3A4NA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
237
Chain Sequence
b'GDIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 93
structure length 237
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4nA01
1NLFA 2MSCB 3I62A 4NYMQ 3WYGA 1QDEA 3SBEA 3OF5A 1II9A 1NI3A 2C9YA 2GA8A 1YZQA 2QSZA 5CLQA 1E9EA 2GJSA 4Q4AB 1VPLA 5FOWA 5JMTA 4KJZA 4W5HA 1TPZA 1F60A 1G18A 5FOTA 5DO9A 3EC2A 4IOMA 3C14C 4IW3B 3NIBA 1ZU4A 2IEZA 1S1MA 3SJAA 1ONBA 3SE0A 2C2HA 2OCBA 5JRZA 2XOKA 1DEKA 5KHOC 1P75A 4JLOA 2FSIA 5TARA 3AVXA 3HYTA 2WOOA 1NMZA 3SYKA 1M34E 1XTJA 4TMTA 5K8LA 1P73A 1TU4A 5LB4A 4PO8A 3B6EA 1VCIA 5DIFA 3HYRA 2D3WA 1NG1A 3CF2A 4RZXA 3B82A 5LPNA 3QY0A 2ANBA 3EZ9A 1YZGA 4C2TA 3PCRB 2OEPA 5L3VA 3TW4A 2WJVA 5AJWA 3V4RA 2WHXA 4D4JA 5BW8A 2Z83A 4WAUA 3EASA 1OXXK 1XMVA 1XP8A 2ZVPX 4HI0E 2KBFA 4JYBA 4LBYA 1W4AA 4F93B 1BIFA 2FU5C 2YOFA 5JCPA 1P5ZB 2ZAMA 1IY2A 4MUAA 5FTNA 5FTKA 1GNQA 2Q9BA 5L3SB 4WZBE 1OFTA 4KAXA 1OV4A 1YQTA 3BE4A 4Q02A 3WY9A 2FX3A 4UXHA 4CT4B 1P2SA 3F0TA 1DG3A 5DN6A 1XCMA 3P27A 2UZIR 1ZUIA 2W2VA 2ZSEA 1UADA 1HA3A 1GRNA 1RZ3A 1ZM4A 1OXVA 2ZSFA 2WIAA 4M9QA 4TN1A 3TKLA 3I8XA 1FUKA 3U5ZB 2D62A 3KDSE 3LX8A 3B60A 1AQUA 1L4UA 1I4TD 1VCNA 1OHHA 2W6JD 3WNBA 2RKOA 4FI3C 2IWHA 2PZFA 2CL6X 2ZVQX 2WSMA 2K5UA 3FTQA 1OW3B 3BC1A 4NYJR 1T91A 2BMEA 4N3NA 3TR5A 1NJGA 1OIVA 1L2TA 3B1XA 3GLFE 3AEZA 2ZI6A 2ZRKA 2XSZD 2QA5A 5B58C 4HUTA 1DPFA 2F1RA 3CRVA 3CWZA 1WDTA 4Q19A 1X8JA 4QGAA 4RFSA 4HAVA 1GG2A 5E3HA 1NF3A 1G41A 4QKQA 3CF0A 2OO7A 4TTQA 3CZPA 2V6JA 5KDDA 4BLQA 4P3YA 2GCPA 2IEYA 3HU2A 3EIQA 4PO9A 3NWJA 4QNRA 1S2MA 1XEWY 3PXGA 2Q0HA 3FOZA 2A7QA 4K8OA 3KXKA 3RHFA 5DI9A 4TL9A 4YMVA 1M8PA 1CXZA 1E2QA 2CJWA 4GMXA 4GT1A 5SZIA 2WKQA 4C30A 3KUCA 1D5CA 2NG1A 1WQ1R 4R98A 1UF9A 4X8OA 2OE2A 2QTFA 4GZLA 4IDOA 5K8TA 2O8FB 4BLRA 3KL4A 1ZM7A 3W3ZB 1ZD9A 3GJ0A 2GEVA 3GFPA 2ZPTX 1T0HB 1ZP6A 4RD4A 3CRMA 1H8HA 1K5DA 2G1KA 1GKUB 4JMPA 3TUJC 2IXEA 1E2NA 2A3RA 3MRSA 3K0FA 4JVLA 2REXB 4MRPA 1HY3A 2VH5R 2ZANA 2IT1A 1OXSC 1NN5A 2NO1A 4M1OA 4TYQA 4ZDWA 5F9HA 4JKYA 3CR8A 1NLYA 3K9HA 1LB1B 1R0XA 1S96A 1GNPA 1BH2A 2C9OA 1Y3AA 1P62B 3K70C 2GAOA 5JS7A 2CK3D 4GI7A 4EFMA 1NIPA 2H7VA 4QL3A 2QGZA 1HQCA 1S3SA 3MG9A 4D4MA 3W8RA 4C0JA 4Q7MB 4JLKA 4JS0A 5TXGA 5A0FA 3W6NA 1DAHA 1G8FA 1X8LA 3UMRA 4RFSB 2F1IA 1AM4D 1S8FA 4Q47A 4QBGB 1KIMA 4LHYA 1U8YA 3AP1A 2VP9A 3LNCA 4WXRA 2QE7D 2RHDA 3B85A 1VYUA 3C7KA 1T8TA 1BO6A 5E4FA 5B57C 5M04A 5BYJA 4DVGA 1HV8A 3SYLA 1US8A 1W36B 1IY1A 2P3SA 2OT3B 4NE2A 1G8GA 3ECCA 3LLUA 2WJYA 5HE8A 3A37A 4FCTA 3VMFA 2DPXA 4NCJA 3ADDA 4JVMA 4US1R 1D2EA 4KBFA 2VPPA 1SHZA 1W4BA 5LD2C 3L0OA 1KI2A 2BOVA 2EFHB 4LK2A 4B33A 2NO0A 4WXPA 4PQYA 3KKPA 4GP6A 3SOPA 3CZQA 2JJ2D 3RS7A 3UMFA 1KNQA 1XJ0A 2R6AA 4OI2A 3JZAA 2NIPA 4OHXA 5IRCD 1LF5A 4MYTA 1GAJA 1QZXA 4TLBA 2WVJA 3F3YA 2RAPA 3BB4A 3CX7A 4P32A 4CEHA 3QBVA 1AZTA 3K0CC 4XD7D 3K09C 4EDHA 2RGBA 4KO8A 2QPOA 5JLJA 3CIOA 1E1QD 2WWYA 4FXPA 4IXNA 2WWWA 5C4GB 2PJZA 2WZQA 3WYFA 3DL0A 1G4UR 4EPTA 1Z6AA 2OESA 1MO3A 3SU8A 1Z0FA 2ZRIA 3MGCA 4H1UA 1SXJC 1X86B 2ZE6A 3MD0A 2CCKA 5FTJA 1Z2CA 2XNDD 1IN6A 2BM1A 1OT3A 3AVOA 3K9NA 3L8YA 4DLRA 1D9ZA 1XD2A 4V0MA 4QBHA 1OH6A 3AVTA 5FPHA 3GLGE 2EWVA 4TT3D 1GP2A 4EPRA 3L8ZA 4OKSA 1NKTA 1EFRA 3N2IA 5AUNB 2H18A 3OFND 3UIEA 2BKUA 2ONKA 1OPXA 2OXCA 3TVDA 4LOAA 1US8B 4A8JC 1NN3A 4QC2A 2OSBA 3RDPA 1YE8A 1KKLA 4JIMA 2J9RA 5JS8A 4OQNA 4ZI2A 4IVQA 3WP0A 5EUMA 1TAGA 5E95A 3JZMA 3B1WA 1WBBA 4Y0AA 3S1AA 3HPRA 1N6RA 3LH5A 1NN1A 2NO7A 1SHKA 3IIJA 4CRWB 1E69A 4HAUA 3VR3A 4NDZA 4C0SA 1LNZA 3X1ZA 5KDLA 2GBLA 2FSFA 4DCVA 3R8CA 3U3MA 4MKGA 4CEHB 4DCSA 2IYYA 5D3QA 2P0EA 3T1QA 3TLXA 4JLPA 1ZM3A 3UANA 1RC8A 2HCJB 2BBTA 4MDFA 2R2AA 4TYYA 4ESVA 1XZPA 3TQCA 3BJIC 5DI3B 3IQWA 4HB0A 2WOJA 3X1YA 3H0KA 1Z47A 4HDCA 3QXJA 2PEZA 4TL6A 4F4IA 3QBTA 1T8UA 2WICA 4JBWA 3UKDA 2IUUA 4QM7A 3AVWA 5FOUA 4B2PA 4PANA 3FPAA 1VG0B 2R9VA 2OXRA 1XD2B 4ZKEA 2WPDA 3RANA 3LBHA 4JLVA 3AVPA 4TTRA 5KUTA 1E2IA 2C03A 1FZQA 2HDNB 1CR0A 5AK0A 3X1DA 3KKOA 1GVNB 1Q1BA 3OEEA 4LYJA 1R8QA 5EE5B 5EE3A 4BZPA 1TF5A 3DEFA 1W7AA 4D4LA 3V4FA 2G1JA 2JJ1A 1D9XA 1IHUA 4D2IA 4DKXA 5G3ZA 3U44A 1MOZA 2PEYA 4J0QA 2YWFA 3S1AB 2ZI3A 1SVMA 1UM8A 2RGNA 2ZYTX 3KJHA 2QAJA 3B8HA 4B76A 3F8TA 3L43A 4MRVA 2R6CA 4X8LA 1DAKA 3RAPR 1RJ9A 4BLPA 1Z8FA 1ZM2A 1N6HA 5BN4A 5IK2D 2IYXA 1JPJA 4Q1FA 4LHVA 1N25A 2XJ9A 4WZAE 4UXIA 4JLAA 1W2GA 4F91B 2IUTA 4Q7JB 3TSOA 1KYIA 2PMKA 5FPSA 3RSOA 2J5XA 1ZUHA 4NYJQ 2RGDA 4R9UC 4Z1MA 1W1WA 3U4QA 5FBVB 2C5LA 4PSKA 2GVDC 4Q4JA 1JAIA 3K0AB 4HLDA 4Z8YA 1VHLA 4Q18A 1M74A 1PLKA 2YVUA 3EZ6A 4M1KA 2ECKA 5H70A 2ZJBA 8OHMA 1UDXA 3JVUA 3DOEA 3SBDA 2V4ZA 1T3LA 3F5FA 5EE9A 3SFVA 2ZAOA 4Z8XA 4ITRC 2QL6A 3W34A 1C1YA 3U44B 4GOKA 5FUWA 1XFAA 3BFVA 2J46A 1KDRA 4Z51A 3PEWA 4Q4HA 2B21A 3EA0A 4FINA 2DFLA 1Z0IA 4P31A 5L3SA 3RVBA 4JJZA 4MH0R 4ACBA 3E70C 4D26A 1JR3A 2WWGA 4PAQA 2JLWA 4I1UA 1RJ9B 1ZD1A 1HURA 2BM0A 3JVVA 5CM9C 1QG4A 2BJWA 2H17A 1KI8A 1E2PA 4DLYA 3EPKA 1NMYA 1T9HA 3THOA 1DTSA 2J87A 3IO5A 4HAXA 1R10A 2OBMA 4Y0VA 3AVUA 