3A4NA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
237
Chain Sequence
GDIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 93
structure length 237
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4nA01
3U2QA 3TAHA 3U7FB 1PVOA 4I4LA 3IGFA 4PPQA 2IS2A 1JAIA 1UPTA 3EC1A 3AVWA 2VHJA 1Z29A 2O8EA 4ITRC 3CH5A 5E7IA 4P32A 4BRWA 5L3QA 3N2EA 3QENA 2CNWD 1HTWA 5CLQA 2OFXA 4M9XA 3GLFE 5FL7D 1NY6A 4F92B 4DLUA 3OIWA 4M1MA 3NEJA 1L8QA 1G17A 1OXSC 2H1LA 2BKEA 1GNPA 4OHWA 4OHXA 4DZZA 4C2UA 1OXVA 1TX4B 2G0NA 1Z6GA 3HJNA 3U3RA 4F4IA 3OAAD 2XNSA 4I1UA 4AWXA 4A8JA 4TQ9A 3KQNA 1NSTA 2EFEB 4JLMA 5FTJA 4MKHA 2VBCA 4WXRA 4C7OB 4JMPA 2WV9A 4UKDA 2CL7X 2WMNB 4LBZA 5FTMA 4Q03A 1EFCA 1GM5A 3AKDA 1MO4A 2GAOA 3D3QA 4DDUA 2O8EB 1Z6YA 5A5GA 3IILA 1KGDA 4RD1A 2GETA 4Q7LA 4OHVA 2YYZA 4P4UA 3R8CA 2OXRA 1T8UA 3SYLA 1KMQA 3IDQA 5FL7A 3UXMA 2D2FA 1E1RD 1KI1A 1TEXA 1XMSA 4U02A 2DHRA 5KNBA 5EZ5A 3UWOA 1GRNA 2NO0A 4KYUA 4ZI2A 2H92A 4XOIA 1I4DD 3W6OA 1XB2A 1JAHA 3LVRE 2OBNA 1KSHA 2QAGC 4NH0A 1G3RA 1LV7A 3M1IA 1U2RA 2BCJQ 5AJWA 1GKIA 5GJCA 3RC8A 1VCNA 2WPDA 1JXOA 2IA5A 3KUCA 1IY2A 4A15A 3I8XA 4A0GA 2CVHA 4PHTA 3KKPA 1G7TA 2J7KA 3NBXX 5FBRB 2JIZA 2JJ1A 2JDIA 4K46A 1CJKC 4AYWA 4Q1FA 5UKDA 1OB5A 5JHHB 4CEHB 1P72A 1S9HA 2QT1A 4LV6A 3LBIA 4Q01A 4TYPA 5JWOA 4GPTA 1TUIA 4ILEA 3UMFA 2F1IA 1NVVQ 2GJSA 2ZVQX 2VSXA 1E4YA 3GLIA 3JZMA 3OEHD 1R4AA 4TSFA 4B48A 4CT4B 1E98A 1ZIPA 1O87A 3I32A 4NYJR 4BGDA 4F4CA 1TF7A 4TZ0A 1Q0UA 2C95A 1P2VA 2EVWX 3REGA 3AF3A 3MGCA 1ZRHA 3A1UA 1L4YA 1UM8A 4DJTA 1ESNA 2CCGA 4JYBA 2NO6A 2ANBA 2P5TB 1ZNXA 3PQCA 5FBWB 5KDLA 1JR3E 2Q3MA 3RC3A 3EASA 3TQCA 1RRPA 1ZD9A 2P65A 4PZLA 1H8EA 5TDHA 4UNRA 3H84A 2O8CA 4LBVA 3BE4A 2HYIC 1G6OA 2ZRGA 3RABA 4Q9HA 3OIVA 2HT6A 3LX8A 4NCIA 3UMSA 3BS4A 4X8LA 5HKKA 1E32A 4PO9A 3KQLA 4JLOA 2PX3A 1T3SA 4HLUA 4A0RA 1RPZA 2BC9A 3CLVA 4JLJA 2ZSAA 1SULA 1TPZA 4LJAA 1E0JA 3A4MA 3BRWD 1FMJA 1B0UA 4G5OA 1WBDA 4ZO4A 3DEFA 4UNSA 1F2UB 1ZVQA 1AKEA 1DAFA 1UFQA 1OFTA 1ZUNB 2FNAA 2IYLD 3GJXC 2HJGA 4DUGA 2ZRHA 1G8GA 5P21A 3TVDA 2FZ4A 2ERYA 1CR1A 2JATA 1OHHD 1XXHA 2I4IA 4QNMA 1IONA 1KO7A 2VHQA 1Q1ZA 1IXRC 2VPPA 5A0FA 2ZJ2A 5FOTA 2HV8A 1H8HD 1AK2A 1W0JA 5C4GB 4BUJA 4FD2A 3B1ZA 2MSEB 4NDZA 4KSCA 4YXWA 4B43A 2Z83A 4TLAA 3IPXA 3CBQA 5KNCA 1OXTA 1ZW6A 2ZI6A 1FUKA 3IO3A 1CXZA 2D7DA 5KTYA 4TMXA 3SZRA 2VEDA 3Q72A 3IHLA 3CRMA 2F1RA 4KV9A 5CITA 1E9DA 4BZXA 5LD2C 5KO2A 4V02A 1ONBA 1FNMA 1ZP6A 3CX8A 4D4JA 3AGPA 4WAUA 2J59A 1VYVA 4EFMA 1XPRA 4KAXA 1ESMA 4UNNA 2XJ9A 5IDVA 2CMKA 2XZLA 1NIJA 3SEAA 3B2EA 3E1SA 4V0NA 4ZCIA 4JKIA 5TV2A 2V1XA 1MOZA 5DISB 4BZPA 1T5IA 4C7OA 2NZJA 2YC2C 1T6NA 4TMTA 3GLGE 1UKZA 3UATA 1FW6A 4P4SA 4OQLA 5TXGA 4RCZA 2FSIA 1E9AA 2WKRA 4HZUB 2DWOA 2K5UA 3CRW1 1RJ9A 4A6PA 4D2IA 3ND9A 3QNUA 3U7HB 1NJGA 4ZDIA 3PVSA 4Q9KA 1YHNA 2KBEA 1M34E 3B1YA 2N1BA 4OK3A 5CJ2A 1UKVY 2CK3A 3DMNA 4RFSA 4HB3A 1E9CA 1QVAA 3NEYA 1ZJ6A 1A2KC 2IL1A 1I2DA 1KI3A 1WQ1R 1X8JA 3LLUA 3L2OB 3A6PC 3IEVA 2OESA 2QAGA 3MWYW 1KJZA 2FPKA 3GJ5A 2EQBA 3ADKA 1BKDR 2ATVA 2DFKB 2IBMA 4MH0R 1ZM3A 4QL3A 2J45A 5D3QA 5JEDA 3KQKA 3Q5EA 5HZHA 3KZ1E 4AI6A 4LZZA 1KI7A 1SVSA 3I4LA 3ZVRA 1ZD8A 5FOSA 5IK2A 5KSOA 3U6BA 1RFLA 3HR7A 1P2UA 3HDTA 3IIKA 3PUYA 2ZAOA 3NC0C 4B71A 3QXXA 5G53C 3FYHA 5SZIA 3BD9A 1KI6B 4QJ3A 3UANA 1SVIA 5J4YA 5KHOC 2BWJA 1AS3A 2H18A 2FGKA 3TKLA 4LI0A 1VHTA 2IYQA 3FMFA 1AS2A 1XJ0A 2VLIA 4M9ZA 4BLQA 2YC4C 2VO1A 3EIEA 5BYJA 3TW8B 1KZ7B 1T9HA 3K53A 5KDDA 3H2YA 1KK1A 2ZR9A 3SYKA 3KXLA 1TL7C 2ZU6A 5FPTA 4C0BA 1XD9A 1Q1QA 4OBEA 4B35A 1YVDA 2ZE8A 3VMFA 2BMDA 4OQXA 1NBMD 2AKYA 2QE7D 5HE9A 3SOPA 2OCYC 5AJZA 3VR4A 2WSMA 4LC1A 3ZVMA 4OKSA 5AUNB 2BDTA 4FMCF 2JCSA 1G4AE 2ZE5A 5K8TA 2WJIA 1KSFX 1P9WA 2F1JA 2X8AA 4L8GA 5EXSA 4A82A 1YJ5A 4HLUC 1T5LA 3EPLA 1E79A 1JECA 2RGAA 3IBYA 5DIFA 4C0SA 4MYHA 2ZRFA 4M8NE 3RSOA 1W2HA 5KSPA 4ACBA 1HYQA 2NQ2C 3RYTC 3WMEA 1FUUA 2ZJOA 3TH5A 3GLHA 1N0WA 3K9HA 3RHFA 3FMIA 3SDZA 2AK2A 2QM8A 3ECCA 4KITB 3QKSB 4G3XA 1R8QA 4MQBA 4Z8YA 1II0A 4R2IA 2BM1A 2VP9A 4JVSB 2KSQA 1E1QD 4YMUA 1QG2A 1R0WA 1E99A 2IUTA 2HT1A 1MR3F 1K8RA 2W6JD 2J46A 2ZR0A 5FI1B 1LVGA 1NN0A 2R8RA 4LJ9A 2CBZA 4XWAA 5EUQB 3BOSA 1Z6AA 1GRQA 2JLRA 4P4TA 3EXAA 3OF5A 3PUWA 4IVQA 2XEXA 4PC7A 4XSGA 3CNOA 4EPXA 2J7PA 1E2GA 1OB2A 1VPLA 2QPOA 2DFNA 4HYYA 1PZNA 4DIDA 3BAFA 3KQHA 2ZSFA 1CRQA 3GEHA 5EJEA 4RKFA 4BFTA 3LNCA 5CYOA 1SVKA 1XF9A 2IYWA 3FHOA 4HDOB 5GJVC 4B6FA 5L8VA 2O8DB 4YQFA 1Z6TA 2PT5A 3AGQA 3LA6A 1W46A 1P7CA 1YQTA 3N2IA 4Q19A 3ZD6A 1WB9A 1YZUA 2ZIAA 2F3RA 3RS3A 4YDSA 1HQCA 1KO8A 5EUMA 2J7PD 1JEDA 2OFOA 3MJRA 2OBMA 3UWKA 4LV8B 4AURA 4IDNA 4W7SA 1YZNA 1R2QA 1E9RA 1AN0A 2XOKA 1EFRD 3HU3A 1OH6A 3R9WA 5JECA 2BMEA 3K0CC 1JEEA 1NVUQ 1G4UR 2EYQA 4QC2A 3UKDA 5H68A 2J5XA 2HCBA 1D9ZA 3C16C 1U90A 3TUIC 4NMMA 2AK3A 2HDNB 1NY5A 3UG7A 2UKDA 4RFSB 4URXR 2NIPA 1R5NA 2J0UA 5JI2E 1TEVA 1W4CA 4A2PA 3U5ZB 4EQ6B 5GVSA 4URYR 4BEJA 1FX0A 2WTUA 1UAAA 1E2MA 3QY0A 2BBTA 2B8TA 3KJEA 3IIJA 5BW8A 5KUTA 2GCOB 521PA 4ZKEA 5HR5A 4Q1BA 1P6XA 2V54A 4OQNA 5BN5A 1F2TA 4NZYA 