3A4RA

The crystal structure of sumo-like domain 2 in nip45
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
GPLGSQELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGLESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NFATC2-interacting protein
publication title Structural basis for regulation of poly-SUMO chain by a SUMO-like domain of Nip45
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 16
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3a4rA00
2N7DA 3ZTDA 2L0FA 4AWJA 2KKCA 4MGYE 1TZ1A 2D3GA 2LUEA 1Z5SB 5HKHA 3ZNID 4ZYNA 1P3QU 2LASA 4I6NB 3H1UA 1K8RB 3N30A 1WGDA 3K9OB 1FXTB 2FCSA 1XT9B 4MGZE 1KLVA 4GXBA 2G4SA 2ZPNA 3PRZA 2IO1B 4WQOB 5D6JB 3AU5A 4M8NA 2I1KA 4CO7A 2K1FA 1CMXB 1WI0A 2BF8B 2MWSB 5KHQA 4DBGA 1TBEA 3WA0A 3PT2B 4B9KA 3DVNV 1Q5WB 4IM2A 2MLBA 5JHAA 3H7PB 1V9JA 4HXDA 5AZGA 4WWPA 1NDDA 1KOTA 1WGYA 2CHXA 4KSLC 4IW0A 2J0KA 4PS8A 2D10A 2KMAA 3BINA 4BBNC 3QC8B 2K6DB 1E90A 3ONSA 4ZRJA 4DHJD 2KC2A 1V5TA 2NS5A 3WIMA 3DPDA 4GIVA 3A1QB 3EFUA 3VTVA 3OLMD 4TKNA 1Z2MA 4W9JA 3ENEA 4CHKA 4W9EA 1WYWB 2C5LC 1WM2A 2DZJA 4EOYA 5G55A 3RZFA 4AJWA 2KFKB 3W1SC 5DPWA 3X23A 3DQVA 2LI5A 2KJRA 4GSWA 1WX9A 1LXDA 2JPHA 2LWPA 2N1WA 3ZW3A 1J8CA 1J19A 2KDBA 2AEHA 2RPQA 2M8SA 2KJHB 4WJNA 3KUDB 2KO3A 4BKSD 3L54A 5TR5A 3A9KA 5CHVC 3VQIA 3CSTA 1GJZA 4NNJB 1E7UA 2MX2A 3Q3FA 4BKGA 4EFOA 4HVBA 1E8YA 2YVCA 3OJ3A 4GN1A 3APFA 3V6CB 3L16A 2JUOA 2K8HA 4II2B 3N3KB 2M1MA 2IZVB 2IO0B 2DENB 2D11A 2MBQA 1WZ0A 2IO2B 1LM8B 1TGZB 3H6NA 4MH0E 4XZ4A 4MGKE 1GC6A 4BFRA 2DYBA 4FLHA 3Q3JA 4HK2A 4RM9A 3DBRI 3ZO5B 1L2NA 1EF5A 3TJPA 1V49A 3L08A 2KDIA 2NPTB 3UIOB 1I35A 2L8JA 5LXHA 2FCNA 2ZNVC 2M0XA 2CHWA 2PPHA 4LDTD 4M8MA 1Y8RC 2XK5A 3EECA 4II3B 5D2MB 4GDKA 4G3XB 5J17A 4RMAA 4WJPA 4URKA 4IM3A 4E71A 1OQYA 2KTRA 3NZUA 3N32A 4J6IA 2ZNVB 2J0MA 1VCBA 2VRRB 3UF8A 4EKUA 2N9XA 1IYFA 1P1AA 2KDFB 2ASQA 2OJRA 1U4AA 1MG8A 2AYOB 3PZDA 1WFYA 2KWCA 4B95A 2KDEB 1WXMA 3M3JA 3NOBA 3PTFC 4CYEA 1F9JA 3JYUA 2GBMA 3EC8A 3DBSA 1UBIA 5DPTA 1H8CA 2MBHA 2WX1A 1R4NI 5GMVA 2MSED 2KD0A 4NY0A 3RUIB 4AOFA 2UYZB 2XBBC 3NHEB 4W9GA 1X1MA 3PLVA 3VDZA 1V81A 3QJZA 4AUQC 2A4ZA 2C60A 1OGWA 1WJNA 1ZKHA 2CU1A 3NY5A 4K7SA 3A9JA 2M17A 2L05A 3DBLI 3KYDD 3M63B 4LDTB 5CTRC 1OEYA 3KUZA 3OAWA 2JF5A 4MSQB 3APCA 1UBQA 2JVCA 3IHPC 3OJ4B 3D32A 2JRIB 3MHSD 3SU8X 4W9KA 2N9PC 4ZDVA 3SD5A 1OTRB 3S2AA 1Q1OA 2JT4B 1YJ1A 2IY0B 1UZXB 2KFJA 2K6QA 1WZ3A 3QHTA 5IA7A 2KQSA 3PVLA 3T8MA 2KLCA 3VHTC 1AARA 3K9PB 4KZCA 1V80A 1WE6A 1WGGA 2LVQA 1VD2A 3AU4A 2J0JA 4HJKA 1HE8A 3NS8A 2K8CA 4E74A 2PE6B 2GMIC 4M0WB 3VAWA 3VTWA 2C9WB 1WR1A 5LXIB 4HCNB 5FR6A 5EDSA 1P98A 4HDQA 2FUHB 4K81A 1ISNA 3ML8A 4GU2A 2KJ6A 1RAXA 3RT3B 2JXXA 4A20A 3MJWA 4E3CA 5J2RA 5KHOA 2PJHA 2D07B 2DAJA 4JL9A 2RD0A 4NQLB 3UQAA 3HK0A 1WX8A 4ANXA 1TTNA 2UWQA 3AULA 4FHKA 1C3TA 3DCGA 3ZRCA 3HIZA 3VVWB 4GDKB 2ZJDA 1D3ZA 4TUUA 3X0WA 4JGHB 3VH4B 2DZMA 1WH3A 4KZ0A 2LRUA 2KTRB 3IFWB 3L0WB 4MSMB 1IP9A 2FNJB 4TV3A 2ZEQA 4HCPB 4MGIE 3VH3B 2LXAA 2MBBB 1R4MI 3RZWC 3KUCB 2D2QA 4ZRKA 4IWOA 4IWQA 5E6OA 1S3SG 2JZ3B 3VUXA 2O6VA 2GOWA 4HWIB 2GBRA 2KTFA 1LQBA 1A5RA 2C7HA 3HM3A 3KH0A 4FHJA 4KIKA 3GZNI 4WJOA 2G45B 1OEYJ 3VUWA 5CHFA 2KK8A 1NBFC 2Z0EB 4EZKA 2IBIB 1LFDA 3A9JB 3CSFA 3PHWB 2KANA 2PE9A 2I1JA 3QK0A 5D94A 3ZIMA 4ANWA 2XEWA 2CS4A 3ZVVA 4BVUC 2WWZA 2MBEA 4G50A 1WRDB 1E8XA 1V5OA 5L95C 2KLGA 1WJ6A 1YD8U 2KX0A 1KJTA 5JH5C 1SIFA 5DCNA 2KN5A 3KYCD 2EMSA 3B08A 3L13A 1GC7A 1SGHA 3JW0X 4ANVA 4JIOU 4G11A 2ZPYA 2PEAA 1E5WA 1WX7A 2HTHA 3B0AA 3R3MA 3L10B 4FA6A 4MJSA 1J0GA 2BYVE 2LVOA 1YIWA 3DVNU 2M4NA 4FULA 3DVGY 4FBJB 2BWFA 4F1SA 1E8ZA 4OVVA 3PLUA 2LXCA 3RULA 4FADA 1V2YA 3TCAA 4IC7B 4DHZE 3B1LX 4RM8A 2MA9B 3GOEA 2C7NB 3PRMB 4LJPB 4GOCA 1QZEA 2BKFA 2HE7A 2O6VD 3QX1A 4DDGD 4WAAA 2LJ5A 3M95A 1WIAA 4HPMB 3UINB 5C23A 1WE7A 2FCMA 3L17A 2MCNB 4AJYB 3QCAA 2NVUI 2A5UA 3TMPB 3H9DA 1H4RA 2JY6A 3HM6X 1UELA 4PYZA 1PQSA 4GDLA 3IG3A 2FIFA 2RR9A 5C1ZA 3R66C 3W1SA 1YX5B 2JRHA 3UQBA 4KDLB 4XC2A 1WMHA 1GNUA 3V60A 4NPNA 3AI5A 2KNBA 4KV2A 1M94A 3PSEB 4K7WA 2GBNA 5DPSA 2BKRB 4JQWC 1E8WA 3RYTA 1YX6B 1WY8A 4DK5A 3QIJA 3TL5A 1I42A 3VFKA 3M62B 4W9LA 2R2OA 1E7VA 2ZZPB 4ZRIA 2G4DB 4X57B 1RLFA 2K25A 3PRPB 4W9FA 2NR2A 2O6VB 4MDKE 4FJVB 3U8ZA 3A9KB 4HLEA 3SDLC 1WR6E 3V62A 3LJ3A 4EUTA 2IY1B 1UD7A 4GB9A 4P7IA 4PS7A 5AZFA 5L83A 3ZDTA 1WJ4A 3WAMA 2BGFA 2Z59B 2KVRA 5IAAC 2N7EA 2O2VA 2MRPA 3KW5B 4TQ1A 2MP2A 2QHOA 2BYEA 2FAZA 3JVZX 3UIPB 4BKSA 2C7MB 3PS6A 4N9F4 3ZNZB 3JSVA 2KX3A 1WJUA 3P2BA 2REXA 2EKEC 2LGDA 5CX3A 3DVGX 3A33B 3ZDMC 2KWUB 1ZW7A 5JHBA 4NAWA 3ECIA 2XK5B 2DYOA 4FN2A 4NQKE 2KHWB 4DDID 4MJSB 4F8CB 3RCZA 2W9NA 3BY4B 1NI2A 3V6EB 2MBOA 4WWOA 2FIDA 1WXVA 3ZTCA 3ZLZA 1WGRA 2N9EB 3LDZE 3QA8A 1ZGUB 1SE9A 1GG3A 2DYMA 2L3ZA 2V1YA 2KOXA 2V4LA 2MQJA 4I6PA 3R7QA 4EZJA 4FJYA 2G3QB 1P9DU 2L0TA 2LD9A 1Q0WB 2DAFA 3TIXA 3U30A 3C0RB 2MW5A 4XX5A 3RD2A 5LLIA 1WGHA 2N1VA 4WJQA 2BWES 2Y5BB 1RFAA 2DZIA 4DXAB 4BKTA 1XD3B 1JRUA 2GBJA 4LCDE 4EEWA 3R7RA 1EF1A 3DBHI 4MELA 3V61A 3PGEA 4GMVA 5DPRA 4ASWC 4TQ0A 4GDLB 5AEKB 3KVFB 3WAPA 2DX5B 1WXAA 4ICVA 2EMTA 2NCNA 1RRBA 1T0YA 2K39A 2WX0A 3PHXB 2CR5A 5E6NA 3QWZB 4A3OA 1WMHB 2L00B 1BT0A 2AWTA 2WYQA 4YL8A 3CF6E 5G2NA 2CKHB 3I3TB 3MTNB 3QARA 4W9DA 1C1YB 3ML9A 3UGBB 4K1RB 4IM0A 2KMCA 3WANA 4KSKC 4DWFA 4IUMB 2ZVNA 4DHJB 1KM7A 2L7RA 4A3PA 3A4SC 3H7PA 3IVFA 5E6PA 4BOSC 3HHMA 3PV1A 4WWNA 2J7QB 5AZHA 1V86A 4NJ7A 4W9IA 2N4FA 4W9CA 3CMMB 3ZNGC 4PYUA 4MEMA 2BPSA 4OVUA 2KXJA 3DDCB 2KQ7A 3PREA 4MM3A 5D7GA 3U7DA 2LGYA 1XQQA 4PS3A 3W1YA 1WF9A 2Z0DB 3ZUNA 2HD5B 2IO3B 4EZLA 3A1QA 2RSUA 4JLCA 3VTUA 2O2VB 4GGQA 2MP2B 3VUYA 3ZKJC 2ZCCA 2LZ6A 2LRWA 4NJ6A 2LVPA 2YLMA 1UGMA 3APDA 2KFKA 1IPGA 1EUVB 3ZRFA 5J18A 3AXCA 3JSVB 3A4RA 2HJ8A 2WDTB 2ZVOA 3WALA 3WAOA 2NBUA 2L76A 5CHWA 2DZKA 3ZNHB 1WM3A 4BBNF 1L7YA 4IWPA 2CHZA 4NAWB 2NBWB 4BOZB 4KDIC 1G6JA 2IYDB 2BYFA 2KWVB 3PPAA 3QQ8B 4HDOA 3TBLD 2JWZA 4W9HA 3SHQA 2R2QA 3T9LA 3NZSA 1YQBA 3ALBA 4I6LB 3DOWA 2ZCBA 4ICUA 5JZEB 2DHZA 4FJZA 3H7SA 3O65B 4LJOB 2JZZA 3EHVA 4ANUA 2B3AA 1EO6A 2AL3A 1WXSA 2NBVB 2V3SA 1UH6A 4DHZB 1GUAB 3IBEA 4KVGB 5BO4B 2AL6A 2FCQA 3QAQA 4G0NB 2GBKA 1P0RA 1S1QB 4IG7B 2KZRA 4KIKB 4HPLB 2LGXA 4B6WA 4AP4C 2K8BA 4K7UA 1V6EA 4F7ZA 2NPTA 2OOBB 3VXWA 2RGFA 2KC1A
chains in the Genus database with same CATH superfamily