2IL1A 3Q85A 4JBXA 5GJWC 2V7QD 5F9FA 2GXUA 1BMFA 2NZ8A 4QGHA 3NHAA 2OBLA 1TF7A 4Q4JB 5G41A 4HLQB 2VHTA 4ZDKA 5H8WA 5KNBA 2GK6A 3T1TA 3FHTA 2FF7A 3WRYC 3TVTA 1G6OA 4B3DA 3C16C 2QGNA 2WIBA 2JLZA 4OHYA 4OI0A 3BGWA 4JLJA 5UKDA 1OXTA 4IOJA 4OK3A 4RD1A 2KWIA 1SKYB 3OAAA 1TL7C 2VO1A 4LJAA 4A4DA 1UKEA 5CJ2A 1TMKA 2BC9A 3NKVA 1ZVQA 2ZE7A 2O8EB 1OJLA 1GDDA 2P5SA 5GJCA 4Q4HB 5AR1A 4U00A 3RS5A 3I32A 3ADKA 3NBYC 3OIYA 1UBCA 4PPGA 4B35A 4V0KA 1FMJA 4A2PA 1CJKC 2BKEA 2J0VA 4Q9HA 1IBRA 3ZIAD 1CR4A 3MWJA 1KAGA 3TSZA 4OHVA 3NDPA 2OCAA 1HE1C 3FMFA 1U0HC 2QZ4A 3CONA 3U7FB 5HZKA 1IN7A 2REOA 3NEJA 4YXWD 1MR3F 1E9FA 1P9WA 4LJ8A 4CT5A 4E22A 4EFNA 4RKEA 4H1VA 5EXXA 1Z08A 1GRQA 1WE2A 1YR7A 1NIJA 2GAAA 1ZU5A 1JPNA 1S4QA 1SKQA 4I1OA 4GRAA 4KODA 4BPBA 4BECA 2JLVA 2RGXA 2VF8A 2OM2A 4RVCA 1AS2A 4UKDA 4HLCA 4TSFA 2XTNA 4EPYA 1Z29A 1Q44A 3UK6A 4C0QC 2OLJA 1Z22A 2BMDA 3B9QA 3RWMB 2P6RA 3GLHB 4RCYA 2ZTSA 3DOFA 1CRQA 3DO6A 2D74A 3DKVA 4MRSA 3VHXA 4XSHA 2CL0X 3SZRA 3FKSA 4HZIA 4JL8A 4RSGA 2ZXUA 1VG9B 2EVWX 4LJYA 4C4PA 1XRJA 4JSTA 4URUR 4WW0A 2L0XA 2WAYA 4PHHA 1OLOA 3ADBA 1KK2A 5J40A 5L3RA 1KSGA 2HF9A 4OQFA 3QPVA 5IDVA 3QG5A 4AWXA 1XDBA 5HPYB 2YZ2A 4QRHA 3U60B 1CLUA 5CIQA 4PPFA 1JI0A 4TTPA 1ZYUA 2VHUA 1NLZA 3ZS9A 4W5WA 2ERXA 2HJVA 2FFQA 4BUJA 4WVFA 1R0ZA 1YZTA 4DLZA 1UAAA 3TJZA 4YDHB 4LY6A 4ZI3A 4YMSA 4Q4LA 3W9YA 2X8AA 4TSFD 4EPXA 2REBA 1OF1A 2Z43A 1XNJA 1P7CA 1E4VA 3VR6A 3GD7A 3SC3A 4EKDA 1VG8A 2VHCA 5FTLA 2RCNA 1NSFA 3SJBA 4B32A 3T1VA 3K70B 2J45A 1G1MA 1XPOA 4PHFA 3KQLA 2HYIC 1SXJA 3T61A 5KPDA 1ZNYA 1ZIOA 2VHJA 4PZLA 3K0SA 1G3UA 2H57A 4Q21A 4PR0A 4JLBA 1E9RA 4IVPA 5HCIA 1E2LA 1KAOA 1NVWQ 1F3OA 4TYPA 4KU4A 5AUQA 1CR2A 5JSZB 1QHHA 1T4GA 4IDHA 5B2ZA 3V9PA 5DISB 4DCUA 5FI0B 1Z28A 2WMNB 4MGKR 2ORWA 3CF6R 5HKKA 2BBWA 2G83A 4HAYA 4Q7KA 4TYWA 4V0OA 1LW7A 1SQ5A 2BCJQ 4B3FX 1N6NA 1N5IA 2WWIA 2IC5A 3IILA 3H2YA 2KBEA 1KO4A 4R2IA 2ZRCA 2CXXA 1Z5ZA 3BAFA 2F3RA 1A7JA 4JT4A 5GVRA 1XEFA 5LD2B 1Z0AA 2YHSA 5CK5A 3ZVLA 3PUYA 4G5OA 3EPLA 2PH1A 3NTUA 2QEQA 5DYIA 4JLDA 1WA5A 3L0IB 4BFYA 1LVGA 4OL0A 2E9SA 1SZPA 4AURA 3VNUA 1SVLA 2QQEA 3CNOA 1GITA 3CH5A 5FPYA 3A36A 1QHGA 2I1VB 4ZIRB 2W0MA 4Q5IA 4CVNA 1ZNWA 4IOKA 2NZJA 1QHXA 3CRQA 5HR5A 2BIFA 4II7A 5J4VA 2GETA 1SVSA 2CL7X 2R62A 1H65A 2PLRA 3AKDA 3M6AA 3MJRA 4P4TA 4PO1A 4NYIR 4ABYA 2IYSA 1SXJB 1AQYA 2GWHA 1G7SA 3UG6A 3SHWA 3G5UA 1D2MA 1IJFA 2O8BA 3EX7C 4LX0A 4FMDF 1ZJ6A 2B7BA 4LHWA 3RSLA 1O3YA 1ZC3A 2QUZA 3FGNA 2IUSA 4W9MC 1QHHB 4FCWA 4M2LA 1AA9A 2ODEA 1S0UA 3THXB 1E2MA 2BVNA 2BDTA 3U3JA 4A8JB 1TQ2A 1KO7A 2P6NA 5JRJA 4NCIA 3PFIA 3THWA 2ZUDA 2G0TA 3K9LA 4IEIA 2IYWA 2X1VA 1XD8A 2FN4A 5KNCA 3IPXA 2KJQA 1MV5A 2CHGA 1A82A 3KJGA 1RW4A 4B6FA 2KB0A 5JZVA 3DPUA 3OEHD 3BWDD 2O8DA 1DAFA 4Q1EA 4AKEA 1N5KA 4EQ6A 3QUSA 5CITA 1Z6XA 4Q1AA 1HT1E 1X1RA 4Q7LA 3QVVA 2ZR0A 2CEAA 2P67A 1FW6A 2ZREA 4JZKA 5SZHB 1SULA 2ZJOA 1VHTA 3DKPA 1G5PA 2KSQA 3I8SA 5C4MA 4PSAA 5GVSA 1E1RD 1KZ7B 3TQFA 4P4SA 1AN0A 1E94E 2W6JA 4DB4A 4EFLA 4G5QA 3QG1A 1KSJA 2MMGA 3WHKA 4CEIA 2BMJA 2LKDA 3EZ2A 1U0LA 1Q0UA 3UXMA 1DARA 3VR1A 2GF9A 1XB2A 4A0HA 1AKEA 2GILA 2WKPA 4Q01A 2XSZA 1N6IA 1J2JA 3NDBB 4FMDB 1HE8B 3HU3A 2XX3A 2W2TA 3UG7A 3WNCA 1E96A 1J8YF 4LWZA 5BN3A 4V0NA 4LJ7A 4OK5A 2AWNA 2OV2A 1LV7A 3THWB 1W46A 3BS4A 4C7OB 4QJ4A 2CBZA 5ELXA 1YVDA 1U90A 3QF4A 3NEYA 3GJXC 4RD2A 2QSYA 1WP9A 3PG5A 2QI9C 4KSBA 1KI9A 2Q9AA 3K0EA 5HCNA 2R6DA 3SJCA 4DLTA 4L15A 1R0WA 2F55A 5DH9A 2O8DB 2GEUA 4EQ6B 2J7PD 4JL6A 5KSYA 1GL9B 2RHMA 3B2EA 3DHWC 2N46A 2FG5A 5FPKA 3A4MA 4NONA 4DJTA 2VLIA 1G7TA 5IHPA 1Z07A 3VR5A 1VCOA 2W00A 4DXAA 4P4SB 1GZSA 1DAIA 1RYFA 4GZMA 5DNYB 2ZRBA 3U7EB 4QM6A 1U81A 2ZRFA 5FBWB 4HAZA 1JEEA 2ZYUX 1YRBA 2DB3A 2XGJA 2AWOA 2RGEA 4PQFA 1Z0KA 3D31A 1PUJA 1RFLA 3EZ7A 3FB4A 1ZCBA 1BS1A 1G5RA 1LS1A 4MRNA 3GP8A 2CK3A 2XB4A 4IKEA 1J7KA 2AL7A 3OE7D 2FV8A 2O5VA 4OYHA 3MWLA 3KB1A 2TMKA 1JECA 2J0UA 3W6PA 1EFTA 4FWIB 4EPWA 3I72A 2QE7A 1NVUQ 4KLZA 1A1VA 3QKUA 3BORA 3GEEA 3KXIA 1PV4A 1FTNA 3SEAA 2ZETA 3L0PA 3QF4B 4NU0A 3ZZ0A 4DUGD 4WA7A 1JEDA 5EQTA 4P4UA 3QSYA 1U2RA 2EW1A 1DAGA 2Z5FA 3ZVRA 5C46F 1R5NA 121PA 5HTKA 1WRBA 5J4KA 4V02A 5TV2A 3GJ8A 1N6LA 3A4NA 2ORIA 2AHOA 2XEXA 3ADCA 2QN6A 4I1SA 1IOZA 2CHVA 2QU8A 1YR8A 1EK0A 1FUUA 2DBYA 4AC9A 3WYAA 4TZ0A 1EX6A 2JJ2A 3LD9A 3IIKA 4C0KA 1IN5A 1QBKC 5FPTA 1HEIA 1Z6GA 5JEEA 4KV9A 1RRCA 1IXRC 2EYUA 4RZUA 1UDWA 3AV0B 4XD7A 4BLSA 1M2OB 4PC1A 3P20A 3AKEA 1E1QA 4HEJA 2JLSA 5FR2A 1EXMA 1YZLA 2HXSA 4CW7A 2HLDD 2WKRA 2YWGA 1LY1A 1E0AA 3VKGA 4QBFA 3K8YA 3CB4A 3WP1B 4XTCS 1ZW6A 3B1YA 1OIXA 2QTHA 4A36A 1HUQA 1Z2AA 1DAMA 3KKQA 2XNDA 1Z3IX 4GL2A 3TBKA 4QNMA 2J0UB 2CJWB 4TT3A 3SYNA 4UJ3A 2J0SA 3MMPA 3NG1A 4HUQA 3OFNA 5F2EA 5DYGA 5JHGB 4F4CA 1XEWX 2ZRPA 3NBXX 1G3QA 4R7ZA 1W44A 4HDOB 1QHSA 5IF9A 1W36D 1PVOA 3I92A 1RVDA 4G5SA 3WNDA 3A4LA 1Q20A 4JJKA 2XTZA 1U94A 3BRWD 1DO2A 3R9XA 2P2LA 3U7HB 3CPJB 3L2OB 3HR7A 1C4OA 1MH1A 1EFHA 1SVIA 3K0FB 2QPAA 5CM8B 5BN5A 4DB2A 4FMBB 1CP2A 1EWQA 1A2KC 4G5RA 2YINC 1G4AE 4E07A 4QOSA 4S35A 3SR0A 2OUKA 2YWEA 