4V0KA 4TMVA 4JBXA 1E2DA 4EQ6A 3PUXA 1IHUA 4C3ZA 2V7QA 4QM6A 1XMVA 3BB4A 3ZVLA 2QRZA 2PH1A 1LY1A 3K09C 1N2CE 2O5VA 1A7JA 1EFHA 1XEWX 4MGKR 4HUQB 2G83A 5E7JA 3I92A 3FB4A 4QBFA 1E2HA 4F93B 1LTQA 4XH9B 2WWFA 1WCV1 4PPGA 1G8FA 5FUVA 1HUQA 1SHZA 1OHHA 2QQ0A 2CJWA 3T35A 2XZOA 3IPYA 3IUYA 1KMHB 3A1TA 3ADDA 2KI5A 4AD8A 1F60A 5KPDA 3QE0A 4Q1DA 1WRBA 3TSZA 1W4RA 1Z0FA 2MSDB 1L2TA 3EA0A 4HDQB 1TADA 2VP6A 2RGEA 2Z4SA 2Q21A 5KSZA 1AA9A 4KLZA 2H5EA 3AV0B 2JLXA 4B6EA 1SXJB 4Q4AB 1ZU5A 4MKIA 3QBVA 3SQWA 1GIAA 1H8ED 3H0KA 1J70A 3VKHA 3B9PA 4CZ2A 4BEBA 2ZSBA 4Q5IA 5CIWA 1G7CA 5FR2A 2ERXA 4RZUA 4B44A 2WVJA 1OYYA 2ZS9A 1DAEA 1SVLA 2GBLC 4GZMA 4AKIA 3IIMA 4M9SA 1E2PA 5FUXA 1XMIA 5FOXA 5K8LA 1IJFA 2G0TA 2AWNA 1G5TA 1KTVA 3Q7QA 1EESA 4PSKA 1Q3HA 5DH9A 1IAQA 3OEEA 4PHGA 1WA5A 4JT2A 1OYWA 4HB4A 1D9XA 2PZEA 5F9HA 4AKEA 1II8A 2ZRIA 5BWMA 1DADA 3QKRA 2WAYA 1CF4A 2PX0A 1NF3A 2DFLA 1G1MA 1S96A 1W47A 2JJ2A 4NYMQ 1VECA 3EZFA 1RC8A 5J4VA 2YOFA 4CVNA 3H4MA 3GLIB 1YU9A 2XGJA 4PC3A 2V9PA 2JA1A 1Q57A 2ZPTX 1BS1A 3MWKA 4TTPA 2BMJA 4MGIR 2AD5A 5JEEA 3AP1A 1XD2A 3V4FA 2FX3A 3Q9LA 3ZLJA 2H17A 2AD1A 2FPLA 1E2LA 2VP4A 4XTCS 1G16A 3DKPA 3PJRA 1N6KA 2O0JA 4IRUB 1DAGA 3ZIAA 5FOVA 2QA5A 2P6RA 1KMHA 4HEJA 2Q9AA 4ASUD 1KKMA 3E5HA 2RHDA 2ZI4A 1YR9A 3AP2A 4EPRA 3S1AB 2B7CA 5JRZA 5JS8A 4ESHA 2V8OA 1FX0B 3CONA 4HLCA 2ORVA 2ZS7A 2EFHB 2JLQA 1LW7A 1SKQA 4MUBA 2OG2A 3QBTA 1RE0A 1SQ5A 3NTUA 3JVUA 3ZGXA 1VCIA 3SBEA 3LVQE 3EX7C 4TSFD 4QBHA 2GKSA 3AKEA 3VFDA 2OV2A 1YR6A 1IM2A 3ZD7A 1IN7A 2GESA 1LNZA 3PIRA 1KAOA 4JKYA 3REFA 1YRBA 4XJXA 1BO6A 1AIPA 2IEZA 2XNDA 3WHKA 5KNDA 1DOAA 2V1UA 1ZM4A 3TRFA 2ORWA 3L0SA 4IHQA 3CR7A 3CX7A 3B82A 3LD9A 3OE7D 2RGGA 1OV4A 2NG1A 2VL7A 4QRHA 2NMVA 1T3LA 4A92A 2R6GA 1KKLA 1T91A 4QHTA 5EXTA 1GL7A 3SFVA 3TSOA 3K70C 2GEUA 1N0VC 1COWD 2E9SA 4C0AC 2OXCA 1N5IA 1FP7A 2ODWA 2JLVA 4Q7MB 3NXSA 2D74A 1GSIA 1S8FA 2QP9X 3N70A 4TMWA 3SE0A 4M53A 4RVCA 1W44A 4Y0VA 5GJWC 1ZU4A 3C8UA 1JQLB 1NG9A 2OCPA 4IEIA 3T06B 2NGRA 1NG1A 4EPWA 2J0VA 2A3RA 5KDOA 4P0TA 4KFUA 2IS4A 4RD3A 4C9BA 3B5JA 3BWDD 2ZUCA 3VAAA 2IUSA 2ODNA 1GOTA 1KNXA 1AJEA 4W5WA 3KB2A 5CDFE 1H8HA 3AP3A 4RKEA 4NYIQ 2PMKA 4LHZA 1P2TA 1YRAA 3BFVA 3LO5A 1YZQA 4D0LB 4M1SA 1NNEA 5LB4A 2XXAB 3A1WA 5SZKB 4QKQA 3CF0A 4UQOA 2YHSA 5FOUA 2ZR7A 3L82B 1XCMA 3F0TA 1U8AA 4D81A 3D7MA 1ZCAA 4CIDA 2J9RA 4MDFA 1R0ZA 4C2TA 4FWTA 5CB6A 3AVUA 1Z63A 4CEIB 3LBNA 4AKGA 3QG1A 4JL8A 1XTKA 4HDCA 4MYUA 4B3DA 1JJ7A 2W00A 4A0FA 2GXSA 2G9NA 4LUCA 3KFVA 5AUPB 3E70C 1N6OA 3K70D 1CU1A 5EP4A 1HY3A 3L0IB 1G7SA 3EPHA 3FMPB 1U0JA 1VMAA 4WZ6A 3SHFA 4M1YA 3ZJYA 3AB3A 4TN1A 4DRZA 3RS2A 1KY3A 1UKEA 1SGWA 4GI7A 4W5JA 4GMDA 3WYFA 1E0AA 3TUJC 4JLDA 5DN6A 2Z5FA 4OI4A 4ASUA 1X8KA 3U61B 4B2PA 2ZXUA 3I1FA 2EFGA 2JJ1D 2J0UB 4M1WA 2RCNA 4US0R 2IW3A 4BLPA 2DYKA 1G3QA 2LCFA 3DL0A 4ARZB 1KYIA 4NCJA 2P0EA 3W90A 1GRRA 1YR7A 2FF7A 4KHZA 5FBLB 4R71A 1GKUB 4H1UA 4BPBA 1G8PA 2VHTA 1Z2AA 1E94E 3S1AA 1X3SA 1KDPA 3WHLA 2O8DA 2HEIA 3HYRA 3EPKA 1X1SA 4A2QA 3AF1A 4V0OA 4Q9LA 2RMKA 2D4HA 2OCAA 1YZGA 3CX6A 3X1DA 1PLJA 4IFBA 4B75A 4KBFA 4JYCA 3AKYA 1NVVR 1CJTC 2FU5C 3LQQA 3QIAA 1CEEA 1IN5A 4XIGS 3QKUA 5JSZA 3AVYA 1KI2A 5D3MA 3OEED 2L0XA 3GMTA 4HI0E 4URWR 4H1VA 4LC0A 3EWSA 2AL7A 4TTRA 2ZRAA 3DZ8A 5EE1A 1ETUA 3R7WA 3GFOA 1M6NA 2AHOA 1DAIA 1S4QA 4MRVA 4Q1EA 1QHIA 2ODBA 4JZKA 5FUWA 1I4LD 4N0DA 1B23P 2E1RA 2DB3A 2C2HA 4UJ3A 3SI7A 2H57A 1FL9A 2A30A 1S2MA 3VU9A 3CWZA 4LYHA 3RRNA 2R6AA 1R6BX 2ZYVX 2H7VA 3QKSA 2QQEA 3RRYA 2XSZD 3FTQA 5DSZA 1DE0A 4C0KA 3OEHA 3HWSA 2ZITA 1G21E 1GILA 3Q8XB 2ONJA 3EZ2A 3BGWA 1R8SA 1A1VA 1GFIA 2QG6A 2WJJA 4JVNA 4WXPA 1Z5ZA 4XWOA 5KU1A 5F9FA 4BE7B 5FPSA 2X1VA 1QF9A 4H9GA 3BB1A 4Q4AA 2WHXA 5ANRB 3ZIAD 2OSBA 2AN9A 3VTKA 5BYKA 1W5TA 1ZYUA 3NH6A 1N3BA 1JR3A 1ZAKA 1Q1EA 4AG6A 4HAUA 5AUQA 4W9MC 2R9VA 3LV8A 1P60A 3ZZUA 1OJLA 3A4LA 1DO2A 3LXXA 4PQFA 2XTZA 3BB3A 4UJ5A 4EKDA 3O8RA 3CWQA 4L9WA 2CLCX 1Y3AA 2RGXA 4A1FA 4KSBA 1K5DA 2OCBA 4RZ2A 5IRCD 3SYNA 3K0CA 1E1QA 2F43B 3QQ5A 1CJVC 1MRSA 4MUAA 4PAQA 2JASA 3BH7A 3KTAA 3T15A 4NKRA 1NRJB 3DM9B 1K6MA 2JIZD 4C4PA 2JJ2D 1P2SA 2E87A 4MRRA 4M0LA 3HPRA 3U7EB 2V7QD 1NIPA 1G5RA 3C4JA 1GITA 3P32A 2CJWB 4C30A 5J4LA 3C14C 1R0YA 3V9PA 4IOJA 3SC3A 2PLFA 4KFRA 2GAAA 5DGXA 5DNYB 4TYWA 4IJMA 4KLNA 1QHHB 2PLRA 3EZ7A 4AC9A 4ZIRA 2QZ4A 2P3SA 1S0UA 4GMXA 4BFSA 2GBLA 4N3NA 5CM8B 1E6CA 1XTIA 1UADA 3AF0A 5J5CA 2JLZA 2G1JA 4XVQA 3QPVA 3RLFA 3WYGA 3E2IA 1XNJA 1Q20A 3AUXA 4EPYA 1Z8FA 3PFIA 1KDOA 1ZUIA 4QJ5A 4WIAA 1XP8A 4G5RA 1EWRA 1UBCA 4WZAE 5HE8A 2Q3FA 3LFUA 4FMBB 4JS0A 1EG7A 2HLDD 3R7WB 4FN5A 4Q7KA 4OQMA 2A5FA 3NBZC 3P4XA 3MMPA 1W1WA 4L16A 2A5GA 2WWWA 3A1VA 4NE2A 3QPWA 3C15C 4CEJB 4RCYA 3GLGB 3U4QA 3C41J 3WMGA 4AYXA 3LX5A 2ZROA 2WJVA 1WMSA 1ZNWA 2ZRLA 2CE7A 1S1CA 4LJ8A 4OI1A 5LBIA 4DDVA 2QL6A 1SKYB 1H65A 1IBRA 4NONA 3THXA 2XXAA 3IO5A 2H16A 3T1OA 1TMKA 4DSTA 5G41A 3OHMA 3FGNA 5ELXA 4EFLA 2V3CC 4PTLA 4F4JA 3PENA 1OXXK 2Z43A 3V4RA 4X8HA 2FZLA 3NIBA 4YMTA 1ANKA 4DB2A 1G18A 2V4ZA 2WMOB 2PJRA 1DAHA 2BIFA 3MAAC 2QTFA 3QXHA 