB8A 2OBMA 1RJ9B 3I8SA 5LBIA 1XZPA 2G77B 1TPZA 2VHTA 5GVSA 2OHFA 1HTWA 1VCOA 3BBPA 3Q7QA 1E9FA 2FPMA 4FMBB 4JLAA 1E79D 1ZUIA 1DAGA 3SJZA 1OIVA 4QBFA 2W2TA 4JVLA 5KSZA 1E9SA 3WNCA 3BGWA 3LQQA 3NVAA 2LCFA 4TTPA 1O87A 5KNCA 2CLDX 3B7GA 1TEXA 5KUTA 4GNKA 2JJ8A 3UANA 5FPHA 4KBFA 3SOPA 2RHMA 4DDUA 1AS3A 1RJ9A 1G291 2HJGA 5A0FA 2AWOA 2WOOA 1JR6A 4F4CA 1NVWQ 1VYTA 3SN6A 5JHGB 2WJIA 4QGGA 1OB2A 5J47A 4G3XA 1R4AA 4HUQB 4RD6A 5FTJA 1G8PA 5DE3A 2Z4RA 3CNLA 4UNNA 3GJ0A 3QQ5A 1GP2A 1Z0FA 2C9CA 1J70A 2Q3MA 1PVOA 1Q22A 5D3QA 3SYKA 3AGQA 1G3QA 3KL4A 1XRJA 4TWZA 2AL7A 2ZR7A 1UEJA 3X2SA 2J41A 1H8ED 2ZRKA 5CIQA 3AVQA 4G5RA 3AEZA 4KAXA 2EU8A 3THWB 4JLMA 4Q5IA 4X8MA 2HT6A 4ZPXA 1TF2A 2EFHB 4TLCA 3HWSA 5FPYA 1GTVA 4M1KA 2QPTA 4OKSA 2GILA 4NBSA 4MQBA 3QUSA 2QENA 5G3YA 4G5GA 4Z8XA 4BRWA 3FYHA 4PHFA 3DOFA 1OH7A 1VPLA 4C0LA 2C8VA 3K9LA 1U9IA 1FW6A 5C2JB 121PA 2JATA 3MJRA 1M8PA 5KTYA 1LS1A 3AVYA 1KMHA 3IQWA 4F92B 4C0QC 1YRAA 3FMPB 1KK1A 2QP3A 4HB4A 5CYOA 2WPDA 4Q1AA 4TYYA 4EFNA 4IDPA 4WBSA 1TEVA 4FMCF 3TJZA 4U5XA 3CX6A 4DUGD 3GLGB 3W6OA 4BPBA 1KJWA 1XD9A 1F2UB 3DKVA 3T1TA 1EWRA 5JCPA 1GAJA 2HUPA 2QSZA 2LKDA 3TE6A 1Z28A 3D8BA 3ZGXA 2R9VA 5LD2C 3BS4A 1VIYA 2GNOA 4W5WA 2BEJA 1IXRC 2FSIA 4Q03A 2PLRA 2OV2A 2VSFA 4HAXA 1S8FA 4JZKA 1XTIA 3LW7A 2O0HA 3TVTA 3GQBA 3BH7A 4D81A 1M1YE 4M4SA 4NCNA 2QNRA 4PAMA 4PQFA 3Q8XB 4V0KA 4DT1A 3SJCA 4V0OA 4DCTA 4GPTA 4QGAA 1Q20A 1SHZA 2AKYA 2RMKA 3D3QA 3NBFA 4IVQA 4NKRA 3R20A 3L0SA 2JA1A 1LTQA 3VX4A 3EWSA 4B3GA 4TQAA 1W4RA 4W5JA 3EZ7A 4B43A 3GEHA 4OI1A 1U8ZA 3AKCA 1E2LA 3RYTC 1QZXA 3FMOB 4F38A 3GJ5A 1PLLA 1Z83A 1II9A 1XMIA 2V54A 5B30A 2EYUA 4C7OA 2D2EA 2EQBA 1U98A 2FPKA 2ZTSA 4EAQA 1LY1A 3U60B 4RFSA 1T0JB 5B64A 1G3MA 1NKTA 3W8RA 5G40A 2Z0MA 1IAQA 4GOJA 2ZI4A 1NBMD 3B2EA 3L0OA 5BYJA 1QHSA 4QJ5A 1DG1G 3W8NA 4PQYA 1M6NA 5FL7D 3ZQJA 2A5DA 4M1OA 4FN5A 3OE7A 2F43B 2IYTA 3AVOA 2GJAA 3R8CA 2OFXA 1MH1A 2CCJA 3QF7A 1GKIA 4AG5A 2IYZA 3NWJA 1KDTA 3TBKA 3TVDA 1VHLA 2QL6A 3M0EA 4MITA 3T34A 2IYQA 2BOVA 3ADDA 1M34E 1N2CE 2OAQ1 1UDXA 1EFTA 3JVUA 4UXJA 5CK5A 4BLSA 5EP2A 5JJKA 2GXAA 2QGNA 1TMKA 3CRVA 2ORIA 4G0NA 1JEDA 2ZSFA 3MWJA 2TMKA 2F43A 2VSXA 1WA5A 3A36A 2ERXA 2ZU0C 3ECCA 3LV8A 5FI0B 1VG0B 2BC9A 3A4MA 5J40A 4DSOA 1KI9A 4FCWA 4RVCA 1E2PA 1GIAA 1CJKC 2OM2A 3GCGA 1E2KA 1N6OA 3HR7A 3QEJA 1TAGA 2FJUA 5KDOA 4F93B 4BZXA 4BLPA 1E2NA 4ZI2A 1ZJ6A 2GK6A 2R6AA 3LWNA 1GM5A 1YRBA 1E0AA 1W0KD 2QRZA 1ZAKA 2HXSA 3AF2A 1SKQA 3NDPA 1A2BA 5TVKA 4EQ6B 3KJHA 1M74A 1R5NA 3I62A 4DHEA 5J4KA 2GRJA 4M1MA 2DPXA 3RRMA 3AKYA 1F3OA 5GJWC 4ZIRA 3DKPA 2CJWA 3QVUA 1WBDA 2HT1A 1A2KC 5E4FA 4NONA 1JR3A 5F9HA 3ASYA 3KQHA 4WAUA 4D4LA 4Q9IA 2ZRLA 3CR8A 2IYWA 4V0LA 5IT5A 3OEED 2JIZA 4IFBA 1WMSA 4O3MA 3QNUA 4U02A 4YC7A 4OQMA 5IRCD 5L3VA 5BWMA 2JLRA 4B3FX 5FBLB 5LD2B 5DIFA 1YZQA 4B73A 3VU9A 4PC7A 3RLFA 3KKPA 5F98A 3PEVA 1SXJA 4XD7A 4AKEA 5C18A 4DT1B 2FU5C 3I5YA 4NU0A 4ERNA 3FDIA 4POAA 3CB4A 1Z22A 4IDQA 3QI2A 4LBVA 3WBKA 5B2ZA 3U3KA 1OH8A 5JWOA 2FFQA 3BWDD 3Q5DA 4FMDB 4FWTA 1RW4A 1XEXB 2ZU6A 3WBJA 3D6TB 4FMCB 1ZIPA 3OIWA 2PEZA 1F2UA 1ZNYA 3LDAA 4TL6A 5EP3A 2CL0X 1OFUX 2Q0HA 3L8ZA 3VHXA 1ANKA 2V6IA 3L82B 3SS8A 3AF3A 3WHLA 3DMDA 4AI6A 4PZYA 2BKUA 1VHTA 2AHOA 4D4MA 2OE2A 1XMVA 3GFTA 1YZTA 2FSFA 1EK0A 4PO9A 2JAQA 3IPYA 5FUYA 3EZ6A 3HPRA 4YDHB 3VFDA 3U3MA 4DVGA 5EJEA 1HT2E 1XMJA 4YMWA 1AZSC 4B48A 2WAYA 3AV0B 4R9UC 3QEOA 2IF2A 2GZAA 2WJHA 4LI0A 1RIFA 4ZDIA 3U7HB 1NP6A 4KHZA 2B21A 2GVZC 3VR3A 1X8LA 3CR7A 3AVVA 1QHIA 2ZRPA 2VRWA 1OKKA 1LF5A 5FFMA 1AGPA 3CW2A 3AM1A 4OL0A 2X8AA 4AWXA 1NSTA 1D9XA 4Y0VA 3SU8A 4RFVA 6Q21A 1TF7A 4Q18A 1G5RA 5ANRB 2MSCB 2OUKA 1GL9B 1OYYA 4YMVA 1BMFA 2H17A 2P65A 2QU8A 4L15A 1R5BA 4LK2A 2BCJQ 2A5GA 3CUEF 5KOYA 3PXGA 3OZXA 4QKQA 1XEFA 3KJIA 5FBRB 2G9NA 2GF0A 3ZZ0A 4ACAA 1WBBA 1IOZA 4KVGA 4B44A 3CPEA 4XWOA 1XCGB 2QZ4A 2HV8A 4BZQA 3A58B 4A1FA 821PA 4XJXA 3IO3A 3BH6A 2QG6A 3CONA 4E09A 2BBSA 3UPUA 2NQ2C 5EXTA 1S96A 2N42A 4LJAA 3RVBA 3QKTA 3KXIA 5FH9A 2XZLA 1SGWA 