2YKGA 4Q03A 3NXSA 3QOFA 2IK8A 4OHWA 4LYHA 3CRRA 3RNLA 3ZYCA 3KKMA 1SGWA 4HYYA 1UKYA 4EJSC 1UJ2A 4U5XA 3RRZA 3SN6A 4M1YA 2D7DA 3AQ4A 1ZM9A 4D0GA 3ICQB 1CRPA 5EP2A 4R2HA 1XCPA 1NNEA 3AUYA 4IEEA 4NYIQ 3TR0A 2QPTA 3C5CA 5JBQA 4MGYR 4L4UA 4BFSA 1N5LA 1PLJA 4O2LA 5GADl 1NRJB 1TADA 4C0AC 2ZI5A 3I3SR 2F3TA 2A5YB 2ZUCA 4JSYA 4US2R 5JI3E 2PT7A 3LLMA 2FFHA 1QHNA 4RZ3A 2I4IA 1E0SA 5TMPA 1QVRA 3U6BA 3TUZC 1S9HA 4HUQB 2NTYC 3PIRA 2ZSAA 2IBMA 3ASZA 1G20E 4HLUC 2E87A 3C15C 3A1UA 3PVSA 1MO5A 3B5JA 5CIWA 2WJGA 3RS3A 3B7GA 2OBNA 1E2JA 2ASEA 3CPHA 2EFEB 5TVKA 5F98A 1KO5A 2F43A 3PV0A 1N6PA 1N0VC 4RCZA 2Z4SA 2J3EA 2GJ8A 1XF9A 3I4LA 5BYKA 1E3MA 2OZEA 2Y8EA 5LB2A 2GXQA 3GLGA 2V1XA 4KVGA 2ZI9A 3LFUA 2WV9A 3PENA 4TL7A 1WMSA 3HWSA 4AI6A 1V5WA 4BQSA 1R4AA 1ZNZA 2Q3FA 3R20A 2Z4RA 3T12A 2NO6A 2G3YA 1XJQA 1TUEA 2V8OA 3GJ3A 5IK2A 1X1SA 1CJVC 2JIZD 1NKSA 1PLLA 1FOEB 2GCOA 5FL7D 4TZ6A 2H8KA 4NZYA 1E2KA 2CE2X 4AKGA 4M9ZA 2IS4A 1FX0A 1VG1A 2P5TB 2C99A 5FBQB 1R8SA 1N2CE 3PJRA 1M7BA 4F7WA 5KU1A 4LSGA 4JLMA 5KO2A 3W8NA 4OBEA 2XTMA 5FBRB 5BXQC 4PPQA 3FFBA 3EIHA 6Q21A 4DSOA 3BBPA 1X3SA 1E9BA 1U0JA 2BMFA 4GSYA 2CCGA 1UBFA 4AKIA 3TH5A 2F7SA 1AGRA 1T5IA 4BEBA 4LJ9A 1AS0A 4A6PA 3QPUA 4KITB 4H9GA 4LC1A 3AF0A 3HP1A 621PA 4G01B 4LPKA 4YONB 2GZAA 4JVSB 1QHYA 2AD1A 2FDCA 4C0BA 2D4HA 3EAQA 2O0KA 3PEVA 4KHZA 3GQBA 5EP1A 1ZC4A 3AF3A 1Z83A 2GEDA 4G5GA 5FUXA 4OHZA 1A2BA 1W5TA 2GJ9A 3HR8A 3T1OA 2FEOA 1J70A 4OJQA 1YR9A 3QEOA 1GKIA 2QAGC 3KFVA 3ZD7A 1NVVQ 1G291 3I5YA 2OAQ1 3BERA 3BD9A 2VP2A 3A1WA 4KCGA 1MO6A 1E32A 2EWWA 1G9XA 1SKYE 3IIMA 2RGGA 1KGDA 2UZ3A 1DG1G 3AGPA 3VKWA 4BFXA 1E2EA 4Q1CA 2ZRAA 3OZXA 1FX0B 1ZBDA 2ODNA 2YOHA 4IDNA 4L9SA 4PSVA 2V7QA 1H8ED 1ZAKA 5TDHA 2XAUA 1DS6A 1KK0A 4MYUA 2HT1A 4EAQA 3Q5EA 1W0JA 2A9KA 2ZR9A 4IVRA 2A78A 4BFZA 5C18A 1V43A 1Z6TA 1KOFA 2V54A 5J4LA 1YJ5A 1ESNA 1K6MA 2D2FA 4A1FA 1JR6A 2CLSA 1QF9A 4NCHA 1N3BA 2Q3HA 2XXAA 4L16A 4BE7B 1IXSB 2DWPA 4LGMA 1JR3E 1J99A 1VYVA 1COWA 4DLUA 2IYRA 4TMKA 1M7HA 2FGJA 4LHXA 2QP4A 4IXMA 3CUEF 2WJJA 3IQXA 2A30A 2XZPA 2CNWA 4D80A 4NPHA 4PHTA 1W4RA 3TGPA 2FNAA 2ZIAA 4N0EA 2NPFA 2JAQA 4PAMA 4KSCA 3UWKA 2BHRA 2J41A 2QMUA 5AWFC 4PC3A 4RD0A 3ZIAA 2R65A 1EG7A 1TX4B 1NL3A 1R7RA 4HZUA 2WSSD 4ZDIA 1Y63A 3QENA 5FOSA 4FMCF 3THYA 1Q21A 2RGCA 4RFVA 2F1HA 2AKYA 3GLHE 4YXWA 3ZH9B 3U4QB 3SS8A 4NTZA 4N1AA 1W0JD 1VIAA 1ZD8A 2CLDX 1Q57A 2LCFA 2ODBA 3Q7PA 5EXSA 4XSGA 2C98A 1KJYA 2JLRA 4MYHA 4PHGA 1COWD 2IYTA 2O0HA 1OYYA 3KKNA 2RH5A 1S3GA 1II0A 4KYIB 4YMWA 1UPTA 2VHQA 5AJVB 4B44A 2W83A 4URZR 2E1RA 3BFKA 2NPIA 4BEJA 4C0HA 4C0LA 2CNWD 2ZU0C 2ZYWX 3LBIA 1IM2A 3LDAA 1P9RA 1Z0JA 2VSOA 5EJEA 1E2FA 3DZ8A 3EZFA 1GUAA 4UNNA 4ARZA 1KO8A 3AP2A 1MKYA 3C4JA 5JWRA 4BRWA 1VCMA 4TWZA 3NBFA 4NL4H 1NP6A 3OESA 5DSZA 5ANRB 2JDID 1YZKA 1CEEA 421PA 1W36C 4GOJA 1XTIA 4PC7A 1G17A 3FE2A 4X8HA 2ZJ2A 4HZUB 1MRSA 2FA9A 3WRXC 2IHBA 1G3MA 1W2HA 2WJHA 4M53A 3THYB 3BK7A 4TQUS 4D0NA 1JNYA 3W90A 4AIIA 2QTVB 4FMCB 1NN0A 3FKQA 5E7JA 4A2QA 4B3CA 4XTRA 5A5GA 1N5JA 5FBLB 3REGA 4GFDA 3RABA 3EXAA 5H1YA 4F92B 1KSFX 1OFIA 2VSXA 3T15A 5AUOB 3M1IA 2FPLA 2IS6A 5J4HA 2PLFA 4YDSA 4FCVA 4O3MA 1RE0A 1C9KA 1F5NA 3PR1A 5CDFA 1OXUA 1W47A 4ASUD 4B3GA 2KI5A 3HJNA 2ZJYA 5EE1A 3FDIA 5HZHA 1NVXQ 1YRAA 4TMZA 2CMKA 3M4YA 3VX3A 1KI4A 1CU1A 1G8PA 5JFGA 1GKYA 2FMXA 4B48A 4MKIA 1R5BA 4G3XA 4YMTA 4RD3A 4UNSA 2OG2A 4ARZB 2XZLA 2QRZA 2GXAA 4ZCLA 1IONA 3KQKA 1F6BA 3DM9B 3GJ5A 2VQSA 4FIDA 2XB2A 3CX6A 3QE0A 2OCYC 2WBLC 3GLIA 4Q66C 4UNQA 3N2EA 4F38A 2IXFA 2WWFA 3AKCA 2HCBA 2DR3A 1OKKD 4B75A 1SXJE 4OQXA 4D4KA 4PZYA 1Q1EA 3CNNA 3P4YA 2OILA 1GFIA 3FVQA 2IF2A 1J90A 2J1LA 1HH4A 1IY0A 1OH8A 1A4RA 4EJSA 4Q9LA 3KJEA 4D25A 2Z6VA 4KBGA 3TAUA 1UBEA 4DSNA 4K81B 1OIWA 5J5CA 2GTPA 1KY2A 3QXSA 1TNDA 3VU9A 3RS0A 1P6XA 4GBMA 5KSZA 4BFWA 2DWQA 3IDQA 3IKJA 3H86A 3T34A 2G77B 4GP7A 3PUXA 2V9PA 4HLUA 2IA5A 2PX3A 5JHHB 5J4YA 2O8CA 1JBKA 1OH7A 4B2LA 2H16A 4N0DA 1PJRA 2VTKA 3UMSA 4BFUA 1NJFA 3GLIB 2PL3A 221PA 3BXZA 2FSHA 1E2DA 4AG6A 4TLCA 4CYMA 2OFWA 1OB2A 3VR4A 4LYFA 2UKDA 4P0TA 4OQLA 5TB5A 4DLVA 1UBGA 3EWAA 4KVAA 4LV5B 3H1TA 4WZ6A 3OEHA 1KMHA 3EW9A 1XTQA 3NBZC 1ZRHA 1HYQA 4UQOA 2YC4C 2OAP1 2ZR7A 4I99A 4LDJA 5D3MA 1G16A 3KUDA 1WCV1 3M0EA 4PC2A 2CHQA 4AYWA 2AX4A 3EC1A 4EJSB 1E1RA 4DSUA 3SFZA 1P2UA 2NOAA 3UATA 3PUVA 4HB2A 1XU4A 2IWRA 1EWRA 3O8CA 5J47A 4TQ9A 2QP9X 2HUPA 1Q12A 3IEUA 1NBME 5C1BA 1Q1QA 2VL7A 2UVQA 1K8RA 3FYHA 3AGQA 1BYIA 1XTSA 3GFTA 3LXRA 3QJYA 3A58B 4Q9IA 5IT5A 2ZE8A 2CCJA 4OI1A 1R0YA 5SZKB 5KNDA 3WHLA 2X2FA 2BEKA 1OSNA 2DCUA 4HATA 1D2NA 1G5TA 3B9PA 1E9DA 2IYVA 3TK1A 2HT6A 4BGDA 4CIDA 3NC1C 4LCBA 4TMWA 3FHOA 4LV6A 4D81A 1DAEA 1Z6YA 3LW8A 5EZ5A 1QG2A 1Z63A 1L7VC 1JAHA 2WWHA 4XWKA 1NY5A 1TUIA 3TAHA 5F3WB 3EPHA 4LJ6A 3KQNA 2C77A 1G8YA 2ZSBA 1KMHB 3LA6A 2YNMA 4O2RA 4LJ4A 2J7PA 3MCAA 1WF3A 1XXHA 2QAGA 1W0KD 3Q9LA 5D3MB 1SVOA 4BWYA 2C78A 4JBYA 2ZEJA 2VIIA 1XCGB 2CLCX 3CH4B 1CIPA 2FPKA 4JLNA 3VHLB 1ETUA 3AUXA 3VR2A 2O8BB 2ONJA 4XVRA 2RMKA 4WOPA 3P1JA 4Q1BA 2VEDA 3LY5A 2G9NA 3ZJYA 2WWXA 4ZPXA 