3ZTDA 3N1XC 3AE7B 1AW7A 3H1UA 1K8RB 3N30A 3SR6A 1XT9B 4GXBA 3AECB 4WQOB 1N62A 3SFEB 4M8NA 4CO7A 2IDYA 2LJIA 1CMXB 4B9KA 1Q5WB 4IM2A 2MLBA 3H7PB 5AZGA 1P7FA 1TY0A 1KOTA 2CHXA 4IW0A 4Q2JA 3EGRA 2D10A 2KMAA 1MPEA 2K6DB 1MI0A 1YOVB 2NS5A 4KKJA 3ENEA 2RDHA 1WM2A 1FM0D 5G55A 4AJWA 2J53A 1AN8A 3Q6BA 2SAKA 3DQVA 3P4QB 1E9MA 2KJRA 1WX9A 1LXDA 2LWPA 2RPQA 3A9KA 1E0ZA 3CSTA 1GJZA 3VR8B 4HVBA 3OJ3A 2K8HA 5FK9C 2M1MA 2IO0B 2IZVB 2FBWB 2CU3A 4FLHA 3NUHB 2NPTB 1I35A 2ZNVC 2AQ2B 2M0XA 4L1BA 2PPHA 3P4SB 5D2MB 4II3B 4GDKA 4RMAA 4URKA 1OQYA 1NI3A 3NZUA 1XXGA 1VRAB 1U4AA 1WFYA 1GPXA 5MPOA 2DWQA 4B95A 1WXMA 3M3JA 3AEGB 2D3BA 1F9JA 3JYUA 2QIEB 4M00A 1C4AA 1UBIA 5GMVA 2KD0A 3NHEB 3MC0B 4ZRPA 1OGWA 1WJNA 1L4DB 3KYDD 2L05A 4HKZE 2M0AA 2JF5A 2MHJA 3OJ4B 3D32A 4ZDVA 2IY0B 1STEA 3QHTA 2INNE 2KQSA 3PVLA 5IA7A 2BQQA 4KZCA 1WE6A 3AU4A 2J0JA 1JWAD 2GB1A 3GB1A 2WXFA 2JQRB 4M0WB 4L23A 1R4MB 3NJTA 4HDQA 2FUHB 1EWCA 4XGAB 3RT3B 1RAXA 4A20A 4XDDA 4YTNB 2WXGA 3GZNB 5KHOA 3RI7C 5AUKA 1TTNA 2QILA 4OHJA 4GDKB 1NYRA 4MACA 2ZJDA 4RCOA 1QF6A 3X0WA 5BMGA 3L0WB 1HA5A 4MSMB 2ZEQA 2MBBB 1R4MI 2FE8A 3ZXRA 2LHEA 4IWQA 5E6OA 2WQYB 2O6VA 1JWMD 3P4PB 4HWIB 1LQBA 1A5RA 3AH7A 3GZNI 4C4VA 3VUWA 3PO0A 1D5XC 3NZ3A 2I1JA 3CIRB 2CS4A 1WRDB 2DBYA 4HROA 1WJ6A 3KYCD 3B08A 1GC7A 1SGHA 1ZDXA 1ESFA 1VDVA 2PEAA 1WX7A 3KLSX 4MJSA 4M01A 1J0GA 2BYVE 2M4NA 1ZE3D 2WXPA 4OVVA 1TS4A 2W55A 4DHZE 4P16A 3VRAB 4D2KA 3B1LX 4RM8A 2MA9B 2XN9C 2WU5B 4GOCA 1QZEA 2HE7A 2KQ4X 2LJ5A 3HUIA 3AM9A 3UINB 5C23A 2PVOD 4AJYB 2WXLA 3QCAA 2NVUI 3TMPB 2EELA 1QOFA 2B76B 1UELA 1PQSA 3IG3A 2RR9A 1Q10A 3UQBA 5H92C 2KMMA 2KNBA 5JXVA 1M94A 3NG0A 1YX6B 4US8A 5BMIA 1IBXB 1I42A 1L0YB 1J7CA 3M62B 4AS1A 2ZZPB 3EFCA 2G4DB 1RLFA 3PRPB 5D3DA 1DGJA 2O6VB 4MDKE 2ACZB 3B2FA 1WR6E 3V62A 2IY1B 1UD7A 2N0SB 3W2DA 2WXIA 2Z59B 1XO3A 5IAAC 3BZDB 2O2VA 2FAZA 4BKSA 2NTTA 2BW2A 2X8XX 3ZNZB 2L83A 4KGSA 5CX3A 3ZDMC 1YQ3B 2KWUB 5JHBA 3ECIA 2XK5B 4DDID 4MJSB 3AN1A 2W9NA 1NI2A 2MBOA 4TMAB 1WXVA 1WYGA 3AB5A 3ZLZA 1B1ZA 2N9EB 3LDZE 1GG3A 1UF0A 2MQJA 2LUMA 3R7QA 4FJYA 2G3QB 1P9DU 3OG5A 1LO5D 3C0RB 3RFZB 1E7PB 2IJ0A 3AMZA 4XX5A 3RD2A 2N1VA 2DZIA 1XD3B 1LGRA 1EF1A 1KLUD 2LEKA 3PGEA 4LTUA 1BMLC 3KVFB 1T0QC 1DYQA 1N6ZA 4IOIE 2GRIA 1T0YA 5E6NA 4BBNF 3ZJTA 2WYQA 2AWTA 3CF6E 4TSSA 1HXYD 3MTNB 3QARA 4W9DA 5EE9A 4K1RB 3C19A 1TS2A 2K5PA 2KN4A 2PKOA 4XWWA 3RNGC 1V86A 3ZNGC 1QLBB 4OVUA 2KXJA 5D7GA 1K52A 2AX5A 1VZ8A 3RMKC 1L0XB 1XLOA 4EZLA 1ZOYB 3VTUA 1YJIA 2O2VB 2H89B 4P6VF 1C79A 2LZ6A 2LRWA 4NJ6A 1UGMA 1IPGA 3ZRFA 1R7SA 2DZKA 4NAMA 1L7YA 4IWPA 2I2YA 1V1PA 1TIFA 2KWVB 4BZAA 3Q69A 4W9HA 2INDC 2R2QA 1AYFA 1KH0A 1YQBA 2OJWA 3ALBA 4N58A 5G5GA 1ZXIA 1TJEA 4FJZA 3H7SA 4LNOA 1TZOA 2AL3A 1BUIC 1NVID 2V3SA 1UH6A 2WNMA 2FCQA 1RYJA 4LNNA 4HPLB 2LGXA 4AP4C 2K8BA 4K7UA 3VXWA 4JWUC 4RGTA 2KC1A 2L0FA 5EE1A 4AWJA 2INCC 2KKCA 1TZ1A 2D3GA 2LUEA 1Z5SB 1UGJA 1KLVA 4N6EB 2ZPNA 2IO1B 3AU5A 2MWSB 1WI0A 2BF8B 1TBEA 1QOAA 3N1YC 1D4BA 1NDDA 5EE0A 2OHFA 4KSLC 2J0KA 3N9YC 3DHIC 3WCQA 1FEHA 4ZRJA 4ACFA 4DHJD 2KC2A 3R2TA 3Q2AC 1Y56A 4YSYB 3I9V1 4TKNA 1SJED 4W9EA 1A70A 3MC9A 2DZJA 2MEKA 3B2GA 3RZFA 5DPWA 1T6BX 2JPHA 3AE4B 3I5JC 3MC8A 1ET6A 1J19A 1V97A 1F1HA 4WJNA 2RDGA 3L54A 3VQIA 2MX2A 4BKGA 5IP4D 1HQRD 2L32A 1XCQL 2PTLA 4ARCA 2JUOA 5HG2A 2D11A 1LM8B 1TGZB 1GC6A 4HK2A 3TEWA 2ZW1A 3UIOB 2L8JA 5LXHA 3P4RB 4JX1C 1SE4A 1FXAA 2KTRA 4J6IA 2J0MA 2VRRB 3E56A 1P1AA 2XNAC 1HZ5A 2WGSA 3PZDA 2KWCA 2WHIA 2YEPB 2BB5A 3PZ8A 2KDEB 2DNFA 3NOBA 3W5UB 3EC8A 3DBSA 1YN3A 5DPTA 2QMTA 1XF5L 2WX1A 4NY0A 5C2TB 3RUIB 3T3OA 1JWBD 2XBBC 3VDZA 2C60A 4K7SA 3NY5A 4FXCA 4C7YA 2M17A 4NZLB 2WU2B 2WXJA 4MSQB 2JVCA 2JRIB 3NVYA 1OTRB 1VZ7A 1SXTA 1YJ1A 1UZXB 1FNWA 1EM7A 1WZ3A 2K6QA 1L6VA 3NRZA 1ZPSA 3VHTC 1WGGA 2LVQA 1VD2A 1HE8A 4PT5A 3NS8A 4E74A 1TT5B 2PE6B 3BVGA 3VTWA 1VLBA 1SJHD 1M4VA 1FCLA 1QQRA 3ML8A 4GU2A 1HZ6A 3AV8A 1ROEA 5J2RA 2KACA 2QJLA 2DAJA 3UQAA 1WX8A 3AULA 1C3TA 3NVZA 3VVWB 1GAQB 1VR9A 3VH4B 2QEJC 4KZ0A 3KWLA 2KTRB 4C7ZA 2FNJB 1MJDA 1VZ6A 4HCPB 4MGIE 3RZWC 3KUCB 2LMCA 2D2QA 3I63C 4HJGE 2JZ3B 3BK1A 3URYA 2GOWA 2JX5A 3HM3A 3KH0A 4FHJA 1JALA 1L6UA 2ON8A 2KK8A 2Z0EB 3BWUD 2IBIB 1LFDA 3PHWB 2PE9A 2QC8A 4ANWA 1ZP0B 2WWZA 2MBEA 1XEEA 5JH5C 1F52A 5HI1A 2KN5A 5H8YE 3LXFA 1ZUD2 4G11A 3B0AA 3R3MA 3L10B 1YIWA 2ZW0A 5BYRA 4FADA 4LNFA 2J52A 4REZA 3Q3MC 3GOEA 3ZYYX 2O6VD 5AUIA 4IKGA 1YNTE 1WIAA 4YSXB 1WE7A 1HEZE 2A5UA 3H9DA 1GOZA 2JY6A 4RF0A 3EUB2 3ZJUA 4GDLA 1QT9A 1P7EA 2E3TA 2FIFA 5C1ZA 5GXGB 1YQ4B 4KDLB 1E10A 4LNKA 1WMHA 2PVGC 2Y5CA 3V60A 3AI5A 1TY2A 3PSEB 3TEYA 1FD6A 4DK5A 3ABVB 1E7VA 2BVCA 4ZRIA 4W9FA 3RNAC 1EU3A 4A55A 4FJVB 3U8ZA 3A9KB 4HLEA 3FAHA 1QKZA 1QOBA 1IGCA 3TSSA 4P7IA 2N7EA 1UUPA 2MRPA 3KW5B 2QHOA 3JVZX 3UIPB 1SF0A 4N9F4 2N7JA 1WJUA 3P2BA 3AE6B 1UNSA 2REXA 5HFYA 2LGDA 3U52E 3A33B 4ZYSA 3DBHB 4GLSC 2DYOA 4NQKE 2KHWB 4ZRQA 1I4RA 2BS2B 3RCZA 3BYTB 3E9SA 2AQ1B 4WWOA 2FIDA 1ZGUB 1SE9A 3IAM1 3LB8C 3KQ4A 2V1YA 2JYTA 2HDEA 3BVZA 2LD9A 4K3BA 1Q0WB 2MW5A 3P42A 1FRRA 1WGHA 2BWES 1I4XA 2BBCA 3GE3C 1PYWD 1FFUA 3DBHI 4MELA 4TQ0A 4GDLB 3WAPA 4ICVA 1YN5A 1RRBA 2NCNA 2WX0A 2CR5A 3Q8EA 3QWZB 1WMHB 2QCZA 1BT0A 3I57A 1FNVA 5G2NA 1EU4A 2CKHB 3I3TB 1C1YB 1FRDA 4DWFA 1D6EC 4IUMB 1KM7A 2L7RA 4LNIA 5E6PA 4OZBA 5HHDG 4BOSC 4WWNA 4W9IA 4W9CA 4MEMA 1HTOA 3PREA 2KQ7A 4MM3A 5IKCM 2ICIA 1WF9A 2IO3B 4JE3B 3A1QA 1SIJA 2M56B 3ZKJC 3RNFC 1XLNA 3ZGZA 2YLMA 3AXCA 3A4RA 2HJ8A 2WDTB 2ZVOA 2RMMA 3WALA 4KGTA 2L76A 1WM3A 2CHZA 4BOZB 4KDIC 4DQOC 1FMAD 4OVZA 5C3JB 2WXOA 4L2YA 2E6XA 4I6LB 3DOWA 2KVZA 4LJOB 2Z8LA 2JZZA 3EHVA 4MT5A 4K3CA 4USAA 2VZKB 5TSSA 2NBVB 3HVZA 2G9HD 4DHZB 1GUAB 4KVGB 5BO4B 2YEPF 3QAQA 4G0NB 4IG7B 2KZRA 4C4VB 4KGRA 2WDRB 3IXSA 2WXKA 4MGYE 3ZNID 1P3QU 2LASA 1N61A 2V4IB 3K9OB 3BK2A 2JZPA 2W3RA 2INPE 4XE0A 3WA0A 2JYEA 2WXQA 4US9A 4HXDA 1WGYA 4RNAA 3RPFC 4PS8A 1L5PA 3BINA 4BBNC 3QC8B 3DWGC 4MM3B 1E90A 2I38A 3MFGA 1JRPA 1N63A 1V5TA 3WIMA 3A1QB 1C78A 1Z2MA 4W9JA 4CHKA 1WYWB 2HTME 4EOYA 3W1SC 3BYYB 2LI5A 2N1WA 5FR3A 2AEHA 2KJHB 2CJOA 3KUDB 2M19A 1PGAA 4YTPB 4NNJB 1E7UA 3Q3FA 4WURA 4EFOA 4M02A 1N60A 2YVCA 4GN1A 4P1CC 3L16A 3V6CB 4II2B 1J7AA 3GP7A 2MBQA 1K51A 2IO2B 4MH0E 4MGKE 4BFRA 3OWEB 1L2NA 3TJPA 1V49A 2L1AA 2KDIA 1CK1A 2LFIA 2KT7A 3R8BA 2RDBC 2WS3B 4M8MA 1Y8RC 5J17A 4G3XB 3VR9B 4WJPA 3IT6B 1N5XA 3N32A 3UF8A 2ZNVB 2N9XA 4S0RA 1JMLA 2AYOB 1MG4A 5BYSA 2BB6A 1D5ZC 2Y3AA 4CYEA 1DOYA 1F2RI 3PZ7A 3L4PA 2MSED 3U2SC 3ZQ4A 4AOFA 1TS3A 4WQMA 1T3QA 1V81A 3QJZA 3TEXA 2A4ZA 4AUQC 1ZKHA 2DLBA 3M63B 2GLSA 2OEDA 4LDTB 1PUTA 4WIPA 1T0RC 3OAWA 4A9AA 3APCA 3IHPC 3Q8CA 3AEBB 3MHSD 3ETRA 4W9KA 2N9PC 3ZJVA 3SD5A 4B0MA 2Q5WD 3S2AA 1Q1OA 2J4XA 2KLCA 3K9PB 2NTSA 1V80A 4HJKA 4HPPA 3NS1A 3VAWA 2WLBA 2C9WB 1WR1A 3Q8AA 5FR6A 4IDIA 4RH6A 5EDSA 1P98A 2Y5PA 3AE1B 1PDXA 1SE2A 2EKIA 4K81A 3T3NA 2KJ6A 2WXHA 1SB3C 2PJHA 2JSVX 2WXNA 4B0EA 2D07B 4JL9A 2RD0A 4CQNA 1JQ4A 3HK0A 4LLGM 2N9KA 2UWQA 3RNEC 4FHKA 5D3IB 3DCGA 3ZRCA 3HIZA 2DZMA 1WH3A 1KRHA 1K53A 4TV3A 2K9XA 3VH3B 4EE2A 2CJNA 4ZRKA 2IPKD 4IWOA 1S3SG 1C4PA 1V1PB 2NMQA 2V3NA 3CWIA 2V0GA 5IN7A 4KIKA 4WJOA 2G45B 3IT4B 2X38A 2L52A 5CHFA 4YSZB 1FCCC 4HKQA 3ZVVA 4G50A 4C80A 4N59A 1E8XA 1V5OA 3J9CA 5L95C 2KLGA 1I4QA 2FUG1 2JU6X 1IGDA 2EMSA 3JW0X 4ANVA 4JIOU 1FFVA 2ZPYA 4ZHOA 3AE2B 1AWDA 4KKIA 1RM6C 3DVNU 3P63A 3DVGY 1E8ZA 3PLUA 2R61A 3RULA 3TCAA 1KLGD 1YMHE 2C7NB 3PRMB 4UDUC 1SBBB 2BKFA 4RGNA 1L4ZB 3M95A 2MCNB 1VJKA 3DHGC 4PYZA 1NENB 3R66C 2IGDA 3W1SA 1YX5B 1ACCA 4QAYA 1E6EB 2PIAA 1GNUA 1ZDVA 3AEAB 4OZAA 4KV2A 4K7WA 2BKRB 4AQ7A 4JQWC 1E8WA 1PGBA 1GB4A 2IGGA 4W9LA 3AE8B 4X57B 2K25A 2NR2A 3DWMA 3LJ3A 4EUTA 2LGIA 5L83A 1WJ4A 1WWTA 2BTEA 2BGFA 2KVRA 1N5WA 2MP2A 4HEA1 3PS6A 4MH8A 2V3PA 3JSVA 2EKEC 3DVGX 1ZW7A 2HJ1A 1MFWA 2J42A 1WGRA 1C77A 2DYMA 2KOXA 4EZJA 2L0TA 3U30A 1T0SC 4XWTA 1UWMA 1SEBD 3C8YA 1F2RC 1TS5A 4WJQA 1C4CA 3VRBB 4DXGA 3MP9A 4BKTA 1JRUA 4LCDE 4EEWA 4JPSA 5LNK1 4GMVA 5DPRA 4ASWC 1FPYA 2V9HA 4YTMB 5AEKB 1C9FA 2EMTA 3PHXB 2K39A 4O1NA 3W5VB 4YL8A 4M0WA 3ML9A 3UGBB 3WANA 