3AVTA 1A4RA 1M8PA 5KSYA 2F9LA 1QHSA 3IKJA 3BXZA 5AUOB 1U8YA 4M22A 1F3OA 3AQ4A 3HYTA 1RRGA 4IDOA 3EC2A 3WXMA 1E2QA 1FTNA 4LY6A 2OO7A 1IXZA 1J8MF 5J4HA 4QGGA 1O3YA 1CP2A 4G5GA 2VP0A 1KOFA 4JT4A 3NDPA 3O47A 1OIWA 1JR3D 1VCOA 1N5JA 2WJGA 4N0EA 5K8IA 1AKYA 5EE5B 8OHMA 2OLKA 2QUZA 2JLUA 1JR6A 1IN6A 2WIAA 1NMYA 3KDSE 3VR3A 2MMGA 1J90A 2ZVPX 2Q9BA 4YDHB 3CNNA 3VR2A 2C78A 3FFBA 2FOLA 4LJ4A 5H70A 3MD0A 3SJBA 4UNPA 1NMXA 3IQXA 3ADBA 4BFZA 5EE3A 5BQ5A 4CYMA 3NDBB 2CXXA 4US1R 1GDDA 1SVMA 2QSZA 1EFRA 4HUTA 2VA8A 4ABYA 3DO6A 1SVOA 4HAYA 2PCJA 3HP1A 4D26A 3Q85A 1V5WA 1QHNA 4TWZA 1X1RA 3FKSD 2JLSA 1MO3A 4YONB 2FFAA 4DEXA 4DXAA 3B60A 4NTZA 3R9IA 4JLBA 3J81k 3WRXC 4A8JC 4LDJA 1LF0A 4RY2A 1R10A 4IVPA 2VP2A 4A36A 1XCPA 4URVR 1HE1C 2EYUA 1ZD1A 1NLZA 1HT1E 3JVVA 2Y8EA 4JL6A 4QGFA 5FPYA 1XXHB 1U0LA 2ZE6A 3U4QB 4DSUA 1KO4A 5L3RA 1ZM9A 3UPUA 3UK6A 2QY9A 4JVMA 3KB1A 2D7CA 1T0HB 2IUUA 4ZDJA 3BH0A 2QORA 4IVRA 1NI3A 5TY0A 1J2JA 3MCAA 1ZINA 6Q21A 3GLHE 4GL2A 2KBFA 2QAJA 2GJ9A 3CR8A 3KUDA 1IY1A 3RNLA 1D5CA 2DY1A 3TK1A 4CT5A 1KI9A 5E95A 2F55A 2GEDA 4LBWA 4Q7JB 5L3SB 3ONWA 1G8YA 3W5JA 1P9RA 1DVRA 4OI2A 1W4AA 3NC1C 3TIFA 4M1KA 4TQAA 4PPNA 5AJXA 1II8B 2BBSA 3GLIE 1R5OA 4OHZA 1NN3A 4KCGA 1HEIA 3HPQA 1Z0KA 4RFVA 1SHKA 1YR8A 3KKNA 1GTVA 2AKAB 2FSGA 2VSOA 4MGZR 1C1YA 2VSFA 3LLMA 1OFUX 3P4YA 4DKXA 5FH9A 4LJ6A 2RGCA 3KJIA 4EPVA 5LPNA 1GG2A 2IC5A 2X2FA 1Z28A 4HAXA 3H86A 3PR1A 3IQWA 3OAAA 1W36B 5TB5A 3U3KA 1NJFA 1TQ6A 2B7BA 3T34A 4EJSB 2W2VA 3RANA 5DHFA 3KTAB 2CHVA 5FBQB 5EP1A 1DAKA 3T61A 3QSYA 4DSNA 5JI3E 2FV8A 3PUZA 3U3JA 1VTKA 1XTQA 1Z6XA 4TL8A 1CR2A 2JLWA 2O0KA 2WOOA 2ZRNA 4O0MA 1VG0B 2ZRCA 4P31A 4D6PA 3FFAA 2ZJ8A 3THWB 2A2ZA 4KXFB 2AXPA 2IHBA 1EFTA 2P67A 2WPDD 4ZDWA 4GBMA 4NBSA 4CRWB 2YWFA 2G3YA 4QNRA 2QGNA 2W6JA 3LW7A 4LPKA 1ZCBA 1SXJC 1P75A 1NLYA 3VQTA 4DSOA 1XXHE 3CIOA 4YMVA 3FWYA 3T12A 1GZSA 4NYMR 1W0JD 2FFQA 3W3ZB 3EG5A 3P26A 4GOJA 2J3EA 3GJ3A 4FIDA 1VG9B 5EE9A 2IT1A 1Z47A 1I2MA 4PHFA 4DIEA 2IYRA 2XTMA 1KDTA 3FDIA 3B1XA 2REXB 4G01B 2O8CB 4JJZA 2CCJA 3GJ7A 1FTSA 1JNYA 2RGNA 3I5YA 1E9BA 5HZKA 3QKTA 2D2EA 5JFGA 3QXSA 3LW8A 4LHVA 3K8YA 4DLZA 5F3WB 1Z2CA 2GXUA 4O2RA 3OESA 1U99A 1WF3A 3THXB 5GADl 2XOKD 3LH5A 2NO7A 2OZEA 2R6FA 1K5GA 2D3WA 1GP2A 5DLQC 4GZLA 4BFUA 3WNDA 2O52A 1KI4A 1J7KA 3SJCA 3QXJA 2GJAA 3AM1A 3C5HA 3FE2A 4Q48A 4EIWA 2GXAA 4B3GA 3W34A 1GWNA 1JALA 1XX6A 3K0FA 4ZKDA 1NN5A 1WE2A 2W83A 2OT3B 2UZIR 2W58A 3SU8A 5FR1A 4DEYA 2WKPA 1Y63A 5JMTA 3UMRA 3RVBA 2C03A 3AKCA 2GCPA 4DLSA 2W0SA 5HPYB 1TQ2A 2VF7A 3A1SA 1C4OA 3GFPA 1CJUC 4OQFA 2QENA 2JLYA 1MKYA 1TAGA 4OJKA 4XVRA 3G5UA 4PHHA 3MSXA 3OIYA 1G3IA 3AH8A 4YMWA 2VRWA 1W5SA 5IK2D 2ONKA 2F9MA 1HE8B 5L3VA 1OPXA 4RSGA 1OIVA 2BEKA 3KXIA 5DYIA 5BN4A 1DS6A 1M74A 2IF2A 2RGDA 2ZU0C 1VKJA 3B8HA 4DC9A 4TTQA 3CF6R 2V6JA 2IS6A 3R20A 4Q1AA 4Q4HB 5DI9A 2ZSDA 1CS4C 2IYTA 4DCUA 1D8TA 1UJ2A 1Q22A 2SHKA 1SKYE 4MDEA 5DYGA 3CM0A 2B8WA 1EX7A 1KO5A 3CRVA 2CNWA 3RWMB 3A4NA 2W2TA 4A8JB 3A8TA 4GFDA 4FMDB 3DPUA 2ZAMA 821PA 4KBGA 1P73A 1OFIA 2NOAA 1WP9A 1N25A 3X1WA 1JB1A 1KDRA 2ZRKA 2YNMA 1CRPA 3GLFB 2HF9A 3U44A 1EGAA 1LB1B 4FW9A 1YZKA 2LKCA 3P20A 1MV5A 3O8CA 1UKYA 3O8DA 1FQJA 4M1OA 1HA3A 1VYTA 1XJCA 3KKOA 1TNDA 4PC1A 2OLJA 5DE3A 3ZH9B 3AVVA 3D6TB 3K9LA 3ICQB 2KWIA 1VG1A 5F98A 2GTPA 4LOAA 2BCGY 2ZEJA 4HUQA 4IOLA 1LFDB 4W5HA 2Q0HA 2YKGA 4LRWA 1QZXA 4JSYA 4PZZA 3THYA 1CLUA 2W6IA 1QG4A 3U60B 4Q00A 1JI0A 2CL0X 2D06A 3PEVA 5B57C 1XMJA 3SFZA 2A5JA 3K70B 5CK4A 2C77A 5CLLA 1KJWA 4IDQA 4LSGA 4TMKA 4GOXA 5EE0A 2XB4A 4L5BA 1W49A 4TLDA 2V55B 3TLXA 2Z0MA 1D2EA 1UDWA 1N6LA 1FQKA 5J40A 3K0FB 1NLFA 1OH8A 1S1MA 2IYSA 1SXJA 1U9IA 3KX2A 2EFDB 3WBKA 4CGZA 3NG1A 5L3SA 4XVUA 1VIYA 2XSZA 2YWEA 3D8BA 1AS0A 2QU8A 3TJZA 1S3SA 2V6IA 2BJVA 5CJPA 1C9KA 1CKEA 1W36D 1RW4A 3VR6A 3QVUA 1LF5A 4Q4JB 5AR1A 4ACAA 1OFHA 1PUIA 3X1XA 3ASZA 2XNDD 4JSTA 1AGRA 4B47A 1ELOA 3WRYC 4B76A 3L0OA 2AFIE 3U7GA 1YKSA 4JJKA 2WJHA 1IY0A 4FCWA 4Q4LA 2Q6TA 4BLRA 3CZPA 2J0QA 2VH5R 5F2EA 3KL4A 4L15A 4HLQB 4FI3C 3HU2A 3GLHB 4TYNA 1PJRA 4HB0A 3KFXA 5FTNA 3VR5A 5K8UA 1RRFA 3K0AB 4HAZA 4B34A 4C0JA 2FSHA 3T1VA 1ODFA 2HXSA 3F5FA 4MRPA 2B6HA 2MSCB 3KKMA 4QFMA 1SZPA 2A5YB 2DWQA 4R9UC 4FMCB 5C4MA 5JJIA 4EJSC 1BYIA 2GZDA 4KO8A 5HCNA 1QRAA 2ZJ5A 2OE2A 3NWJA 1N6NA 4LYFA 2HUPA 2N42A 2HJVA 3AVXA 5B58C 4TQUS 5IHPA 4MGYR 4V0ME 2REBA 1JQJC 1RJ9B 4IXNA 2P5SA 4Q66C 4E07A 2O8FB 4KVGA 1A82A 4KYIB 1JPNA 1E96A 2W2XA 3K9NA 1GKYA 1J8YF 1WXQA 2BV3A 2LKDA 2F3TA 3QJYA 1S9DA 1BMFD 1OLOA 3U3OA 5AJYA 1U98A 2IXFA 4HATA 3QI2A 3WP0A 4URZR 2CHGA 3AVQA 2IXGA 1F5NA 4PAOA 4IDPA 4D0GA 1TQ4A 4NP6A 5JCZA 4KVAA 4P33A 3NBYC 1NKSA 1BYUA 1PUJA 2AWOA 2FFHA 4JL5A 2ZUBA 4UXHA 4DT1B 1UBEA 2PL3A 1Z0IA 1KAGA 3GFTA 1VIAA 2QROA 3BIFA 1RVDA 3DHWC 3HU1A 4LYJA 4O2LA 4Z54A 2P2LA 4AKHA 3CPJB 1XCGB 2G1KA 3CRRA 1DO0A 1J99A 2F6RA 4ON9A 2QI9C 1N6IA 2ZRBA 3DZDA 3VX3A 5D3MB 3RS0A 4HAWA 2BVNA 3FHCB 4QHSA 4Q9IA 5FPHA 4DB4A 2DBYA 3K09A 3M0EA 4HZIA 3W6NA 3TNFA 5FFMA 1G3UA 1M7GA 3B1VA 4TLCA 4F38A 3W5IA 3TGPA 1E79D 1US8A 