4DCNA 1GRRA 3KX2A 4Q1DA 2HV8A 4QHTA 1PZNA 1XMSA 2QM7A 4A0GA 5AUPB 3QKRA 3ZVNA 4JKIA 2QMOA 2ZS9A 4QBIA 1UKVY 3AF2A 2F6RA 2PJRA 4DLSA 2ZJ5A 1I2DA 5CJPA 3OE7A 3RLFA 1JALA 5CYPA 1E79D 2GRJA 5JECA 4RJLA 1RRFA 2QM8A 3OIVA 2AN9A 1G3IA 1QRAA 4MITA 5P21A 4DDVA 3W6OA 4AY2A 2Q9CA 2J59A 2GVZC 4HSEA 3OIUA 2IYZA 1G7CA 1KDPA 3VKHA 2D2EA 1E98A 1NBMD 3QKSA 3TSWA 3PITA 1IAQA 1QVAA 521PA 4TYNA 2IS1A 1YZNA 4DUGA 4BRUA 1M6NA 1T6NA 1YZUA 1ESMA 5KSPA 4TMXA 5FR1A 1NVVR 3L0SA 3LO5A 3HPQA 1OB5A 3O8RA 4B3BA 2R6FA 3RRMA 1W5SA 3BH6A 3U3OA 1XXHB 2Q21A 2QAGB 4JL5A 2JASA 2JLQA 5DHAA 3UWOA 4CEIB 2O8FA 2XOKD 2VF7A 4JT2A 4AYTA 3LQRA 4AYXA 4XJXA 5JWOA 1M7GA 1RPZA 2QORA 3U3KA 4A2WA 3U6KA 4PX9A 4A0RA 2OHFA 3QI2A 1G3RA 5LBIA 3PEUA 2FEMA 3U61B 1F2TA 4U7DA 3MUFA 3QKRB 4M8NE 3I5XA 4DDTA 3TRFA 4TLEA 4DC9A 2DWOA 2HLDA 3MLEA 4BASA 5FOVA 3FFAA 1N6KA 3WMFA 2DFKB 4W7SA 1XTRA 2FSGA 2DYKA 3KQUA 3A8TA 3ZQ6A 1KI1A 4LJ5A 2QT0A 4G1UC 1NG9A 2QMEA 3D7MA 4L5BA 2FFBA 4DLWA 3KTAA 4M9XA 3GLFA 1FP7A 1ZINA 5H68A 5JCZA 4Q00A 2OCPA 3QXHA 3GFOA 2JLYA 3TE6A 2JLUA 3QKSB 4HDQB 3LW7A 2P6UA 2YWHA 4DEYA 1KZGB 1HQYE 2VBCA 2NGRA 1O87A 3BOSA 3ZZTA 5DN6D 2FH5B 1MO4A 2AFIE 2DFNA 4IJMA 5CB8A 1KI7A 1FQJA 3REFA 2DHRA 1FFHA 3VAAA 4XWOA 3W3AA 1Q22A 4ZCMA 2EQBA 5EXPA 2FOLA 2IX3A 4IFBA 4ZV4A 1JQLB 1OHHD 2GCNA 2GHIA 4V03A 3C8UA 3IBGA 4A6XA 4A92A 3TUIC 4MKFA 4B47A 1WXQA 1ZCAA 2X19A 2GKSA 4M1SA 2FZ4A 1E6CA 1E2GA 4FW9A 2V55B 1N0UA 5CYOA 2A5GA 4DDWA 2GXSA 3RS2A 5B30A 1M1YE 3QEJA 2VP6A 1CR1A 3N5CA 2IS2A 1CTQA 2Q6TA 1KKMA 5K8UA 1F2TB 4NH0A 1VYTA 4KXFB 1MRNA 4C2UA 3IHLA 3KJIA 1XPUA 2YV5A 3DVLA 4O25A 2NQ2C 1SVWA 5CK4A 4TMVA 5KPJA 2C9CA 1L8QA 4KFUA 3HU1A 2ZE5A 5L8VA 3KTAB 4R71A 2EYQA 3GLFB 2CVHA 2YJTD 3GEHA 4BZQA 3LVQE 1CJTC 2H5EA 1W4CA 3X1XA 2HJGA 3WBJA 4EPVA 4DRZA 3E5HA 4O0MA 3TW8B 3AH8A 2ZS7A 2AXPA 2A5JA 1XBTA 1KDTA 2J0QA 1TQDA 1JB1A 2QENA 4OI4A 1LFDB 4PTLA 1P60A 1CBUA 1OH5A 2W0SA 4NHOA 3GJ6A 1FL9A 1Z06A 3VFDA 1RYHA 1H8HD 2JEOA 3ZD6A 4V0ME 3U2QA 1U99A 3G0HA 4XWAA 4A0FA 3RC8A 1XJCA 3TMKA 1GL7A 4MYCA 4URXR 4M4SA 5FL3A 2R6GA 1Q3HA 3ND8A 3FWYA 4PXAA 1JXOA 3KB2A 3QNUA 2WAXA 4ILEA 1E99A 3LX5A 2ATVA 3MFYA 2C04A 2JIZA 3QXCA 4I4LA 4B43A 5FL7A 3A1VA 1P4SA 1FMLA 1E0KA 1R2QA 2I3BA 2J7KA 2FWRA 1OE0A 1U9IC 3LAWA 4RD6A 5DI3A 1EFCA 2CVFA 4ESHA 1KSHA 1GL6A 5JI2E 1GM5A 1DVRA 2ERYA 1CJUC 2W6IA 4M0LA 4A15A 3LWNA 2BWJA 4WBSA 3ONWA 5DLQC 3GPLA 1UKZA 4GOXA 4DHEA 3OHMA 3BIFA 3AM1A 2JJ8A 3O8DA 3DDCA 3H84A 3HDTA 3T5DA 4QGGA 5EP3A 1KK3A 4MUBA 1E9CA 2ZM5A 1XWIA 3EIEA 1T5LA 1G64A 3R9WA 1AS3A 1KTVA 1AIPA 2N42A 4QHYA 3CLVA 4LBZA 4B74A 2A5DA 1NMXA 1YKSA 5DGXA 2V1UA 2A5FA 2B7CA 2CDNA 1FNNA 4NP6A 4D82A 5AJYA 2ZRLA 4X8MA 4ON9A 3NC0C 4LHZA 3R7WA 2F9MA 1KNXA 2LKCA 3AVQA 1P9NA 2N1BA 5EE0A 1LS6A 3WMGA 2HXYA 5FI1B 2EFDB 2ZI7A 3ZZUA 2ZRGA 4MA4A 2D06A 3CX8A 2D7CA 2AXNA 1Q3TA 2WMOB 3D6TB 4QGFA 4IOLA 3RYTC 2FGKA 2FE4A 5FOXA 2QT1A 3K53A 2IYUA 5DE3A 3AP3A 2MSEB 5K8IA 2W6ID 2ZROA 1WBDA 3ZLJA 3W5IA 2ZJZA 4NBSA 3IUYA 3T06B 1HT2E 2QY9A 3MAAC 4PAOA 4CGZA 3QKTA 3EWSA 2AR7A 4IHQA 2B92A 2F9LA 2GDJA 3KXLA 4NCKA 2OFOA 1H8EA 1Z0DA 1KJWA 1CS4C 1I4DD 1G19A 3SHFA 1XMJA 1EFRD 2G88A 2KE5A 4GNKA 4UNRA 4RKFA 4ZKDA 4DLXA 3K0AA 2F1JA 3T35A 3QPWA 1RIFA 3KZ1E 2I1QA 2F43B 3OIWA 2ODWA 4QG7A 4TLAA 4B34A 4B6EA 1AJEA 4DSTA 3SI7A 1UEIA 2QQ0A 1DADA 3RRYA 2R44A 4Q9JA 3CW2A 2YC2C 1FPMA 3MSXA 2H92A 2WM9B 2CE7A 2DY1A 3GLGB 2AK3A 1P2VA 1IXZA 2JATA 5FH9A 3KQHA 2ANCA 1N0WA 1OFHA 2QP3A 3CBQA 2RGAA 1P2TA 5G53C 4KFTA 3A1TA 3Q3JB 4IDQA 3R7WB 4ZO4A 4CF7A 5JWHA 1OYWA 4GMDA 1AKYA 5DHFA 1B23P 2BBSA 3CKLA 2GCOB 3IGFA 2WTUA 5FFMA 2OLKA 3H4MA 2WSSA 2VP4A 3BFXA 1A5TA 3SJZA 4AD8A 1X6VA 4AKHA 1NSTA 4ERNA 3ZS8A 2HF8A 1XD9A 4BFTA 3R8FA 3U7GA 4QJ3A 3LQQA 2ZRHA 3DM5A 1ELOA 2NO9A 5C2JB 5HE9A 3B13B 2WPDD 3U3RA 821PA 2V3CC 2EFGA 3O47A 4E5UA 4GPTA 4PC6A 5KSOA 1DO0A 3D8BA 3L82B 3AVYA 2H1LA 1R5OA 1SVKA 2ZRNA 3NH6A 2Z0MA 1U98A 4EUNA 1E9AA 3OEED 3CPEA 4U02A 2PZGA 1DBSA 2R8RA 2JJ1D 1CULC 3CR7A 4LRWA 2BEJA 5KYKA 1W49A 1CJMA 4C9BA 4Z54A 3PUWA 1VIYA 5CB6A 1VMAA 1KHTA 2IF0A 4TQAA 3SDZA 2ZJ8A 1FNMA 5CLLA 2ZRDA 5EP4A 3VX4A 1T3HA 3RS4A 3A6PC 2O8EA 2PX0A 1G21E 4LUCA 4M22A 2BBOA 3MWKA 4LV8B 1XEXA 4QJ5A 3ETLA 2X2EA 4NYMR 3WXMA 2JDIA 3FMOB 2HYDA 1JQJC 2BJVA 3NHBA 5FTMA 4XVUA 1DE0A 1D8TA 3GMTA 3K1JA 3Q72A 3NH9A 3ZVMA 3AF1A 4LZZA 4CDGA 3V00A 1TTTA 4BZXA 3PQCA 3SQXA 3VQTA 4Q48A 1AZSC 4PZZA 2ZQ5A 3P32A 3W5JA 3GEIA 1T0JB 1KMQA 1PUIA 3LBNA 1GSIA 1TQ6A 2VP0A 4V0LA 4Z1MD 4L9WA 2RB4A 4XVQA 4KI0A 4MGIR 4AG5A 4OJKA 4KFSA 4KFRA 2AD5A 4URWR 4S2EA 3J81k 3X2SA 1L4YA 5TY0A 3ZDQA 4KLNA 5B64A 2XXAB 1VKJA 2FJUA 4XH9B 3EARA 4QFMA 4NCNA 1TQ4A 4ASUA 4URVR 1RRGA 2OFXA 4UJ5A 4MRRA 2B8WA 1P72A 2QNRA 2VYFA 3BH7A 5L3QA 4JVNA 1OFUX 4M1MA 3C5HA 3ZQJA 3BH0A 2PCLA 4MGZR 3GLHA 3GCGA 4IFEA 4DCTA 2YOGA 3FHCB 5JJIA 3D3QA 3T5GA 2A2ZA 4WIAA 1YHNA 4KYUA 4FWTA 4LYAA 4OK6A 1AK2A 2VP5A 1JR3D 1MABA 1EESA 3AVVA 1UFQA 1XEXB 1XTKA 3ASYA 4B3XA 1II8A 3CO5A 3N70A 1JJVA 3I61A 1KDOA 1Q1ZA 1FTSA 2QMHA 4YMUA 4FD2A 3DMDA 5CDFE 2GF0A 3RWOA 