3T5DA 3TGPA 1OXVA 3J81k 2JLZA 4Q1BA 3LFUA 2FE4A 1K8RA 4NE2A 1GNRA 3R7WB 5JWHA 1S4QA 2KBFA 1E2IA 4MH0R 2XOKD 4Q9JA 1ZBDA 2G1JA 2OXCA 2WWIA 3LW8A 3SYNA 4EDHA 2BMEA 2Q9CA 5JEEA 4CDGA 1J99A 1ETUA 4BFZA 1Q57A 2GBLC 4KSCA 2V1UA 3JZMA 2OLJA 3EIEA 1S2MA 2OCPA 4IKEA 4OHVA 2CEAA 4ZCLA 3KUDA 4DDTA 2QBYA 3NH9A 2H92A 3IKJA 4B3BA 1WDTA 1XPUA 3THOA 1P7CA 4PC3A 1GL6A 3T15A 3I73A 1Z0KA 4IRUB 1B0UA 4F91B 5KDDA 3OFND 3GFOA 4FI3C 1OB5A 3KKNA 1Z2CA 4JLPA 3V4FA 4DLRA 5JS8A 4O0MA 1T6NA 2CDNA 3SE0A 3X1ZA 4C2TA 3SEAA 5DYIA 2IS6A 5JS7A 1PLKA 1UF9A 5SZKB 3VR1A 4Q7JB 2W2VA 1P2TA 1SXJB 2Q3HA 3NTUA 4QHYA 1TQ2A 1N0UA 1TU4A 2PMKA 3TSOA 4A0FA 1U81A 1KI4A 2HCJB 3VKWA 2FOLA 1CLUA 3NC1C 1LW7A 4WZ6A 2ANCA 1K6MA 2QQ0A 1G17A 3IEVA 1XJQA 2E1RA 5CLQA 2C77A 2OT3B 2FEMA 3OEHA 3LRPA 5CJ2A 1C4OA 3GLGA 3SDZA 3WYAA 4B34A 1MO5A 2D7CA 3UMFA 4C7OB 1OPXA 2HYIC 3SFZA 4TMWA 3TSWA 4FMDF 1YR7A 1T0HB 1LF0A 3X1XA 2B7CA 2RGBA 2REBA 2ZAMA 3PG5A 4TQ9A 1Q3HA 3UKDA 3BJIC 3OAAD 3FKSA 4HDCA 3ZVLA 1F6BA 1SVIA 1Z06A 1KY2A 3Q72A 3MJHA 2VHJA 2J59A 3KKMA 1Q0UA 3QG5A 2WPDD 4EIWA 2RCNA 3T1OA 1L7VC 4NZYA 4Z8YA 1RKBA 2O52A 1XEWY 2H16A 3QKUA 4DKXA 1KK0A 3F0TA 3FPAA 2WWHA 3U4QA 1XEWX 2ZQ5A 2F55A 1NJGA 1NL3A 2PL3A 1S1MA 2BV3A 3HU2A 4KI0A 2B8WA 4DLVA 1EESA 4PZLA 4DCUA 3F8TA 3B1WA 1MRSA 1IM2A 1DAIA 1BYIA 1HUQA 4AURA 2W58A 2CCGA 2BBWA 1EFCA 2CE2X 1Z6TA 4QNMA 2W00A 1UBFA 3CWZA 2XZOA 2VH5R 1YVDA 1FMLA 5FOVA 2ZYVX 4US1R 1HT1E 1E99A 4B74A 1VDZA 3KXKA 3RS7A 1WRBA 1A1VA 5FI1B 1DEKA 2XSZA 4Q9KA 2PLFA 3UG7A 3T12A 1HQCA 2KBEA 1OXUA 4LWZA 5J4LA 4HSEA 1FNNA 3PIRA 3PFIA 4TMTA 1D6JA 4JLOA 1N3BA 5AJXA 2QPAA 4JVSB 2HYDA 1U99A 1LB1B 2JJ2A 3UIEA 3CO5A 3QIAA 2ZS8A 3SJAA 2YWEA 2CCKA 1E9BA 4CYMA 2I3BA 3TMKA 3NC0C 4IDHA 3K0FA 1UM8A 1NIJA 4FW9A 2NMVA 4Q02A 1M2OB 3PEUA 1NY5A 2C96A 3M6AA 1VTKA 5CDFE 2JLUA 1E79A 1N6HA 4DSUA 3EZFA 3NXSA 5HCNA 4IW3B 1GFIA 2YYZA 5JWRA 3AUYA 1W4BA 4RD0A 2WBLC 1U2RA 2YWHA 3VKHA 3O47A 4G1UC 2J45A 2ZIAA 4N0EA 1OXTA 1KKLA 2QY9A 3AP3A 4LHZA 3NEJA 1UKVY 4OK3A 3C5CA 4O2LA 4BASA 5HKKA 4NHOA 4HB3A 4B35A 2BEKA 3TKLA 2PBRA 4WA7A 1HE1C 4MRRA 2RGXA 2CK3A 4IJMA 2WKRA 5AUOB 4ON9A 4BEJA 2UVQA 2ERYA 2Q21A 1S0UA 5HTKA 2ZRHA 2X1VA 2WSMA 3PENA 4PHHA 4QXAA 2ZREA 3A1WA 4IFEA 4Q1DA 4N1AA 2A7QA 3BB1A 1II0A 4MKHA 1KDPA 2ATVA 5JSZA 4QM7A 4LBYA 4XTCS 2WKPA 1CP2A 4FCTA 4D26A 1DE0A 2GK7A 3D7MA 2CNWD 4IOLA 4LHYA 4CT5A 3PJRA 2IEZA 4V03A 1OW3B 4LBWA 1W0JA 1GWNA 4TMVA 5J5CA 2QE7A 2BMJA 1JB1A 4FWIB 4HATA 2JEOA 4LHXA 2ZRDA 3U3OA 5FUXA 3HU3A 1OIXA 4C0SA 4IVRA 2EWVA 2I1VB 3NBZC 4H9GA 2BM1A 3IBYA 2A3RA 2Q3FA 3ZD7A 4D0GA 2DFKB 1MRNA 1R5OA 3IIMA 2IEYA 2XX3A 5BN3A 1XPOA 3EX7C 3DDCA 4Q7KA 1S1CA 5TY0A 5L3SB 2J87A 3CX7A 4GOXA 3EPLA 2EFDB 1CTQA 2FSHA 4L9WA 2X2FA 3WY9A 3K0AB 2ZE6A 4OI2A 2VEDA 3LX5A 4EPRA 3QXSA 3WP1B 1KAOA 4HI0E 4TT3D 4C9BA 4LC1A 2YOFA 2WHXA 1D8TA 1UBGA 1NG1A 2A9KA 2F1IA 2RGGA 2NO1A 2FPLA 2ZI3A 1YZNA 2FG5A 1XZQA 4DIDA 2D06A 4Q9HA 4PO1A 3KQUA 1G3UA 2GXUA 4M1YA 4EPWA 2OESA 3KFVA 3GEIA 3QPVA 1YR6A 2JJ1D 4JBXA 2ORVA 1ZVQA 3O8DA 4HLUC 1E9RA 2WWFA 3RRYA 4ZKDA 1S3GA 3LX8A 3M4YA 3TQCA 4GFDA 3B85A 3FTQA 3NHAA 2ZUDA 2XAUA 1SKYE 3K0SA 4Y0AA 4C3ZA 2N46A 3IGFA 1R6BX 3QY0A 1IY2A 4FD2A 1TU3A 4MGIR 4EQ6A 1G18A 4FXPA 2AKAB 4HAYA 1N5LA 3ZVNA 2XTMA 4HLUA 1SXJE 4B47A 2YZ2A 1E2GA 2FFBA 3B78A 1LVGA 1CRQA 1D5CA 1HV8A 1XP8A 1WXQA 2VL7A 4HAWA 3RRZA 1P61B 3CM0A 4MKFA 1RC8A 2MMGA 4JKIA 1CULC 1Z2AA 3K9HA 3MLEA 3C4JA 4PANA 1U90A 2GHIA 1SVWA 2ZRFA 4QL3A 3TSZA 1I2MA 4JJKA 1NI3A 1XJ0A 2QRNA 4W7SA 4CRWB 5BYKA 4CW7A 2ONKA 1N6RA 2WJVA 3A1SA 1XD2B 1MO4A 4HAUA 2B8TA 1QRAA 3C16C 3CZQA 1XTQA 2OXRA 3U44B 4EJSC 4BEBA 5FUWA 2WM9B 5GADl 3W34A 1II8A 1AQUA 2XZPA 3K1JA 3NHBA 1U94A 3WYGA 4PC1A 3QKRB 4IDNA 3FFAA 4GZLA 1SZPA 3PCRB 1LV7A 4P3YA 1SVMA 3QENA 5P21A 4MDFA 2QA5A 1A7JA 2ZRGA 3C15C 1PJRA 3U4QB 2BJVA 2ZXUA 4M53A 1CR1A 2F9MA 2ZI7A 3M1IA 4LYHA 4UJ5A 1JR3D 1RYHA 1XTKA 5F2EA 2A78A 4QNRA 1ODFA 2WJYA 3H2YA 3GLHA 2OSBA 1WF3A 3H86A 3LLMA 5A5GA 4A0GA 4QGHA 3OIUA 2I4IA 