4OW0A 4DHJB 4A3PA 4JWSC 3A4SC 1V8CA 3HHMA 5I4DA 1FNUA 3CMMB 3Q3NC 3U7DA 2LGYA 4PS3A 4KX6B 3W1YA 2Z0DB 2HD5B 2VZKD 4JLCA 1I4PA 2MP2B 5G5HA 3VUYA 2LVPA 2KFKA 3JSVB 1WGKA 3BIID 3WAOA 5CHWA 2NBWB 2MJEA 2IYDB 2BYFA 3PPAA 3QQ8B 2K3UA 3TBLD 2JWZA 1KTKA 4ICUA 3AE3B 3O65B 1DOXA 1WXSA 1NYQA 2GBKA 1P0RA 2W82A 4B6WA 1NEKB 1V6EA 4F7ZA 2OOBB 2RGFA 3NVWA 2N7DA 4BAXA 1K50A 4WAFA 5HKHA 1IUEA 4ZYNA 4I6NB 5FKAC 1WGDA 1FXTB 2FCSA 4MGZE 3FKYA 2G4SA 3PRZA 5D6JB 1SE3A 2I1KA 2W54A 2K1FA 5KHQA 4DBGA 3PT2B 2BS4B 3DVNV 3NVVA 5JHAA 5EE3A 1V9JA 1XLQA 4WWPA 2K22A 3V3XA 1UWXA 3O13A 2D3AA 3ONSA 1XCTL 1MVKA 3DPDA 4GIVA 3EFUA 3VTVA 1MHHE 3B9JA 3OLMD 2C5LC 4WH4A 2VH2A 3SFDB 3DBRB 1KFYB 2KFKB 3X23A 4C56C 4GSWA 2LHDA 1OQQA 4PK1A 1BXTA 1IBXA 3ZW3A 2BS3B 1J8CA 2KDBA 4H2AA 2M8SA 2D3CA 1PGXA 2KO3A 4BKSD 2N9LA 1TKEA 5TR5A 3MHZA 5CHVC 5BMHA 2KYWA 1ZXHA 3HRDD 2MJDA 1E8YA 5IO9A 3AE5B 3APFA 3N3KB 1L0VB 2DENB 2K0PA 1WZ0A 3H6NA 4XZ4A 2DYBA 3ZO5B 1R4NB 3Q3JA 4RM9A 3DBRI 1EF5A 3L08A 2FCNA 4P1BC 2CHWA 3DBLB 4LDTD 1CJEA 2XK5A 3EECA 3HVDA 3RNBC 4IM3A 4E71A 3IAS1 1VCBA 4EKUA 1IYFA 3DHHC 2KDFB 2ASQA 2OJRA 2WDVB 1MG8A 3PTFC 3TEZA 2GBMA 3U7ZA 1H8CA 2QSDA 2MBHA 1I7HA 1R4NI 2UYZB 4W9GA 1X1MA 3PLVA 1WRIA 2CU1A 3A9JA 3DBLI 5CTRC 1OEYA 3KUZA 3TUOA 2MJ3A 2WXMA 1XLPA 4A6QA 1UBQA 3Q14C 3MJ5A 3SU8X 2UU7A 1OQRA 2JT4B 4YXDB 2KFJA 3W9CB 3T8MA 3U4EG 1JWSD 1AARA 4J3OD 1V1OA 2K8CA 1F0ZA 2GMIC 5LXIB 4HCNB 5E6JA 1I4HA 2KAJA 1ISNA 2JXXA 3MJWA 4E3CA 1HTQA 4NQLB 3Q8BA 3FILA 4ANXA 1EWYC 2WDQB 1D3ZA 4TUUA 4JGHB 4A8XC 2LRUA 2PLPA 3IFWB 1IP9A 1QILA 2BT6A 2LXAA 1DOIA 3AEEB 1C76A 3VUXA 1I4GA 3R2IA 4RGOS 2GBRA 2KTFA 4S17A 3UI3A 2C7HA 1FIQA 1OEYJ 2RPVA 1NBFC 4EZKA 1F77A 2QDFA 3A9JB 1T5XD 3CSFA 2KANA 3QK0A 5D94A 3ZIMA 1PFDA 4BVUC 1ET9A 3N20C 1YD8U 2KX0A 1KJTA 1SIFA 5DCNA 3L13A 2TSSA 3H8HA 1E5WA 2HTHA 3FC4A 4FA6A 3ZXVA 4WWMA 2LVOA 4FULA 3AEDB 4FBJB 2BWFA 4F1SA 2LXCA 1V2YA 4IC7B 2G1EA 4ITKA 4LJPB 4RFBA 1RWSA 3QX1A 4DDGD 3Q3OC 4WAAA 4HPMB 2FCMA 3L17A 3FILB 1H4RA 3V05A 3HM6X 3Q8FA 3BVMA 1FXIA 1OFFA 3RN9C 3SEBA 2JRHA 3EA6A 4XC2A 1KF6B 4NPNA 1FO4A 1JW9D 5DPSA 1GB1A 2GBNA 3RYTA 1JCKB 1WY8A 3QIJA 3TL5A 1QOGA 3VFKA 4HRSA 2R2OA 4XYCA 3SDLC 2KDMA 1MHXA 3N1ZC 4GB9A 5AZFA 4PS7A 3ZDTA 3WAMA 3KWVA 4OZCA 4TQ1A 2BYEA 2C7MB 2KX3A 3RNCC 2PW9A 2PMVA 4NAWA 4RGMA 4ZOHC 4FN2A 4F8CB 3BY4B 3V6EB 3ZTCA 3QA8A 2GI9A 1SSNA 2L3ZA 1CZPA 2V4LA 4I6PA 4C00A 2DAFA 3TIXA 4YT0B 5LLIA 1D5MC 2Y5BB 1RFAA 4DXAB 2GBJA 3R7RA 3V61A 4A90A 1B9RA 1TYGB 3AEFB 2DX5B 1WXAA 5BYQA 1J7BA 4A3OA 2L00B 1WXQA 4IM0A 2KMCA 2ONQA 4KSKC 2ZVNA 3H7PA 2AQ3B 3IVFA 3LYYA 3PV1A 2J7QB 5AZHA 4NJ7A 2N4FA 4PYUA 2IGHA 2W3SA 2BPSA 1TKGA 3DDCB 1RFKA 1XQQA 4RF1A 3P1MA 1WSPA 2LGSA 1JROA 3AE9B 3ZUNA 1TKYA 2RSUA 2VH1A 4GGQA 5T8IA 4NJCA 2ZCCA 3GE8C 1YN4A 3APDA 1EUVB 5J18A 1CQVA 2NBUA 3ZNHB 2MH7A 2JXTA 4DXFA 4R3DA 4NAWB 1G6JA 4HDOA 3SHQA 2WP9B 3T9LA 2KWDA 3NZSA 1JWUD 4XDCA 5IOIA 2ZCBA 2WXRA 3GS2A 5JZEB 2D5GA 2DHZA 2SEBD 4ANUA 2B3AA 1EO6A 4YWGG 1ENFA 2BYTA 3IBEA 2AL6A 1S1QB 4ZHPA 2JWUA 4KIKB 4ARIA 2H88B 2NPTA 4LK0M 1YJJA 2XEWA
chains in the Genus database with same CATH topology
2N7DA 3ZTDA 2L0FA 4AWJA 2KKCA 4MGYE 1TZ1A 2D3GA 2LUEA 1Z5SB 5HKHA 3ZNID 4ZYNA 1P3QU 2LASA 4I6NB 3H1UA 1K8RB 3N30A 1WGDA 3K9OB 1FXTB 2FCSA 1XT9B 4MGZE 1KLVA 4GXBA 2G4SA 2ZPNA 3PRZA 2IO1B 4WQOB 5D6JB 3AU5A 4M8NA 2I1KA 4CO7A 2K1FA 1CMXB 1WI0A 2BF8B 2MWSB 5KHQA 4DBGA 1TBEA 3WA0A 3PT2B 4B9KA 3DVNV 1Q5WB 4IM2A 2MLBA 5JHAA 3H7PB 1V9JA 4HXDA 5AZGA 4WWPA 1NDDA 1KOTA 1WGYA 2CHXA 4KSLC 4IW0A 2J0KA 4PS8A 2D10A 2KMAA 3BINA 4BBNC 3QC8B 2K6DB 1E90A 3ONSA 4ZRJA 4DHJD 2KC2A 1V5TA 2NS5A 3WIMA 3DPDA 4GIVA 3A1QB 3EFUA 3VTVA 3OLMD 4TKNA 1Z2MA 4W9JA 3ENEA 4CHKA 4W9EA 1WYWB 2C5LC 1WM2A 2DZJA 4EOYA 5G55A 3RZFA 4AJWA 2KFKB 3W1SC 5DPWA 3X23A 3DQVA 2LI5A 2KJRA 4GSWA 1WX9A 1LXDA 2JPHA 2LWPA 2N1WA 3ZW3A 1J8CA 1J19A 2KDBA 2AEHA 2RPQA 2M8SA 2KJHB 4WJNA 3KUDB 2KO3A 4BKSD 3L54A 5TR5A 3A9KA 5CHVC 3VQIA 3CSTA 1GJZA 4NNJB 1E7UA 2MX2A 3Q3FA 4BKGA 4EFOA 4HVBA 1E8YA 2YVCA 3OJ3A 4GN1A 3APFA 3V6CB 3L16A 2JUOA 2K8HA 4II2B 3N3KB 2M1MA 2IZVB 2IO0B 2DENB 2D11A 2MBQA 1WZ0A 2IO2B 1LM8B 1TGZB 3H6NA 4MH0E 4XZ4A 4MGKE 1GC6A 4BFRA 2DYBA 4FLHA 3Q3JA 4HK2A 4RM9A 3DBRI 3ZO5B 1L2NA 1EF5A 3TJPA 1V49A 3L08A 2KDIA 2NPTB 3UIOB 1I35A 2L8JA 5LXHA 2FCNA 2ZNVC 2M0XA 2CHWA 2PPHA 4LDTD 4M8MA 1Y8RC 2XK5A 3EECA 4II3B 5D2MB 4GDKA 4G3XB 5J17A 4RMAA 4WJPA 4URKA 4IM3A 4E71A 1OQYA 2KTRA 3NZUA 3N32A 4J6IA 2ZNVB 2J0MA 1VCBA 2VRRB 3UF8A 4EKUA 2N9XA 1IYFA 1P1AA 2KDFB 2ASQA 2OJRA 1U4AA 1MG8A 2AYOB 3PZDA 1WFYA 2KWCA 4B95A 2KDEB 1WXMA 3M3JA 3NOBA 3PTFC 4CYEA 1F9JA 3JYUA 2GBMA 3EC8A 3DBSA 1UBIA 5DPTA 1H8CA 2MBHA 2WX1A 1R4NI 5GMVA 2MSED 2KD0A 4NY0A 3RUIB 4AOFA 2UYZB 2XBBC 3NHEB 4W9GA 1X1MA 3PLVA 3VDZA 1V81A 3QJZA 4AUQC 2A4ZA 2C60A 1OGWA 1WJNA 1ZKHA 2CU1A 3NY5A 4K7SA 3A9JA 2M17A 2L05A 3DBLI 3KYDD 3M63B 4LDTB 5CTRC 1OEYA 3KUZA 3OAWA 2JF5A 4MSQB 3APCA 1UBQA 2JVCA 3IHPC 3OJ4B 3D32A 2JRIB 3MHSD 3SU8X 4W9KA 2N9PC 4ZDVA 3SD5A 1OTRB 3S2AA 1Q1OA 2JT4B 1YJ1A 2IY0B 1UZXB 2KFJA 2K6QA 1WZ3A 3QHTA 5IA7A 2KQSA 3PVLA 3T8MA 2KLCA 3VHTC 1AARA 3K9PB 4KZCA 1V80A 1WE6A 1WGGA 2LVQA 1VD2A 3AU4A 2J0JA 4HJKA 1HE8A 3NS8A 2K8CA 4E74A 2PE6B 2GMIC 4M0WB 3VAWA 3VTWA 2C9WB 1WR1A 5LXIB 4HCNB 5FR6A 5EDSA 1P98A 4HDQA 2FUHB 4K81A 1ISNA 3ML8A 4GU2A 2KJ6A 1RAXA 3RT3B 2JXXA 4A20A 3MJWA 4E3CA 5J2RA 5KHOA 2PJHA 2D07B 2DAJA 4JL9A 2RD0A 4NQLB 3UQAA 3HK0A 1WX8A 4ANXA 1TTNA 2UWQA 3AULA 4FHKA 1C3TA 3DCGA 3ZRCA 3HIZA 3VVWB 4GDKB 2ZJDA 1D3ZA 4TUUA 3X0WA 4JGHB 3VH4B 2DZMA 1WH3A 4KZ0A 2LRUA 2KTRB 3IFWB 3L0WB 4MSMB 1IP9A 2FNJB 4TV3A 2ZEQA 4HCPB 4MGIE 3VH3B 2LXAA 2MBBB 1R4MI 3RZWC 3KUCB 2D2QA 4ZRKA 4IWOA 4IWQA 5E6OA 1S3SG 2JZ3B 3VUXA 2O6VA 2GOWA 4HWIB 2GBRA 2KTFA 1LQBA 1A5RA 2C7HA 3HM3A 3KH0A 4FHJA 4KIKA 3GZNI 4WJOA 2G45B 1OEYJ 3VUWA 5CHFA 2KK8A 1NBFC 2Z0EB 4EZKA 2IBIB 1LFDA 3A9JB 3CSFA 3PHWB 2KANA 2PE9A 2I1JA 3QK0A 5D94A 3ZIMA 4ANWA 2XEWA 2CS4A 3ZVVA 4BVUC 2WWZA 2MBEA 4G50A 1WRDB 1E8XA 1V5OA 5L95C 2KLGA 1WJ6A 1YD8U 2KX0A 1KJTA 5JH5C 1SIFA 5DCNA 2KN5A 3KYCD 2EMSA 3B08A 3L13A 1GC7A 1SGHA 3JW0X 4ANVA 4JIOU 4G11A 2ZPYA 2PEAA 1E5WA 1WX7A 2HTHA 3B0AA 3R3MA 3L10B 4FA6A 4MJSA 1J0GA 2BYVE 2LVOA 1YIWA 3DVNU 2M4NA 4FULA 3DVGY 4FBJB 2BWFA 4F1SA 1E8ZA 4OVVA 3PLUA 2LXCA 3RULA 4FADA 1V2YA 3TCAA 4IC7B 4DHZE 3B1LX 4RM8A 2MA9B 3GOEA 2C7NB 3PRMB 4LJPB 4GOCA 1QZEA 2BKFA 2HE7A 2O6VD 3QX1A 4DDGD 4WAAA 2LJ5A 3M95A 1WIAA 4HPMB 3UINB 5C23A 1WE7A 2FCMA 3L17A 2MCNB 4AJYB 3QCAA 2NVUI 2A5UA 3TMPB 3H9DA 1H4RA 2JY6A 3HM6X 1UELA 4PYZA 1PQSA 4GDLA 3IG3A 2FIFA 2RR9A 5C1ZA 3R66C 3W1SA 1YX5B 2JRHA 3UQBA 4KDLB 4XC2A 1WMHA 1GNUA 3V60A 4NPNA 3AI5A 2KNBA 4KV2A 1M94A 3PSEB 4K7WA 2GBNA 5DPSA 2BKRB 4JQWC 1E8WA 3RYTA 1YX6B 1WY8A 4DK5A 3QIJA 3TL5A 1I42A 3VFKA 3M62B 4W9LA 2R2OA 1E7VA 2ZZPB 4ZRIA 2G4DB 4X57B 1RLFA 2K25A 3PRPB 4W9FA 2NR2A 2O6VB 4MDKE 4FJVB 3U8ZA 3A9KB 4HLEA 3SDLC 1WR6E 3V62A 3LJ3A 4EUTA 2IY1B 1UD7A 4GB9A 4P7IA 4PS7A 5AZFA 5L83A 3ZDTA 1WJ4A 3WAMA 2BGFA 2Z59B 2KVRA 5IAAC 2N7EA 2O2VA 2MRPA 3KW5B 4TQ1A 2MP2A 2QHOA 2BYEA 2FAZA 3JVZX 3UIPB 4BKSA 2C7MB 3PS6A 4N9F4 3ZNZB 3JSVA 2KX3A 1WJUA 3P2BA 2REXA 2EKEC 2LGDA 5CX3A 3DVGX 3A33B 