3QUSA 4DVGA 4N1AA 2JEOA 3DM5A 4Z51A 2WWGA 2G77B 4D4MA 5FOWA 5C1BA 3QEOA 2PMDA 2AXNA 2QMEA 4LBYA 3X1ZA 5E4FA 2WWIA 2Z6VA 2AX4A 5AJVB 2ZRDA 2ZI9A 3TUZC 1UEJA 3F3YA 2XX3A 2IWRA 2IS1A 3UG6A 3HR8A 3EZ9A 3RDPA 1OH7A 2N46A 4PAMA 4LCBA 2QPAA 1P9NA 2IYXA 5KYKA 2I1QA 3B6EA 1U9IC 1R7RA 4IKEA 4WOPA 2XZPA 3THOA 5E7MA 2C5LA 1MO5A 1OW3B 1AM4D 2MMCA 4RZXA 4EAQA 3AVOA 3MWLA 1EXMA 1JPJA 4PANA 2CEAA 4WA7A 4GOKA 3SNHA 4UNQA 4L9SA 3SHWA 2ZI3A 1RYFA 1ZUHA 2J1LA 3QVVA 4YLGA 4PX9A 5TVKA 1AGPA 2FJUA 4G0NA 2P6NA 1UF9A 3U44B 1E69A 2QP4A 3C7KA 2WAXA 4YXWD 1RKBA 2ECKA 3TVTA 4I1VA 3ASYA 1XRJA 4LWZA 4LHWA 5CYPA 4L4UA 3ICEA 1KO1A 5JSZB 3VNUA 5DO9A 2WOJA 4KI0A 1XPOA 1G20E 5JCPA 4DDWA 3I72A 2QN6A 3AEZA 4UXIA 1MT0A 2GVDC 1DELA 4II7A 4Q21A 1KSJA 5G40A 2BEJA 1FMLA 2PBRA 4DLVA 3K0AA 2ZETA 1T8TA 2PZFA 5KOYA 5TMPA 4Q18A 3G82C 4EJSA 4FWIB 1T0JB 3ZYCA 4YMSA 421PA 4QJ4A 3ZS9A 1W0KA 3TAUA 1E2IA 4GRAA 2HXYA 2B21A 3I3SR 3W8RA 1PLKA 3C5CA 1N6PA 4EPTA 4ZV4A 2EFCB 1QBKC 1MABA 2WWHA 3CW2A 1XPUA 2VHCA 1EX6A 2GCNA 4WBSA 3SN6A 4AG5A 2HLDA 1QHYA 2C9CA 4PSVA 1E4VA 1N6HA 1WDTA 221PA 2R65A 4MKFA 3DMDA 3WNBA 3P1JA 4LJ5A 2KB0A 2VF8A 4HLDA 4DUGD 5M04A 4WW0A 2GZAA 3A58B 3WY9A 1WBBA 4B2IA 2ZE7A 2KJQA 2GHIA 1N5KA 3CB4A 2O8BA 2QT0A 4A4DA 3K9GA 2PZGA 5HTKA 3B7GA 3W6PA 1G8HA 5B30A 4KODA 3ZS8A 4TLEA 4OL0A 2TMKA 2IX3A 3LY5A 4EUNA 4PSAA 3GD7A 2FG5A 2ASEA 4R98A 4E22A 1QHXA 4NCHA 2NO9A 3EWAA 1OXUA 3G0HA 1GL6A 3BC1A 3DOFA 1BMFA 2QGZA 1E2FA 1IN4A 1S3GA 2VIIA 3KQUA 2WSSA 2PJZA 5A4JA 4EFNA 4NCNA 2EW1A 3LBHA 4E03A 2GJKA 3QF4B 3U6KA 2EWWA 2FSFA 3U3MA 1NP6A 4GP6A 1CR0A 1OF1A 4G1UC 4XD7A 4A9AA 3TR0A 5GJBA 1XTRA 5E3HA 5HCIA 4GT1A 4B2LA 5FTLA 5BN3A 1AZSC 4TL6A 4TMZA 2WICA 1CR4A 5BXQC 4HAVA 2I3BA 4XSHA 4MKGA 2ZJYA 1XWIA 2WIBA 4OHYA 2GNOA 4U5XA 3GEEA 5EP3A 3B13B 2OUKA 2F43A 2QMHA 1CULC 1FZQA 1AZTA 2GCOA 2IWHA 1U8ZA 2FWRA 1OKKD 2DR3A 5JS7A 2ZRPA 1TU3A 5KPJA 3GQBA 4S35A 4B32A 2WM9B 2RHMA 3TR5A 2C8VA 4QG7A 1VHLA 3VKWA 1KZGB 1Q21A 2JAQA 1U81A 1KSGA 4AK9A 1BH2A 1I4TD 1G291 5CK5A 4DLRA 5FBVB 4UXJA 1JJVA 4PR0A 3GP8A 1KNQA 2GF9A 5CM9C 3L8YA 4HSEA 2A7QA 1EFUA 3EARA 4RD0A 5AK0A 3LQRA 4ARZA 4ERNA 1G41A 4LHXA 4FINA 4O25A 1JBKA 3T5DA 2QPTA 1DBSA 1TF5A 5JWHA 4U00A 2GVZC 4DBLC 4DCTA 1M7BA 4M4SA 4US2R 3LXRA 3KXKA 2DFTA 4R2HA 2G88A 2VTKA 3A37A 4P3YA 5SZHB 1RIFA 4DLYA 4LX0A 1OH5A 1KIMA 2YWGA 1SVWA 4KJZA 4B3BA 2XITA 2GDJA 1D6JA 2A78A 2IF0A 3MFYA 4QHYA 3WP1B 1P4SA 1XEXA 3AUYA 3VHLB 2RKOA 1DAMA 1NSFA 1M1YE 4NCKA 3H1TA 2QBYB 1N0UA 4ZI3A 2BHRA 2OILA 3BORA 4LJYA 2XAUA 3W3AA 1EWQA 721PA 3TE6A 4DWJA 2QNRA 2ANCA 2VHUA 1UBFA 3CPHA 1KI6A 1KHTA 1FP6A 2ZSEA 3MG9A 4CEJA 3QPUA 2CVFA 4AYTA 5CB8A 4OK5A 1NBMA 3AF4A 4I1SA 1L7VC 5FTKA 2ODEA 2GK7A 1IN8A 2ZRJA 4WZBE 4ESVA 1CBUA 1XZPA 2QSYA 1GNRA 5JJKA 1E9EA 2QMUA 2QM7A 1NN1A 2Q9CA 2QBYA 4IEEA 3QF4A 4BZQA 3NH9A 2R44A 1SXJE 4IOKA 5EQTA 2YOHA 3I8SA 4DLTA 3ZQJA 4X8OA 4DT1A 4Q4HA 5JBQA 3BERA 1E1RA 3BJIC 4Z1MA 4NYIR 1II9A 2PEYA 4NHOA 2GZHA 4QBIA 2WWXA 3BK7A 3PEUA 4JLVA 2OHFA 4JIMA 2OFWA 3EA5A 3ZZ0A 4PO8A 2QRNA 4V0MA 3RWOA 1W2GA 5AWFC 1MO6A 2D62A 1W7AA 4FCVA 3Q5DA 1KY2A 1X6VA 2RGBA 4BQSA 2NZ8A 3CZQA 1ZBDA 3IBGA 4Q1CA 3R9XA 1NVXQ 4MITA 2JDID 1U0HC 1Z06A 4LPSA 5CIQA 4G5QA 4ZCMA 3B78A 4B3XA 2YWHA 3DDCA 1ZC4A 4NL4H 3GJ0A 4BFWA 1IOZA 4BLOA 4U7DA 3THWA 3NHBA 3O8BA 4OI0A 2FH5B 1W48A 3WMFA 3L43A 3MLEA 1U94A 1XD2B 1HT2E 4NYJQ 2GA8A 3B1WA 3I5XA 3N5CA 3OZXA 4Z1MD 1XTSA 1F2TB 3TBKA 2ZJZA 2QMOA 2XB2A 4TYQA 2J87A 1V43A 2JJ8A 1XEFA 1GNQA 3UIEA 2LWIA 1YZLA 2XTNA 1XU4A 1XBTA 5L3QB 1XEXB 2JGNA 1F6BA 2F1HA 2GK6A 2WKQA 3W8NA 1OE0A 3TSWA 5C46F 3CPEA 1G3MA 3I61A 3NBFA 3PG5A 5FPKA 3NKVA 1VG8A 3ZQ6A 4I99A 3EIQA 2VP5A 4JVLA 4MYTA 4Q47A 3BFKA 1AQYA 1TQDA 4NPHA 4B3CA 4JBYA 2IHYA 4QBGB 2QEQA 4E5UA 3T1QA 1FFHA 2XJ4A 3OFND 1DARA 4AY2A 4IW3B 1KK2A 4QGAA 4DHEA 1KI8A 4CDGA 2GWHA 3RAPR 4RD4A 3W9YA 1IJEA 4MRSA 5SZJA 2FE4A 3GJ6A 3F8TA 3L0PA 4BFVA 2W0MA 4C0HA 3CF2A 3Q7PA 3X2SA 2R62A 3BH6A 4BRUA 3OFNA 3FPAA 3PEYA 3VKGA 1OSNA 4I81A 2BM0A 1E2JA 2AFHE 4OYHA 1XD8A 1KK3A 3QEJA 4JLPA 3LAWA 4JLKA 4IXMA 4D0NA 4JLNA 3MWJA 1W0KD 2VYFA 1Z83A 3PITA 2WSSD 4F7WA 4LV5B 1Q12A 4RD2A 3B85A 3BBPA 2IYYA 1FOEB 1ZIOA 1XZQA 3AVPA 2ZYUX 3ZZTA 5IF9A 1KJYA 1DEKA 4EDHA 2IYVA 2YZ2A 4I1OA 2BKUA 1D2MA 4D82A 1D2NA 4BASA 1FNNA 3MJHA 4RJLA 3EAQA 1P61B 3TMKA 2REOA 5DHAA 1QHHA 4OJQA 2Z4RA 4A0HA 4D4KA 1XFAA 2FEOA 1BOFA 3AF2A 4XWKA 1M7HA 1BIFA 3P27A 4LGMA 2X19A 4M2LA 2CDNA 3DOEA 1E3MA 1XEWY 5H1YA 3GEIA 4GNKA 3CO5A 1Q1BA 2AR7A 2GXQA 4TL7A 1E2KA 3ZDQA 2CK3D 4Q4JA 4YC7A 3SBDA 2O8BB 3GJ4A 5B64A 2CLDX 2C9OA 2IXEA 3CKLA 4D80A 2NPIA 4DLXA 1OT3A 3L8ZA 1QHGA 2ZJBA 4TZ6A 2ZQ5A 3ADCA 2EWVA 4FMDF 4PZYA 3OIUA 4DDTA 2GRJA 1T3HA 2O8FA 2FEMA 1Z0AA 3FOZA 1R0XA 1VYUA 2DCUA 1F48A 2R2AA 2RB4A 3WYAA 2ZI7A 2YOGA 2ZTSA 4B33A 2BOVA 1CTQA 3VR1A 3K1JA 4M9QA 4S2EA 1GL9B 4QM7A 1T4GA 3GCGA 3BFXA 2WBLC 4M21A 1TTTA 4K8OA 1F2UA 4WVFA 3PXGA 5IT5A 2FA9A 2OEPA 4E09A 2BMFA 3DKVA 5FI0B 3D31A 4URUR 3FMOB 3QOFA 1N6RA 4MRNA 2RAPA 2Q3HA 2YVUA 1NL3A 3LRPA 3WBJA 4ZIRB 1HH4A 