4YMTA 4C0AC 4BGDA 4OI4A 4DXAA 4GMXA 5BQ5A 2DHRA 3GFPA 1W2HA 1DVRA 2P67A 4QC2A 2GBLA 4NP6A 1M7BA 4RZ2A 3WP0A 1W0KA 4YMUA 3LBHA 1G19A 2QTVB 4Q48A 2PJZA 3CPJB 2BWJA 5F9FA 3LAWA 1W2GA 3VX3A 4WVFA 3REFA 2GKSA 1GZSA 4XTRA 3KTAB 5FBWB 4BLRA 4M1TA 4DCSA 5CB6A 4G5QA 4QBIA 5DISB 3I1FA 4RFSB 1CJUC 5JSZB 1X8KA 1FP6A 2JLXA 3KTAA 4KFUA 2QTHA 3HYRA 3RAPR 2GAOA 2O0KA 1KO7A 4M22A 3GLFB 2EWWA 1ZD9A 2ZITA 5L3RA 1IN8A 1TNDA 4QG7A 1GUAA 5AK0A 4D0NA 4A0RA 1A4RA 2NGRA 1KO1A 1RVDA 2R44A 2VHUA 2ZUCA 1R0YA 4IOKA 1TQDA 4PAQA 5DO9A 1FUUA 2AK3A 1E2HA 1TQ6A 4Z54A 4CEJB 2O8DA 1US8B 2J0UA 4BFWA 5BN4A 1BIFA 3AQ4A 3HJNA 1Z0IA 2WSSD 3SC3A 4XVUA 2H7VA 3N2EA 1EX7A 2QTFA 5IHPA 3KQKA 1Y3AA 4CEHA 4PHGA 2ZROA 3H84A 1XTSA 3FWYA 3HP1A 1KJYA 3CIOA 5CJPA 4C4PA 2WWYA 3QSYA 1Z47A 1XXHE 4P31A 3GLIA 2G6BA 2B92A 1QHGA 2HXYA 1P9NA 2A30A 4QBHA 2E9SA 2ODNA 4ARZB 4BFUA 1ZW6A 3KDSE 4ZCMA 2G0NA 3RS4A 2O8FB 3E1SA 4I1OA 3P4XA 2CBZA 2DY1A 4DLWA 2ZRJA 1PLJA 2ZI9A 5JRZA 2VP5A 2R6FA 2VBCA 4DDWA 2P3SA 3K0FB 3MD0A 3SI7A 1SXJC 5FPTA 2QT1A 4DRZA 2ECKA 2GCOA 3OIVA 1FQJA 1FTNA 4MYTA 4Q7LA 1W4CA 3G0HA 2IL1A 3AB3A 2O8CB 4H1VA 2PJRA 3U3RA 4A8JC 3CF0A 1FL9A 1IY1A 2RHDA 2JJ2D 4B6FA 2BMFA 2NO7A 1ZP6A 4US2R 4OQNA 3QJYA 1RRCA 3OAAA 4JL6A 1UDWA 2IK8A 1ZM4A 4RJLA 1IY0A 3BORA 2JDIA 5EE5B 5E7JA 1G8GA 4RSGA 4A92A 1QHHA 4LJ9A 1AA9A 1J7KA 4LSGA 2NG1A 2P0EA 1UADA 1AIPA 1FQKA 2ZRAA 2BM0A 4JT2A 1G64A 3RC3A 3QE0A 4ASUA 1YJ5A 4DSTA 1H8EA 1PUJA 4URZR 2IYUA 1NVVR 4MGYR 3IPXA 2FA9A 3LBNA 1ZUHA 4NH0A 1PUIA 1ZD8A 1NMYA 2ZANA 4XSGA 1ZYUA 1XEXA 3HR8A 3IIKA 3GPLA 1DO2A 4MA4A 3FOZA 2PH1A 2IXFA 1OKKD 2FEOA 1NN3A 2QI9C 4XH9B 2PEYA 3U7GA 4UXHA 1ZNWA 2AFHE 2H5EA 3LH5A 4LJ6A 1Q3TA 3EZ9A 4G5SA 4A15A 2N1BA 4WXPA 5JECA 2JASA 4KFTA 1TUEA 2O0JA 3L0IB 4MKGA 4NMMA 2J0QA 4MRVA 4RKFA 1DOAA 1TX4B 2ODWA 4PX9A 2MSDB 2V1XA 3FHTA 5KSOA 5GJCA 4UQOA 1CR2A 1JR3E 4IOMA 3ADKA 1HURA 1NLFA 4E07A 1KY3A 3MFYA 4ASUD 1T3SA 2AX4A 2D4HA 4WXRA 3ZS8A 3ZIAD 4HB0A 3RS2A 1XTRA 2CL6X 2UZIR 3S1AA 3MWYW 2DWPA 2UKDA 4TTRA 1YZLA 2WV9A 5CLLA 3I4LA 5E3HA 3NBYC 1IBRA 3U61B 3OIYA 3VR5A 3EARA 4JBWA 5AUNB 4DB4A 1VYVA 2ZRNA 5L3SA 3MG9A 3O8BA 2IBMA 4U7DA 4YXWA 3E5HA 1OJLA 2MMCA 4NYIQ 5JHHB 4NCHA 4X8HA 3WMGA 1R0XA 3QXCA 3CX8A 3B5JA 5FBVB 1JXOA 4XSHA 4BFYA 2SHKA 3B1YA 2Z83A 2F3RA 4PR0A 1Z63A 1XB2A 1LNZA 1Z07A 4LV5B 2O8BA 1XXHA 1DAFA 2A5JA 1C9KA 4A2QA 2WMOB 3MGCA 1KO8A 4B3DA 3BAFA 4TLDA 1U0HC 4CT4B 1XTJA 2GCNA 3GLFE 2RGNC 4KFSA 3CBQA 1UKZA 5GJBA 3OFNA 2F1RA 4P4UA 4I81A 1WCV1 4J0QA 3LA6A 3SR0A 4TZ0A 2YWGA 2B6HA 2VHQA 3LO5A 4KYUA 4OQFA 4WZAE 3TIFA 2W6JD 5DI9A 2RGDA 1G7SA 3T35A 1L2TA 5A4JA 3V4RA 4A8JB 4CEIB 3BIFA 4ZDJA 4A36A 3R7WA 4GRAA 4R2IA 1COWD 5EQTA 3KKQA 4KFRA 3AF1A 1IN5A 1AS2A 2V8OA 4D0LB 5KO2A 1N6PA 1E2DA 1N25A 4DIEA 4ZCIA 1R10A 2CHGA 4E03A 2R6DA 4XWAA 3ADCA 1ESMA 4UNRA 2QAGB 3B82A 2O8CA 4I4LA 4QHSA 5C4MA 5JMTA 2ZSBA 3SYLA 5LB2A 1VCNA 2VP2A 2CVFA 4JIMA 4FCVA 5TXGA 4YMSA 5E95A 1CIPA 1M7HA 3PUYA 5KHOC 4ZV4A 1P3JA 4AKIA 3QF4A 5JEDA 2WTUA 3FE2A 1KSJA 3K8YA 1OYWA 4ABYA 1XFAA 1E94E 3P20A 4Q7MB 2YJTD 4C2UA 1FOEB 2DR3A 3RANA 4AC9A 1OF1A 1Z6YA 4QJ3A 2ZS9A 3BK7A 2VF7A 1P2SA 1T8TA 4AD8A 1F60A 3IHWA 8OHMA 2OO7A 4L5BA 3A1VA 3U3JA 1P2VA 2ZYWX 4B6EA 1G7TA 3FMIA 2BBOA 2GEDA 4MUAA 4NCJA 3EXAA 1R0WA 3P32A 4P4SA 1D2EA 3EPKA 4O2RA 3TRFA 4TLAA 1D2MA 3OE7D 1SKYB 1OE0A 4BFTA 721PA 4BE7B 1BS1A 4Q00A 3PV0A 4DLUA 3WRXC 2QUZA 3V9PA 4LY6A 3GJXC 4OJQA 3TLXA 5IK2D 3O8CA 1KI6A 3TAHA 1UEIA 3SQWA 4JLBA 4XVQA 2QORA 1E6CA 1UBCA 2ZJZA 1CBUA 1KO5A 2WWXA 5LPNA 4LUCA 4DEXA 3CLVA 1TL7C 5FTKA 4MDEA 2J7PA 2Q9BA 5H1YA 2K5UA 2OCBA 3RRNA 3THXB 5EUMA 1CRPA 5JFGA 5SZHB 4US0R 3AVWA 4TN1A 1W36C 2OBLA 3ZVRA 3ZLJA 1DO0A 4DJTA 4RY2A 4H1UA 1E1QA 1E2EA 2A5FA 3BD9A 4GP7A 4TYPA 5CM8B 1VIAA 2G88A 3T1QA 1E0SA 2RH5A 1Q1ZA 5AR1A 2A5YB 3I5XA 5ELXA 1FNMA 2KB0A 4NCKA 5L3QB 3R9XA 2FMXA 4ESVA 3I32A 1N6NA 1GKYA 3HYTA 4HUQA 4QHTA 2W0SA 5L3QA 3ICQB 3RNLA 1S9HA 4OBEA 4M21A 2CL7X 2GCPA 3SFVA 1CJTC 3GLGE 3IBGA 2XTNA 4AYXA 3QXHA 