3A4RA

The crystal structure of sumo-like domain 2 in nip45
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
GPLGSQELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGLESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NFATC2-interacting protein
publication title Structural basis for regulation of poly-SUMO chain by a SUMO-like domain of Nip45
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 16
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3a4rA00
2D07B 2LVQA 1RLFA 3T9LA 1J19A 2C7MB 2R2OA 3M3JA 3PRZA 4DWFA 1P98A 2PPHA 3IBEA 2RD0A 2KNBA 3N30A 2MP2B 3VFKA 3ZNZB 2C5LC 3PRPB 2IZVB 3PZDA 4KDLB 4NAWA 1OTRB 4WWOA 4KIKA 4W9HA 1ZGUB 2DHZA 2L05A 2KFKB 2A4ZA 4HCNB 1E7VA 4KSKC 3SHQA 4IG7B 4FHJA 2UWQA 2KTRA 2EMTA 2XK5B 5DCNA 2FCSA 1YX5B 2J0KA 4W9GA 2KD0A 2ZZPB 4W9FA 1H4RA 2AEHA 2V3SA 4M8NA 2O2VB 4XZ4A 3VUXA 2N1WA 3DCGA 2BYVE 3UF8A 2C7HA 1GC6A 1IP9A 1WYWB 4ZYNA 5CTRC 4HPLB 1OEYA 1WGHA 1L7YA 4B9KA 2MLBA 1UZXB 2C7NB 2LD9A 4BBNF 3A9KB 2KWVB 1J8CA 4G50A 2L0FA 2MBHA 2NBVB 2PJHA 1WX7A 3JVZX 4FBJB 3ECIA 2GBNA 4EZJA 3M63B 4I6PA 4MELA 4PYZA 4LJPB 3LJ3A 2KX0A 4NJ6A 3PT2B 4JLCA 4DBGA 2UYZB 2JUOA 2J0JA 4EZLA 3KUCB 2DYMA 1FXTB 1Q5WB 3NZSA 3OLMD 3SD5A 1WR6E 2ZNVB 2EKEC 3ZO5B 2KHWB 1E90A 2LUEA 2N9EB 4WQOB 2GBMA 3L17A 2RGFA 4NPNA 1WXMA 3N32A 3PLUA 4BOSC 2DAJA 4KZCA 3CF6E 2XBBC 5DPSA 2M0XA 1S3SG 2HD5B 3KYCD 2OOBB 3WAPA 3NS8A 3P2BA 5J18A 5LXHA 3MHSD 4HDQA 4P7IA 3RT3B 4W9KA 5JZEB 2MRPA 2FAZA 1X1MA 4M0WB 2DX5B 1YIWA 4GOCA 3VDZA 4II3B 2YVCA 1GC7A 2J0MA 1WZ3A 2O6VB 2LGYA 4LJOB 4RM8A 4A3OA 2KLCA 3TMPB 4K81A 1WZ0A 2AL6A 2N1VA 4W9LA 4N9F4 3V6EB 4GU2A 3ONSA 4MJSA 2WYQA 2JWZA 1C1YB 2C9WB 3A9JA 4EUTA 2G3QB 3VH4B 5JHBA 4OVUA 2KZRA 1IPGA 4XC2A 2VRRB 2KMCA 3UQBA 4RMAA 4NQLB 3DBSA 3KH0A 4FLHA 4IM2A 4LDTB 4LCDE 2KXJA 1GUAB 2PE6B 4NY0A 3X0WA 5HKHA 4MM3A 2D11A 1D3ZA 2KC2A 5DPRA 2K39A 2WX1A 1E8YA 2JY6A 5AZHA 2LVOA 2MBBB 2L7RA 3ALBA 