5EXPA 2PEZA 1PLLA 3EZ6A 4KU4A 2KE5A 4Q9JA 1MRNA 1ZC3A 2ZRMA 5J4KA 1HQYE 2FPMA 3QKRB 3R8FA 1OKKA 1A5TA 2GF0A 2QAGB 3EW9A 3IEUA 4MYCA 2CCKA 2CHQA 1XTJA 5C2JB 2G6BA 4C0QC 2OAQ1 1Z22A 3FKSA 1X8LA 1ZM7A 2C9YA 4A6XA 5HKKD 1E0SA 3X1YA 1G19A 5H8WA 2R6CA 1G9XA 4NU0A 1VCMA 3QF7A 4PC2A 5DI3B 3SS8A 4DCNA 1E0KA 4LYAA 4GSYA 2OBLA 4ZCLA 3GJ8A 3CH4B 3T5GA 4D25A 4Y0AA 5LB2A 1L4UA 2YV5A 2VQSA 2BBWA 1E2NA 2ATXA 4D4LA 1G64A 1QDEA 3GLGA 3PV0A 1M2OB 1TU4A 1Z0DA 2F7SA 4PPFA 3A36A 1W36C 1Z0JA 2NTYC 4XTRA 2ZM5A 1Z08A 1E9FA 3K0SA 1E9SA 2FGJA 3M4YA 5FL3A 4DLWA 1P5ZB 2J41A 1IXSB 4IDHA 1DPFA 4RZ3A 1HURA 2WJYA 2ZI5A 4BFXA 4TLBA 2OM2A 2PCLA 4B3FX 4PQRA 1W4BA 2P6UA 5B2ZA 4CW7A 4OK6A 1NKTA 2B92A 1CIPA 3TQFA 5JZVA 5LDDC 2GILA 3RRMA 2J0SA 5GVRA 1KK0A 1IQPA 1MABB 3EPJA 2C04A 3OE7A 4LK2A 3VHXA 1AQUA 3THYB 2UZ3A 1G7RA 4Q02A 4PFSA 2CLSA 1N5LA 5JRJA 4B73A 4BFYA 2DWPA 3RSLA 1DG1G 5EP2A 3SJZA 2ZJAA 4ZPXA 5CDFA 2X2EA 2H8KA 4FCTA 2NPFA 5JHGB 2GJ8A 2GEVA 3IHWA 4X8MA 3CUEF 2WZQA 3PCRB 3T1TA 2WWYA 2IK8A 2QP3A 1UDXA 1YZTA 2FN4A 4JBWA 4R7ZA 3B9QA 2HF8A 3SJAA 4B74A 3SQXA 1JXMA 2C98A 4BECA 3ZVNA 1TUEA 3DVLA 3RS4A 1G6HA 5JWRA 2HCJB 5EXXA 3LWNA 2ZREA 4O3MA 1A2BA 1GAJA 4GP7A 4C0LA 3QXCA 2C96A 3JZAA 4BLSA 1RZ3A 3I73A 4TL9A 121PA 4BWYA 4ZDKA 4M1TA 4FXPA 1UBGA 1E2EA 2FFBA 3CNLA 1LS6A 4MA4A 1P62B 1DTSA 4A2WA 4KFSA 2X77A 3SR0A 4CEIA 1MH1A 1G5PA 1OIXA 1UEIA 3KJHA 5EZ6B 1ZMXA 1X86B 4IFEA 4QOSA 5DI3A 3RRZA 4LHYA 3GPLA 1ZNZA 4PXAA 4PO1A 4CF7A 1NMZA 5G3YA 4G5SA 4BLTA 1R5BA 1HV8A 3VX4A 3PUVA 5FUYA 4DCVA 3VNVA 1RYHA 1QVRA 4F91B 1GUAA 2QTVB 4TT3D 2EU8A 2HYDA 3V00A 4PQYA 3TW4A 4QXAA 2FDCA 1VDZA 4Z8XA 4K81B 2BBOA 2R6DA 2A5DA 1TF2A 3FVQA 1GVNB 1FPMA 2C99A 3KKQA 4KFTA 3WNCA 5JJLA 3CRQA 2CE2X 2NO1A 1PV4A 2UVQA 3M6AA 4XD7D 1Z07A 4GDFA 3MUFA 3ETLA 4TT3A 1Q44A 1NVWQ 2BJWA 2W6ID 4IOMA 4AIIA 1EK0A 1NBME 3ND8A 1LS1A 1YE8A 3NVAA 1US8B 4JLAA 4RD6A 2ZANA 4J0QA 4V0LA 3K0EA 1RRCA 2ORIA 3MRSA 4LJ7A 2IEYA 1ZM2A 3RS7A 3GLFA 2ZS8A 4TYYA 2O0HA 2OAP1 3RS5A 621PA 1Z3IX 2ZYWX 1DG3A 1XJQA 2QTHA 4PC6A 2IYUA 5JLJA 5LD2B 2A9KA 3KJGA 1SXJD 1COWA 4CEHA 4HZUA 2RGNC 2YINC 4HB2A 2DPXA 2ZUDA 3NHAA 5TARA 1CJMA 4P4SB 5G3ZA 5DN6D 3Q3JB 2CL6X 4POAA 2IYZA 1P3JA 3PEWA 2RH5A 5C18A 3FKQA 3QG5A 3EIHA 2I1VB 3VU9B 3FHTA 2YJTD 1Q3TA 2PT7A 4V03A 4DCSA 4QGHA 3LDAA 5J47A 1ZNYA 2FMXA 3I62A 2QE7A 1XDBA 2ZYTX
chains in the Genus database with same CATH superfamily
2YHAA 4WD3A 3KSUA 1GGNA 3U7FB 1PVOA 4J90A 4KO1S 4I4LA 5CXUA 1WZIA 1U2DA 1A98A 3GRYA 1JAIA 1EMDA 4ID3A 1VL5A 5AKXA 2QI9F 2WFLA 4TUYB 5E7IA 4BQOA 4CL0A 4NXMB 3PQDA 4FYJA 5L3QA 3N2EA 2CNWD 3IMGA 1Z35A 2PN1A 2OFXA 1B7GO 1SHTX 1A9QA 5JROA 1NY6A 1CUVA 1SCKA 4DLUA 2QLJA 1L8QA 1UP4A 1G17A 4C08A 1XROA 4BNLA 4DZZA 5HF5A 4DMGA 4DMRA 1TX4B 1MMFB 1X74A 1XYYA 3CZCA 1AUPA 1ENPA 3NONA 4MUYA 3CW8X 1D6NA 3D5TA 4YRSA 3C3DA 5H59A 4AWXA 4BJ6A 3R7DA 3OM1A 4J0EA 2EFEB 4YCNA 1QHFA 1IPFA 2VBCA 3GIWA 2ZSJA 1J0DA 4ARUA 4ICIA 5F12A 4JP1A 3EFOB 5FTMA 5BWBA 5GZ6A 2VTDA 3OFVA 5JSYA 3AKDA 2RGRA 2MHCA 4YCMA 4JGIA 1XQVA 1Z6YA 2WJWA 2Y9PB 3PF9A 1VIDA 2GPJA 4XUEA 5IJ0B 3DHYA 3BEOA 4DPKA 3RM3A 4QARA 3IILA 2XMRA 1GPH1 2YYZA 2IP1A 2NSHA 1OZ0A 4EJ2A 1G5HA 1NW6A 2CLHB 4F3TA 1T8UA 3PHIA 3SYLA 5H9VA 2D8MA 1YI1A 3IDQA 1D7OA 2Z8ZA 3IMEA 4KYVA 1YB4A 5LXTB 1CUHA 1CUXA 5EMNA 3M6LA 5EZ5A 1QH9A 2E21A 2BFBA 2H92A 4IH9A 4K0RA 4P92A 4WI1A 3UT5A 1TM2A 5IEJA 1QKIA 3KVRA 4RENA 1QSGA 1NI5A 4JAVC 3T1OA 1G3RA 4IIBA 1I6LA 2BCJQ 4AN1A 3R6DA 4HHEA 2R25B 4XWYA 2IA5A 2Q6KA 3G2HA 2EERA 5T8KA 2JHAA 1G7TA 4Q7EA 1WIWA 3NBXX 4X54A 2FY8A 2JIZA 3LLSA 4K46A 1NAHA 3SC6A 1CJKC 2DUNA 4ZAWA 4BO2A 2I3GA 5JHHB 1P72A 4LV6A 4Q01A 1V1MB 3L7CA 3FR8A 4GPTA 1TUIA 1VKZA 3UMFA 1WDWB 4MQLA 2PRKA 3IDZA 2ZVQX 3I39X 3VZSA 1NE2A 1YTLA 2AG1A 2B4TO 2HUNA 3Q9SA 1E4YA 4LW8A 3ZCVA 4MI6A 1GZUA 4AICA 1XZ8A 3IDAA 1V37A 3M9XA 4B48A 3MT8A 1UXOA 1LJLA 3DB1A 1VB5A 2C7PA 1BAPA 4I9GA 5THXA 3IP7A 2XBUA 4NYJR 3M3PA 1D03A 1TDJA 2X4DA 1DKNA 1X7YB 1QV7A 1ZWLA 3MGCA 2FKNA 1LBHA 1Y7PA 2HU5A 1ESNA 3PNOA 5FQNA 3G8YA 3WL8A 5I45A 4TVOA 1MXHA 3TZKA 3EDQA 3PQCA 3THSA 1HL7A 2WC1A 5FFFA 3H16A 5BW6B 1GYPA 3HADA 4AO6A 3HFJA 4EFKA 1RSZA 3W2EA 3TQCA 5DTIA 1ZD9A 1AKUA 1FFAA 3QIVA 1E77A 3GDFA 4PZLA 3ESDA 5ES3A 5FA5A 4UEQA 4F9TA 3BE4A 2CZGA 1EGVB 1N5RA 2Q1XA 2YBDA 2CMGA 2Z5GA 2ZQYA 3PL1A 1RZRA 3UMSA 4BB9A 3ZY5A 3BS4A 4DV3B 2G70A 5GINE 3O4RA 4X8LA 2AG5A 4PO9A 4LCEA 4A0RA 4HLUA 1TO6A 4MPRA 5IXJA 1AUVA 4M36A 3N76A 1RYMA 1SIUA 3AY0A 1E0JA 4IWYA 2QVGA 3IXQA 3R24A 4N49A 4UNSA 1F2UB 1ZVQA 1AKEA 1DAFA 1ZUNB 2J5BA 2WU3A 2IZ1A 1AKNA 2OOKA 3BJZA 4TXNA 2A9FA 4DUGA 1RWPA 2ZRHA 3D5QA 3VR6H 2AYXA 1GN9A 3OQPA 3UOAB 1DIHA 1M33A 2FZ4A 1P5FA 1S6YA 2I4IA 2JCGA 2R6HA 1IONA 2ZYDA 4GL4A 4GWGA 4QNMA 3AHHA 2VPPA 4WUTA 3WFIA 1O5OA 1EWKA 4DNFA 5EJ8A 2ZJ2A 4KGVA 2IQIA 5HZGA 2VNJA 1WMDA 4OUKX 2BGTA 3SVLA 1Y8QA 1NWHA 1W0JA 3E3LA 4BUJA 3B1ZA 2EW8A 1ZJWA 1H6DA 3MJTA 3WB1A 5KYXB 2B4KA 2E82A 5F3DA 4R8MA 3R5XA 3DCJA 4FGSA 1ZW6A 3RR2A 3ZI7A 4DQVA 3JWJA 4Z4GA 4UHHA 3AUTA 5K2MA 3SC4A 1O6GA 4RPKA 4LOHA 2VEDA 