4W5JA 4M9SA 1GWNA 1OKKA 2DFTA 2QBYA 2GZDA 1J8MF 2NMVA 1E9SA 3E2IA 3PEYA 3NVAA 4TLDA 1EFUA 1KI3A 4FN5A 1R6BX 2ATXA 5SZJA 4DBLC 5A4JA 3EG5A 4Q9KA 1ZUNB 1BMFD 4LPSA 3LRPA 4B2IA 1IN8A 4E03A 3TNFA 1P61B 4ZCIA 4P33A 1VDZA 2QG6A 3K9GA 2B8TA 2ORVA 2ZUBA 2HEIA 1U8AA 2PZEA 1IQPA 3IO3A 2ZS8A 3C41J 4XOIA 4DIDA 3I73A 2C95A 3OAAD 3Q7QA 3WMEA 3EPJA 1TEVA 3AF4A 5GJBA 5L3QB 4QXAA 3TIFA 3GLIE 2EU8A 1HTWA 1DELA 4DT1A 5BWMA 1I4LD 1XX6A 2BCGY 1EGAA 4BLTA 4RY2A 5AJZA 1E0JA 5JEDA 2AK2A 5FUVA 1GTVA 1T3SA 4IDPA 4MDEA 4TL8A 5JSZA 4DEXA 2C8VA 4MQBA 1ANKA 1ZIPA 3VNVA 1N6OA 3GJ4A 2LWIA 4XIGS 1E2HA 1K5GA 2ZYVX 1MABB 4BFVA 2SHKA 3LVRE 4K46A 4M1TA 2GESA 4OQMA 1XMIA 3LV8A 5EUQB 4YQFA 1II8B 1VECA 4ACAA 2IW3A 3LXXA 5EZ6B 4A82A 3QIAA 3I1FA 3IPYA 4UNPA 3ND9A 2MMCA 2ZITA 5BQ5A 3P26A 1U8ZA 1LTQA 2QBYB 4EIWA 2QRNA 2VA8A 1RRPA 2PMDA 2XJ4A 1P3JA 2BV3A 2X77A 4POAA 2VSFA 4C3ZA 4LC0A 2FPMA 4B71A 1F48A 1BOFA 4YLGA 2AFHE 4CZ2A 1XPRA 2PT5A 1UEJA 2JA1A 1ODFA 1KY3A 4QHSA 1YU9A 4URYR 4DWJA 3K70D 4ZIRA 3BB1A 2VRWA 3K0CA 4LI0A 3K09A 3A1SA 1XZQA 2V6IA 3CNLA 3IEVA 4PFSA 3EA5A 2ZSDA 2JLXA 2YYZA 1FP6A 5FUYA 3WBKA 1G8HA 1QHIA 1U9IA 2XITA 4HAWA 1S1CA 4DZZA 1KI6A 3IHWA 1CKEA 4PQRA 3FKSD 1GOTA 1RKBA 3AKYA 4NKRA 3CWQA 5JJKA 1CF4A 4NMMA 4IRUB 1E4YA 1NY6A 3MWYW 4DT1B 3QVUA 2MSDB 2ZRMA 2QROA 1GNRA 4M1WA 4DIEA 1ZNXA 4CEJA 3CM0A 2ZI4A 4US0R 3THXA 2PBRA 3RRNA 3SNHA 4A9AA 2IYLD 5KOYA 1IJEA 1AGPA 2WJIA 5E7MA 4A8JA 3DZDA 1G7RA 1TF2A 2GNOA 2P65A 2W58A 4LBVA 5G40A 2O52A 3ZGXA 3RC3A 2XZOA 3QQ5A 1BKDR 1TU3A 4B73A 1GIAA 3ICEA 3QXXA 3UPUA 2XNSA 1YR6A 2PCJA 1F2UA 1S9DA 2G0NA 2B6HA 3GJ7A 721PA 1ZMXA 4D0LB 1JXMA 5E7IA 2GBLC 1GILA 4Q4AA 3VTKA 3MJHA 1W0KA 4HB4A 3G82C 4YC7A 1I2MA 4DDUA 3SQWA 1KO1A 4ZDJA 1FQKA 2ZRJA 2JCSA 4MKHA 1W48A 1KK1A 1IN4A 1SXJD 1VTKA 2JGNA 3VU9B 4F4JA 4HB3A 5EXTA 5G3YA 1JJ7A 3E1SA 3B1VA 3AB3A 4M21A 4JYCA 3BB3A 3DMNA 5AJXA 2G6BA 5KDOA 2ZJAA 2IHYA 4RZ2A 4AK9A 2FFAA 1KI6B 5LDDC 1MT0A 1G6HA 4PPNA 3PUZA 4E09A 2ZU6A 2GJKA 1WB9A 1DOAA 2IYQA 3O8BA 5JJLA 1X8KA 4L8GA 2FZLA 5HKKD 1KJZA 3QF7A 3KFXA 2O8CB 2IXGA 2GK7A 2GZHA 3Q5DA 4CEJB 2O0JA 1EX7A 1E79A 3FMIA 3P4XA 1D6JA 1XXHE 3R9IA 4I1VA 1LF0A 3X1WA 4LBWA 4BLOA 3IBYA 4D6PA 2C96A 4G0NA 2Q3MA 4I81A 1BYUA 3B78A 1TEXA 1B0UA 2GJAA 1NBMA 3B1ZA 3Q8XB 3FMPB 2AKAB 4GDFA 2RGNC 4C7OA 5GJVC 3CRW1 2EFCB 4UXJA 1F2UB 2W2XA 5KTYA
chains in the Genus database with same CATH superfamily
1NLFA 3ST7A 2MSCB 1XAIA 2A1TR 5FA5A 1J2EA 3WGNA 1QDEA 4PRZA 5B3JA 3BJRA 3WYGA 4HN4B 1U4NA 1JKMA 3DR3A 1LLDA 2GJSA 2IZ6A 3N2KA 4L74A 1MIHA 4Q4AB 2O19A 3NONA 3GGSA 3HDHA 4CTMA 4B9AA 2OWEA 1VSTA 3C14C 3CZ5A 3NIBA 4IOMA 2WU3A 4W5OA 3SJAA 1ONBA 3PNSA 1T1JA 2OCBA 4Q05A 2PBZA 5BVHA 1DEKA 1LQ2A 4KKXB 3C1AA 3OBIA 2BE7A 5GZ1A 3BWYA 1DC8A 2WOOA 1Z3CA 1GVHA 3RTEA 3VU8A 4HDMB 4L0QA 4L08A 4MP6A 3E81A 1K8YB 3ZDBA 2PKCA 1VB3A 3B6EA 3O1IC 4AL4A 5LL6P 3VTZA 1FQWA 4QBKA 2H3EA 4J3NA 2ANBA 3MN1A 3EZ9A 1JU3A 1YQEA 3KCQA 1QV9A 3PC8A 3KHUA 3QLEA 4HDAA 5B7GA 2DTEA 1PV1A 2ACWA 3EB9A 3GMSA 4IL5A 2FUG6 4R1UA 1N4AA 5INTA 3TW4A 4X00A 3ZCXA 3V4RA 4K6MA 3UJ3X 4D4JA 4F2HA 4OATA 2IDMA 4EYGA 2YYAA 1W19A 3EASA 2VATA 5C1DA 3PXCX 2W2LD 1FTYA 2ZVPX 1UM9A 1IMOA 3CMMA 5KOIA 3BWMA 3RFCA 3B48A 2YOFA 3KT3A 4DWOA 2AEFA 2ZWPA 3VYUB 1BOOA 5KNCD 2WF9A 1FJ2A 3DOJA 4N6GA 5FTNA 5HRUA 4MPRA 1B93A 4WL0A 1M2EA 3QVXA 1OFTA 2WVHA 4X90A 3VSBA 1YQTA 4BB0A 4CT4B 1T1SA 5NLLA 1RPNA 1HG0A 3U40A 5KS2A 4UW9A 5DULA 5DN6A 1T2FA 1EJBA 1QDLB 1R0LA 2ARKA 4FEYA 2ZSEA 1ORWA 2B99A 3PF9A 1GRNA 4FB4A 4UM7A 3V8BA 2YZGA 2WIAA 5C8YF 2NV0A 3N2KB 1DXHA 3RT7A 4X7MA 1FQOA 3LX8A 4JJIA 2OECA 1FYVA 4LDRA 4ZT3A 4EMUA 5K05A 3S2UA 1VCNA 1VE7A 2W6JD 4IZOA 5DTJA 4E5NA 4YP5A 3AUAA 4BEWA 5HUQA 1L9KA 1Y1SA 2GZSA 2XEDA 4S1NA 2K5UA 4E08A 4PX3A 1OW3B 4XUCA 2BEUB 4BNFA 2FEPA 3RC7A 2BMEA 3WJ1A 3QMPA 4KDFA 3B1XA 4BC1A 3PQ5A 3CVUA 1RKXA 1H6AA 2Q5JA 3TLAA 4WCDA 1DPFA 3CRVA 4M8KA 1DIHA 5EHIA 3RR2A 5DDIP 5AK5A 5D7BA 1WDTA 1B0AA 2BZGA 2QVCA 4Q19A 4G5XA 4ENQA 2XQJA 1Z68A 2BH9A 1FNDA 3KYCB 4KQ2A 4QGAA 3JS5A 1GG2A 3VHQA 3VR5H 2H9YA 3QOWA 4OBXA 4Q9NA 4QKQA 3DEYX 2OO7A 3D8HA 2RH9B 3I83A 3KYBA 1D8AA 4EBFA 2IEYA 2GLTA 1UM9B 5D6OA 1LZKA 4IV0A 3TEMA 1VLVA 2Q0HA 4OKNA 3RRBA 1R4NA 2FVYA 2Y27A 2A7QA 4K8OA 3TGWA 1M0EA 3FSJX 4ZGGA 1F6WA 1M8PA 2J3DA 4HL6A 3RQSA 1OILA 5BOVA 4ZJUA 3MWDA 1D5CA 1WQ1R 3ITKA 3AFOA 2XUKA 1DPGA 2R00A 2X4LA 3PRYA 2CGEA 4BNWA 4GZLA 4IDOA 1I1OA 5HQ3A 3TXAA 4WLEA 2CY0A 2AOUA 4GBJA 3GJ0A 2QN7A 1AUOA 5HILA 4DUZB 1T0HB 1ZP6A 4Z3KA 5A5DA 3PHJA 2WUWE 3UBMA 5HS4A 1GZDA 3GVPA 5BO5A 1OFUA 4YV1A 3OIDA 3K0FA 4MRPA 1HY3A 3L40A 4G63A 2C7PA 2QRMA 2BM8A 4D3FA 5KTRA 1A9YA 2NO1A 1NN5A 3R1IA 4LKRA 1SUBA 4OH1A 1MA0A 2W22A 5KB3A 3R6TA 4PICA 5AVOA 2IU0A 5AVWA 1LB1B 1E6KA 5CT8A 3MJVA 2C9OA 3UV3A 1TKAA 4YGYA 2KQUA 4YROA 2Z56A 4KO1S 2V3VA 2QGZA 3MG9A 1S3SA 1XL0A 1Z56C 2B4QA 2V0GA 3G49A 4I9GA 1IQRA 4JS0A 5ED0A 3NS7A 5TXGA 3WNZA 1G8FA 1U1FA 3H4IA 4MKRA 3UMRA 1N7GA 3WFIA 4ZHQB 1J2RA 3PNMA 5HKBA 1T15A 4GXNA 5CNMA 3BBLA 4Q47A 6PFKA 3W5UA 4WEQA 1KIMA 3Q9UA 4LHYA 