3ZDMC 2KWUB 1ZW7A 5JHBA 4NAWA 3ECIA 2XK5B 2DYOA 4FN2A 4NQKE 2KHWB 4DDID 4MJSB 4F8CB 3RCZA 2W9NA 3BY4B 1NI2A 3V6EB 2MBOA 4WWOA 2FIDA 1WXVA 3ZTCA 3ZLZA 1WGRA 2N9EB 3LDZE 3QA8A 1ZGUB 1SE9A 1GG3A 2DYMA 2L3ZA 2V1YA 2KOXA 2V4LA 2MQJA 4I6PA 3R7QA 4EZJA 4FJYA 2G3QB 1P9DU 2L0TA 2LD9A 1Q0WB 2DAFA 3TIXA 3U30A 3C0RB 2MW5A 4XX5A 3RD2A 5LLIA 1WGHA 2N1VA 4WJQA 2BWES 2Y5BB 1RFAA 2DZIA 4DXAB 4BKTA 1XD3B 1JRUA 2GBJA 4LCDE 4EEWA 3R7RA 1EF1A 3DBHI 4MELA 3V61A 3PGEA 4GMVA 5DPRA 4ASWC 4TQ0A 4GDLB 5AEKB 3KVFB 3WAPA 2DX5B 1WXAA 4ICVA 2EMTA 2NCNA 1RRBA 1T0YA 2K39A 2WX0A 3PHXB 2CR5A 5E6NA 3QWZB 4A3OA 1WMHB 2L00B 1BT0A 2AWTA 2WYQA 4YL8A 3CF6E 5G2NA 2CKHB 3I3TB 3MTNB 3QARA 4W9DA 1C1YB 3ML9A 3UGBB 4K1RB 4IM0A 2KMCA 3WANA 4KSKC 4DWFA 4IUMB 2ZVNA 4DHJB 1KM7A 2L7RA 4A3PA 3A4SC 3H7PA 3IVFA 5E6PA 4BOSC 3HHMA 3PV1A 4WWNA 2J7QB 5AZHA 1V86A 4NJ7A 4W9IA 2N4FA 4W9CA 3CMMB 3ZNGC 4PYUA 4MEMA 2BPSA 4OVUA 2KXJA 3DDCB 2KQ7A 3PREA 4MM3A 5D7GA 3U7DA 2LGYA 1XQQA 4PS3A 3W1YA 1WF9A 2Z0DB 3ZUNA 2HD5B 2IO3B 4EZLA 3A1QA 2RSUA 4JLCA 3VTUA 2O2VB 4GGQA 2MP2B 3VUYA 3ZKJC 2ZCCA 2LZ6A 2LRWA 4NJ6A 2LVPA 2YLMA 1UGMA 3APDA 2KFKA 1IPGA 1EUVB 3ZRFA 5J18A 3AXCA 3JSVB 3A4RA 2HJ8A 2WDTB 2ZVOA 3WALA 3WAOA 2NBUA 2L76A 5CHWA 2DZKA 3ZNHB 1WM3A 4BBNF 1L7YA 4IWPA 2CHZA 4NAWB 2NBWB 4BOZB 4KDIC 1G6JA 2IYDB 2BYFA 2KWVB 3PPAA 3QQ8B 4HDOA 3TBLD 2JWZA 4W9HA 3SHQA 2R2QA 3T9LA 3NZSA 1YQBA 3ALBA 4I6LB 3DOWA 2ZCBA 4ICUA 5JZEB 2DHZA 4FJZA 3H7SA 3O65B 4LJOB 2JZZA 3EHVA 4ANUA 2B3AA 1EO6A 2AL3A 1WXSA 2NBVB 2V3SA 1UH6A 4DHZB 1GUAB 3IBEA 4KVGB 5BO4B 2AL6A 2FCQA 3QAQA 4G0NB 2GBKA 1P0RA 1S1QB 4IG7B 2KZRA 4KIKB 4HPLB 2LGXA 4B6WA 4AP4C 2K8BA 4K7UA 1V6EA 4F7ZA 2NPTA 2OOBB 3VXWA 2RGFA 2KC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7D A;  3ZTD A;  2L0F A;  4AWJ A;  2KKC A;  4MGY E;  1TZ1 A;  2D3G A;  2LUE A;  1Z5S B;  5HKH A;  3ZNI D;  4ZYN A;  1P3Q U;  2LAS A;  4I6N B;  3H1U A;  1K8R B;  3N30 A;  1WGD A;  3K9O B;  1FXT B;  2FCS A;  1XT9 B;  4MGZ E;  1KLV A;  4GXB A;  2G4S A;  2ZPN A;  3PRZ A;  2IO1 B;  4WQO B;  5D6J B;  3AU5 A;  4M8N A;  2I1K A;  4CO7 A;  2K1F A;  1CMX B;  1WI0 A;  2BF8 B;  2MWS B;  5KHQ A;  4DBG A;  1TBE A;  3WA0 A;  3PT2 B;  4B9K A;  3DVN V;  1Q5W B;  4IM2 A;  2MLB A;  5JHA A;  3H7P B;  1V9J A;  4HXD A;  5AZG A;  4WWP A;  1NDD A;  1KOT A;  1WGY A;  2CHX A;  4KSL C;  4IW0 A;  2J0K A;  4PS8 A;  2D10 A;  2KMA A;  3BIN A;  4BBN C;  3QC8 B;  2K6D B;  1E90 A;  3ONS A;  4ZRJ A;  4DHJ D;  2KC2 A;  1V5T A;  2NS5 A;  3WIM A;  3DPD A;  4GIV A;  3A1Q B;  3EFU A;  3VTV A;  3OLM D;  4TKN A;  1Z2M A;  4W9J A;  3ENE A;  4CHK A;  4W9E A;  1WYW B;  2C5L C;  1WM2 A;  2DZJ A;  4EOY A;  5G55 A;  3RZF A;  4AJW A;  2KFK B;  3W1S C;  5DPW A;  3X23 A;  3DQV A;  2LI5 A;  2KJR A;  4GSW A;  1WX9 A;  1LXD A;  2JPH A;  2LWP A;  2N1W A;  3ZW3 A;  1J8C A;  1J19 A;  2KDB A;  2AEH A;  2RPQ A;  2M8S A;  2KJH B;  4WJN A;  3KUD B;  2KO3 A;  4BKS D;  3L54 A;  5TR5 A;  3A9K A;  5CHV C;  3VQI A;  3CST A;  1GJZ A;  4NNJ B;  1E7U A;  2MX2 A;  3Q3F A;  4BKG A;  4EFO A;  4HVB A;  1E8Y A;  2YVC A;  3OJ3 A;  4GN1 A;  3APF A;  3V6C B;  3L16 A;  2JUO A;  2K8H A;  4II2 B;  3N3K B;  2M1M A;  2IZV B;  2IO0 B;  2DEN B;  2D11 A;  2MBQ A;  1WZ0 A;  2IO2 B;  1LM8 B;  1TGZ B;  3H6N A;  4MH0 E;  4XZ4 A;  4MGK E;  1GC6 A;  4BFR A;  2DYB A;  4FLH A;  3Q3J A;  4HK2 A;  4RM9 A;  3DBR I;  3ZO5 B;  1L2N A;  1EF5 A;  3TJP A;  1V49 A;  3L08 A;  2KDI A;  2NPT B;  3UIO B;  1I35 A;  2L8J A;  5LXH A;  2FCN A;  2ZNV C;  2M0X A;  2CHW A;  2PPH A;  4LDT D;  4M8M A;  1Y8R C;  2XK5 A;  3EEC A;  4II3 B;  5D2M B;  4GDK A;  4G3X B;  5J17 A;  4RMA A;  4WJP A;  4URK A;  4IM3 A;  4E71 A;  1OQY A;  2KTR A;  3NZU A;  3N32 A;  4J6I A;  2ZNV B;  2J0M A;  1VCB A;  2VRR B;  3UF8 A;  4EKU A;  2N9X A;  1IYF A;  1P1A A;  2KDF B;  2ASQ A;  2OJR A;  1U4A A;  1MG8 A;  2AYO B;  3PZD A;  1WFY A;  2KWC A;  4B95 A;  2KDE B;  1WXM A;  3M3J A;  3NOB A;  3PTF C;  4CYE A;  1F9J A;  3JYU A;  2GBM A;  3EC8 A;  3DBS A;  1UBI A;  5DPT A;  1H8C A;  2MBH A;  2WX1 A;  1R4N I;  5GMV A;  2MSE D;  2KD0 A;  4NY0 A;  3RUI B;  4AOF A;  2UYZ B;  2XBB C;  3NHE B;  4W9G A;  1X1M A;  3PLV A;  3VDZ A;  1V81 A;  3QJZ A;  4AUQ C;  2A4Z A;  2C60 A;  1OGW A;  1WJN A;  1ZKH A;  2CU1 A;  3NY5 A;  4K7S A;  3A9J A;  2M17 A;  2L05 A;  3DBL I;  3KYD D;  3M63 B;  4LDT B;  5CTR C;  1OEY A;  3KUZ A;  3OAW A;  2JF5 A;  4MSQ B;  3APC A;  1UBQ A;  2JVC A;  3IHP C;  3OJ4 B;  3D32 A;  2JRI B;  3MHS D;  3SU8 X;  4W9K A;  2N9P C;  4ZDV A;  3SD5 A;  1OTR B;  3S2A A;  1Q1O A;  2JT4 B;  1YJ1 A;  2IY0 B;  1UZX B;  2KFJ A;  2K6Q A;  1WZ3 A;  3QHT A;  5IA7 A;  2KQS A;  3PVL A;  3T8M A;  2KLC A;  3VHT C;  1AAR A;  3K9P B;  4KZC A;  1V80 A;  1WE6 A;  1WGG A;  2LVQ A;  1VD2 A;  3AU4 A;  2J0J A;  4HJK A;  1HE8 A;  3NS8 A;  2K8C A;  4E74 A;  2PE6 B;  2GMI C;  4M0W B;  3VAW A;  3VTW A;  2C9W B;  1WR1 A;  5LXI B;  4HCN B;  5FR6 A;  5EDS A;  1P98 A;  4HDQ A;  2FUH B;  4K81 A;  1ISN A;  3ML8 A;  4GU2 A;  2KJ6 A;  1RAX A;  3RT3 B;  2JXX A;  4A20 A;  3MJW A;  4E3C A;  5J2R A;  5KHO A;  2PJH A;  2D07 B;  2DAJ A;  4JL9 A;  2RD0 A;  4NQL B;  3UQA A;  3HK0 A;  1WX8 A;  4ANX A;  1TTN A;  2UWQ A;  3AUL A;  4FHK A;  1C3T A;  3DCG A;  3ZRC A;  3HIZ A;  3VVW B;  4GDK B;  2ZJD A;  1D3Z A;  4TUU A;  3X0W A;  4JGH B;  3VH4 B;  2DZM A;  1WH3 A;  4KZ0 A;  2LRU A;  2KTR B;  3IFW B;  3L0W B;  4MSM B;  1IP9 A;  2FNJ B;  4TV3 A;  2ZEQ A;  4HCP B;  4MGI E;  3VH3 B;  2LXA A;  2MBB B;  1R4M I;  3RZW C;  3KUC B;  2D2Q A;  4ZRK A;  4IWO A;  4IWQ A;  5E6O A;  1S3S G;  2JZ3 B;  3VUX A;  2O6V A;  2GOW A;  4HWI B;  2GBR A;  2KTF A;  1LQB A;  1A5R A;  2C7H A;  3HM3 A;  3KH0 A;  4FHJ A;  4KIK A;  3GZN I;  4WJO A;  2G45 B;  1OEY J;  3VUW A;  5CHF A;  2KK8 A;  1NBF C;  2Z0E B;  4EZK A;  2IBI B;  1LFD A;  3A9J B;  3CSF A;  3PHW B;  2KAN A;  2PE9 A;  2I1J A;  3QK0 A;  5D94 A;  3ZIM A;  4ANW A;  2XEW A;  2CS4 A;  3ZVV A;  4BVU C;  2WWZ A;  2MBE A;  4G50 A;  1WRD B;  1E8X A;  1V5O A;  5L95 C;  2KLG A;  1WJ6 A;  1YD8 U;  2KX0 A;  1KJT A;  5JH5 C;  1SIF A;  5DCN A;  2KN5 A;  3KYC D;  2EMS A;  3B08 A;  3L13 A;  1GC7 A;  1SGH A;  3JW0 X;  4ANV A;  4JIO U;  4G11 A;  2ZPY A;  2PEA A;  1E5W A;  1WX7 A;  2HTH A;  3B0A A;  3R3M A;  3L10 B;  4FA6 A;  4MJS A;  1J0G A;  2BYV E;  2LVO A;  1YIW A;  3DVN U;  2M4N A;  4FUL A;  3DVG Y;  4FBJ B;  2BWF A;  4F1S A;  1E8Z A;  4OVV A;  3PLU A;  2LXC A;  3RUL A;  4FAD A;  1V2Y A;  3TCA A;  4IC7 B;  4DHZ E;  3B1L X;  4RM8 A;  2MA9 B;  3GOE A;  2C7N B;  3PRM B;  4LJP B;  4GOC A;  1QZE A;  2BKF A;  2HE7 A;  2O6V D;  3QX1 A;  4DDG D;  4WAA A;  2LJ5 A;  3M95 A;  1WIA A;  4HPM B;  3UIN B;  5C23 A;  1WE7 A;  2FCM A;  3L17 A;  2MCN B;  4AJY B;  3QCA A;  2NVU I;  2A5U A;  3TMP B;  3H9D A;  1H4R A;  2JY6 A;  3HM6 X;  1UEL A;  4PYZ A;  1PQS A;  4GDL A;  3IG3 A;  2FIF A;  2RR9 A;  5C1Z A;  3R66 C;  3W1S A;  1YX5 B;  2JRH A;  3UQB A;  4KDL B;  4XC2 A;  1WMH A;  1GNU A;  3V60 A;  4NPN A;  3AI5 A;  2KNB A;  4KV2 A;  1M94 A;  3PSE B;  4K7W A;  2GBN A;  5DPS A;  2BKR B;  4JQW C;  1E8W A;  3RYT A;  1YX6 B;  1WY8 