1RLUA 1M10A 5EIXA 4NJOA 4D9KA 3Q3HA 1E9DA 4NR0A 1Q0ZA 4BZXA 2Y9MB 2FPRA 1SWWA 2HQSA 3KFLA 4KAAA 1SAYA 2O2YA 1W29A 3WLKX 4KAXA 3OPVA 2OQ2A 1ZN8A 2GARA 1O95A 3IVGA 5FJJA 2XZLA 3SEAA 4WCZA 5CH5A 3QLUC 1PDVA 3WHIA 4GE3A 2V1XA 4L8WB 4KXNA 3CW9A 5DISB 4MR7B 4BZPA 3VDMA 4C7OA 3H7AA 1JA9A 5CLFA 2OZPA 4BVFA 1EDOA 1BEZA 3VR0A 3A26A 1K0UA 3VHQA 1CP3A 3H9BA 5GZ1A 1M6WA 4P4SA 2IV3A 1KRXA 3HACA 2VJMB 2OZLB 4M98A 4IICA 1JZTA 4G1CA 2WKRA 4UUNA 1LDBA 3UOGA 2K5UA 3CRW1 4P7BA 4FJWD 1RJ9A 3SDBA 2QOEA 3F2IA 3ND9A 4IM7A 4KGZA 3VGPA 2FTKE 3QNUA 4EA6A 3U7HB 3ZNOA 2I0FA 1QANA 1UK7A 1V9LA 1UMDB 5DGIA 1L4EA 3LWBA 3V7FA 2JFXA 5A4IS 1RXWA 3B1YA 5FADA 4FOPA 3GBPA 3OE1A 4Y6LA 5D7NA 1JMKC 4TT8A 1E9CA 3ANXA 1SC4A 1I2DA 4J91A 4CQLA 3UJ6A 3L2OB 1J00A 4LYDA 3IEVA 1NXWA 3MWYW 4MS3B 4FGJA 1KJZA 3IX7A 3RUCA 4R1MA 5C9ZA 3GJ5A 3VNRA 2AFHB 2Q2VA 1L1RA 1JQKA 2ENUA 3KYBA 5A1TA 5T8KC 1TZBA 1BKDR 1JLRA 2WILA 4E2ZA 1L7EA 2WI8A 3UN1A 2OB1A 1ZM3A 4QL3A 3WTCA 4EP1A 3VV3A 1WABA 3QRWA 2QRGA 2SNIE 1UZLA 4R81A 3KQKA 3KZ1E 2X7XA 1YUBA 4IUYA 4QATA 1KI7A 2ZCUA 4NJEA 3C98A 2AR0A 1PYOA 2EKQA 3RSIA 1RFLA 3LUPA 3HR7A 5EJAA 1YS9A 3K20A 2O4CA 3VZBA 4RH0A 3NC0C 4B71A 3K5WA 1MJGM 4WNIA 5F52A 3FYHA 1IZ9A 1DQSA 5GOTA 2AOTA 4QJ3A 3L04A 4FP9A 5J4YA 2BWJA 3EZYA 2CB9A 2FGKA 2C2YA 2CNOA 1Y1PA 4TZTA 3SZLA 1N1DA 1X7DA 3QHQA 4LY3A 3HY3A 1AS2A 2VLIA 3VZCA 1I51A 5CYGA 6PFKA 3BVPA 4FBGA 2VO1A 3CTPA 3PFNA 4LFBB 3K53A 4PINA 1WHSA 1RJNA 4ZVUA 1JSZA 1KK1A 3KXLA 3UWDA 1Z2DA 4EI9A 1H2BA 1TUBB 2ZE8A 3WK9A 3M9LA 1QO0D 3GGSA 1PZHA 2DR2A 2AKYA 1A96A 5JCJA 3SOPA 4HYTA 2OCYC 1CNMA 1MJNA 2CNNA 1NUUA 2J9GA 4X1KB 4KNPA 3VSCA 4X64B 5HJEA 1ODLA 3OECA 4U1AA 4GLFA 4S1WA 4UM7A 3NHWA 1VQ1A 5F33A 3TO5A 5AIBA 3AHEA 5LL6P 3WIVA 1V4BA 4GWKA 2WJIA 1KSFX 2F1JA 1ZMRA 4IEFB 4N0MA 4UPDA 2NX2A 4A82A 4YPVA 1YI8A 1T5LA 4HLUC 4NU8X 3RIHA 4ATNA 4IG4A 1JECA 4DZRA 5C1OA 4Z4EA 2VJNA 1WZ8A 1TYDE 2J4DA 4F4UA 4S1PA 1O94D 3O3CA 2NXEA 2C9BA 3CZ5A 5EI5A 4ZU1X 3ESBA 4LF5B 2NQ2C 1FMCA 1KBOA 3WMEA 4WBNF 1FUUA 2ZJOA 2DX7A 2QR2A 1QUFA 2C61A 3K9HA 1E2BA 2GBPA 4IX9A 3FBGA 1SC6A 4G3XA 1LI4A 4JJEA 4Z8YA 4A8TA 2Y0PA 5NLLA 2VP9A 4FOTA 4ENVA 2KSQA 3G7NA 2YYSA 1T6XA 1VE3A 3PSAA 2ZP1A 4R69A 3UK7A 2FR8A 2OHJA 3COYA 2IUTA 4GPAA 1MR3F 1JPVA 2KS6A 1PJBA 2ZUSA 4ZOBA 5FI1B 1LVGA 3RTEA 4R8KA 4XWAA 4TSRA 2AHRA 5JBXA 1Y3HA 2GZ1A 2K6GA 1C3EA 3WVNA 2JLBA 3ZXSA 1KWKA 1E1NA 4OM7A 1L6RA 3TF5A 3QWHA 2P2CA 4BP9A 1I4EB 4RIIA 1XYGA 3MTJA 4KMMA 5JYBA 4UMVA 4IVQA 4DMCA 4KFCA 4TTAA 1E7WA 1R18A 2JFBA 4BN5A 1E2GA 3WL5A 4CCAA 1OB2A 1T4CA 2WT4A 5DBEX 3GG2A 1PZNA 2NUTB 4JR2A 4DIDA 3P8ZA 4ZANA 3KQHA 2H1VA 2ZSFA 4OXKA 2HSDA 3GEHA 4P4NA 2IIBA 4I46A 4RKFA 5CYOA 3Q1KA 1SUSA 1SVKA 2IYWA 2AN5A 2PANA 2P8SA 2VNHA 1IHOA 1KP3A 3HB9A 4J6EA 5GJVC 5F5LA 3ZN2A 5CGQB 3DR5A 1K75A 4LZWA 4Q19A 3GARA 4X7MA 3OQVA 4GQIA 4O5AA 2F3RA 3RS3A 1ID1A 1EIZA 3O92A 4X20B 4YDSA 1HQCA 1DX6A 2J7PD 2NXNA 1K06A 1JEDA 1IHDA 2XE7A 2VDRB 2G36A 3ITNA 3N58A 2FW2A 3SLLA 2H7CA 4W7SA 3HU3A 1E9RA 1Z2OX 3SYTA 1BE8A 4X94A 3RFFA 4CR7A 1PFUA 4NNQA 4YUZA 3M5WA 4QC2A 2KPOA 3AL2A 1T9ZA 2J5XA 1DEAA 3KT0A 5BRNA 1ETHA 2QJOA 4KRXA 3W1VA 5DWDA 1TJNA 2TRSB 5JATA 2AK3A 1HZDA 4WEOA 2UKDA 4H7DA 4HAIA 2XTAA 4MO2A 4Q24A 2J0UA 3SJ7A 2MDTA 4IZ6A 4OXQA 5JI2E 2NSLA 5KYXA 1W4CA 1W5EA 2HMAA 3CVWA 4EQ6B 1P6UA 1FX0A 5AIAA 3R4CA 2WTUA 2RCYA 5IU6A 4KNWA 1NW3A 1T5TA 4IIDA 3U56A 1E2MA 2W48A 2BBTA 3EDRA 2B8TA 3KJEA 3QYAA 4D9MA 5FPQA 1NC3A 2WF7A 5I9NA 1HT3A 2GCOB 1U9JA 3NRCA 1V6SA 5IAOA 4I36A 4HNVA 2G06A 1KVTA 1RQ7A 1W4ZA 1XKTA 2PL9A 3VTAA 4X3CA 5AYVA 5BN5A 3NCTA 4V0KA 2NXCA 2XH8A 3HHPA 2E4XA 2QK4A 3NW9A 1UJNA 5F4ZA 4J3NA 1DHRA 4TPKA 1MOSA 1E2DA 2R751 3PUXA 3TTXA 4D99A 1RP7A 1QWSA 3NBMA 4M7OA 4C2AA 1I2AA 5CVCA 4KQ9A 4PVCA 4RIGA 1Q7TA 2DJIA 4CV1A 5L40A 4QYSA 2VUIB 3RVPA 3I1JA 2W5UA 1LK5A 2E49A 4R84A 1U80A 1XA3A 2A8YA 3JYNA 3LF1A 3R8XA 4CG0A 4E2FA 5IANA 2Y27A 4CKWB 1N2CE 4MS4A 1A7JA 1EFHA 1TYCA 1RTKA 3KQFA 1IJBA 2Q3DA 4EMBA 3HG7A 4RIFA 3QU4A 2W4QA 3FG9A 4QBFA 3T7SA 3KTOA 3JATB 1LTQA 2YN4A 1WCV1 1JIJA 5BVHA 3WAJA 3KC2A 1VSVA 3T41A 4FKBA 2BI7A 2CJWA 2CEKA 4BX0A 1PI3A 1QRRA 1GGKA 2JGAA 4U0JA 5EKTA 5KPDA 2I9KA 5JSUA 1HC7A 1YUNA 1BCSB 1GNSA 3TSZA 2J5KA 2Q8QA 2QLNA 4K28A 3ROGA 5ARBA 4LCJA 1Q3KA 3ROQA 5EZSA 5KNDD 3O94A 1GZVA 1BG6A 1NOKA 4WUVA 1DU4A 3UPDA 2RGEA 1JTVA 3PK0A 4IGIA 3WG9A 3VH1A 5KSZA 5FLYA 2VWQA 2H5EA 2ISCA 1ZU5A 2ICAA 1HEUA 1H0RA 3W5SA 5L4NA 4ZHQA 5LSAA 2EIXA 2GN1A 1GIAA 4D3YA 3H0KA 4KRFA 1OJ7A 3B9PA 4B87A 4CZ2A 3VKHA 2PGAA 5GY7A 2G71A 2VDOB 2IV7A 3T7JA 4LDAA 2BFFA 4FC7A 4MDHA 3NALA 4TXJA 1KJ8A 1D2GA 3ESQA 2P9GA 1E4OA 2RIPA 2PTHA 1YFLA 1UDAA 2CT8A 4BJ1A 4YACA 1BXGB 1E2PA 1FNSA 1KVSA 1UWCA 3BD6A 2FRDA 5FOXA 4E7OA 2FZEA 2WFLB 5GGYA 4BX9A 1IBMB 1QFSA 3NOXA 4L0CA 4BMCA 2PK3A 2GRUA 2WTEA 3JQEA 1Q3HA 4LOIA 1IAQA 5GWXA 4HMOA 1HYEA 1WA5A 3B3GA 2XYQA 3GL9A 1VBMA 4JT2A 4RZIA 3G0CA 2HU7A 4HB4A 4D9NA 4ZYTA 2PZEA 5EJFA 4QNNA 1M5TA 1DADA 4KWCA 2J9FB 2J48A 2PX0A 1NUPA 5F64A 2DFLA 1OTYA 3Q10A 1S96A 4W9NC 4B82A 1CUDA 1U6IA 2JJ2A 