3LNCA 4J3JA 1SBNE 4ARBA 1NW7A 5EHZA 1R6XA 3C7KA 1T8TA 1BO6A 3D0QA 1RYNA 5E4FA 3ZE7A 5CFZA 4DVGA 2IQIA 3P0JA 1HV8A 3KOZA 4UTZA 3G0DA 4DOMA 5LOVF 1ZN8A 2PBPA 2OT3B 2GEKA 3MWDB 5HE8A 1W29A 3M2TA 5KYXB 2C7GA 1FTWA 3EJ6A 1Z36A 3QHPA 3UAOA 3A37A 3VMFA 3L79A 4LQLA 1FYDA 1A4IA 2DPXA 2MSKA 1ISPA 1SELA 2EF0A 1FC0A 3ADDA 1XZIA 2YMPA 4LGCA 4US1R 2NX2A 2AG6A 5EKTA 5CFRA 2FDXA 4KBFA 5HQ3B 1SHZA 5LD2C 2NVUA 2FLVA 2AOUB 4IGKA 1AMOA 5K4HA 1P44A 2VPIA 2XVAA 1U3FA 1GU7A 3L49A 4ZQBA 4B33A 3O1HB 4GP6A 1RE1A 1ZNQO 4PQYA 3OTGA 4OV6B 3UQYS 3MHPA 5JCOC 4WERA 1KNQA 3TCKA 5D5QA 4CF5A 1TZCA 4OHXA 3NBKA 4QECA 3VC1A 5FB3A 1PQPA 4TLBA 1QZXA 4ZZ3A 4LF8B 4P32A 4DIOA 2PLNA 3FWHA 4EDHA 4CI9A 3TPZA 5A4AA 3DAFA 1U5CA 3CIOA 1E1QD 1O9BA 1PBTA 1QFYA 2P9FA 5KJFA 2CKMA 4JBGA 2NU7A 1LBEA 4CR6A 1DBRA 1UIMA 4R41A 1Z6AA 1YKGA 2R1TA 2XVMA 3GOHA 1Z6ZA 1A9TA 1NJ2A 1SXJC 4CWAA 1RWXA 1JA1A 2CCKA 1Z2CA 4OA8A 4P93A 5AICA 5FTJA 3VPCA 1VGVA 1RQPA 3W1EA 4ZI7A 1IN6A 4ZVTA 3K9NA 1OA0A 2VSQA 3L8YA 1UJ5A 4C06A 4QBHA 3SE7A 4C76A 4RDHA 2FG6C 3AM4A 1E3TA 4Y2UA 4XIIA 3ZWCA 4ENUA 1D03A 3U56A 1GP2A 4EPRA 3MA0A 2R66A 4CIVA 3J7AC 3CNHA 3AR7A 1EFRA 4L0MA 3D9QX 2H18A 2F3QA 2KM1A 1RTTA 1R4MB 4E6PA 3AESB 1M1NB 5LKRA 1QKIA 1T2NA 2XR1A 3BIWA 4F4UA 1HR0B 5JLAA 4OQNA 4UBJA 4H3SA 1YR2A 5E95A 3JZMA 1E8DA 3B1WA 4Y0AA 5F73A 2XUDA 3R24A 5TQ2A 1Y8RA 3BFPA 9GPBA 1SHKA 2HO5A 3ZD8A 3PJFA 5CBKA 3KG2A 2DT8A 1GRCA 2H0QA 2AA3A 3FOWA 4ZVKA 1AMUA 4NDZA 4UBKA 3QU2A 5ARCA 1LNZA 4ER5A 4GU5A 3X1ZA 1YFJA 5ECWA 1QAMA 2J9GA 2GBLA 4DCVA 5DBOA 1KF0A 1LDGA 4L4RA 1O2DA 1U2SA 3H8SA 3QIVA 3BXOA 4TZTA 3O8NA 4Z9XA 4DCSA 4D43A 2P0EA 2R47A 4YCDA 5A0TA 3UANA 3R3HA 2RDMA 1RC8A 2BBTA 3PCXA 4KSYA 3EODA 4ESVA 1X1TA 1X7YA 4QUBA 1U7XA 3K2IA 3QU7A 1GU0A 3TQCA 4B4VA 2VWGA 3S5UA 2FPGA 1WXEA 2P9HA 3DCYA 3QXJA 2AXQA 5F78A 2CXRA 3QBTA 1T8UA 2J4CA 4JBWA 4RUKA 4YT4A 3LZDA 1TJNA 4EHAA 2CDAA 4WJLA 3AVWA 1KEZA 2C88A 4PANA 1Q7BA 2R9VA 3U48A 1EK6A 2OXRA 2HQ1A 1Y82A 2ZBVA 1FDWA 4KDCA 3RANA 3UXEA 5TQ0A 1CUXA 1EQ2A 1E2IA 3HMQA 3F5SA 2X8JB 1FZQA 1PSWA 2IHTA 4U2GA 3FG9A 3AFHA 3FBGA 5E3JA 1X1AA 1G66A 2P1ZA 3KKOA 1RDFA 1RZUA 3OEEA 3RKRA 4BJ1A 4TZKA 3KZNA 2I78A 1VMKA 3HXMA 3KELA 1TF5A 3PJDA 1U3UA 4HTAA 4INPA 4D4LA 1W7AA 3UAVA 1RI1A 5G3ZA 1CE8B 1MOZA 5KU7A 1E7RA 2F6QA 1NFQA 4F5EA 4Z3DA 3HBLA 1MD9A 1Y8RB 4F3RA 2RGNA 2RGWA 2QQ5A 2ZYAA 3B8HA 3L7BA 3SYTA 3UAGA 2LIVA 3TNDA 2R1ZA 1TO2E 4MWEA 5HGXA 2XMSA 3L43A 3T8AA 4X8LA 4P35A 3RAPR 1RJ9A 3ISTA 1A5BB 3H5LA 1RQ2A 3DTVA 2AQ8A 1AY0A 1OWPA 2QRLA 1K89A 2F00A 2IYXA 2AZDA 3DE3X 1V35A 3N9IA 4JT9A 2YHUA 1Z73A 1UMKA 2XJ9A 3NHPA 3PQ6A 4JB2A 4LHVA 4O29A 3DV2A 4JLAA 1HDIA 1X7YB 4Q7JB 1KYIA 2PMKA 3IEXA 3PX7A 1GD1O 3L6EA 2J5XA 1ZUHA 5IM5A 3L7CA 1NOJA 2MIIA 4IUDS 3RFUA 1L8OA 3T4UA 2NZ2A 3VH1A 3MB8A 3JWHA 2VDOB 4Y1RA 1YI0A 3VDQA 1ABBA 1SOWA 2DRIA 4PSKA 1CDEA 1XQWA 2GVDC 2LE0A 1DT5A 2FN8A 2P2DA 2VHWA 3AZQA 3AERA 3FRIA 3D5QA 3FSRA 1J0EA 3MBKA 4RESA 3V6LA 4DG9A 2CNOA 3NHLA 3TTWA 2B1IA 3VH2A 2B94A 2YVUA 4UBIA 3GUHA 4FEAA 4DG8A 4LVCA 2OL4A 3U7JA 8OHMA 1V2GA 4N03A 4QSHA 1T3LA 3F5FA 5TQJA 2NU6B 1XTZA 1TD1A 2QL6A 1C1YA 2W4IA 3TRDA 1WDKA 3LL7A 3M70A 4ZYVA 1ORHA 2QE6A 1CW2B 1GV0A 1KDRA 3QH4A 5E2BA 3WGKA 4UATA 4AROA 4CM7A 3PEWA 2HSWA 4Q4HA 2B21A 2GJ4A 1L5NA 5A5FA 4EF4A 9LDBA 1L5GB 4FINA 2YJ4A 3UHJA 4KXMA 3OQPA 2C97A 5SY4A 1TJYA 2HLPA 2JEZA 4ACBA 3NBMA 3GEGA 1JR3A 4AS1A 1JLRA 1P1HA 5AD1A 3DDZX 3N28A 4MVJA 6ABPA 3DAHA 1YA4A 1RJ9B 1R74A 2VQDA 5CM9C 4P98A 2DEUA 2R7MA 1YD7A 4E5YA 1DJQA 3DTVB 4IXTA 3QWHA 5GAJA 3ZBPA 2HPHA 4FI3F 3SS9X 4DLYA 3V7UA 3WGLA 2XODA 4P4LA 2R4QA 3D2AA 1Z4LA 4MQ6A 1DKRA 1G0NA 1YB7A 2H5JA 2PKQO 4WUTA 2LW7A 3OZVA 4FONA 2Q3DA 3NWPA 3Q85A 3TMAA 1I13A 3GGOA 3KSUA 4CM1A 4QDZA 1BMFA 2A9FA 3LUBA 3Q4GA 4Y1RB 2WJWA 4BATA 4UHCA 2VOEA 2N3ZA 3GNLA 3GLQA 1TF7A 3NHAA 1ST3A 3RUPA 3UV7A 1DV1A 4HLQB 5HP4A 5EPOA 4RMJA 2XRZA 3AERB 4JI8B 1NW4A 3DE5X 4QPJC 5BRJA 4B3DA 4LOIA 4A10A 2JLZA 2C7QA 4J0GA 1TI7A 4RMHA 1PK9A 1Q14A 4OHYA 2RJOA 2OBYA 2QRPA 3OCYA 4NJMA 1Y9ZA 2QNIA 1H2FA 4MXDA 4RD1A 4BP3A 2Z6QA 4LJAA 1MQ9A 1Z2NX 3L8CA 3BF7A 5B12A 2BC9A 1Q0TA 1SCDA 1ZVQA 1U0SY 1VRWA 2B30A 1FFDA 3P0HA 2AFRA 1N8TA 2G5PA 2VK4A 3IUEA 2XVXA 1M76A 1R16A 1C8BA 3KOOA 4TM7A 4Q4HB 3AJ8A 1L5VA 4U00A 3S70A 3U19A 2H8GA 2Q8QA 2XT9A 2CVQA 2G5CA 4V0KA 1TIKA 4ZI5A 3K9QO 3LBYA 2A88A 2BKEA 4DWVA 4F9TA 3PHGA 5LLTA 5TSDA 1ZVJA 1K6EA 4Q9HA 3PVCA 4MULA 4C3OB 2Q0XA 4HNAA 4YJ3F 1HC7A 2WB4A 4AP9A 5IKPA 4KQJA 2P35A 3NDPA 5HDBB 2R0QC 3AR9A 3DLHA 3O1LA 3OP4A 4DLBA 3V2IA 1UOQA 4BMNA 5JH7A 1VDMA 3ORRA 2REOA 3NEJA 1KC1A 1NLMA 2BFCA 2CNLA 3NETA 1FS5A 1KFEB 4LJ8A 4EY7A 4WBNA 4AY5A 4A8PA 2XLCA 2JG3A 1JHZA 1NIJA 2PU5A 1ZU5A 5F64A 1L3BA 1WNTA 2CMGA 5CX1B 5M3BA 5GTDA 2RGXA 3ELYA 2JLVA 2PXXA 4H7JA 5AI6A 3U37A 5BSFA 2LCIA 3NGMA 4HNUA 1QNFA 1MVLA 1WCXA 4DR6B 1AS2A 2PSFA 4DIUA 4G4SO 4TYYA 5AOBA 3MINA 1XLVA 1XLTC 4DGSA 3DZKA 1ZA2A 3B70A 2JH3A 3L8HA 3UK6A 2OLJA 2GPSA 4S0XA 3RWMB 4RTRA 3I1YA 3GLHB 1BS2A 1TC1A 4RCYA 4OIFA 4GKKB 1CRQA 1TYCA 3PKIA 3Q8LA 2D74A 2PRKA 1CCWA 