2VTKA 5KPJA 4Z51A 1G4UR 1YE8A 4C0JA 2J9RA 4EPVA 1ZC3A 4Q1CA 4MYUA 4Q4HA 1G6OA 1T8UA 3PUZA 2G1KA 3THWA 2VP6A 4IOJA 1IXZA 5K8TA 2QE7D 4OK6A 2EVWX 3BB3A 2G3YA 3EW9A 4N0DA 1EWQA 2CJWB 3MAAC 4KLNA 3SZRA 4UKDA 1NJFA 1NIPA 3ADBA 2ASEA 3Q85A 1U9IC 4QJ4A 2G83A 3L8YA 1DARA 2FN4A 1G3IA 5EZ6B 2VP4A 4X8LA 4GP6A 5TB5A 4LYJA 1QHHB 2KI5A 1II8B 4U00A 3U2QA 1AQYA 1FX0A 2D3WA 4TL8A 1GILA 3LD9A 3RHFA 2CVHA 3L0PA 1G6HA 1GRQA 1CXZA 1ZNXA 4URYR 5J4YA 2E87A 2JLWA 4CGZA 2AFIE 1IJEA 4PO8A 2WOJA 3LNCA 3FB4A 4R98A 3ONWA 3NEYA 1N5JA 2AK2A 1G3RA 1ZMXA 2GJ8A 4D4JA 1P6XA 4LJ7A 3LVRE 1G41A 3C5HA 2GVDC 1SULA 5AJWA 4UNSA 2AWNA 1T3HA 2BBTA 1C1YA 2ZJ2A 5LB4A 1FZQA 2XNDA 3DZ8A 3U6KA 1Z0DA 3L2OB 1JAIA 2RB4A 3BERA 4LV6A 4CEIA 4ZDKA 4Q4JA 4IVPA 4P0TA 1ZC4A 3AVPA 2VA8A 1T5IA 2C95A 3PEYA 2IS2A 3RS0A 5KSYA 2P6NA 2GTPA 3MUFA 1NG9A 4I1UA 4Q1FA 2QBYB 2ODBA 3REGA 2QMUA 4HDQB 1HY3A 4GL2A 5CK4A 2WMNB 5AJVB 1Q21A 1G8HA 4MGKR 4Q4LA 2GESA 2LWIA 1JQJC 2FFHA 5KNDA 4LGMA 1P60A 1SVKA 1XWIA 4XD7D 1KOFA 4HAVA 1FUKA 1EFUA 3K9NA 2YOGA 5G3ZA 2ZSDA 3IEUA 1CU1A 2NO0A 5DYGA 2ZYUX 1COWA 3AUXA 3DOEA 1Z8FA 221PA 1FPMA 2WJGA 1J90A 2VLIA 1I2DA 1MV5A 1W1WA 4UXIA 5DHFA 1UFQA 4AK9A 3EIQA 1LS6A 1KI7A 1Q1BA 4GI7A 1NMXA 4UJ3A 2H57A 5FOTA 2OFOA 1E2FA 2BCGY 1VG8A 2GDJA 4TSFD 2ZRMA 4AYWA 2ZPTX 1N0WA 1QHNA 3ASZA 4UNQA 2PZGA 4NL4H 2J0UB 3AVUA 4Q19A 5JJLA 1BO6A 1KKMA 5FOSA 4ESHA 4LV8B 4DB2A 1FP7A 2GEVA 1ZINA 4DCVA 5EE1A 1KHTA 2VHCA 1OH5A 4L8GA 4P33A 2C03A 4Q66C 1OFTA 3ND8A 3Q5EA 5H70A 2WSSA 4JJZA 4B76A 5FPSA 4X8OA 2MSEB 2ZR0A 4MKIA 3GJ3A 3ICEA 2QAGA 4EPXA 1I4LD 4TZ6A 2C5LA 4NPHA 2GA8A 2ZSEA 1YU9A 3FKSD 2EFCB 2IF0A 2BJWA 3CRW1 1G9XA 3IQXA 4PPNA 2IHBA 1E4VA 1D9ZA 5FL3A 4F4JA 4ACBA 1QHYA 1RYFA 4WW0A 4TYQA 4E5UA 2NO6A 2FH5B 1W0JD 2VPPA 5CITA 3OESA 2ZETA 3TW4A 1US8A 3IO5A 2CNWA 1E32A 1AS0A 1UJ2A 3A37A 4TL9A 3A4NA 1QDEA 3A1UA 4O25A 2YC4C 3KB1A 4FIDA 4I99A 2P6UA 4BRUA 4NTZA 4V0MA 5M04A 1CR4A 3ZVMA 3B60A 4HB2A 4II7A 2GXSA 5AJZA 1MO6A 2ODEA 2Z6VA 1OXXK 3TK1A 5FL7A 3TUIC 1E1RD 5JLJA 3F3YA 5FR2A 2AXNA 4IHQA 3VTKA 2QROA 1G8YA 2AD5A 1EXMA 1NBMA 1U8AA 1ZNZA 5KSPA 1DAKA 1MABB 2EYQA 4I1SA 5FTLA 3RS3A 4HUTA 1E1RA 2ZJOA
chains in the Genus database with same CATH superfamily
3GEBA 4D82A 5EP4A 3BJRA 3ENWA 5CVDA 4TM8A 4UNIA 1U6IA 2HA7A 4JYBA 4D99A 1FLDA 4P9NA 4XUEA 1L5NA 4FSDA 3TR0A 3JS5A 2L18A 3EMKA 4O2AA 5J23A 4A6XA 4G0ZA 2DKFA 3LXXA 1ZD5A 3M9WA 1NBWB 1ZU5A 3IUYA 4PBSA 3X0DA 1CUAA 4B7ZA 2JIRA 2L82A 3C5EA 2QD5A 1IHYA 4M1ZA 3NYWA 3KL2A 1HOXA 2C0QA 4KSYA 4R8MA 1AZTA 5A62A 2GF9A 4WJKB 3NRBA 5FAKA 3IDOA 1JNYA 2AR9A 1N77A 3O74A 1H3FA 3LL4A 4TRMA 5CNMA 3UV6A 1NPTO 4IDOA 4P2BA 4MI3A 5HPYB 4MW7A 1I1OA 1J39A 5JDIC 4LPSA 1SUDA 2JLSA 4EQ6B 2CXRA 1SUPA 4W5OA 4MGHA 2I3GA 3NETA 2PLAA 1QVRA 1XELA 5CT4A 5IJ9B 1ELOA 1UX4A 2ZR8A 1YS6A 3G59A 1YKSA 2YX1A 3PSHA 3HJBA 2DX7A 2QPOA 1J56A 3ZDZB 4J0JA 5JE8A 2W2PA 3MILA 2V9PA 4MVJD 4X20A 4KR3A 5IAAA 3IODA 3IHTA 2V55B 3A11A 3WSWA 1EDZA 2WA1A 3NGMA 4QBGB 2XDQA 4PPFA 3TLJA 1N2CA 2YY5A 3K94A 3NASA 1IE3A 2UVPB 5I48A 1DTWA 3N87A 1J21A 1X74A 3CH7A 3N0WA 4U7PB 2PX0A 2I34A 3C6QA 4L74A 4RLHA 3SNHA 4HWOA 1YKGA 2KX7A 3F97A 5AHKA 5AOBA 1A5TA 3TRJA 2GYYA 3VR0A 2PBLA 5A6SA 521PA 5K8LA 3W3AD 2C9MA 4GRDA 3WK7A 2HIHA 2ZYAA 1C5KA 2G9UA 2IUSA 4HQKA 3AJDA 4IIFA 3TTXA 4A6PA 5F3WB 3QXXA 1GD1O 2R6ZA 1EFRA 1G8JA 2ZYSA 3DW3X 4J0GA 3P9YA 4C7XA 1M6YA 4LDRA 2RGCA 1Z26A 3F9CA 3FFBA 3KR9A 4KYVA 4ND1A 5E1BA 4AX4A 3ENKA 1NNEA 3L5KA 3ZHUA 1IN4A 3ETLA 2PCJA 2ORED 2W48A 4QOFA 4RKYA 4KITB 5LVAA 2XEDA 3N70A 1ADCA 3V1YA 2UXBB 5AW3A 5AW1A 1UPTA 2QAJA 3CNNA 1F0YA 3DBHB 1L4GA 4G0YA 4QWWA 3GFBA 2O3SA 2JGRA 4KR7A 3LCJA 3MELA 5JD6A 5DULA 4RZXA 1Y8QA 3RW9A 1Z35A 2X0RA 3ZGZA 5DTQA 1HQYE 5KYWB 1VECA 2OG1A 4CFSA 2E5FA 2RH8A 4U5QA 3ZCPA 1YGYA 2HF9A 3VAAA 4ZARA 3L0ZA 3CUKA 1VP3A 4GLOA 4A9AA 4QLBA 1HTTA 2JRCA 3JR3A 1X19A 3PXBA 1KSHA 2B5WA 3LGSA 1UZAA 2KJQA 4FILA 4ZTUB 2QRMA 1E0JA 4NOKA 4MWOA 1KEEB 4AZSA 3FWHA 4XWKA 5IW8A 3U4DA 2GXQA 1LNQA 