4F60A 3LUBA 5DU2A 2PL5A 4NOKA 5IAKA 2WUGA 5EVCA 2V0GA 1R66A 1X77A 3DEJA 1FF9A 5G4LA 1YIAA 2Z5VA 1KOGA 1YU9A 1NF2A 3L8MA 1OFGA 4PC3A 1VLVA 4EY5A 2JA1A 2QMYA 4MW1A 2N1MA 4RMJA 4HSGA 3MYRA 3JWHA 4H4EA 3W2GA 2WE7A 3PFFA 1Q16A 2YN2A 3UV3A 1H2XA 4YHHB 3GJSA 3BRCA 1EE2A 1Y0BA 1DXQA 1Z6QA 1M2OA 4EL5A 2F90A 1RJDA 2QM3A 4ND3A 3EGVA 4CIVA 1E2LA 5KYWA 1NPYA 1QTIA 1ZA1A 2O0JA 4UULA 5BWNA 3ZIAA 1R3UA 1MLDA 4YNBA 1YJCA 1YQDA 5FOVA 3ZQ4A 3F9CA 1QPBA 4CBVA 3HV2A 3OZEA 5DRTA 3E5HA 3OTHA 2RHDA 1T35A 3NYIA 3PTZA 4WJLA 5DLDA 4Y2PA 5JRZA 1NZDA 4RK0A 1X7ZA 1PEKE 2W93A 4AZ0A 5JS8A 1K7XB 3ZEAA 4B8WA 3T89A 1QH1B 2H1WA 2VTVA 3A7DA 1JMYA 3QHPA 1O0SA 4OAQA 4ENQA 4EKEA 3OQ6A 4K40A 1YVUA 1QC5A 2B4AA 1Y5IA 1RTTA 3E53A 2JCBA 1HG1A 1Y7HA 3JSXA 2OG2A 2IVZA 1CUBA 5KC9A 4PZPA 2BFEB 3LVQE 3SBEA 3BJMA 5AKHA 5AW7A 4QBHA 3NTLA 3N07A 2ZIUB 1DRKA 2ZWOA 4F7DA 5BSEA 3AL0C 3KQVA 5EXSA 3VFDA 3ZD7A 2WVHA 2R7KA 5CVJA 4UVEA 3R3SA 3OX4A 4ZMBA 3D3EA 1YRBA 2R66A 1BO6A 1R4ZA 1W1IA 3IBCA 2IEZA 2XNDA 1RBZA 4GYWA 4IIGA 3QU7A 5TEVA 4FTWA 3WHKA 4FHFA 4RTQA 3ZJ5A 3DLBA 2VYND 4H7JA 3TRFA 4DIBA 1J8DA 4YMHA 1NSYA 1WW3A 4XCQA 3UICA 1H5QA 5MGNA 2APJA 1Z0UA 1D04A 3I05A 4BMYA 4EG3A 2YWDA 3D6VA 5TC4A 3D7SA 4EMTA 1ZK1A 2NG1A 2BFFB 2VL7A 2NMVA 4GQAA 1A9RA 3RQFA 1T2UA 1F0YA 3R7AA 4EO7A 3QLVC 1KKLA 4O4HA 5TLSA 2K7FA 2HHAA 4X65B 2GB4A 4FQ5A 1EVEA 2GEUA 3CXUA 2OXCA 4IZIA 4DV1B 3CHYA 1B42A 4H59A 1RHMA 3WJ2A 1AB5A 2QP9X 1QH8B 1JKFA 3SE0A 4G0XA 4M53A 3FN4A 2XUGA 4FW8A 2X8BA 3DWIA 4XDYA 4ZO8A 4CMBA 4ZVTA 4H08A 3QMPA 1MB0A 1NNSA 2CFSA 3L7YA 4WVLA 1UXGA 2ZZKA 1C7FA 3PXEA 4UUPA 1O4WA 2AZDA 3DQZA 4EF4A 4O33A 1U6KA 4F3NA 2JBAA 2YXLA 3A05A 2UUBB 4GKJB 4H7PA 5HIAA 1OX4B 4L3VA 2CNKA 5EINA 2NU7B 4HYQA 2J0VA 5KDOA 4UEKA 4YI5A 4KFUA 2O19A 3C1UA 3VHRA 1OLUB 4YAIA 3LPLA 4ZVQA 2VJDA 2W2NA 4YIHA 3NWPA 3VH2A 2WM3A 1ONNA 2XVXA 5EKSA 1H8HA 2X0DA 4NYIQ 2FPSA 2R1TA 1P2TA 1YRWA 2EV9A 1SK9A 2WYHA 3BFVA 1YZQA 3ZCSA 2I7VA 5L45A 2OHOA 2ZT7A 1PJZA 4YS6A 2PM8A 3IAM6 3RKUA 2XXAB 2JEYA 2PZLA 1CQJA 1DBWA 1PEYA 3B20A 3PUJA 4A91A 5HP4A 1O7JA 5G0WA 4RF3A 4IWXA 4E3WA 1TYEB 3SBOA 2DCMA 2J9RA 3DWGA 4FFBB 4G24A 4YRPA 1F51E 2X4GA 2WTAA 3CMCO 5JAPA 5ALKA 1T5DX 3OQNA 5A4MS 3GD5A 3UHFA 1Z63A 1PL6A 3AVUA 4AKGA 1I0ZA 4X84A 2PX4A 1TZJA 4REQB 3WKDA 2P6MA 4ZA2A 4HDCA 4MHTA 3KWFA 1XZFA 2PBPA 3Q8WA 2GXSA 4WCDA 4LUCA 3ENVA 1JDVA 3E70C 1HY3A 1DC6A 1PCXA 3KKEA 3JRXA 3DTTA 4M1YA 4Z5XA 3NAGA 2EZUA 6NULA 1Y7LA 3FOEC 3AIOA 3GYGA 3HI6A 3MJEA 4TN1A 3D3WB 4FWBA 4N7BA 3RS2A 1EA5A 1WPRA 1PTJC 1SGWA 1XJ5A 2C4MA 2FUG1 2WDPA 3FXAA 4GI7A 3UHJA 4F3CA 2XWPA 1I33A 4KTVE 4COOA 1Q0QA 3HLYA 1CVLA 4UHJA 1U3DA 2EFGA 1BW9A 2BRUA 4YRJA 1DUVG 2Q6IA 1GZ6A 5E4TA 3A3KA 1M83A 4CTMA 1K7YA 4DILA 3U39A 4LMPA 5B55A 4JBNA 4CN9A 4BLPA 2DYKA 2JH9A 1B6TA 3MD9A 3O21A 2HN9A 3OOHA 1TMGE 2CBGA 4ARZB 4F56A 5D5QA 1KL7A 2X7HA 4BE9A 4WBXC 1EJ2A 1N2CA 4BB6A 4ZJYA 4UDOA 1XKLA 4YI3A 2DEUA 1UJ6A 2W7TA 5C0OE 1Z15A 2CYAA 4YT2A 4X60A 4BPBA 1G8PA 2VHTA 2XQVA 5FIUA 4PYLA 3HYSA 1W88B 1KDPA 1I0IA 1RMYA 1BN6A 3M6XA 4RGBA 5AW5A 3E5MA 3Q1TA 3H9EO 3LRTA 4LOLA 4Y2XA 5F1OA 4DEVA 2VRBA 1Y4AE 2GPSA 2B1JA 2D4HA 1YZGA 3CX6A 1DIBA 2C7GA 3A31A 2G80A 4B75A 1R00A 1SG9A 2IHTA 4JA0A 1NVVR 5SY6A 3OZUA 3B38A 1YL6A 4IRMA 3QKUA 4PGHA 3ESZA 5F7JA 5IC4A 2WUFA 4OQYA 4GI3A 2IYOA 3LX6A 3LVFO 1L7MA 4F8EA 4CKYA 1BKYA 1J0CA 3DZ8A 1NQ5A 1ETUA 3G1WA 3GZNA 3GFOA 4C7XA 1Z26A 4CM8B 2HMUA 2PG3A 4AS3A 2ZZMA 5H83A 4BNMA 1AXGA 2DUBA 1BDJA 1MN6A 2VAMA 4OLFA 1E6LA 3OTOB 3UMJA 3QPCA 1W88A 1G8MA 3BWYA 4WK6A 5DXAA 5F1KA 2IPMA 2PD4A 3S2UA 2C7RA 3V42A 1C9DB 5TT1A 1DBQA 2W43A 3VU9A 4S05A 2H7VA 4MKRA 1YE3A 4LDQA 5C52B 2QQEA 3RRYA 1G21B 5DSZA 3ILHA 4KLCA 5HQJA 3OEHA 4RPHA 4ZOCA 2WKSA 1Y3IA 2FCAA 3EZ2A 3S44A 3BGWA 4BWVA 2QG6A 2VJBA 2WJJA 4JVNA 2FSPA 4AMUA 1Z5ZA 2P35A 4FKZA 3D4NA 4BE7B 5AW4A 4XDZA 1U63A 1VJ1A 2VDNB 3RO7A 3K71B 2H29A 1Q84A 2WHXA 1S2DA 1U7TA 4JUFA 2AN9A 2XRMA 1OV6A 3G5AA 3IQFA 4M9UA 3ZU4A 3H5LA 3HM9A 2YXDA 4AG6A 4ZVLA 4W9MC 2R9VA 1P60A 3BPSA 4BMZA 3V3TA 3A4LA 1V8PA 2XTZA 4ZEVA 1J0EA 1FSZA 2PSDA 4C0XA 5DM0A 3H3XA 4I08A 3D6NB 4LG1A 3CWQA 4L9WA 4HEA6 1Q1AA 2CV2A 3DHVA 1GDHA 1YS7A 2IXDA 5IRCD 4YRBA 2Z3VA 4PYIA 3QQ5A 2ACKA 4PAQA 5ALEA 4DY4A 2JASA 5K8CA 4DGQA 4CUZA 3L7MA 2JIZD 2IDJA 5K6AA 1WVMA 3IUPA 4GZ6A 2Q0SA 3B7PA 4J3JA 2E87A 3W5HA 4M0LA 4G1FA 2FMIA 5KWVA 5LWHA 1E20A 3AOEA 3E9QA 3PNSA 1H1TA 5DX1A 2C4UA 1NIPA 4FZ5A 3P32A 3ANNA 3TOCA 2BPOA 3TLKA 2X6RA 4C30A 1I5OA 4MQEB 3JCZA 4RESA 1Q7RA 2J3IA 3BMXA 3FVVA 4HOYA 3V9PA 1BVYF 1NATA 3IUNA 3UC5A 1ZK3A 1XRMA 2GAAA 5DNYB 2G04A 5AHKA 4UTNA 2DLNA 1EHIA 1P1HA 3FCXA 4KR2A 5D00A 4OQEA 5FLEX 3E7XA 1DBIA 2AI2A 3ZWNA 4LHEA 3F3KA 2FW8A 1S0UA 3N2NA 2DUWA 2QVYX 4ZYXA 4BFSA 5CM8B 3G2JA 1UADA 2JLZA 4D9IA 3AMVA 3QPVA 4OSOA 4XVQA 3RBZA 3E15A 2WYVA 3V1YA 1L1QA 3AR3A 2C82A 3M34A 4PYMA 5F2OA 4AW9A 2IOQA 4RM2A 2HZBA 3L7BA 4I50B 4CLXA 2CSXA 4MOWA 2Z6UA 3ZK9A 1UBCA 1MBZA 4HNHA 4ND8A 5CNKA 3TLZA 2HWKA 2K2QB 2Y71A 4Q7KA 3DE2X 5KVVA 1ISRA 2ORED 3NBZC 3P4XA 4QD3A 4UQPA 3AUJB 3WGYA 