2JHCA 3DKVA 3LP8A 4MRSA 4NJMB 4O1MA 4R1LA 3T95A 3O4VA 4G36A 4K3UA 4C7BA 3FVVA 2RHGB 2KLBA 1JS1X 4GXQA 4NICA 4RSGA 3H87A 2EVWX 1POWA 2H0RA 2ZXUA 2ZM6B 5BQOA 3DVSX 5FHRA 5B3KA 2L0XA 4PHHA 3MB5A 1KK2A 2YJ3A 4GH5A 3OC7A 4EHIA 2H1OA 4YAFA 4H0NA 1OZHA 2J3HA 3OECA 3HUEA 1BA2A 2DQ4A 3OOSA 5HPYB 2YZ2A 2ACKA 2NXCA 3AEUA 3UWPA 2UAGA 3EVCA 5EGNA 2JD1A 3A9VA 1JI0A 3FJOA 2GTHA 4PS0A 4TTPA 4TQGA 2OZVA 5JZSA 4KXVA 2Q45A 1CUCA 4DJAA 3A0UA 2ISSD 4QU9A 1WUTA 2OB2A 4QQ8A 2HA4A 2PZKA 2QX4A 5ESXA 1DIRA 1R0ZA 5JH7B 4JUAA 5JNWA 2G5TA 4DM3A 3UMCA 5ALUA 1OI7A 1RQLA 2BFCB 3DC7A 3QNWA 3UWMA 2WP0A 1XA4A 3RIHA 1T8YA 3T8YA 4B0PA 3IUPA 4WBNB 1IAVA 4GX5A 3HB4X 3PC6A 1WF6A 2X8AA 3G2KA 4TSFD 3WLJA 4EPXA 5JO0A 1OF1A 1X7GA 1XNJA 1WB4A 2P4EA 1J0XO 2Z43A 1P7CA 1E4VA 1T9DA 3R44A 4WLUA 4EKDA 2Q1XA 3RUFA 2HQSA 4WFIA 4OXIA 3UUGA 4LY9A 1N9GA 1CZNA 1VG8A 1WM1A 4IJUA 4CL8A 4B32A 5LQUA 1BX3A 1G1MA 5FV7A 3KQLA 4RGBA 2HYIC 3MINB 5KPDA 2FZKA 3RVKA 2H4YA 1D04A 1GKLA 1ZIOA 5B7PA 6AT1A 3TJMA 3GGCA 3KWFA 1G3UA 3K0SA 3UWSA 2O6LA 4Q21A 4UDXX 1M2FA 1Y1LA 2CLKB 3DC2A 3OI7A 4P3XA 4V0RA 1E2LA 1KAOA 4S12A 4EG0A 4K0KB 4BNMA 3CSUA 1F3OA 4GYKA 4TYPA 1QU3A 4KU4A 5ALFA 3V9PA 1E1NA 1AURA 2PUTA 3WLMA 5CD9A 3VZQA 4C6TB 2ORWA 2DUUA 3CF6R 4C43A 4TYWA 1E61A 3DMHA 3EHEA 3OFKA 3WE7A 4CV0A 1XZBA 2DBVO 3NFYA 4KAAA 3LT4A 1JIQA 2J6HA 1SQ5A 3BWEA 3DCJA 2BCJQ 3DL7A 1REQA 1YS9A 3EFHA 1N6NA 2W93A 3PPVA 4FOLA 4MX8A 3TX2A 1HKUA 5CVCA 4U1RA 2H7YA 4CU5A 3AEUB 3NHRA 2ZRCA 3Q87B 5A4MS 1SUSA 5HRCA 2F3RA 2JFQA 1NRIA 1IPHA 1UKAA 3AWIA 3NV7A 4HDKA 4O5AA 4I4ZA 2XXBA 3I04M 3ZIDA 1QIHA 4HSGA 1KOGA 1Z0AA 1E64A 4HBGA 4DCPA 3A1CA 3E5MA 1VXRA 5AMXA 1NNI1 3SX4A 4Y2TA 4BNKA 1WA5A 3EDMA 1K4YA 4GM1A 1LVGA 3ICVA 2E9SA 1SZPA 4MYDA 3WA7A 2H65A 1SVLA 1Y1QA 4EI7A 3R23A 3TVYA 4YV0A 5IZCA 3CNOA 1Q7EA 4C7OA 4ZAFA 2JH9A 2RK4A 1LQUA 3A25A 3HN2A 5FPYA 5EJMA 2PXAA 3A36A 4F12A 2I1VB 3N74A 3BM5A 3NVDA 4G4SP 1ZAYA 1V8DA 2PUCA 1QO0D 2ODPA 1MAVA 1N0IA 2JZNA 2WFLB 2QJRA 2VJYA 1J9ZA 1UWCA 2GETA 2ZPAA 5HIAA 2CL7X 1N9GB 1RQXA 3D1VA 3M6AA 2UU9B 4O2BF 1EQUA 2VTVA 2WG2A 4QAQA 3U7QA 3VU1A 2COUA 4IIBA 3W2TA 3KSDO 5G02A 3STUA 2GWHA 1N2IA 4AWBA 3G5UA 3NIFB 3NAGA 1SM4A 1UXJA 3UK1A 4JP1A 3PGVA 4AG3A 1ZJ6A 2CD9A 1B15A 1QORA 1NRWA 1P9OA 2B82A 5EYPA 5K3FA 3RSLA 1O3YA 4RPGA 3CCCA 1MX3A 4KMOA 2QUZA 3FGNA 4A1OA 2IUSA 1HDRA 1EF8A 2RHBA 4FCWA 5IMBA 3D3NA 4M2LA 7AT1A 3T54A 3M2PA 2DM6A 3E9QA 5DV9A 2QYOA 1M2VA 2IDJA 3PGXA 4ESOA 5KQMA 2WRZA 3OFJA 1BDIA 5DZSA 4N54A 4FUTA 2A86A 1DQYA 1T6YA 3ZU4A 5HNKA 2NVBA 5JRJA 4U18A 1JDSA 4AJEA 3PFIA 5BUQA 1O4VA 1PS8A 2J09A 4YP1A 1KRWA 5IAGA 2GCEA 2G0TA 3CVYA 2E4YA 2YVKA 3L9WA 4E5DA 4UTVA 4HDKB 3FNHA 3T1YB 1IG0A 1XC7A 1MV5A 1AKVA 5JZVA 2PWBA 5F5LA 5ADVA 2CL5A 3BWDD 2O8DA 2GNPA 1XKLA 3GUCA 1YS7A 3QE9Y 2HRCA 1YL6A 1C3LA 4BNUA 3FA2A 5KEIA 5FADA 1HT1E 4Q7LA 1OMOA 2ZREA 5KNCH 5SZHB 1M2HA 3CKKA 1SULA 1O94C 2KSQA 1QIGA 3C5WP 4MS4A 4CCAA 2J9FB 4XM2A 4C07A 3D8UA 2JAWA 2XHZA 1AN0A 2C0QA 3O92A 1R18A 4HOYA 3WHKA 3LPDA 2PPVA 3ONEA 5JS1A 3U7QB 1Q0UA 3JQAB 3VR1A 2GF9A 1VLZA 1XB2A 4ISCA 4MP8A 3RTBA 2NV6A 3H5AA 1XMXA 4OGGA 2G9ZA 2W2PA 1O89A 2GILA 4K2AA 4FDVA 2VFAA 5I9NA 3NAZA 5JV5A 3ZPXA 1ML3A 3K1TA 4Q01A 3SHOA 3O90A 5K3FB 3I30X 3NDBB 4I7EA 4MOWA 3FAZA 1P33A 1DRUA 2ZGVA 1PDVA 2W2TA 4CCYA 4X3OA 3K31A 4G86A 1GCGA 1NQWA 2EKLA 4LWZA 4E2YA 1M2VB 4F4FA 5BN3A 3Q3CA 3B12A 5JS6A 1E3JA 3T9CA 2G07A 5JQGF 5DN9A 1A9ZA 3RGWS 1NF8A 4U2CA 1T24A 1FXWF 4LJSA 5B58T 5KKNB 1RKQA 2IQ5A 4WHMA 4C7OB 4UOZA 3QUTA 3L84A 2EP8A 3QF4A 1WPXA 3GJXC 3GOQA 4HGYA 1PR3A 4LDZA 3W7VA 2Q9AA 3U9LA 1L5LA 3SXUA 2R6DA 3G59A 4LOLA 5T5QA 3RBZA 4Q6WA 2F55A 2O8DB 3O74A 1RVV1 1QRDA 2R4UA 5K3BA 1RXEA 1QK5A 1GL9B 2OBBA 3BHIA 3GWGA 2PUFA 4I9HA 3GYGA 5CCDA 2RHMA 3KUKA 4XDGA 2N46A 4RK6A 1YL7A 2HW5A 2OWDA 3I9V6 3A4MA 4H6PA 1QIJA 4O3FA 5BQXA 5JMWA 2WTMA 1MHTA 4P92A 2XZTA 4WA8A 2FMKA 4MS4B 4XA8A 3OU7A 4N5HX 2MYTA 1E58A 3UUFA 2I54A 2VF5X 4AY6A 4CGZA 5THKA 2ZZNA 1ZO8A 3E9CA 2IODA 1EK5A 1RYFA 2Q1WA 4GZMA 3AI7A 3U7EB 1U81A 3USES 5FBWB 5FI5A 5T67A 1DIGA 5IPFA 1DGQA 4DABA 1PD0A 1WIWA 3AM5A 3PLNA 4NVRA 1XKTA 4YI5A 4WUVA 3DV0B 4OFWA 1J07A 1V3QE 5T3YA 3VSAA 2AWOA 3OG9A 2D1SA 4NENA 4B7AA 2ZXEA 1HDGO 2AGVA 4L9RA 4UHFA 3UO8B 3FB4A 3HBMA 4EWLA 2H52A 1M8KA 4CXMA 3Q7IA 2HPZA 2SICE 3N3BC 1W581 1UFOA 1K4KA 1ZJZA 1AHIA 1QKJA 2AL7A 3NM5A 2VBGA 4CCYB 5T8KC 4YP6A 1YB6A 3HRIA 5BN3B 2ZT5A 3KOUA 1QANA 2HBRA 4FOSA 1E89A 2ICAA 4G2TA 4KRXA 3ZTYA 4Q93A 1EFTA 2CVZA 4EPWA 2FEAA 1RHJA 3BL8A 2C54A 4QYXA 2QE7A 3A6HA 1A1VA 1X15A 4XYEA 2W6NA 1H3FA 4IJ5A 1H05A 2GUWA 1QXSA 4YRQA 3C3WA 1UBTS 2FXIA 5ES4B 3UJAA 3FPEA 4KWIA 4QIHA 2RC6A 3QF4B 4QTXA 2R7KA 4B6OA 5BV0A 1U2GA 3ITEA 5JDIC 4LF4B 4GXRA 1Y6ZA 2BGLA 1DKOA 5EQTA 3SXUB 2Q1UA 3P9YA 3OPQA 4X7PA 2W8ZA 4DBLE 2J30A 4HNSA 4WFKA 1AGYA 2Y92A 3LGXA 2Y6VA 1EFPA 1L7QA 4GMKA 3DLAA 4I4TB 1QFZA 1BEEA 2BI7A 5DKFA 3ILXA 4J03A 5DTRA 3A4NA 2FTKE 3ADCA 2WSBA 3N59A 3ZZNA 4MWSA 1PR9A 2CJXA 1GPNA 2DBYA 1IATA 4GMGA 2P4UA 4X65B 4TZ0A 2JGFA 2W2QA 2FQQA 3DXZA 3CS3A 3LD9A 