1BXGA 1EHYA 4KRYA 4RZ3A 2JH8A 3HI4A 4JBYA 4OHPA 4HLQB 4JJIA 1F2TB 4JZYA 2VH2A 3EIFA 1MO3A 5KJ1A 5KNBA 3L43A 1QBKC 2Q4EA 3V2HA 1QNFA 5DI3A 3CKKA 3ETJA 1T9HA 4ZU6X 5EQDA 4M54A 3AL3A 4MUEA 4UHEA 3PHJA 1SOAA 1C0PA 4U19A 1FW8A 1GN9A 1FU4A 2YUIA 3MD9A 4PSAA 3W5JA 1WPGA 3WNZA 4BECA 4YV7A 4M46A 4HXYA 3IILA 3ROTA 2QN6A 3A9UA 2O9JA 1WHSA 2Z56A 3BFVA 1XU7A 2WKSA 1MMFB 4KUHA 4X97A 3PS9A 3RM3A 3RSCA 1EUQA 4HYYA 1GXSB 1XPJA 2OBNA 3QXJA 4Z3OA 2D0OB 2NPFA 1N36B 2JJ1A 1JEEA 1DADA 1IQPA 2ATEA 2ZUSA 4U8HA 2BUCA 2QLJA 1Q19A 3SHFA 1U0LA 3ENZA 1YS7A 2CB9A 2V7QD 4ZVVA 1Y3DE 2CNKA 1G7RA 1EF8A 2L0XA 2JIZD 1BXRB 4HEA1 4BB9A 2WVJA 3EA0A 3OEEA 2CW5A 4JC8A 1KYXA 3KFXA 2HLDD 4GQBA 4Q3EA 2I5PO 2PKQO 1ZA2A 2BFOA 2TYSB 1ZGAA 3EF1A 4OG1A 3PDHA 4NENA 1RHQA 5IARA 3WLIA 5IPFA 4EF4A 5TDHA 2RI0A 4WY8A 3JQFC 4ZOAA 2Q5JA 4UHBA 4UREA 4JWTA 1Y6GA 1H2ZA 4G1VA 1PZXA 2QD4A 2NIPA 3IEMA 4MV4A 2J5XA 1KMNA 3OECA 1FLVA 1ZD1A 2E82A 3OFVA 4GX2A 3QYPA 2DQYA 2GEKA 3H9CA 4JLNA 2PA3A 4RORA 4GX5A 4BMZA 5ADUS 1JLHA 5L9AA 3X1WA 4QGBA 4ARIA 3GLVA 5DCWA 1ULAA 3DZGA 4CKWA 5BW4A 5HZHA 4KPEC 3TW8B 2X2EA 3PE6A 3FOCA 2E6KA 2ZBPA 3FI9A 1L5KA 4R84A 2I1WA 3A70A 4DIUA 1ACJA 4DDVA 5IXJA 3BIXA 3S99A 2XYQA 3MERA 2GEBA 5ALWA 2Q41A 1XU4A 1L4KA 3H4VA 1QIFA 3ZZ1A 5GPBA 3H0KA 4DUPA 4ZFNA 1I51A 3BSSA 3EC7A 4KWEA 2WJAA 2B1QA 2WR8A 4RW0A 1TB4A 2MDTA 5JR3A 4DV7B 5BPFA 3JXEA 3V2UA 1SK8A 3OOEA 4C01A 1GRRA 1T1GA 3U31A 2J7KA 1PIWA 1R0KA 5JI2E 1IM8A 1H93A 1SU8A 3O5AA 4YT2A 3H6HA 3NDBB 3DF7A 4RYDA 4JWKA 2ODAA 3COPA 3VKGA 1I3NA 3BDIA 2OA0A 3GUVA 3OTQA 3UFBA 5F7OA 3W5CA 1M5RA 1WZUA 4P93A 4ARSA 4BX9A 2VSOA 1LZKA 1SNYA 1PYGA 4EY4A 1JMVA 1WHTA 4QOSA 1RP1A 1T0IA 4GBJA 2NU8B 3E15A 1SH7A 1KMMA 4C6SA 2GPWA 4ZI3A 2IH4A 4YJ2F 3RPEA 2R8PA 13PKA 2MR6A 1O03A 2RAPA 2Q28A 3O3CA 4FFBA 3KAPA 4G01B 4MUMA 1S2GA 1R1DA 2ZB7A 5B1YA 1KVUA 5DH9A 1V11A 4K2NA 3WTBA 4J0HA 5LZ4A 4WBNF 3IEIA 4FGLA 3UOWA 3OTGA 1G20E 4MS4A 4QFMA 2AD1A 2J6IA 2ZBEA 5LDDC 1W36B 5K2MA 1RYBA 2BMWA 4OK5A 2WKQA 1SD1A 2Q6TA 4E51A 5DEOA 1MPTA 1LDEA 1BEUB 3SJBA 5DI3B 1G1MA 1QQAA 4EGAA 3DXZA 1IVNA 4TV8A 5K3CA 3N8KA 2AT1A 2MWMA 4BY9E 4HH3C 1HEUA 1SCNE 4MYSA 1LA2A 1EFRD 4NVRA 3IDQA 2AZTA 4JQSA 2HO4A 4OUDA 2R00A 4RZSA 2R8ZA 1QTRA 5EFOA 4UE2A 5TLSA 4LOAA 3GOQA 1UWKA 4DLBA 1EX1A 2O7SA 5I4BA 4MB6A 2NWQA 1YRYE 1CP3A 3AG6A 3ZU4A 3W9SA 4YRMA 5JC8A 3N6XA 1RHUA 3F6CA 1P62B 3K6KA 3KB2A 4RCYA 4CF7A 4L4ZA 2BSAA 4HL6A 3UXMA 1E2MA 3MTIA 3O1HB 1R0ZA 2R2AA 5DNDA 1X1RA 5GMOA 1A98A 3C3AA 4B75A 3TLGA 3WLRA 4IHJA 3DEIA 3Q8WA 3GG2A 2ZUVA 5G4KA 3JW8A 2QK4A 4I55F 2WM8A 3WL6A 4B2PA 2B35A 3PX3A 4GVLA 4D3XA 4QQRA 4YJ3B 5AXBA 1KI1A 2C8LA 1M2FA 2ZP1A 5H9WA 3FOEC 3DV0B 1AUOA 1M54A 2AEMA 2X5OA 3AF0A 1ZZGA 4OHWA 3AWDA 1PFQA 1IDN1 3NJ4A 4JT4A 3W8FA 5M34A 2BI8A 4HGZA 5CLJA 5FULA 4II2A 1HZJA 2V03A 1WY5A 2ID8A 3KXLA 1LJUA 1R9JA 3FDXA 3MMZA 3MSCA 3PA8A 4ND7A 3T7AA 4NXMB 2VATA 3N2IA 3II6X 3QMMA 3QX8A 1GSOA 3TX2A 1B6SA 1YB6A 1I6LA 3FKQA 5HRUA 4LCBA 3F5SA 4N39A 2SCUA 3C3MA 4PRKA 3K09A 2NTYC 1KZGB 3VR6D 5KNBH 4TYWA 3KHUA 4MUXA 2FXIA 4V0ME 3I72A 4JVMA 2NUTB 4O2AF 5A3JA 4KCGA 4MVXA 3UM9A 4A26A 3B38A 3ON5A 1GKUB 1ZQ1A 3SQXA 3EOZA 5FOUA 2Q1XA 1ACMA 3V1KA 3ZNNA 3ZNQA 4CLHA 5BXQC 1EGQA 1FFHA 2BFEB 1IXYA 2AXQA 2E6UX 1TJYA 5KTSA 2OBYA 4O29A 3OHMA 2OZEA 1NLYA 4TN5A 4G4GA 4AUEA 4UE6A 4O4JB 4B31A 3A0RB 5CG2A 1KA9H 1Z62A 1KYYA 3DC7A 1SCKA 3RGGA 1RBZA 1AA6A 3OKAA 2QTGA 2VF8A 1QYDA 1E8DA 4Z4IA 3BGIA 3S70A 3OC6A 4ND3A 3KJZA 3JQAD 5GONB 4ZC8A 3VGJA 3ZCTA 4MKRA 4BFXA 4D41A 4LMBA 1G2QA 1OHHA 2VPYA 4OY3A 4B6SA 2NU7A 4PYKA 1VPDA 5EPEA 5BQXA 3I0NA 3HXTA 1IJFA 2CVOA 5D7NA 3JR7A 4Z9YA 3UMMA 2D6FA 2AVDA 3MCZA 1Q2XA 1P2GA 3UK7A 3A1DA 2EKQA 2PUHA 4QDKA 3LT2A 3QVTA 5BW8A 1EFDN 1NBME 1PHPA 2XOKA 1F5SA 3C8DA 4WZ6A 1KAGA 2QLBA 4EJSA 4AKHA 2IZ5A 4JBNA 4KO1S 5CUQA 3FNEA 3M5PA 2F6RA 2FSGA 1R6AA 1ZGHA 2QEQA 3QKSA 1DXOA 2A0FA 3PSAA 4C0KA 4QTXA 1ZEMA 4DR4B 2ZSAA 1P0FA 3HB7A 4N6GA 4WSOA 3PVZA 1H22A 5JRJA 5DBEX 4BWYA 3JQAA 3R0OA 1MFZA 3I2GA 