A;  4DK5 A;  3QIJ A;  3TL5 A;  1I42 A;  3VFK A;  3M62 B;  4W9L A;  2R2O A;  1E7V A;  2ZZP B;  4ZRI A;  2G4D B;  4X57 B;  1RLF A;  2K25 A;  3PRP B;  4W9F A;  2NR2 A;  2O6V B;  4MDK E;  4FJV B;  3U8Z A;  3A9K B;  4HLE A;  3SDL C;  1WR6 E;  3V62 A;  3LJ3 A;  4EUT A;  2IY1 B;  1UD7 A;  4GB9 A;  4P7I A;  4PS7 A;  5AZF A;  5L83 A;  3ZDT A;  1WJ4 A;  3WAM A;  2BGF A;  2Z59 B;  2KVR A;  5IAA C;  2N7E A;  2O2V A;  2MRP A;  3KW5 B;  4TQ1 A;  2MP2 A;  2QHO A;  2BYE A;  2FAZ A;  3JVZ X;  3UIP B;  4BKS A;  2C7M B;  3PS6 A;  4N9F 4;  3ZNZ B;  3JSV A;  2KX3 A;  1WJU A;  3P2B A;  2REX A;  2EKE C;  2LGD A;  5CX3 A;  3DVG X;  3A33 B;  3ZDM C;  2KWU B;  1ZW7 A;  5JHB A;  4NAW A;  3ECI A;  2XK5 B;  2DYO A;  4FN2 A;  4NQK E;  2KHW B;  4DDI D;  4MJS B;  4F8C B;  3RCZ A;  2W9N A;  3BY4 B;  1NI2 A;  3V6E B;  2MBO A;  4WWO A;  2FID A;  1WXV A;  3ZTC A;  3ZLZ A;  1WGR A;  2N9E B;  3LDZ E;  3QA8 A;  1ZGU B;  1SE9 A;  1GG3 A;  2DYM A;  2L3Z A;  2V1Y A;  2KOX A;  2V4L A;  2MQJ A;  4I6P A;  3R7Q A;  4EZJ A;  4FJY A;  2G3Q B;  1P9D U;  2L0T A;  2LD9 A;  1Q0W B;  2DAF A;  3TIX A;  3U30 A;  3C0R B;  2MW5 A;  4XX5 A;  3RD2 A;  5LLI A;  1WGH A;  2N1V A;  4WJQ A;  2BWE S;  2Y5B B;  1RFA A;  2DZI A;  4DXA B;  4BKT A;  1XD3 B;  1JRU A;  2GBJ A;  4LCD E;  4EEW A;  3R7R A;  1EF1 A;  3DBH I;  4MEL A;  3V61 A;  3PGE A;  4GMV A;  5DPR A;  4ASW C;  4TQ0 A;  4GDL B;  5AEK B;  3KVF B;  3WAP A;  2DX5 B;  1WXA A;  4ICV A;  2EMT A;  2NCN A;  1RRB A;  1T0Y A;  2K39 A;  2WX0 A;  3PHX B;  2CR5 A;  5E6N A;  3QWZ B;  4A3O A;  1WMH B;  2L00 B;  1BT0 A;  2AWT A;  2WYQ A;  4YL8 A;  3CF6 E;  5G2N A;  2CKH B;  3I3T B;  3MTN B;  3QAR A;  4W9D A;  1C1Y B;  3ML9 A;  3UGB B;  4K1R B;  4IM0 A;  2KMC A;  3WAN A;  4KSK C;  4DWF A;  4IUM B;  2ZVN A;  4DHJ B;  1KM7 A;  2L7R A;  4A3P A;  3A4S C;  3H7P A;  3IVF A;  5E6P A;  4BOS C;  3HHM A;  3PV1 A;  4WWN A;  2J7Q B;  5AZH A;  1V86 A;  4NJ7 A;  4W9I A;  2N4F A;  4W9C A;  3CMM B;  3ZNG C;  4PYU A;  4MEM A;  2BPS A;  4OVU A;  2KXJ A;  3DDC B;  2KQ7 A;  3PRE A;  4MM3 A;  5D7G A;  3U7D A;  2LGY A;  1XQQ A;  4PS3 A;  3W1Y A;  1WF9 A;  2Z0D B;  3ZUN A;  2HD5 B;  2IO3 B;  4EZL A;  3A1Q A;  2RSU A;  4JLC A;  3VTU A;  2O2V B;  4GGQ A;  2MP2 B;  3VUY A;  3ZKJ C;  2ZCC A;  2LZ6 A;  2LRW A;  4NJ6 A;  2LVP A;  2YLM A;  1UGM A;  3APD A;  2KFK A;  1IPG A;  1EUV B;  3ZRF A;  5J18 A;  3AXC A;  3JSV B;  3A4R A;  2HJ8 A;  2WDT B;  2ZVO A;  3WAL A;  3WAO A;  2NBU A;  2L76 A;  5CHW A;  2DZK A;  3ZNH B;  1WM3 A;  4BBN F;  1L7Y A;  4IWP A;  2CHZ A;  4NAW B;  2NBW B;  4BOZ B;  4KDI C;  1G6J A;  2IYD B;  2BYF A;  2KWV B;  3PPA A;  3QQ8 B;  4HDO A;  3TBL D;  2JWZ A;  4W9H A;  3SHQ A;  2R2Q A;  3T9L A;  3NZS A;  1YQB A;  3ALB A;  4I6L B;  3DOW A;  2ZCB A;  4ICU A;  5JZE B;  2DHZ A;  4FJZ A;  3H7S A;  3O65 B;  4LJO B;  2JZZ A;  3EHV A;  4ANU A;  2B3A A;  1EO6 A;  2AL3 A;  1WXS A;  2NBV B;  2V3S A;  1UH6 A;  4DHZ B;  1GUA B;  3IBE A;  4KVG B;  5BO4 B;  2AL6 A;  2FCQ A;  3QAQ A;  4G0N B;  2GBK A;  1P0R A;  1S1Q B;  4IG7 B;  2KZR A;  4KIK B;  4HPL B;  2LGX A;  4B6W A;  4AP4 C;  2K8B A;  4K7U A;  1V6E A;  4F7Z A;  2NPT A;  2OOB B;  3VXW A;  2RGF A;  2KC1 A; 
#chains in the Genus database with same CATH topology
 3ZTD A;  3N1X C;  3AE7 B;  1AW7 A;  3H1U A;  1K8R B;  3N30 A;  3SR6 A;  1XT9 B;  4GXB A;  3AEC B;  4WQO B;  1N62 A;  3SFE B;  4M8N A;  4CO7 A;  2IDY A;  2LJI A;  1CMX B;  4B9K A;  1Q5W B;  4IM2 A;  2MLB A;  3H7P B;  5AZG A;  1P7F A;  1TY0 A;  1KOT A;  2CHX A;  4IW0 A;  4Q2J A;  3EGR A;  2D10 A;  2KMA A;  1MPE A;  2K6D B;  1MI0 A;  1YOV B;  2NS5 A;  4KKJ A;  3ENE A;  2RDH A;  1WM2 A;  1FM0 D;  5G55 A;  4AJW A;  2J53 A;  1AN8 A;  3Q6B A;  2SAK A;  3DQV A;  3P4Q B;  1E9M A;  2KJR A;  1WX9 A;  1LXD A;  2LWP A;  2RPQ A;  3A9K A;  1E0Z A;  3CST A;  1GJZ A;  3VR8 B;  4HVB A;  3OJ3 A;  2K8H A;  5FK9 C;  2M1M A;  2IO0 B;  2IZV B;  2FBW B;  2CU3 A;  4FLH A;  3NUH B;  2NPT B;  1I35 A;  2ZNV C;  2AQ2 B;  2M0X A;  4L1B A;  2PPH A;  3P4S B;  5D2M B;  4II3 B;  4GDK A;  4RMA A;  4URK A;  1OQY A;  1NI3 A;  3NZU A;  1XXG A;  1VRA B;  1U4A A;  1WFY A;  1GPX A;  5MPO A;  2DWQ A;  4B95 A;  1WXM A;  3M3J A;  3AEG B;  2D3B A;  1F9J A;  3JYU A;  2QIE B;  4M00 A;  1C4A A;  1UBI A;  5GMV A;  2KD0 A;  3NHE B;  3MC0 B;  4ZRP A;  1OGW A;  1WJN A;  1L4D B;  3KYD D;  2L05 A;  4HKZ E;  2M0A A;  2JF5 A;  2MHJ A;  3OJ4 B;  3D32 A;  4ZDV A;  2IY0 B;  1STE A;  3QHT A;  2INN E;  2KQS A;  3PVL A;  5IA7 A;  2BQQ A;  4KZC A;  1WE6 A;  3AU4 A;  2J0J A;  1JWA D;  2GB1 A;  3GB1 A;  2WXF A;  2JQR B;  4M0W B;  4L23 A;  1R4M B;  3NJT A;  4HDQ A;  2FUH B;  1EWC A;  4XGA B;  3RT3 B;  1RAX A;  4A20 A;  4XDD A;  4YTN B;  2WXG A;  3GZN B;  5KHO A;  3RI7 C;  5AUK A;  1TTN A;  2QIL A;  4OHJ A;  4GDK B;  1NYR A;  4MAC A;  2ZJD A;  4RCO A;  1QF6 A;  3X0W A;  5BMG A;  3L0W B;  1HA5 A;  4MSM B;  2ZEQ A;  2MBB B;  1R4M I;  2FE8 A;  3ZXR A;  2LHE A;  4IWQ A;  5E6O A;  2WQY B;  2O6V A;  1JWM D;  3P4P B;  4HWI B;  1LQB A;  1A5R A;  3AH7 A;  3GZN I;  4C4V A;  3VUW A;  3PO0 A;  1D5X C;  3NZ3 A;  2I1J A;  3CIR B;  2CS4 A;  1WRD B;  2DBY A;  4HRO A;  1WJ6 A;  3KYC D;  3B08 A;  1GC7 A;  1SGH A;  1ZDX A;  1ESF A;  1VDV A;  2PEA A;  1WX7 A;  3KLS X;  4MJS A;  4M01 A;  1J0G A;  2BYV E;  2M4N A;  1ZE3 D;  2WXP A;  4OVV A;  1TS4 A;  2W55 A;  4DHZ E;  4P16 A;  3VRA B;  4D2K A;  3B1L X;  4RM8 A;  2MA9 B;  2XN9 C;  2WU5 B;  4GOC A;  1QZE A;  2HE7 A;  2KQ4 X;  2LJ5 A;  3HUI A;  3AM9 A;  3UIN B;  5C23 A;  2PVO D;  4AJY B;  2WXL A;  3QCA A;  2NVU I;  3TMP B;  2EEL A;  1QOF A;  2B76 B;  1UEL A;  1PQS A;  3IG3 A;  2RR9 A;  1Q10 A;  3UQB A;  5H92 C;  2KMM A;  2KNB A;  5JXV A;  1M94 A;  3NG0 A;  1YX6 B;  4US8 A;  5BMI A;  1IBX B;  1I42 A;  1L0Y B;  1J7C A;  3M62 B;  4AS1 A;  2ZZP B;  3EFC A;  2G4D B;  1RLF A;  3PRP B;  5D3D A;  1DGJ A;  2O6V B;  4MDK E;  2ACZ B;  3B2F A;  1WR6 E;  3V62 A;  2IY1 B;  1UD7 A;  2N0S B;  3W2D A;  2WXI A;  2Z59 B;  1XO3 A;  5IAA C;  3BZD B;  2O2V A;  2FAZ A;  4BKS A;  2NTT A;  2BW2 A;  2X8X X;  3ZNZ B;  2L83 A;  4KGS A;  5CX3 A;  3ZDM C;  1YQ3 B;  2KWU B;  5JHB A;  3ECI A;  2XK5 B;  4DDI D;  4MJS B;  3AN1 A;  2W9N A;  1NI2 A;  2MBO A;  4TMA B;  1WXV A;  1WYG A;  3AB5 A;  3ZLZ A;  1B1Z A;  2N9E B;  3LDZ E;  1GG3 A;  1UF0 A;  2MQJ A;  2LUM A;  3R7Q A;  4FJY A;  2G3Q B;  1P9D U;  3OG5 A;  1LO5 D;  3C0R B;  3RFZ B;  1E7P B;  2IJ0 A;  3AMZ A;  4XX5 A;  3RD2 A;  2N1V A;  2DZI A;  1XD3 B;  1LGR A;  1EF1 A;  1KLU D;  2LEK A;  3PGE A;  4LTU A;  1BML C;  3KVF B;  1T0Q C;  1DYQ A;  1N6Z A;  4IOI E;  2GRI A;  1T0Y A;  5E6N A;  4BBN F;  3ZJT A;  2WYQ A;  2AWT A;  3CF6 E;  4TSS A;  1HXY D;  3MTN B;  3QAR A;  4W9D A;  5EE9 A;  4K1R B;  3C19 A;  1TS2 A;  2K5P A;  2KN4 A;  2PKO A;  4XWW A;  3RNG C;  1V86 A;  3ZNG C;  1QLB B;  4OVU A;  2KXJ A;  5D7G A;  1K52 A;  2AX5 A;  1VZ8 A;  3RMK C;  1L0X B;  1XLO A;  4EZL A;  1ZOY B;  3VTU A;  1YJI A;  2O2V B;  2H89 B;  4P6V F;  1C79 A;  2LZ6 A;  2LRW A;  4NJ6 A;  1UGM A;  1IPG A;  3ZRF A;  1R7S A;  2DZK A;  4NAM A;  1L7Y A;  4IWP A;  2I2Y A;  