3HVKA 1HBJA 2KMLA 1IN5A 3C98A 1HEIA 2CBGA 4RCVA 4UUPA 3RJMA 2HIMA 5GOZA 1YI8A 3L18A 2PD6A 1IXRC 5K03A 1M8JA 2IOQA 1M2OB 3JZFA 3P20A 1OGJA 4LS3A 4Z4HA 2NVOA 2O50A 3JYPA 4MTCA 2WKRA 2YWGA 1CNEA 4XJSA 4OYRA 3LL4A 3R6WA 4PSDA 5AVSA 4FR0A 5A5VA 4WH0A 4M7OA 1DKPA 1OIXA 4D8UA 5A62A 4A36A 3EPPA 3CLSD 3VUFA 4HDRA 1YNSA 1JG7A 4IUBS 3DFZA 3O3OB 4F2WA 3G64A 4F8YA 4MJ7A 5JJCA 4O8CA 1BDMA 3SXJA 1AHHA 4QNMA 1M1YA 3CF4A 2J0SA 3QTLA 3IT1A 1VKZA 3W5HA 1HYBA 3MCWA 3G9QA 4UCWA 5G1PA 5JXWA 1SXIA 2A9QA 1H42A 3GUZA 3NG1A 1T4BA 1GSAA 3V2UA 1R50A 3E6AA 4OJTA 3RFVA 4QWMA 4A23A 3VO1A 4F4CA 3K94A 3NBXX 4K9KA 1G3QA 1T1IA 4J75A 1W44A 5I7FA 4CT0A 1EUYA 3EZGA 4CG0A 4IEFB 5CHEA 1W36D 3BGVA 3O8QB 4MWTA 2WFAA 3QLUA 2NZYA 1QAOA 3IAHA 2H85A 1DX6A 1U94A 3BRWD 2C4WA 3MS2A 2QTMA 4TLMB 4L6AA 3VKFA 2HA0A 4DY6A 2V7WA 3CPJB 3OX3A 1MH1A 3CLTC 3OD5A 1TVKB 2AMLA 2GH1A 4G5RA 3I5AA 3DLIA 1TGYA 2R87A 3LQKA 3QFHA 3SR0A 4B87A 4B3MB 3QOFA 2XUAA 4LYHA 2AOTA 3W2IA 3O26A 2R84A 4KL8S 3KKMA 2PX2A 4Y2GA 4HYYA 3B3JA 2O2GA 1WJGA 3H2HA 3IIEA 1M66A 4BQQA 5CGZA 1QF6A 1SBHA 5JNSA 4ZK6A 2QPTA 4NV1A 5ES3A 1NUHA 1HFWA 3DFKA 1XZNA 3C6BA 5GADl 2A0XA 4G56A 1HGXA 2JW5A 4ENVA 1EESA 2JFNA 2XMGA 1BDBA 2ZI5A 2F3TA 4KO4S 4NZPA 4US2R 5JI3E 1M1YB 2A0UA 1N75A 2Q5IA 5CW2A 1KMMA 4MIOA 4JASB 5DNEA 1MAAA 1QVRA 3G1WA 4W7HA 3TUZC 2PAAA 4JBNA 3OTOB 2I62A 2P7HA 3ECAA 5K51A 4RK5A 1K6XA 3E53A 5BSEA 3C15C 2PUAA 5BNWA 4FHGA 4K9OA 1NC1A 1EXNA 2XUFA 5D87A 1O6ZA 3B7GA 4A2CA 3ESXA 5M5BA 2EFEB 4ID9A 2I9PA 5F98A 1KO5A 2F43A 3A1EA 4RNDB 4BNZA 3AIMA 2VJOA 1N6PA 1N0VC 1KWKA 1FDRA 1RYBA 4NOJA 2E5WA 2VWQA 3IUMA 1JQ5A 1DZ3A 5KJEA 5IZCC 2JGLA 2ZJ1A 5LB2A 4DMHA 4BVLA 2V1XA 1PYOA 3MFQA 4G07A 4YCAA 4J7AA 4RZSA 4Z7JA 1XLUA 3M6IA 3UUEA 1WMSA 4IZDA 2JFUA 3ER8A 1JFFA 1V47A 1V5WA 3O94A 5DYTA 3T4XA 3SLGA 4D0SA 4AI6A 5CR9A 3IB6A 1GU1A 1ZNZA 2AOTB 3R20A 4LRQA 4NU8X 2BT4A 4OH7A 4BQRA 2AF4C 3T12A 2NO6A 3GJ3A 2V03A 5IK2A 4Z2YA 3D6MA 4J0IA 4ZZ2A 2MU1A 1QIKA 1X1SA 1CJVC 3G17A 1EKXA 5FWNA 2JIZD 4WPGA 4HAIA 1FOEB 5FL7D 3JQQA 4NFHA 1RXIA 2X0JA 1KR5A 3R5SA 1DRJA 2P8SA 3W7AA 4Q0MA 3GZ4A 4M9ZA 2P5TB 3G2IA 4DGQA 1ISFA 2JI9A 3HCAA 4FZ3A 3LKZA 4QYTA 4DA8A 4XUEA 4F7WA 4D9KA 4I4NA 4HBZA 5KO2A 4NZNA 4B82A 3W8NA 3ZQ4A 1C8LA 2XTMA 3E58A 4NEHB 5FBRB 3VU3A 4DUYB 5ILQA 1U7HA 2FWNA 1UBOS 1W88A 2AJCA 2I3DA 1U0JA 4RF5A 3WKAA 2WP8J 1Z12A 1NONA 3F98A 3QV2A 3SQOA 4BKMA 4KRGA 3R40A 3PIDA 4OXKA 3CVOA 2P0AA 3LK6A 3CGGA 5ALLA 4Q3DA 3OQJA 3AF0A 4L8YA 4Z0HO 3IT3A 4G41A 4JROA 2CLHB 3P5SA 1QHYA 2AD1A 2V58A 4RQUA 2FDCA 1BSVA 1ONSA 3PE4A 4F60A 1K88A 1XI2A 2D4HA 4KHZA 2ZB7A 1Z83A 4FHCA 2GEDA 2UUCB 1X1QA 2VDQB 2XF8A 4IDFA 4TTIA 2P9JA 1OASA 3FDXA 2CXPA 4KQMA 2O2HA 5ADHA 3I01M 1U8FO 3H8JA 1L7DA 1NKVA 3PDIA 2BGMA 2P75A 5ER9A 2KLHA 2W5UA 2PPLA 2J9YB 1JG4A 5IM4F 2DY0A 1JFFB 3AJMA 1E7SA 4OM7A 1GKIA 3JR7A 2QAGC 3ZD7A 3NYRA 2CHFA 4FJ0A 1CY2A 2R4TA 1IHDA 3BD9A 3NVKI 4DYHA 1QQTA 3ORQA 4QTZA 1EXDA 1ZR4A 5JSYA 5KMGB 1M2GA 3R6GA 1OPRA 1TA9A 1UXGA 1GLVA 3MGBA 3IIMA 1KGDA 3A6JA 3HL0A 3AGPA 3VKWA 4YRMA 3MQFA 4MUFA 3QY9A 4BFXA 3AFIA 1MZPA 2ODNA 4C2AA 5JZ9A 4EVSA 1RZRD 4L9SA 5BUZA 2QD2A 4WK4B 2V7QA 1YBFA 1H8ED 5TDHA 2P2YA 4O4LA 2TRSB 2H1CA 1PDOA 2CJPA 2IYFA 1FU8A 1OAAA 2C1ZA 3ZOKA 1NW3A 1XDUA 5C18A 3SNKA 2V54A 1ZGJA 3X3HA 2I3AA 4RTOA 4A1FA 2CT8A 1JR6A 1KEEA 3EEOA 1QF9A 1N3BA 2ZZKA 4HH4A 5JYCA 2Q3HA 1W88B 2PD4A 1BDJA 2J5BA 2P0YA 1IXSB 1X77A 4IG9A 5JSHA 2NO4A 1JR3E 3U16A 1V2HE 4G1CA 1DHRA 1J99A 3CH7A 3PXEA 4MVJE 1COWA 4WZAA 5EKUA 3RTDA 2Q3BA 3HC7A 1LDNA 1NVEA 4TMKA 3MAGA 5KTOA 1L5ZA 4GMHA 4JWVA 2BLLA 4RYDA 2QP4A 6GPBA 3LUCA 4ESEA 5DNVA 5IH3A 4N47A 1A9RA 3C3CA 1IXYA 2IV3A 3D6HA 1IOVA 1FUEA 1L7RA 5E6SB 3RAGA 3FPGA 1D4OA 5AKHA 4YS6A 3N0WA 3PGMA 3K9CA 3L5KA 4KSCA 1WSWA 2YDXA 5JNRA 3M4JA 3GA5A 4QARA 1O4WA 1VIDA 1HYHA 3PTZA 2YXPX 4KR9A 3DBHA 3ZIAA 2R65A 3H4VA 1TX4B 3ITDA 1DUSA 1NL3A 3RLIA 1B8OA 2QXYA 2TMDA 1W9MA 4YB8A 3PYXA 2WSSD 3W06A 3RAJA 3IEIA 3BCSA 3G68A 2HWXA 4R69A 2YWJA 5CM2Z 3KPJA 3MOSA 2WYVA 2AKYA 3GLHE 3R3VA 4YXWA 3ZH9B 5BXYA 3SS8A 3VYVA 1YT5A 1W0JD 2X42A 3W4JA 1VIAA 4EUSA 3QP9A 2LCFA 2WT9A 3O93A 5LZ4A 4LG1A 2ZBPA 2ZPUA 3Q7PA 1H4QA 3BDAA 1PQYA 1KIFA 4DEVA 2AJDA 2IH5A 1PIWA 4C7XA 4MWDA 2B1RA 5ARDA 4YFVA 4EVRA 4ZYTA 5MF6A 2OAEA 3MIIA 4GM0A 3G9UA 3IQDB 3KKNA 2RH5A 1FFAA 1S3GA 3DLTA 1QJCA 1UPTA 2ORED 4FIZA 3N58A 4MRMA 5I7SA 1WSBA 3E9DA 4OHKA 5LDGA 1R88A 2CNWD 1ZH8A 2YYSA 4H6VA 1FYFA 4FYHA 1DB3A 1JLSA 3FMGA 5JIBA 3PX3A 4HWSA 3Q0TA 4KXYA 2VSOA 1WXFA 5EJEA 2H31A 1GUAA 3ZDEA 4RH1A 3IKLA 1GLNA 4AKTA 1PZHA 1KO8A 1SIOA 4MPJA 5JWRA 3HS3A 4BNHA 1VCMA 1ULUA 5ICFA 1M8GA 4L75A 1UKBA 5TPWA 2JDID 3HUDA 3OKPA 2YRWA 4BAUA 2P2NA 3RREA 1CEEA 1JKFA 4JUFA 3HFGA 3S2IA 3BJMA 2VRCD 3DBHB 4OB7A 1Y3DE 4Y9TA 3I39X 4NU5A 4X8HA 4G4IA 3EQ7A 5ER6A 1CIVA 2P9TA 2RKWA 4BWVA 4K1XA 5DLPA 5IAJA 4GC5A 4KR0A 1WX1A 4KRYA 4M53A 3BK7A 4R9VA 3S44A 4WXEA 1UIYA 3W90A 4H60A 1NN0A 5AM4A 4A2QA 5C8VA 3UW1A 1A8PA 1KE1A 1BHO1 3HZHA 1N5JA 3KYIB 5FBLB 5KX5B 1G8MA 3REGA 3RABA 1P1KA 1FW8A 2CNDA 2ZJ3A 2WG1A 4LWOA