6CHYA 2Y8EA 3GDHA 2DPYA 2W83A 2P11A 3F9RA 1EKXA 4LX0A 4D57A 5K09A 1W5TA 1W47A 3U49A 3D5TA 1EFPA 4BNNA 4KEAA 3S8MA 2QP9X 1O95A 1Q1NA 3G8DA 4ZO6A 3L7MA 1TUBB 2YBDA 4FLMA 4GC5A 4DBLC 2WILA 1Z39A 3CRMA 4AIIA 3KT6A 1XIVA 1SOVA 2PZEA 4RE5A 3ZWAA 1GEGA 4O5OA 4C29A 3RYCB 1JI3A 5TS2A 4RF3A 1TD9A 1F06A 3VR5H 1ONSA 3JSAA 4MV0A 4ZOLF 3K0AA 1RRMA 4IEEA 1Q1EA 2AG5A 4NY1A 5DW0A 3LDUA 1WSWA 1FQOA 1AM4D 3Q7PA 2ZVJA 1TA4A 2RFLA 1MABA 2O2EA 2X19A 2WT4A 4IEIA 1A8UA 3L0CA 3TQQA 2FZCA 2NZVG 4R71A 4K05A 3WL4A 1DT3A 1A95A 1JT2A 1LFAA 1U8CB 2HDOA 2Q07A 3RBVA 5BSVA 1YDHA 3IPAA 2QJTA 2CHUA 2R0QC 2O2DA 2QOEA 4M9QA 4TROA 4Z9BA 3RSOA 1JWLA 3L41A 1O9GA 2PYDA 3S1LA 1U0TA 1Z08A 2DBZA 3HY4A 4IYJA 1XROA 4EATA 4K03A 4WXEA 1K5HA 2IY8A 5DLPA 3QY9A 1K5DA 1N32B 1GL3A 1KXJA 2P2GA 1E1MA 1KARA 3B9RA 4DA9A 1WF6A 1SXIA 3NB0A 1J8MF 4TUYF 3EGCA 3Q87B 4Z4QA 2FFAA 1X1QA 3ONEA 2P35A 2C5HA 3VU8A 4DNOA 1OAOC 1ZI9A 3TZEA 1EFHA 1NQTA 3EZLA 1IIRA 3EDCA 3BRQA 4RZQA 4IS2A 4ILKA 1Z36A 4MV7A 5REQA 5CLFA 1QG2A 1WHSB 4CR6A 2AN9A 2XJ9A 3GRCA 2XXAA 2GLUA 5DGTA 5G0UA 5A7GA 4WD3A 4UPVA 5EUBA 2IDKA 3A6PC 3OP4A 1LPNA 3FVQA 1N78A 2IU3A 5KNBD 2AF3C 1JPNA 1VE1A 4K7JA 5KMGB 4YJGA 2CV1A 4BX2A 5AESA 5ALVA 2HGSA 2GZHA 2GJKA 4KJZA 5F35A 3RUEA 3TZLA 5CDUA 4LF5B 1X38A 1KMHB 2BP7A 1A69A 2Y68A 2ZJ0A 1NR1A 3MJ4A 3TZBA 5A3RA 4HV4A 1O89A 4FOOA 1JG6A 2YY6A 3HFSA 2H9IA 2P9HA 1R7RA 1V39A 4YAGA 1ZWLA 2ZT6A 1K6XA 3ASUA 1VG1A 4ZEXA 4HHEA 4DSZA 4UBKA 4CMAA 2V6JA 2VA9A 1CWUA 3OQMA 3ZLVA 4KBYA 2XGJA 4P98A 1TF5A 2O2YA 1AGRA 4B32A 2DWOA 4MUYA 4INJA 5CTJA 4G0XA 9LDBA 1EGMB 1OFVA 1W4ZA 2AFVA 3Q1TA 3LBIA 1NXTA 2IVFA 5IANA 3MMPA 2QN2A 4U2BA 5I6DA 1RQLA 3M82A 2BFPA 3FETA 2IX9A 5F21A 3EEOA 1EWKA 1XZJA 3I9V6 1EAMA 3S5UA 4HY3A 5DP1A 3E9MA 3GGOA 1U9JA 4QX6A 4E5PA 4M89A 1Y8AA 1FXWF 1CZHA 1K3FA 3ZI7A 1RYZA 4ZYUA 4F1WA 4OJKA 4ZVOA 4XPIA 1VRVA 1DRVA 2RGNA 1KAHA 3ZGVA 1RI5A 2Z09A 2QV7A 3RU2A 5BQ3A 3SJUA 1TD1A 5FORA 2E7ZA 4EABA 3GH3A 3LLCA 1DXHA 3FKJA 3EG5A 1Q51A 3TAUA 1L7PA 4M87A 1KK2A 2J6CA 4RELA 3L4BA 3EODA 2JRLA 1P9LA 1UDAA 1N9GA 3I12A 4RD2A 2QUJA 4JP1A 4KQGA 1FP1D 2C7BA 2PSFA 4D44A 2GAAA 3VJRA 1LC3A 2EW1A 2VUSA 3EDMA 1IN7A 3S6JA 1IEQA 4N41A 4M9RA 5T8KA 1NNI1 3AW9A 3FMFA 4XARA 3S27A 4Z6KA 1C1XA 2CFTA 3QVSA 4KLRA 5CHEA 3W06A 4HLCA 3CE9A 4YJFB 5KYWA 3K4PA 1IFXA 4TYNA 5EHNA 2JH9A 1ONOA 3IP3A 4TV8F 1JECA 2COKA 4BMCA 4M98A 2GFHA 3GIWA 4GMDA 5C31A 5MFPA 1KEVA 5A0VA 1XZDA 3A3YA 1NKSA 4PLZA 1N2IA 4BJ3A 2R6CA 3THYA 4MLCA 3C6KA 4NQZA 3Q10A 1J0BA 4CL0A 2P7IA 1SC9A 1T4GA 4S35A 1L7XA 4TRRA 4AJPA 2H1IA 2VJYA 3FTFA 2DTDA 5KVQA 4DWOA 5DGCA 2CZGA 3E22B 2P2LA 4JASB 3IVAA 3BMOB 1NMSA 4K9NA 3UWPA 4CVNA 4ER5A 1H9CA 2GWHA 3ML1A 4O5AA 1BMFD 2P41A 3JY6A 4KUGA 4PR3A 1KFCB 2PO5A 4KMMA 1I3LA 2OC4A 4M7PA 5CBPA 5B58C 3Q4GA 3G1WA 3EUFA 3GIDA 4QJBA 4RLQA 2HLDA 1JLKA 1JIIA 2ONCA 1BRMA 4A3SA 4ADSG 1BCSB 1TT7A 4GXNA 4P1ZA 3CG0A 1OX4A 2FJPA 3LVQE 4A4DA 5IN5A 1TKRA 1IONA 2GPTA 2WMYA 2M6KA 2YXDA 2FHSA 5IK2A 2I22A 1HG0A 1N5KA 3B6EA 3HLTA 2ONJA 5AVTA 3EZGA 3UB2A 5F77A 2VYND 3VYUB 1NN5A 3KZNA 1YZKA 4XUCA 1LH0A 3Q88A 2WAXA 1J1IA 3O4GA 3UJ9A 2P9ZA 1EYZA 1ID1A 1Z7EA 1YR1A 1O95C 2FWIA 4QOGA 1GPBA 1C2YA 3WLQA 1FFAA 3K5IA 3ZYZA 3WGGA 3B48A 3UMYA 4ENTA 4ICIA 3D0KA 4G5OA 5HIAA 3FDZA 2P75A 4LJ5A 2PWZA 3G2LA 1KYTA 4KODA 3KSBC 4BCBA 4HBZA 3IXMA 1AJEA 2YHIA 1ULSA 4R2MA 1XVVA 2BGTA 3KKKA 2VPTA 2IX3A 3PUWA 1SOUA 1P3Y1 5IN4A 1DL5A 1A2QA 1S2LA 2PJDA 1TQ4A 1ZN2A 5B3JC 3GVCA 4L8FA 5FIUA 4U7TB 5FOXA 2Q2QA 4NE9A 3BTUA 2Y76A 3AP2A 1QWSA 3H1TA 3TMAA 2ZI6A 1TTTA 3ZHTA 2CXXA 2QRHA 2P3LA 3AKEA 1OIWA 1VE9A 1P73A 4Y9UA 4KGDA 4YRRA 2G9RA 3DXFA 1CDOA 1PWYE 2DY0A 1V5IA 4Q4AA 3P2YA 5ECDA 3TEFA 3VHXB 3O8RA 1JQLB 2I7XA 3EF0A 1JDSA 3GEGA 3VVMA 1A77A 1FYWA 3CF6R 4MUBA 1JDZA 3EC1A 3O8QB 1OT3A 4K9DA 5DWQA 2IEAA 5KQGA 4WRRA 3L3BA 4LRYA 3ZDEA 4I4TA 2OEPA 3PPWA 4DRYA 2OB1A 2QM8A 4ITUA 3QOFA 1M8FA 2XCQA 5TPZA 1AG9A 2V9ZA 3UG6A 2I4NA 4FDTA 3V2IA 3A1EA 4EUNA 2YV3A 1Z15A 3V3KA 3E9RA 5GIOE 5ERYA 