1V1P A;  1TIF A;  2KWV B;  4BZA A;  3Q69 A;  4W9H A;  2IND C;  2R2Q A;  1AYF A;  1KH0 A;  1YQB A;  2OJW A;  3ALB A;  4N58 A;  5G5G A;  1ZXI A;  1TJE A;  4FJZ A;  3H7S A;  4LNO A;  1TZO A;  2AL3 A;  1BUI C;  1NVI D;  2V3S A;  1UH6 A;  2WNM A;  2FCQ A;  1RYJ A;  4LNN A;  4HPL B;  2LGX A;  4AP4 C;  2K8B A;  4K7U A;  3VXW A;  4JWU C;  4RGT A;  2KC1 A;  2L0F A;  5EE1 A;  4AWJ A;  2INC C;  2KKC A;  1TZ1 A;  2D3G A;  2LUE A;  1Z5S B;  1UGJ A;  1KLV A;  4N6E B;  2ZPN A;  2IO1 B;  3AU5 A;  2MWS B;  1WI0 A;  2BF8 B;  1TBE A;  1QOA A;  3N1Y C;  1D4B A;  1NDD A;  5EE0 A;  2OHF A;  4KSL C;  2J0K A;  3N9Y C;  3DHI C;  3WCQ A;  1FEH A;  4ZRJ A;  4ACF A;  4DHJ D;  2KC2 A;  3R2T A;  3Q2A C;  1Y56 A;  4YSY B;  3I9V 1;  4TKN A;  1SJE D;  4W9E A;  1A70 A;  3MC9 A;  2DZJ A;  2MEK A;  3B2G A;  3RZF A;  5DPW A;  1T6B X;  2JPH A;  3AE4 B;  3I5J C;  3MC8 A;  1ET6 A;  1J19 A;  1V97 A;  1F1H A;  4WJN A;  2RDG A;  3L54 A;  3VQI A;  2MX2 A;  4BKG A;  5IP4 D;  1HQR D;  2L32 A;  1XCQ L;  2PTL A;  4ARC A;  2JUO A;  5HG2 A;  2D11 A;  1LM8 B;  1TGZ B;  1GC6 A;  4HK2 A;  3TEW A;  2ZW1 A;  3UIO B;  2L8J A;  5LXH A;  3P4R B;  4JX1 C;  1SE4 A;  1FXA A;  2KTR A;  4J6I A;  2J0M A;  2VRR B;  3E56 A;  1P1A A;  2XNA C;  1HZ5 A;  2WGS A;  3PZD A;  2KWC A;  2WHI A;  2YEP B;  2BB5 A;  3PZ8 A;  2KDE B;  2DNF A;  3NOB A;  3W5U B;  3EC8 A;  3DBS A;  1YN3 A;  5DPT A;  2QMT A;  1XF5 L;  2WX1 A;  4NY0 A;  5C2T B;  3RUI B;  3T3O A;  1JWB D;  2XBB C;  3VDZ A;  2C60 A;  4K7S A;  3NY5 A;  4FXC A;  4C7Y A;  2M17 A;  4NZL B;  2WU2 B;  2WXJ A;  4MSQ B;  2JVC A;  2JRI B;  3NVY A;  1OTR B;  1VZ7 A;  1SXT A;  1YJ1 A;  1UZX B;  1FNW A;  1EM7 A;  1WZ3 A;  2K6Q A;  1L6V A;  3NRZ A;  1ZPS A;  3VHT C;  1WGG A;  2LVQ A;  1VD2 A;  1HE8 A;  4PT5 A;  3NS8 A;  4E74 A;  1TT5 B;  2PE6 B;  3BVG A;  3VTW A;  1VLB A;  1SJH D;  1M4V A;  1FCL A;  1QQR A;  3ML8 A;  4GU2 A;  1HZ6 A;  3AV8 A;  1ROE A;  5J2R A;  2KAC A;  2QJL A;  2DAJ A;  3UQA A;  1WX8 A;  3AUL A;  1C3T A;  3NVZ A;  3VVW B;  1GAQ B;  1VR9 A;  3VH4 B;  2QEJ C;  4KZ0 A;  3KWL A;  2KTR B;  4C7Z A;  2FNJ B;  1MJD A;  1VZ6 A;  4HCP B;  4MGI E;  3RZW C;  3KUC B;  2LMC A;  2D2Q A;  3I63 C;  4HJG E;  2JZ3 B;  3BK1 A;  3URY A;  2GOW A;  2JX5 A;  3HM3 A;  3KH0 A;  4FHJ A;  1JAL A;  1L6U A;  2ON8 A;  2KK8 A;  2Z0E B;  3BWU D;  2IBI B;  1LFD A;  3PHW B;  2PE9 A;  2QC8 A;  4ANW A;  1ZP0 B;  2WWZ A;  2MBE A;  1XEE A;  5JH5 C;  1F52 A;  5HI1 A;  2KN5 A;  5H8Y E;  3LXF A;  1ZUD 2;  4G11 A;  3B0A A;  3R3M A;  3L10 B;  1YIW A;  2ZW0 A;  5BYR A;  4FAD A;  4LNF A;  2J52 A;  4REZ A;  3Q3M C;  3GOE A;  3ZYY X;  2O6V D;  5AUI A;  4IKG A;  1YNT E;  1WIA A;  4YSX B;  1WE7 A;  1HEZ E;  2A5U A;  3H9D A;  1GOZ A;  2JY6 A;  4RF0 A;  3EUB 2;  3ZJU A;  4GDL A;  1QT9 A;  1P7E A;  2E3T A;  2FIF A;  5C1Z A;  5GXG B;  1YQ4 B;  4KDL B;  1E10 A;  4LNK A;  1WMH A;  2PVG C;  2Y5C A;  3V60 A;  3AI5 A;  1TY2 A;  3PSE B;  3TEY A;  1FD6 A;  4DK5 A;  3ABV B;  1E7V A;  2BVC A;  4ZRI A;  4W9F A;  3RNA C;  1EU3 A;  4A55 A;  4FJV B;  3U8Z A;  3A9K B;  4HLE A;  3FAH A;  1QKZ A;  1QOB A;  1IGC A;  3TSS A;  4P7I A;  2N7E A;  1UUP A;  2MRP A;  3KW5 B;  2QHO A;  3JVZ X;  3UIP B;  1SF0 A;  4N9F 4;  2N7J A;  1WJU A;  3P2B A;  3AE6 B;  1UNS A;  2REX A;  5HFY A;  2LGD A;  3U52 E;  3A33 B;  4ZYS A;  3DBH B;  4GLS C;  2DYO A;  4NQK E;  2KHW B;  4ZRQ A;  1I4R A;  2BS2 B;  3RCZ A;  3BYT B;  3E9S A;  2AQ1 B;  4WWO A;  2FID A;  1ZGU B;  1SE9 A;  3IAM 1;  3LB8 C;  3KQ4 A;  2V1Y A;  2JYT A;  2HDE A;  3BVZ A;  2LD9 A;  4K3B A;  1Q0W B;  2MW5 A;  3P42 A;  1FRR A;  1WGH A;  2BWE S;  1I4X A;  2BBC A;  3GE3 C;  1PYW D;  1FFU A;  3DBH I;  4MEL A;  4TQ0 A;  4GDL B;  3WAP A;  4ICV A;  1YN5 A;  1RRB A;  2NCN A;  2WX0 A;  2CR5 A;  3Q8E A;  3QWZ B;  1WMH B;  2QCZ A;  1BT0 A;  3I57 A;  1FNV A;  5G2N A;  1EU4 A;  2CKH B;  3I3T B;  1C1Y B;  1FRD A;  4DWF A;  1D6E C;  4IUM B;  1KM7 A;  2L7R A;  4LNI A;  5E6P A;  4OZB A;  5HHD G;  4BOS C;  4WWN A;  4W9I A;  4W9C A;  4MEM A;  1HTO A;  3PRE A;  2KQ7 A;  4MM3 A;  5IKC M;  2ICI A;  1WF9 A;  2IO3 B;  4JE3 B;  3A1Q A;  1SIJ A;  2M56 B;  3ZKJ C;  3RNF C;  1XLN A;  3ZGZ A;  2YLM A;  3AXC A;  3A4R A;  2HJ8 A;  2WDT B;  2ZVO A;  2RMM A;  3WAL A;  4KGT A;  2L76 A;  1WM3 A;  2CHZ A;  4BOZ B;  4KDI C;  4DQO C;  1FMA D;  4OVZ A;  5C3J B;  2WXO A;  4L2Y A;  2E6X A;  4I6L B;  3DOW A;  2KVZ A;  4LJO B;  2Z8L A;  2JZZ A;  3EHV A;  4MT5 A;  4K3C A;  4USA A;  2VZK B;  5TSS A;  2NBV B;  3HVZ A;  2G9H D;  4DHZ B;  1GUA B;  4KVG B;  5BO4 B;  2YEP F;  3QAQ A;  4G0N B;  4IG7 B;  2KZR A;  4C4V B;  4KGR A;  2WDR B;  3IXS A;  2WXK A;  4MGY E;  3ZNI D;  1P3Q U;  2LAS A;  1N61 A;  2V4I B;  3K9O B;  3BK2 A;  2JZP A;  2W3R A;  2INP E;  4XE0 A;  3WA0 A;  2JYE A;  2WXQ A;  4US9 A;  4HXD A;  1WGY A;  4RNA A;  3RPF C;  4PS8 A;  1L5P A;  3BIN A;  4BBN C;  3QC8 B;  3DWG C;  4MM3 B;  1E90 A;  2I38 A;  3MFG A;  1JRP A;  1N63 A;  1V5T A;  3WIM A;  3A1Q B;  1C78 A;  1Z2M A;  4W9J A;  4CHK A;  1WYW B;  2HTM E;  4EOY A;  3W1S C;  3BYY B;  2LI5 A;  2N1W A;  5FR3 A;  2AEH A;  2KJH B;  2CJO A;  3KUD B;  2M19 A;  1PGA A;  4YTP B;  4NNJ B;  1E7U A;  3Q3F A;  4WUR A;  4EFO A;  4M02 A;  1N60 A;  2YVC A;  4GN1 A;  4P1C C;  3L16 A;  3V6C B;  4II2 B;  1J7A A;  3GP7 A;  2MBQ A;  1K51 A;  2IO2 B;  4MH0 E;  4MGK E;  4BFR A;  3OWE B;  1L2N A;  3TJP A;  1V49 A;  2L1A A;  2KDI A;  1CK1 A;  2LFI A;  2KT7 A;  3R8B A;  2RDB C;  2WS3 B;  4M8M A;  1Y8R C;  5J17 A;  4G3X B;  3VR9 B;  4WJP A;  3IT6 B;  1N5X A;  3N32 A;  3UF8 A;  2ZNV B;  2N9X A;  4S0R A;  1JML A;  2AYO B;  1MG4 A;  5BYS A;  2BB6 A;  1D5Z C;  2Y3A A;  4CYE A;  1DOY A;  1F2R I;  3PZ7 A;  3L4P A;  2MSE D;  3U2S C;  3ZQ4 A;  4AOF A;  1TS3 A;  4WQM A;  1T3Q A;  1V81 A;  3QJZ A;  3TEX A;  2A4Z A;  4AUQ C;  1ZKH A;  2DLB A;  3M63 B;  2GLS A;  2OED A;  4LDT B;  1PUT A;  4WIP A;  1T0R C;  3OAW A;  4A9A A;  3APC A;  3IHP C;  3Q8C A;  3AEB B;  3MHS D;  3ETR A;  4W9K A;  2N9P C;  3ZJV A;  3SD5 A;  4B0M A;  2Q5W D;  3S2A A;  1Q1O A;  2J4X A;  2KLC A;  3K9P B;  2NTS A;  1V80 A;  4HJK A;  4HPP A;  3NS1 A;  3VAW A;  2WLB A;  2C9W B;  1WR1 A;  3Q8A A;  5FR6 A;  4IDI A;  4RH6 A;  5EDS A;  1P98 A;  2Y5P A;  3AE1 B;  1PDX A;  1SE2 A;  2EKI A;  4K81 A;  3T3N A;  2KJ6 A;  2WXH A;  1SB3 C;  2PJH A;  2JSV X;  2WXN A;  4B0E A;  2D07 B;  4JL9 A;  2RD0 A;  4CQN A;  1JQ4 A;  3HK0 A;  4LLG M;  2N9K A;  2UWQ A;  3RNE C;  4FHK A;  5D3I B;  3DCG A;  3ZRC A;  3HIZ A;  2DZM A;  1WH3 A;  1KRH A;  1K53 A;  4TV3 A;  2K9X A;  3VH3 B;  4EE2 A;  2CJN A;  4ZRK A;  2IPK D;  4IWO A;  1S3S G;  1C4P A;  1V1P B;  2NMQ A;  2V3N A;  3CWI A;  2V0G A;  5IN7 A;  4KIK A;  4WJO A;  2G45 B;  3IT4 B;  2X38 A;  2L52 A;  5CHF A;  4YSZ B;  1FCC C;  4HKQ A;  3ZVV A;  4G50 A;  4C80 A;  4N59 A;  1E8X A;  1V5O A;  3J9C A;  5L95 C;  2KLG A;  1I4Q A;  2FUG 1;  2JU6 X;  1IGD A;  2EMS A;  3JW0 X;  4ANV A;  4JIO U;  1FFV A;  2ZPY A;  4ZHO A;  3AE2 B;  1AWD A;  4KKI A;  1RM6 C;  3DVN U;  3P63 A;  3DVG Y;  1E8Z A;  3PLU A;  2R61 A;  3RUL A;  3TCA A;  1KLG D;  1YMH E;  2C7N B;  3PRM