5EZYA 1X9HA 3K32A 2GZMA 3LQFA 3O4VA 3QPWA 1NBAA 1NBHA 3GLGB 3QPDA 3M5PA 2ZYHA 3C41J 3IYLW 2I5PO 4AYXA 4BU1A 1LDNA 1WMSA 4MNTA 2Z2ZA 1J42A 2G4VA 3QFCA 4XJSA 3BRWA 2VDUE 4LYYA 4UU0A 5FO1A 1QXSA 1UZAA 1VPEA 1SU8A 2QL6A 2IE0A 1AH2A 4Q7QA 2H16A 4O4LF 5JDIC 1FQWA 1JQ5A 5BOSB 3OHMA 2G8LA 3LUDA 5ELXA 3JQGA 1PJLA 4UD6A 1G8JA 2V3CC 3H4VA 5KREA 5G4KB 3DGFC 1OXXK 3FGZA 3QU2A 4UE2A 1V11A 2XCOA 4C05A 3G7UA 1Z73A 4MLDA 1ANKA 3IJPA 3D4LA 5IVDA 2NT4A 4FDLA 2YTZA 2QTFA 1A4RA 1M8PA 4QRIA 1J9GA 4BBZA 3L6CA 4K8RB 3IKJA 1VPTA 2VHXA 2R8PA 2H1CA 4KP7A 3WGZA 1U8YA 2OAGA 1F3OA 1UBUS 3DDUA 4TTVA 3EC2A 4RNDB 1RADA 2QRVB 4B0OA 3DDHA 4OLJA 4M76B 4KWIA 1IXZA 4UASA 5J4HA 3A9UA 4ABTA 3BILA 1D1TA 3R40A 4LOJA 4ND1A 4P1ZA 4QGGA 3K5PA 4Y98A 3WWYA 1CP2A 4LA4A 3S0JA 3ITDA 2IY8A 1B8UA 2AQHA 1GL3A 1P5HA 1GZHB 3DCYA 1YIDA 1O6BA 4C6TA 2LPMA 3O47A 3MBKA 1VB3A 1W8IA 2C5HA 3BBLA 4N7RA 4EL0A 1W0CA 1N5JA 3VPHA 4N0EA 4YVFA 3RFUA 2OLKA 5IT9A 4W8OA 1FP4A 3DKRA 1B2RA 3KDSE 2JIBA 3VYRB 4ERXA 1MG5A 1J90A 3ISVA 4YDHB 1A3CA 1RQGA 4CTOA 5AFSA 3FFBA 4YLYA 3T3NA 1DCFA 4P2BA 2RHHA 1X2EA 4BV3A 3IQXA 1Z5UA 2EWMA 4IVNA 1D07A 2WYOA 1RWBA 1R27A 4IAOA 4BFZA 1SBCA 3NDBB 3EQ2A 5LMZA 4FFMA 4G09A 1SVMA 1YS2X 4C7MA 2A9PA 1EFRA 1T4DA 5EWJB 5FV7A 4LECA 4FDVA 3DO6A 4A03A 4D26A 3HP1A 4TV8F 5HA5A 4CTKA 4G81A 1QHNA 1U2EA 3P94A 4NJEB 3TWOA 2JLSA 1MO3A 3CX4A 2FFAA 1N2HA 2AE1A 4RMGA 2IIVA 3AHFA 3B60A 4NTZA 5EKXA 3IVMA 4R1LA 3O8QB 1ZW1A 3SLRA 2GK4A 4QQKA 1YRHA 2N75A 3HCEA 3IT0A 3LQ2A 4ZOLB 3TLYA 4AMYA 5FHRA 3R75A 2VP2A 2HLPA 4URVR 1XQWA 1GEEA 3M3HA 4O2AF 3PHBE 2TYSB 1HT1E 3GXBA 4IHJB 1N92A 4JL6A 1ORDA 4FSDA 4QGFA 1K08A 3PPVA 3NAMA 4FJ0A 4LXYA 1XXHB 3O4IA 4URHA 1CNEA 1THTA 4X1KA 3C70A 4DSUA 2QAIA 1JEYB 1LLDA 3ZLBA 4EG7A 2W37A 1NLUA 2QY9A 4JVMA 2J9YB 3KB1A 4ZDJA 5DM2A 1N77A 3MMSA 5ALMA 2PXAA 2MT9A 3PGMA 4MICA 4CU5A 4YJKA 1NI3A 1ORIA 2B35A 4G63A 1J2JA 1LK7A 3MCAA 6Q21A 3VR5D 4OLBA 5EHIA 1Y1RA 2C92A 2KBFA 2QAJA 3EXHA 2OPBA 4QQNA 3NKLA 1M1ZA 1CQZA 2QLTA 2QRVA 5BRJA 1KOJA 1Z4OA 1KI9A 5DTQA 4AY3A 1CQIB 2I76A 4Q7JB 2AVDA 1LNQA 4RZQA 3ONWA 1G8YA 3Q0EA 4DV5B 1DVRA 1JEJA 3CUSA 3KLNA 4OI2A 2PAFA 3TIFA 5K0TA 4TQAA 5C32A 4BE4A 3DC7A 4RVDA 4WFJA 2CLEB 2Q3BA 4PX5A 3SVZA 3FNGA 3GLIE 4YV1A 5EAIA 4DSZA 1HEIA 3HPQA 1QNLA 4ARVA 1VYHA 4RFVA 1WUHS 1YR8A 4L3OA 5IJWA 1TA0A 3GNTA 2FSGA 1HLFA 4Y3UA 4P3NA 4YT5A 3P4YA 4PBRA 3GEDA 4ZT7A 1N7JA 2RGCA 3G6KA 4XX0A 3I9V1 2FR0A 4EPVA 5LPNA 4Q16A 3UJPA 3R6WA 3OT1A 4OHMA 3H86A 3HCNA 3IQWA 1W36B 1PL7A 3N8DA 5TB5A 3U3KA 2NXJA 4EJSB 3EFBA 3H6GA 2CLFB 2W2VA 2CHVA 3JXEA 4LAFA 5FBQB 1DAKA 3EB9A 4C76A 3QSYA 3LC2O 5EUCA 2BRUC 4V38A 4Y7DA 5F21A 2FV8A 4KREA 4XUCA 4IJ5A 4NZMA 2R3SA 5CEJA 3UYKA 3ABOB 5BN5B 4DA4A 1CR2A 1HSOA 3FR7A 1PS8A 4YP1A 2G08A 4U18A 2OOSA 5BSUA 3TEMA 1SA0A 3U31A 2ZYRA 4NOMA 1VG0B 4O0MA 1C9JA 4PYNA 3FFAA 4D6PA 2P77A 3GGPA 3K6SA 4C0WA 1PR6A 3TDMA 2CXQA 3J7TA 4DLLA 1EFTA 1Y98A 1BVRA 1SPXA 2XMQA 4F5EA 5IH7A 2A67A 2I1WA 2YWFA 3DMRA 3LY8A 4D45A 2EHDA 5ISMA 4Y6RA 2F9FA 2GI4A 2ZULA 4LHSA 3AXSA 4EYOA 4ELXA 2XKBA 3BIXA 5DK4A 5JANA 2RD2A 4F04A 3LW7A 3H0EA 4MV9A 1TK9A 3OZGA 4HXFB 5K3SA 4EY3A 1JLHA 3QYJA 2BE9A 3DJFA 3B52X 3CIOA 4BGUA 3C87A 2P75A 4U63A 1DIOB 3FWYA 3QP9A 5LJIA 4MV0A 3FDUA 1ISGA 2FFQA 1FE8A 2N0SA 2NV6A 3Q0IA 4NY1A 2YJGA 4QU5A 3ZX5A 3P26A 4GOJA 4AN0A 4JOTA 3GJ3A 2V8BA 3HXKA 1Z3CA 1RXEA 2IT1A 4V0QA 3GA0A 4DIEA 3ZHSA 3G59A 2XTMA 4FC6A 5DM60 1U0FA 4I1YA 3URMA 1FDSA 5IG2A 3GJ7A 1U9YA 5U4QA 3I5YA 1JNYA 1YKGA 3HKBA 5AOCA 5HZKA 1GCAA 2QSUA 2NU6A 3NYRA 5E6UB 4LHVA 4IIVA 4AL4A 1Z2CA 2DJ5A 2H9YA 1PEAA 4RA9B 3JQ8A 4BVHA 3UW1A 1TVEA 4RJJA 5EMLA 2HDOA 4L9AA 1BA2A 1GTZA 2CVPA 1RKQA 3KLBA 4MAMA 4OF4A 3QK8A 4IMRA 3K6JA 2XOKD 4EWLA 5SYNA 3CE6A 3IXLA 1EP1B 5BSKA 1OWOA 4KK4A 5L7WA 3P2EA 3TPZA 3DTVB 3ER6A 5DLQC 3E3NA 1GUZA 3TR6A 4Y2UA 5PNTA 3WNDA 2GHTA 2JBHA 1I32A 2BGRA 2VRCA 3RSHA 3SJCA 3RSQA 1XLVA 5AKLA 3AM1A 3C5HA 3ESCA 3HLKA 3O73A 4R9RA 2ZK7A 3UM9A 1X1AA 2R7NA 1GWNA 5AI0A 4K9RA 3K0FA 1OD6A 1E1DA 1NN5A 3P0JA 4ZKDA 4OFWA 1E8DA 3OCUA 3BTVA 1PFYA 4GEKA 2NADA 1LPMA 2NO5A 2WKPA 3D4PA 4YR7A 4G1VA 1VLMA 2C03A 4BBAA 3QFFA 4BQQA 1JBQA 3HY4A 1QPGA 3CN9A 1C4OA 1OBFO 2NSYA 1XR3A 3GFPA 4HGPA 4MX8A 2VPWA 4OQFA 3FSEA 4ZFNA 1I94B 2QENA 3CEAA 2JLYA 3ZDCA 2WFMA 1Z4PX 3G5UA 4NXNB 1W9MA 2QVLA 4CFSA 3IE1A 1B15A 1QOQB 1MEOA 3MSXA 3ONFA 4Q6BA 3TTSA 4YV0A 2EF0A 2XTJA 4B7UA 1NC1A 5IK2D 4JKOA 1HE8B 4RDHA 5L3VA 1SKBA 3FHLA 1SXPA 4BNDB 1NM5A 1OIVA 1YGPA 3NDRA 5BVHB 2NQTA 3OPYA 1DS6A 1M74A 3NIWA 1EDBA 1DQYA 2XXBA 3WSWA 2QTLA 4DUZB 4DC9A 4Q3DA 2ZBQA 3CF6R 5H3CA 4JDPA 5AM2A 2DAPA 3A7EA 4LXGA 5CA0F 3NOQA 1WWKA 1AZLA 1GADO 2IYTA 2M6RA 3CF4A 1JA0A 1MX3A 3DW1X 4DMLA 1D8TA 1KEWA 1UJ2A 1W5AA 4UU7A 2UUAB 1KBQA 4I5EA 1SKYE 1XZKA 4I5IA 4LXTA 3DL4A 5DYGA 1EX7A 1IUPA 2E3JA 4M38A 3CEJA 1EGQA 1QCYA 1UAYA 4A8JB 4GFDA 4MB6A 1YZVA 1WTCA 1H0HA 2BMWA 3HNRA 2IOHA 3MEQA 1QH0A 3ENKA 1JB1A 4U3JB 3HB1A 5ESDA 1KXZA 4K26A 2FMFA 4J9UE 1AV6A 4WPGA 2HF9A 2ZYSA 1M6VB 3KG2A 3U7IA 1EGAA 1NU8A 2OD7A 1SC9A 4FW9A 4B4VA 1YQ9A