4W9DA 3S2AA 4FULA 2NBUA 4TKNA 3EECA 4ZRJA 3VTVA 2G4SA 4GDKA 2CU1A 4JQWC 4G3XB 2I1KA 1K8RB 5J17A 4RM9A 1Z2MA 3U7DA 3VH3B 1QZEA 3H7PB 1SE9A 3APFA 5JH5C 2KDBA 3IG3A 3VQIA 1KJTA 1UBIA 4ICUA 1TBEA 2M17A 1LFDA 2BKFA 2M8SA 5TR5A 4BOZB 1WI0A 3JSVA 2HE7A 3QA8A 2BPSA 4WJOA 3U8ZA 1RRBA 5G2NA 1V5OA 2BGFA 2IY1B 2LXCA 3BINA 1EUVB 4GXBA 1WFYA 4DHJB 2K6QA 1RAXA 4GN1A 1F9JA 2M1MA 2NBWB 2YLMA 3L10B 4ZRIA 3H7SA 1LXDA 4TQ0A 5EDSA 1UH6A 4M8MA 2GMIC 4HCPB 1GNUA 2JT4B 1T0YA 2FCMA 1Q0WB 2K6DB 1YX6B 3A1QB 4FADA 3ML9A 3ZNHB 3RZWC 3AXCA 4KV2A 4NJ7A 2LJ5A 1WY8A 1V5TA 3W1SA 4IM3A 4MEMA 4CHKA 2MSED 1WR1A 4HXDA 4TUUA 2N7DA 5D7GA 2NPTB 2CHXA 3C0RB 1RFAA 3H6NA 5D6JB 2PEAA 3QC8B 2L3ZA 2D3GA 3L13A 1G6JA 2KKCA 3IHPC 2GBRA 5IAAC 2BYFA 3RD2A 1J0GA 2KVRA 1YQBA 3D32A 1EF5A 5GMVA 5D94A 1V6EA 2IO1B 3ZDMC 3HK0A 1WJ4A 5J2RA 1KOTA 4F8CB 2IYDB 5CX3A 2KDIA 2AL3A 3WAMA 2HTHA 2FCQA 2MP2A 2KK8A 3L0WB 4II2B 4PS8A 1P0RA 4G0NB 1WXSA 2KC1A 4GSWA 3HIZA 3R3MA 4AUQC 5KHOA 2Z0DB 4BKSA 1P3QU 3HM6X 4K7SA 1V81A 4IW0A 2J7QB 2K25A 4AOFA 4FA6A 4WJQA 1SIFA 2ZCCA 3BY4B 4BBNC 1VD2A 3ENEA 3AU4A 4FJZA 3UIPB 5L83A 2MWSB 2JVCA 3ZVVA 3PREA 3QK0A 4ICVA 4TV3A 5G55A 3RYTA 2KFKA 2LGXA 3OJ4B 3A4SC 3TJPA 3DBRI 2XK5A 4G11A 3A33B 2L0TA 1NI2A 2JF5A 2WWZA 2ZNVC 4CYEA 2N4FA 2O2VA 1E5WA 4IWPA 2KDEB 4EZKA 4B95A 1EF1A 4DHZB 3L16A 2KLGA 4ANUA 3UINB 2V1YA 3A9KA 3IFWB 3KW5B 4AJWA 4K1RB 1Z5SB 2KTFA 2KJ6A 4DHZE 3Q3FA 2K8BA 2RPQA 2ASQA 1V2YA 1LQBA 2G45B 2IBIB 4HPMB 3ZIMA 4DXAB 2KJRA 4DK5A 3DVNV 2ZPNA 3UIOB 3PSEB 4J6IA 3VAWA 2DZJA 2KN5A 3GZNI 2REXA 2DAFA 2K8HA 2KWUB 3L54A 2MBQA 4F1SA 4AJYB 4EFOA 3RUIB 3APDA 2BWES 4WJNA 1IYFA 1MG8A 4GIVA 2Z0EB 2OJRA 2FUHB 1YJ1A 5CHFA 4URKA 5JHAA 2LZ6A 2GBJA 4HVBA 4BFRA 5C1ZA 4GDLB 1E7UA 1WJNA 2DYOA 2IO3B 1WGRA 2FNJB 1OEYJ 2JRIB 3CSFA 3VHTC 3VTUA 1WIAA 2R2QA 3DVGX 3V61A 3HM3A 1WJUA 1UD7A 4GB9A 3M62B 2KJHB 3QX1A 2D2QA 3LDZE 1WMHB 2KQ7A 4EKUA 4YL8A 2O6VA 4HJKA 3GOEA 