5ALJA 1GNTA 3NUZA 2O3TA 2JIPA 2H2GA 2REOA 1BFDA 4BJ5A 1INLA 2XBLA 3KZVA 4WLEA 1YR9A 4Q37A 4DPKA 5K2OA 4DA7A 4MZXA 3MWKA 1XRSB 2FWRA 2VR1A 2PX6A 5FV4A 1E8NA 1R6VA 2W6JA 2YJZA 1OXSC 2V8BA 4OFWA 4GPBA 4M6WB 5ARDA 1ML4A 2GF2A 4ESOA 5EJ8A 4KAJA 4TMZA 1Q84A 4D74A 1XZIA 3D7SA 4G1BA 1SUWA 4PPQA 3MSXA 4IXMA 4A82A 3PZBA 4HAZA 3U40A 3GLHB 4BB5A 2BGNA 4NBWA 2D74A 1MC5A 3T7IA 3ILXA 4LYFA 2WTMA 1RPNA 1RXIA 4QELA 4QVIA 3QFHA 3AUJB 1UKEA 1KMQA 1IH8A 1SUEA 1FTWA 3KQNA 1JTVA 4PPYA 3WYCA 1FFBA 1ISHA 4PICA 5ILQA 3K09C 3N2LA 1GZ6A 3KQSA 1N9GB 3KYDA 4XOIA 4LC0A 4TVSA 1ILEA 3R9IA 1QYWA 4IZOA 4TOIA 5DNWA 3USZA 1Y42X 2FEPA 3QSGA 3CCCA 2EX1A 1W94A 2ZJ3A 4P5EA 1QFXA 3LPDA 4ZVMA 1TM2A 3P4YA 3QFRA 3D64A 5G41A 1SZDA 4P58A 4LNHA 3N8DA 2Q9UA 1UWVA 1XT6A 3TO5A 2X4IA 3W8EA 4XPZA 3N86A 9MHTA 1RJ9B 2Q3EA 5LBIA 3MWGA 1RHRA 2WQZA 1T2DA 1XZPA 4S1OA 4BO2A 3OPYB 1YBFA 2VJMB 4MIEA 4R01A 3WRYA 1T2NA 4URFA 5GVSA 4RK5A 3OU6A 1EM8B 2NN3C 1T4MA 3BN3A 3DMYA 1JSRA 3HJCA 5M29A 3RAEC 4UCFA 4CUJA 2I29A 3PNVA 1QAMA 3ZWPA 5KIAA 3SJZA 1ZN8A 4QBFA 5EJGA 3D54D 3FRJA 5KSZA 4YRGA 1B3RA 1S8AA 2PUEA 5PGMA 4TTPA 3FMVA 1CY1A 3VPHA 3ZWKA 2W6MA 2ZBQA 3BE8A 3B7GA 4HEQA 5TJHA 1TEXA 5IH7A 3QE2A 2O19A 1QCZA 1XCJA 3UANA 4BVHA 2RHMA 1D6SA 1T5OA 1AS3A 5MGNA 4K40A 2HJGA 2EERA 1GPWB 3EGDB 4B85A 1LBHA 3JQ8A 4A6DA 3JTMA 4F4CA 1D2AA 5JHGB 3C6YA 2WEKA 1ZK2A 2HJRA 1P1KA 1QR6A 3M5CA 1NE2A 3DS8A 3MJFA 4EHAA 5ISMA 1PS8A 2PY6A 3NTVA 4GOND 4K9OA 3PHIA 5J47A 2FDRA 4MQMA 4HUQB 5FTJA 3GDWA 4WBXC 4H16A 4DQLA 3T7KA 3I9V1 2QZSA 3G17A 4CM3A 1J70A 3MUEA 2VRCD 1Q22A 1T5BA 1XMXA 3P9CA 1YJBA 3H7AA 1P4JA 1IPFA 2H4XA 2QYHA 4OM8A 3QZUA 4UUPA 3ZWNA 2JHFA 3KL4A 3KT8A 5CCEA 3T38A 3LY8A 3ZHSA 2ZR7A 5D87A 1UEJA 2I8LA 3WK9A 1UMBB 4QVKA 1H8ED 2V7EA 5TMDA 3AVQA 4G5RA 3AEZA 1PJZA 2HTFA 2F8SA 2HT6A 4L0QA 2EFHB 5FPYA 3Q8MA 1ZD2P 3IRUA 3BMNA 4KHPB 4IO1A 2OCLA 1QGUB 1Y1TA 2LCIA 3FAZA 2AZXA 3QUSA 2QRJA 4R2XA 1QF7A 4XJVA 3A6HA 3TLBA 4HVAA 1VPLA 4LZJA 2C8VA 4N3CA 5A5VA 121PA 1M8PA 3T5TA 5AXCA 3OPQA 1KMHA 2BP7B 2LIPA 2V98A 3GYBA 3IQWA 4F92B 5I9NA 4C0QC 5DGHA 2QP3A 2WG0A 3DLAA 4AJ2A 4IJUA 1NC3A 2ZRQA 3R4VA 5TRTA 5DYYA 4U5XA 3CX6A 5EESA 5ERGB 4BZWA 4POOA 5B7PA 5COAA 1UPBA 1F2UB 1CE8B 3F4LA 1EWRA 4GWGA 3H19A 4CGYA 3SZLA 1Q17A 2HO5A 3P9PA 2HUPA 5T4BA 3TE6A 3NONA 1H0HA 1Z28A 2L17A 4L85A 3ZGXA 5LD2C 3FPJA 2ECOA 3BS4A 3RVJA 3VYWA 1VIYA 1DC7A 3GFVA 4RGVA 5REQB 2FSVA 2OV2A 4HAXA 1S8FA 4ELXA 1XTIA 3LW7A 1WUYA 2Y6VA 4RANA 4DDKA 4D81A 3LCUA 2Q4DA 3QW2A 4M4SA 4PQFA 3IUSA 5KYXA 1E61A 5J63A 3SJCA 4CV2A 3PJFA 3LFTA 3D3QA 4HXFB 4NKRA 2FW6A 1X87A 2K4MA 3QWFA 3HUUA 2CV0A 2HHAA 4HN2A 4N03A 1XAJA 1C1DA 1VL6A 2JA1A 1YDEA 1TUBA 1KMCA 1R3UA 2V6GA 3VX4A 4MNTA 1UXOA 1TKAA 3EAGA 3EZ7A 3AM5A 1FMCA 3GEHA 4GGOA 1PEYA 3OC7A 4OI1A 3L1VA 3GNTA 4Y8VA 1DT5A 3QRWA 1PLLA 2V54A 4GW3A 4ZCTA 1XQ6A 5BMVA 2JI9A 1SQSA 1QMGA 1R4NB 1U98A 2FPKA 3PQ7A 3TTVA 1P81A 3DLTA 4RFSA 2B4KA 3CN9A 1T0JB 3QM1A 4P08A 1JQDA 3RYFA 1FP2A 1NKTA 2NT3A 4PAWA 4Y1RA 4JAVC 4JP2A 5G40A 4F9TA 2BHTA 5CDTA 1PNRA 3IDAA 4FSHA 7AT1A 4IEFB 4OQYA 5J2UA 1NBMD 3IXLA 4QJ5A 1DG1G 4GUDA 3UC5A 3BGSA 1KC3A 4ZU3A 3M83A 4FYYA 3RFTA 1M6NA 4OKNA 2C54A 3ZQJA 3H75A 3OE7A 2WM3A 3B51X 4QUEA 4WI1A 1U31A 1X8XA 3PJDA 1UOEA 2Y99A 3LQ1A 5JC1A 2YJ4A 1BMQA 4R1MA 3ZDXB 5ER9A 4ETIA 5SV2A 5AVYA 3A9VA 4ENPA 5FHQA 2N47A 3TBKA 2AC4A 4MWCA 4AJLA 3M0EA 3RT1A 4MITA 1I7DA 3LQKA 1JSXA 3LUFA 4M6WA 3CJTA 1KY4A 2J5KA 2PXAA 2SICE 1AGXA 1Y7IA 2ZKIA 4GI1A 1I2AA 1K7FB 4TLMB 10MHA 1N2CE 1TKCA 2OAQ1 3SKYA 3T8YA 1RM4A 4UXJA 1ODJA 3I1IA 1BVUA 1F12A 1RWMA 4L3WA 2GXAA 2QGNA 1B8UA 2ORIA 3ZTTA 1QQ6A 3KM0A 3X2FA 4F3TA 1R66A 4P5DA 3HCDA 4MJLA 4W8OA 3UWMA 4BS9A 1H1LB 2F43A 5LQAA 4MXDA 1WA5A 3LV8A 4L8LA 3ECCA 5FI0B 3V48A 4DC0A 4Z5XA 3GUCA 1V96A 4H17A 5ALGA 4ZREA 2AJTA 5BQOA 4W5QA 3ZQ4A 2G63A 4QDUA 1KI9A 1J97A 4MQEA 1WQ4A 2BLNA 3OZUA 1CJKC 1P91A 1HG1A 3I0ZA 3FUCA 4I3GA 3WQRA 1C9NA 3Q0IA 4X6LA 3PWKA 4HXGA 5D5PA 2IXDA 3VZBA 4F93B 4BLPA 1FYVA 3L4BC 2OAEA 2R6AA 