B;  4UDU C;  1SBB B;  2BKF A;  4RGN A;  1L4Z B;  3M95 A;  2MCN B;  1VJK A;  3DHG C;  4PYZ A;  1NEN B;  3R66 C;  2IGD A;  3W1S A;  1YX5 B;  1ACC A;  4QAY A;  1E6E B;  2PIA A;  1GNU A;  1ZDV A;  3AEA B;  4OZA A;  4KV2 A;  4K7W A;  2BKR B;  4AQ7 A;  4JQW C;  1E8W A;  1PGB A;  1GB4 A;  2IGG A;  4W9L A;  3AE8 B;  4X57 B;  2K25 A;  2NR2 A;  3DWM A;  3LJ3 A;  4EUT A;  2LGI A;  5L83 A;  1WJ4 A;  1WWT A;  2BTE A;  2BGF A;  2KVR A;  1N5W A;  2MP2 A;  4HEA 1;  3PS6 A;  4MH8 A;  2V3P A;  3JSV A;  2EKE C;  3DVG X;  1ZW7 A;  2HJ1 A;  1MFW A;  2J42 A;  1WGR A;  1C77 A;  2DYM A;  2KOX A;  4EZJ A;  2L0T A;  3U30 A;  1T0S C;  4XWT A;  1UWM A;  1SEB D;  3C8Y A;  1F2R C;  1TS5 A;  4WJQ A;  1C4C A;  3VRB B;  4DXG A;  3MP9 A;  4BKT A;  1JRU A;  4LCD E;  4EEW A;  4JPS A;  5LNK 1;  4GMV A;  5DPR A;  4ASW C;  1FPY A;  2V9H A;  4YTM B;  5AEK B;  1C9F A;  2EMT A;  3PHX B;  2K39 A;  4O1N A;  3W5V B;  4YL8 A;  4M0W A;  3ML9 A;  3UGB B;  3WAN A;  4OW0 A;  4DHJ B;  4A3P A;  4JWS C;  3A4S C;  1V8C A;  3HHM A;  5I4D A;  1FNU A;  3CMM B;  3Q3N C;  3U7D A;  2LGY A;  4PS3 A;  4KX6 B;  3W1Y A;  2Z0D B;  2HD5 B;  2VZK D;  4JLC A;  1I4P A;  2MP2 B;  5G5H A;  3VUY A;  2LVP A;  2KFK A;  3JSV B;  1WGK A;  3BII D;  3WAO A;  5CHW A;  2NBW B;  2MJE A;  2IYD B;  2BYF A;  3PPA A;  3QQ8 B;  2K3U A;  3TBL D;  2JWZ A;  1KTK A;  4ICU A;  3AE3 B;  3O65 B;  1DOX A;  1WXS A;  1NYQ A;  2GBK A;  1P0R A;  2W82 A;  4B6W A;  1NEK B;  1V6E A;  4F7Z A;  2OOB B;  2RGF A;  3NVW A;  2N7D A;  4BAX A;  1K50 A;  4WAF A;  5HKH A;  1IUE A;  4ZYN A;  4I6N B;  5FKA C;  1WGD A;  1FXT B;  2FCS A;  4MGZ E;  3FKY A;  2G4S A;  3PRZ A;  5D6J B;  1SE3 A;  2I1K A;  2W54 A;  2K1F A;  5KHQ A;  4DBG A;  3PT2 B;  2BS4 B;  3DVN V;  3NVV A;  5JHA A;  5EE3 A;  1V9J A;  1XLQ A;  4WWP A;  2K22 A;  3V3X A;  1UWX A;  3O13 A;  2D3A A;  3ONS A;  1XCT L;  1MVK A;  3DPD A;  4GIV A;  3EFU A;  3VTV A;  1MHH E;  3B9J A;  3OLM D;  2C5L C;  4WH4 A;  2VH2 A;  3SFD B;  3DBR B;  1KFY B;  2KFK B;  3X23 A;  4C56 C;  4GSW A;  2LHD A;  1OQQ A;  4PK1 A;  1BXT A;  1IBX A;  3ZW3 A;  2BS3 B;  1J8C A;  2KDB A;  4H2A A;  2M8S A;  2D3C A;  1PGX A;  2KO3 A;  4BKS D;  2N9L A;  1TKE A;  5TR5 A;  3MHZ A;  5CHV C;  5BMH A;  2KYW A;  1ZXH A;  3HRD D;  2MJD A;  1E8Y A;  5IO9 A;  3AE5 B;  3APF A;  3N3K B;  1L0V B;  2DEN B;  2K0P A;  1WZ0 A;  3H6N A;  4XZ4 A;  2DYB A;  3ZO5 B;  1R4N B;  3Q3J A;  4RM9 A;  3DBR I;  1EF5 A;  3L08 A;  2FCN A;  4P1B C;  2CHW A;  3DBL B;  4LDT D;  1CJE A;  2XK5 A;  3EEC A;  3HVD A;  3RNB C;  4IM3 A;  4E71 A;  3IAS 1;  1VCB A;  4EKU A;  1IYF A;  3DHH C;  2KDF B;  2ASQ A;  2OJR A;  2WDV B;  1MG8 A;  3PTF C;  3TEZ A;  2GBM A;  3U7Z A;  1H8C A;  2QSD A;  2MBH A;  1I7H A;  1R4N I;  2UYZ B;  4W9G A;  1X1M A;  3PLV A;  1WRI A;  2CU1 A;  3A9J A;  3DBL I;  5CTR C;  1OEY A;  3KUZ A;  3TUO A;  2MJ3 A;  2WXM A;  1XLP A;  4A6Q A;  1UBQ A;  3Q14 C;  3MJ5 A;  3SU8 X;  2UU7 A;  1OQR A;  2JT4 B;  4YXD B;  2KFJ A;  3W9C B;  3T8M A;  3U4E G;  1JWS D;  1AAR A;  4J3O D;  1V1O A;  2K8C A;  1F0Z A;  2GMI C;  5LXI B;  4HCN B;  5E6J A;  1I4H A;  2KAJ A;  1ISN A;  2JXX A;  3MJW A;  4E3C A;  1HTQ A;  4NQL B;  3Q8B A;  3FIL A;  4ANX A;  1EWY C;  2WDQ B;  1D3Z A;  4TUU A;  4JGH B;  4A8X C;  2LRU A;  2PLP A;  3IFW B;  1IP9 A;  1QIL A;  2BT6 A;  2LXA A;  1DOI A;  3AEE B;  1C76 A;  3VUX A;  1I4G A;  3R2I A;  4RGO S;  2GBR A;  2KTF A;  4S17 A;  3UI3 A;  2C7H A;  1FIQ A;  1OEY J;  2RPV A;  1NBF C;  4EZK A;  1F77 A;  2QDF A;  3A9J B;  1T5X D;  3CSF A;  2KAN A;  3QK0 A;  5D94 A;  3ZIM A;  1PFD A;  4BVU C;  1ET9 A;  3N20 C;  1YD8 U;  2KX0 A;  1KJT A;  1SIF A;  5DCN A;  3L13 A;  2TSS A;  3H8H A;  1E5W A;  2HTH A;  3FC4 A;  4FA6 A;  3ZXV A;  4WWM A;  2LVO A;  4FUL A;  3AED B;  4FBJ B;  2BWF A;  4F1S A;  2LXC A;  1V2Y A;  4IC7 B;  2G1E A;  4ITK A;  4LJP B;  4RFB A;  1RWS A;  3QX1 A;  4DDG D;  3Q3O C;  4WAA A;  4HPM B;  2FCM A;  3L17 A;  3FIL B;  1H4R A;  3V05 A;  3HM6 X;  3Q8F A;  3BVM A;  1FXI A;  1OFF A;  3RN9 C;  3SEB A;  2JRH A;  3EA6 A;  4XC2 A;  1KF6 B;  4NPN A;  1FO4 A;  1JW9 D;  5DPS A;  1GB1 A;  2GBN A;  3RYT A;  1JCK B;  1WY8 A;  3QIJ A;  3TL5 A;  1QOG A;  3VFK A;  4HRS A;  2R2O A;  4XYC A;  3SDL C;  2KDM A;  1MHX A;  3N1Z C;  4GB9 A;  5AZF A;  4PS7 A;  3ZDT A;  3WAM A;  3KWV A;  4OZC A;  4TQ1 A;  2BYE A;  2C7M B;  2KX3 A;  3RNC C;  2PW9 A;  2PMV A;  4NAW A;  4RGM A;  4ZOH C;  4FN2 A;  4F8C B;  3BY4 B;  3V6E B;  3ZTC A;  3QA8 A;  2GI9 A;  1SSN A;  2L3Z A;  1CZP A;  2V4L A;  4I6P A;  4C00 A;  2DAF A;  3TIX A;  4YT0 B;  5LLI A;  1D5M C;  2Y5B B;  1RFA A;  4DXA B;  2GBJ A;  3R7R A;  3V61 A;  4A90 A;  1B9R A;  1TYG B;  3AEF B;  2DX5 B;  1WXA A;  5BYQ A;  1J7B A;  4A3O A;  2L00 B;  1WXQ A;  4IM0 A;  2KMC A;  2ONQ A;  4KSK C;  2ZVN A;  3H7P A;  2AQ3 B;  3IVF A;  3LYY A;  3PV1 A;  2J7Q B;  5AZH A;  4NJ7 A;  2N4F A;  4PYU A;  2IGH A;  2W3S A;  2BPS A;  1TKG A;  3DDC B;  1RFK A;  1XQQ A;  4RF1 A;  3P1M A;  1WSP A;  2LGS A;  1JRO A;  3AE9 B;  3ZUN A;  1TKY A;  2RSU A;  2VH1 A;  4GGQ A;  5T8I A;  4NJC A;  2ZCC A;  3GE8 C;  1YN4 A;  3APD A;  1EUV B;  5J18 A;  1CQV A;  2NBU A;  3ZNH B;  2MH7 A;  2JXT A;  4DXF A;  4R3D A;  4NAW B;  1G6J A;  4HDO A;  3SHQ A;  2WP9 B;  3T9L A;  2KWD A;  3NZS A;  1JWU D;  4XDC A;  5IOI A;  2ZCB A;  2WXR A;  3GS2 A;  5JZE B;  2D5G A;  2DHZ A;  2SEB D;  4ANU A;  2B3A A;  1EO6 A;  4YWG G;  1ENF A;  2BYT A;  3IBE A;  2AL6 A;  1S1Q B;  4ZHP A;  2JWU A;  4KIK B;  4ARI A;  2H88 B;  2NPT A;  4LK0 M;  1YJJ A;  2XEW A; 
#chains in the Genus database with same CATH homology
 2N7D A;  3ZTD A;  2L0F A;  4AWJ A;  2KKC A;  4MGY E;  1TZ1 A;  2D3G A;  2LUE A;  1Z5S B;  5HKH A;  3ZNI D;  4ZYN A;  1P3Q U;  2LAS A;  4I6N B;  3H1U A;  1K8R B;  3N30 A;  1WGD A;  3K9O B;  1FXT B;  2FCS A;  1XT9 B;  4MGZ E;  1KLV A;  4GXB A;  2G4S A;  2ZPN A;  3PRZ A;  2IO1 B;  4WQO B;  5D6J B;  3AU5 A;  4M8N A;  2I1K A;  4CO7 A;  2K1F A;  1CMX B;  1WI0 A;  2BF8 B;  2MWS B;  5KHQ A;  4DBG A;  1TBE A;  3WA0 A;  3PT2 B;  4B9K A;  3DVN V;  1Q5W B;  4IM2 A;  2MLB A;  5JHA A;  3H7P B;  1V9J A;  4HXD A;  5AZG A;  4WWP A;  1NDD A;  1KOT A;  1WGY A;  2CHX A;  4KSL C;  4IW0 A;  2J0K A;  4PS8 A;  2D10 A;  2KMA A;  3BIN A;  4BBN C;  3QC8 B;  2K6D B;  1E90 A;  3ONS A;  4ZRJ A;  4DHJ D;  2KC2 A;  1V5T A;  2NS5 A;  3WIM A;  3DPD A;  4GIV A;  3A1Q B;  3EFU A;  3VTV A;  3OLM D;  4TKN A;  1Z2M A;  4W9J A;  3ENE A;  4CHK A;  4W9E A;  1WYW B;  2C5L C;  1WM2 A;  2DZJ A;  4EOY A;  5G55 A;  3RZF A;  4AJW A;  2KFK B;  3W1S C;  5DPW A;  3X23 A;  3DQV A;  2LI5 A;  2KJR A;  4GSW A;  1WX9 A;  1LXD A;  2JPH A;  2LWP A;  2N1W A;  3ZW3 A;  1J8C A;  1J19 A;  2KDB A;  2AEH A;  2RPQ A;  2M8S A;  2KJH B;  4WJN A;  3KUD B;  2KO3 A;  4BKS D;  3L54 A;  5TR5 A;  3A9K A;  5CHV C;  3VQI A;  3CST A;  1GJZ A;  4NNJ B;  1E7U A;  2MX2 A;  3Q3F A;  4BKG A;  4EFO A;  4HVB A;  1E8Y A;  2YVC A;  3OJ3 A;  4GN1 A;  3APF A;  3V6C B;  3L16 A;  2JUO A;  2K8H A;  4II2 B;  3N3K B;  2M1M A;  2IZV B;  2IO0 B;  2DEN B;  2D11 A;  2MBQ A;  1WZ0 A;  2IO2 B;  1LM8 B;  1TGZ B;  