3RZFA 3DOWA 1LM8B 3KUDB 2AWTA 3Q3JA 3TIXA 1ZKHA 2DZMA 1V86A 2CHWA 2DENB 2IO0B 1UELA 2ZCBA 1S1QB 1VCBA 2KX3A 4EOYA 1E8WA 1WM3A 2BWFA 4HDOA 3DVGY 1ISNA 2MX2A 3ZKJC 3ZRCA 2N7EA 1NDDA 1P9DU 2G4DB 2K1FA 3QQ8B 5KHQA 4ANVA 3V62A 2NVUI 5CHVC 3QJZA 1OGWA 4I6LB 1GG3A 4BVUC 3DDCB 1V9JA 3PS6A 2CHZA 5BO4B 4K7WA 4BKSD 2LVPA 2PE9A 4FJVB 4KZ0A 4NNJB 3ZTCA 4KVGB 2FCNA 2A5UA 4WWPA 2M4NA 3B0AA 2HJ8A 2L8JA 4MGIE 4NAWB 3DPDA 4W9JA 4KIKB 5AZFA 3VUYA 3ZNGC 4BKTA 2KO3A 2N9XA 4JIOU 2MBOA 3H7PA 3OJ3A 2W9NA 2KTRB 4IWQA 5E6PA 1Q1OA 1WGGA 3EC8A 1PQSA 4W9EA 3AULA 3PHXB 1V80A 4MSQB 3VVWB 1XQQA 3NZUA 4ASWC 5DPWA 3ZDTA 3ZTDA 1H8CA 1WE7A 1R4MI 4HLEA 1WXVA 1OQYA 2CS4A 1ZW7A 5DPTA 3QIJA 1KLVA 1E8ZA 3QCAA 2MCNB 3WALA 4ANWA 1TZ1A 1WRDB 4MGYE 3U30A 2QHOA 3QWZB 4HK2A 1C3TA 3ML8A 2BF8B 4X57B 1WX9A 3I3TB 3A1QA 2JZZA 4FHKA 2CKHB 3AI5A 1V49A 5L95C 5E6OA 1XT9B 4XX5A 3TCAA 2ZJDA 2IY0B 5IA7A 3PRMB 1WGDA 4PS3A 3QARA 2JPHA 1TTNA 2NPTA 2CR5A 4JL9A 1UGMA 3OAWA 3R7RA 3X23A 1WE6A 1U4AA 3K9PB 2LRWA 3PVLA 4MH0E 3ZUNA 2RR9A 2MQJA 3AU5A 2XEWA 2KMAA 1TGZB 1AARA 3V60A 1A5RA 4E71A 1XD3B 1WJ6A 4K7UA 4ZDVA 3PPAA 3JW0X 3B08A 3B1LX 3PTFC 3R7QA 4CO7A 1HE8A 3UGBB 3EFUA 2JRHA 4WWNA 3VTWA 2DZKA 3PV1A 2BYEA 4BKGA 2C60A 2NS5A 1P1AA 2O6VD 1WH3A 2NR2A 2WDTB 2Y5BB 4MJSB 3QAQA 3A9JB 5D2MB 4EEWA 4E74A 3CSTA 2B3AA 3CMMB 3RULA 2DZIA 1WM2A 2I1JA 5C23A 3W1YA 4IWOA 3KYDD 4FJYA 4E3CA 1I35A 3R66C 4AWJA 1GJZA 2N9PC 3MJWA 4MGZE 4GGQA 4JGHB 2KQSA 3PHWB 2KANA 3A4RA 3SDLC 2K8CA 4A3PA 4LDTD 3KVFB 2D10A 2BKRB 1WGYA 2IO2B 4GDKB 5FR6A 2LWPA 3UQAA 4B6WA 2KFJA 2LASA 3RCZA 3ZLZA 2LGDA 3DBLI 2MA9B 4IC7B 4AP4C 4IM0A 2V4LA 4HWIB 3ZW3A 2LXAA 5E6NA 4ANXA 3WANA 5LXIB 2WX0A 3NY5A 3H1UA 3JSVB 3MTNB 2KOXA 3K9OB 4PS7A 3TBLD 3NOBA 2ZVNA 3TL5A 4GMVA 3V6CB 2L76A 4MDKE 3QHTA 2JZ3B 3JYUA 2FIFA 2KDFB 1NBFC 1CMXB 1M94A 3WAOA 3M95A 4DHJD 1Y8RC 2MW5A 1JRUA 4DDGD 3SU8X 1UBQA 4DDID 2GOWA 4OVVA 2Z59B 4A20A 2KWCA 2LI5A 