2H51A 3L84A 2E4ZA 4H0NA 1E0AA 1L5SA 1HKHA 3NDPA 4KQ1A 1EZ1A 1Z8DA 3KJHA 4J1TC 1M74A 4W1SA 3WKCA 1Q0ZA 4N9WA 4K86A 4BGEA 5JD4A 2F3QA 2ZG6A 1UMCA 4HYEA 5EY5B 5DHSA 1U0SY 2Q6KA 1TU0A 3S2FA 4OGGA 2BGIA 1F3OA 3RRMA 1ICEA 2CYCA 4Y2UA 5JALA 1X39A 3ROEA 3QVUA 1F2DA 3P5SA 1QH1B 3GT7A 4MA0A 2OMKA 2PZAA 2WINI 5E4FA 5E8RA 5DYNA 1JR3A 3R09A 4JENA 1VHQA 3AK4A 4N7JA 1AB5A 3PNMA 5FEMA 3KQHA 3AKZA 4D4LA 2ZRLA 1BJKA 3ES9A 5G0WA 5LYYA 3MPUA 4DPLA 5C8ZA 5CA0B 4QOEA 1W6RA 2WVHA 3I09A 4O3MA 2I6UA 4NBLA 4WK6A 4YC7A 4LW8A 2IPLA 5IRCD 2KQUA 3AR6A 2JLRA 3TMYA 2GT1A 5FBLB 4B3FX 3VTAA 3VU9A 3F6SA 2QRGA 3KOUA 5JAPA 2ID4A 2PVCA 3KKPA 3NHFA 4FFPA 3PEVA 4MDYA 1SXJA 2P79A 2QLNA 4XD7A 4E13A 3IQDB 2WVAA 2VT3A 4K3WA 4DV0B 4QU5A 2FKAA 1GJRA 4QOIA 1W5AA 3AR9A 5HHTA 1R16A 4ERNA 3LCCA 1CY6A 3JZFA 4P0PB 1J9GA 1MG0A 1XU9A 2MSWA 3K20A 1OH8A 1UBNA 3U3KA 1CNFA 5B7GA 3G1TA 3Q5DA 4L73A 4XFKA 4AL4A 4AUMA 4GI3A 4HWGA 1I6WA 2JIDA 4JY7A 3ZU2A 2QRVB 2H54A 3ZW7A 5CXUA 2Q0HA 3ZCVA 1BQ3A 2V6IA 5FT9A 1JU3A 5IT0A 4KNPA 3FPLA 3RGWS 4OSEA 1A9TA 4TS9A 3TL2A 2YN2A 2BKUA 1DX4A 3R7FA 1GYRA 1ZOSA 1L1QA 2AHOA 3QW4B 2CXOA 3D7RA 1P9OA 1U0NA 1ZL2A 1JKXA 2OE2A 4B6JA 9GPBA 2YASA 2HQOA 1MOPA 1EK0A 2PUJA 3LK6A 3LK7A 3ZJTA 5C1IA 1Y64B 1FFXB 5LBTA 1IRIA 1KYZA 1PWXA 4YDHB 3QVJA 1TCBA 4H7JA 4C6TB 3E23A 1V2HE 4R5HA 5BR8B 5F5LA 2I1LA 1T1IA 2IF2A 2EF0A 2GZAA 2VG8A 3NWOA 3U7HB 4ZDIA 1T2CA 3LOUA 4CIWA 1JFTA 1NP6A 3FR7A 5D3KA 1RMYA 2EAUA 4L78A 3PLAE 1SOWA 3NWBA 1UK6A 1GUYA 3W8NA 1C1XB 1SU4A 3AW8A 1NXSA 4L4RA 1NHWA 4CMIB 4INPA 1N57A 1OKKA 3HA7A 3LKDA 3D7KA 2C88A 1LF5A 3WWDA 4DEVA 3I5YA 1V8ZA 5AOAA 4CUZA 1AGPA 3Q98A 4RNDB 3SU8A 3IP9A 5K6TA 1X7XA 4HWSA 4B2YA 1ZRSA 2MOKA 2MSCB 2OUKA 4JU8A 2CVZA 3VYTB 5CXSA 1DEAA 1UX5A 2W8ZA 2H17A 3LUAA 3IR6A 4L15A 1FVFA 3MCVA 4LK2A 1J09A 5K8VA 2FMFA 3N3BC 3OZXA 2G1PA 1JQEA 3KR0A 4ZT4A 4LF9B 4RY0A 4QKQA 1L5FA 3DE6X 5FBRB 1P1IA 3HCBA 2AG8A 4YJFA 3RVRA 4COOA 3SIXA 4ACAA 3GLTA 2QM3A 4DG8A 5AKHA 1IOZA 4B44A 3FSJX 4XWOA 2E4YA 4DR5B 1XCGB 2QZ4A 3NBAA 3CC8A 3A58B 1W93A 5TT1A 2Z4TA 2XMSA 2Q4BA 1TO2E 1C7QA 3ZR4B 2JZOA 3A2LA 3CONA 3Q3VA 4LIPD 4OUKX 3WGJA 3FWNA 5IC6A 3VR4D 1U2QA 4DV1B 3T3NA 3O4JA 4O4LB 5EIBC 2GYVA 5JPCA 1KEWA 1OOEA 2YQ4A 1PTJA 2ONZA 4J76A 3ET5A 3LFUA 1K8RA 3JQ8B 3M2PA 1J1ZA 1W35A 1GNRA 2BFCA 4XEHA 3JRWA 1S4QA 4IAOA 1NVFA 4QIHA 3G7UA 1MA0A 3TTSA 2AIRA 1ZBDA 1XZCA 1IHOA 2OXCA 2WYHA 3R2JA 4YGXB 1SC6A 2DPGA 3PPXA 4PYRA 3L7CA 5J43A 4GX1A 1OVMA 5EAIA 4DMMA 3V8BA 3HXMA 2V1UA 1CUGA 1MO2A 1QE5A 2FQWA 4BP3A 1QPZA 4HGPA 3WYNA 5CVJA 3WHIA 4ATNA 2V6BA 2CEAA 3PR3A 5K3EA 2I6QA 3PCXA 2JIBA 3GJTA 3V8NA 4AIRA 3THOA 3E9NA 1P7CA 3QWBA 1GARA 1GL6A 1MNQA 1Z5PA 1QYVA 3NHRA 4NWIA 4P4LA 4P38A 3I73A 3WDMA 1B0UA 4KQHA 4F91B 3OFND 4FI3C 4GMGA 5E8JA 5KDDA 3IQGX 3I2KA 1DRWA 4QLAA 5JS8A 4N49A 4DLRA 4CLXA 5KWIA 4KW7A 3SE0A 1C1HA 4C2TA 4OQPA 1VJDA 2X22A 4O4HB 4DYVA 3OIGA 4HQ6A 1GG8A 1NQXA 2O50A 4KR9A 4OLFA 2IS6A 1SFRA 1UF9A 4C4OA 4OJTA 2OL4A 2W2VA 1QU3A 1P2TA 2RK3A 3C6XA 3VJMA 1U0FA 3H7IA 4E3ZA 4DUZB 3CR3C 4QHYA 1JTEA 1QRDA 4RZHA 1NAIA 4G9EA 3H2JA 1RI2A 3QVGB 2HCJB 1D1QA 4CKBA 2WE7A 4YPFA 2J3KA 5EFZA 1CLUA 4P86A 3HN6A 2PGJA 4ED9A 1OWMA 2GN2A 5KNCD 4NOMA 1L7EA 4Q9AA 3DAFA 3K1AB 5CLQA 2ETXA 1AKNA 2XUGA 3CZAA 1C4WA 2I99A 4PCLA 3W4IA 2C4MA 5EWLA 2XA2A 1Q1GA 1SCIA 1Y9EA 3BDAA 3DDUA 3DTTA 1DINA 2RBKA 2YZ7A 3QH4A 4ZXFA 3WYAA 1EXDA 3WDKA 4YALA 4C7OB 3A26A 3O90A 1DKNA 2H1SA 3H3XA 2BTOA 1ZGJA 2OXTA 3GLRA 1RWQA 1YR7A 1YFZA 3HCPA 1BA3A 2QRLA 2Y2UA 4TPKA 5DYTA 5L7TA 1WM1A 3PG5A 3TTWA 4U0JA 4RL4A 3FKSA 3VKVA 1HFJA 2G6TA 5CB0A 1SVIA 1Z06A 2I6FA 1GGNA 4EELA 2QLMA 4WCFB 1YB5A 1XCLA 3GAFA 3KKMA 3ZXSA 2ZTMA 5KWJA 3QG5A 3N0XA 4EIWA 2RCNA 1XFDA 2F3PA 3T1OA 1L7VC 3X43A 5KVAA 5A4AA 2WA2A 1LLDA 4YA6A 3PYXA 1I0LA 4EG7A 4I55B 3VOSA 4IVNA 4GKVA 1RKBA 3GFSA 5EJ6A 4D9EA 3OJXA 2OXFA 4XWYA 5CH3A 3F0TA 1XEWX 4HDKA 4ER6A 1E66A 2JFZA 1LPPA 1NL3A 2GDZA 2JK0A 2C2WA 3KC2A 4OAQA 4KI0A 1RXYA 3U5ZB 2XMPA 3AG5A 4PZLA 2GN4A 2WLSA 4KXWA