3H6N A;  4MH0 E;  4XZ4 A;  4MGK E;  1GC6 A;  4BFR A;  2DYB A;  4FLH A;  3Q3J A;  4HK2 A;  4RM9 A;  3DBR I;  3ZO5 B;  1L2N A;  1EF5 A;  3TJP A;  1V49 A;  3L08 A;  2KDI A;  2NPT B;  3UIO B;  1I35 A;  2L8J A;  5LXH A;  2FCN A;  2ZNV C;  2M0X A;  2CHW A;  2PPH A;  4LDT D;  4M8M A;  1Y8R C;  2XK5 A;  3EEC A;  4II3 B;  5D2M B;  4GDK A;  4G3X B;  5J17 A;  4RMA A;  4WJP A;  4URK A;  4IM3 A;  4E71 A;  1OQY A;  2KTR A;  3NZU A;  3N32 A;  4J6I A;  2ZNV B;  2J0M A;  1VCB A;  2VRR B;  3UF8 A;  4EKU A;  2N9X A;  1IYF A;  1P1A A;  2KDF B;  2ASQ A;  2OJR A;  1U4A A;  1MG8 A;  2AYO B;  3PZD A;  1WFY A;  2KWC A;  4B95 A;  2KDE B;  1WXM A;  3M3J A;  3NOB A;  3PTF C;  4CYE A;  1F9J A;  3JYU A;  2GBM A;  3EC8 A;  3DBS A;  1UBI A;  5DPT A;  1H8C A;  2MBH A;  2WX1 A;  1R4N I;  5GMV A;  2MSE D;  2KD0 A;  4NY0 A;  3RUI B;  4AOF A;  2UYZ B;  2XBB C;  3NHE B;  4W9G A;  1X1M A;  3PLV A;  3VDZ A;  1V81 A;  3QJZ A;  4AUQ C;  2A4Z A;  2C60 A;  1OGW A;  1WJN A;  1ZKH A;  2CU1 A;  3NY5 A;  4K7S A;  3A9J A;  2M17 A;  2L05 A;  3DBL I;  3KYD D;  3M63 B;  4LDT B;  5CTR C;  1OEY A;  3KUZ A;  3OAW A;  2JF5 A;  4MSQ B;  3APC A;  1UBQ A;  2JVC A;  3IHP C;  3OJ4 B;  3D32 A;  2JRI B;  3MHS D;  3SU8 X;  4W9K A;  2N9P C;  4ZDV A;  3SD5 A;  1OTR B;  3S2A A;  1Q1O A;  2JT4 B;  1YJ1 A;  2IY0 B;  1UZX B;  2KFJ A;  2K6Q A;  1WZ3 A;  3QHT A;  5IA7 A;  2KQS A;  3PVL A;  3T8M A;  2KLC A;  3VHT C;  1AAR A;  3K9P B;  4KZC A;  1V80 A;  1WE6 A;  1WGG A;  2LVQ A;  1VD2 A;  3AU4 A;  2J0J A;  4HJK A;  1HE8 A;  3NS8 A;  2K8C A;  4E74 A;  2PE6 B;  2GMI C;  4M0W B;  3VAW A;  3VTW A;  2C9W B;  1WR1 A;  5LXI B;  4HCN B;  5FR6 A;  5EDS A;  1P98 A;  4HDQ A;  2FUH B;  4K81 A;  1ISN A;  3ML8 A;  4GU2 A;  2KJ6 A;  1RAX A;  3RT3 B;  2JXX A;  4A20 A;  3MJW A;  4E3C A;  5J2R A;  5KHO A;  2PJH A;  2D07 B;  2DAJ A;  4JL9 A;  2RD0 A;  4NQL B;  3UQA A;  3HK0 A;  1WX8 A;  4ANX A;  1TTN A;  2UWQ A;  3AUL A;  4FHK A;  1C3T A;  3DCG A;  3ZRC A;  3HIZ A;  3VVW B;  4GDK B;  2ZJD A;  1D3Z A;  4TUU A;  3X0W A;  4JGH B;  3VH4 B;  2DZM A;  1WH3 A;  4KZ0 A;  2LRU A;  2KTR B;  3IFW B;  3L0W B;  4MSM B;  1IP9 A;  2FNJ B;  4TV3 A;  2ZEQ A;  4HCP B;  4MGI E;  3VH3 B;  2LXA A;  2MBB B;  1R4M I;  3RZW C;  3KUC B;  2D2Q A;  4ZRK A;  4IWO A;  4IWQ A;  5E6O A;  1S3S G;  2JZ3 B;  3VUX A;  2O6V A;  2GOW A;  4HWI B;  2GBR A;  2KTF A;  1LQB A;  1A5R A;  2C7H A;  3HM3 A;  3KH0 A;  4FHJ A;  4KIK A;  3GZN I;  4WJO A;  2G45 B;  1OEY J;  3VUW A;  5CHF A;  2KK8 A;  1NBF C;  2Z0E B;  4EZK A;  2IBI B;  1LFD A;  3A9J B;  3CSF A;  3PHW B;  2KAN A;  2PE9 A;  2I1J A;  3QK0 A;  5D94 A;  3ZIM A;  4ANW A;  2XEW A;  2CS4 A;  3ZVV A;  4BVU C;  2WWZ A;  2MBE A;  4G50 A;  1WRD B;  1E8X A;  1V5O A;  5L95 C;  2KLG A;  1WJ6 A;  1YD8 U;  2KX0 A;  1KJT A;  5JH5 C;  1SIF A;  5DCN A;  2KN5 A;  3KYC D;  2EMS A;  3B08 A;  3L13 A;  1GC7 A;  1SGH A;  3JW0 X;  4ANV A;  4JIO U;  4G11 A;  2ZPY A;  2PEA A;  1E5W A;  1WX7 A;  2HTH A;  3B0A A;  3R3M A;  3L10 B;  4FA6 A;  4MJS A;  1J0G A;  2BYV E;  2LVO A;  1YIW A;  3DVN U;  2M4N A;  4FUL A;  3DVG Y;  4FBJ B;  2BWF A;  4F1S A;  1E8Z A;  4OVV A;  3PLU A;  2LXC A;  3RUL A;  4FAD A;  1V2Y A;  3TCA A;  4IC7 B;  4DHZ E;  3B1L X;  4RM8 A;  2MA9 B;  3GOE A;  2C7N B;  3PRM B;  4LJP B;  4GOC A;  1QZE A;  2BKF A;  2HE7 A;  2O6V D;  3QX1 A;  4DDG D;  4WAA A;  2LJ5 A;  3M95 A;  1WIA A;  4HPM B;  3UIN B;  5C23 A;  1WE7 A;  2FCM A;  3L17 A;  2MCN B;  4AJY B;  3QCA A;  2NVU I;  2A5U A;  3TMP B;  3H9D A;  1H4R A;  2JY6 A;  3HM6 X;  1UEL A;  4PYZ A;  1PQS A;  4GDL A;  3IG3 A;  2FIF A;  2RR9 A;  5C1Z A;  3R66 C;  3W1S A;  1YX5 B;  2JRH A;  3UQB A;  4KDL B;  4XC2 A;  1WMH A;  1GNU A;  3V60 A;  4NPN A;  3AI5 A;  2KNB A;  4KV2 A;  1M94 A;  3PSE B;  4K7W A;  2GBN A;  5DPS A;  2BKR B;  4JQW C;  1E8W A;  3RYT A;  1YX6 B;  1WY8 A;  4DK5 A;  3QIJ A;  3TL5 A;  1I42 A;  3VFK A;  3M62 B;  4W9L A;  2R2O A;  1E7V A;  2ZZP B;  4ZRI A;  2G4D B;  4X57 B;  1RLF A;  2K25 A;  3PRP B;  4W9F A;  2NR2 A;  2O6V B;  4MDK E;  4FJV B;  3U8Z A;  3A9K B;  4HLE A;  3SDL C;  1WR6 E;  3V62 A;  3LJ3 A;  4EUT A;  2IY1 B;  1UD7 A;  4GB9 A;  4P7I A;  4PS7 A;  5AZF A;  5L83 A;  3ZDT A;  1WJ4 A;  3WAM A;  2BGF A;  2Z59 B;  2KVR A;  5IAA C;  2N7E A;  2O2V A;  2MRP A;  3KW5 B;  4TQ1 A;  2MP2 A;  2QHO A;  2BYE A;  2FAZ A;  3JVZ X;  3UIP B;  4BKS A;  2C7M B;  3PS6 A;  4N9F 4;  3ZNZ B;  3JSV A;  2KX3 A;  1WJU A;  3P2B A;  2REX A;  2EKE C;  2LGD A;  5CX3 A;  3DVG X;  3A33 B;  3ZDM C;  2KWU B;  1ZW7 A;  5JHB A;  4NAW A;  3ECI A;  2XK5 B;  2DYO A;  4FN2 A;  4NQK E;  2KHW B;  4DDI D;  4MJS B;  4F8C B;  3RCZ A;  2W9N A;  3BY4 B;  1NI2 A;  3V6E B;  2MBO A;  4WWO A;  2FID A;  1WXV A;  3ZTC A;  3ZLZ A;  1WGR A;  2N9E B;  3LDZ E;  3QA8 A;  1ZGU B;  1SE9 A;  1GG3 A;  2DYM A;  2L3Z A;  2V1Y A;  2KOX A;  2V4L A;  2MQJ A;  4I6P A;  3R7Q A;  4EZJ A;  4FJY A;  2G3Q B;  1P9D U;  2L0T A;  2LD9 A;  1Q0W B;  2DAF A;  3TIX A;  3U30 A;  3C0R B;  2MW5 A;  4XX5 A;  3RD2 A;  5LLI A;  1WGH A;  2N1V A;  4WJQ A;  2BWE S;  2Y5B B;  1RFA A;  2DZI A;  4DXA B;  4BKT A;  1XD3 B;  1JRU A;  2GBJ A;  4LCD E;  4EEW A;  3R7R A;  1EF1 A;  3DBH I;  4MEL A;  3V61 A;  3PGE A;  4GMV A;  5DPR A;  4ASW C;  4TQ0 A;  4GDL B;  5AEK B;  3KVF B;  3WAP A;  2DX5 B;  1WXA A;  4ICV A;  2EMT A;  2NCN A;  1RRB A;  1T0Y A;  2K39 A;  2WX0 A;  3PHX B;  2CR5 A;  5E6N A;  3QWZ B;  4A3O A;  1WMH B;  2L00 B;  1BT0 A;  2AWT A;  2WYQ A;  4YL8 A;  3CF6 E;  5G2N A;  2CKH B;  3I3T B;  3MTN B;  3QAR A;  4W9D A;  1C1Y B;  3ML9 A;  3UGB B;  4K1R B;  4IM0 A;  2KMC A;  3WAN A;  4KSK C;  4DWF A;  4IUM B;  2ZVN A;  4DHJ B;  1KM7 A;  2L7R A;  4A3P A;  3A4S C;  3H7P A;  3IVF A;  5E6P A;  4BOS C;  3HHM A;  3PV1 A;  4WWN A;  2J7Q B;  5AZH A;  1V86 A;  4NJ7 A;  4W9I A;  2N4F A;  4W9C A;  3CMM B;  3ZNG C;  4PYU A;  4MEM A;  2BPS A;  4OVU A;  2KXJ A;  3DDC B;  2KQ7 A;  3PRE A;  4MM3 A;  5D7G A;  3U7D A;  2LGY A;  1XQQ A;  4PS3 A;  3W1Y A;  1WF9 A;  2Z0D B;  3ZUN A;  2HD5 B;  2IO3 B;  4EZL A;  3A1Q A;  2RSU A;  4JLC A;  3VTU A;  2O2V B;  4GGQ A;  2MP2 B;  3VUY A;  3ZKJ C;  2ZCC A;  2LZ6 A;  2LRW A;  4NJ6 A;  2LVP A;  2YLM A;  1UGM A;  3APD A;  2KFK A;  1IPG A;  1EUV B;  3ZRF A;  5J18 A;  3AXC A;  3JSV B;  3A4R A;  2HJ8 A;  2WDT B;  2ZVO A;  3WAL A;  3WAO A;  2NBU A;  2L76 A;  5CHW A;  2DZK A;  3ZNH B;  1WM3 A;  4BBN F;  1L7Y A;  4IWP A;  2CHZ A;  4NAW B;  2NBW B;  4BOZ B;  4KDI C;  1G6J A;  2IYD B;  2BYF A;  2KWV B;  3PPA A;  3QQ8 B;  4HDO A;  3TBL D;  2JWZ A;  4W9H A;  3SHQ A;  2R2Q A;  3T9L A;  3NZS A;  1YQB A;  3ALB A;  4I6L B;  3DOW A;  2ZCB A;  4ICU A;  5JZE B;  2DHZ A;  4FJZ A;  3H7S A;  3O65 B;  4LJO B;  2JZZ A;  3EHV A;  4ANU A;  2B3A A;  1EO6 A;  2AL3 A;  1WXS A;  2NBV B;  2V3S A;  1UH6 A;  4DHZ B;  1GUA B;  3IBE A;  4KVG B;  5BO4 B;  2AL6 A;  2FCQ A;  3QAQ A;  4G0N B;  2GBK A;  1P0R A;  1S1Q B;  4IG7 B;  2KZR A;  4KIK B;  4HPL B;  2LGX A;  4B6W A;  4AP4 C;  2K8B A;  4K7U A;  1V6E A;  4F7Z A;  2NPT A;  2OOB B;  3VXW A;  2RGF A;  2KC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...