3N3KB 4W9IA 1WXAA 3PGEA 2NCNA 3WA0A 4PYUA 4GDLA 3DQVA 2AYOB 4KSLC 3IVFA 2EMSA 1EO6A 2ZVOA 3W1SC 4ZRKA 2LRUA 3O65B 5AZGA 3HHMA 2FIDA 3ZRFA 2MBEA 2RSUA 1WF9A 3PLVA 4KDIC 1I42A 2ZPYA 5AEKB 1L2NA 3APCA 2ZEQA 4F7ZA 4FN2A 2DYBA 3L08A 3T8MA 4W9CA 1WMHA 3KUZA 2JXXA 4WJPA 1R4NI 3WIMA 4IUMB 4NQKE 4I6NB 5CHWA 3H9DA 3DBHI 1YD8U 4WAAA 3VXWA 2L00B 3DVNU 5LLIA 4MGKE 1E8XA 3EHVA 3ZNID 3NHEB 4TQ1A 1BT0A 1WX8A 2GBKA 4MSMB 1SGHA 3VUWA 1KM7A
chains in the Genus database with same CATH superfamily
2D07B 2R2OA 1P98A 2PPHA 3IBEA 4A8XC 2QDFA 3HUIA 2KNBA 1E9MA 2IZVB 1EWYC 2DHZA 4HCNB 5EE0A 2A4ZA 2EELA 1E7VA 1V8CA 2UWQA 2XK5B 4W9GA 2KD0A 2V3SA 4M8NA 4AQ7A 2D3CA 2BYVE 1IP9A 2C7HA 1GC6A 1FXIA 1OEYA 1L7YA 2MLBA 2PMVA 3MJ5A 1XO3A 4G50A 2PJHA 4FBJB 3Q2AC 3ECIA 2GBNA 4EZJA 1YJIA 4MELA 3LJ3A 2KX0A 1DYQA 1CZPA 2WXLA 3IT4B 1FNWA 2J0JA 4LK0M 3R2IA 1Q5WB 3OLMD 4IKGA 2EKEC 2IJ0A 2DWQA 2WNMA 2GBMA 3L17A 2V0GA 3N20C 4BOSC 3ZJVA 3CF6E 4LTUA 1QOAA 2MEKA 1S3SG 1OQQA 3RT3B 4O1NA 4M0WB 3VDZA 1ZUD2 4RM8A 2O6VB 4LJOB 4A3OA 2KLCA 1WZ0A 2WDRB 2N9LA 2CJOA 4MJSA 3ONSA 5H92C 2N0SB 4WURA 4EUTA 2G3QB 5JHBA 4OVUA 3N1YC 3UQBA 4RMAA 4JX1C 4LDTB 2KXJA 1D3ZA 1E8YA 2JY6A 4KGTA 2ACZB 3ZYYX 2NBUA 4GDKA 1F1HA 5IN7A 2I1KA 1K8RB 4RM9A 3H7PB 3Q8BA 5EE1A 5JH5C 2KDBA 4WQMA 1F2RI 2M17A 1LFDA 5TR5A 3L4PA 1L6VA 3JSVA 5C3JB 1RRBA 2AQ1B 1T3QA 5G2NA 2IY1B 1EUVB 4GXBA 1FPYA 2K6QA 1RAXA 1F9JA 3L10B 1UH6A 2GMIC 1GPXA 2JT4B 1Q0WB 3ZNHB 2GB1A 4NJ7A 1V5TA 1NYRA 3MC0B 4L23A 2DLBA 3U4EG 2D3BA 1RFAA 3QC8B 1GB4A 3L13A 2KKCA 3IHPC 4ZRPA 1JWAD 5GMVA 2IO1B 5CX3A 2AL3A 5BMIA 2MP2A 3L0WB 2KK8A 2KC1A 3HIZA 4C4VB 1P3QU 5EE3A 3DBRB 4WJQA 3LB8C 2GLSA 3UIPB 2JVCA 3PREA 3VRBB 2KACA 1ZDXA 4KKIA 2WXHA 3AECB 3KWLA 4G11A 2PVOD 1TIFA 1F52A 2Y3AA 3UINB 3IFWB 4AJWA 2ZW0A 2KJ6A 2UU7A 1SJED 1JWUD 1LQBA 3Q8AA 4DXAB 4DK5A 2BB5A 3DVNV 3ZGZA 1TS5A 3VAWA 2L52A 1ET9A 1C77A 2QIEB 2REXA 3DHGC 5HHDG 5TSSA 4AJYB 3RUIB 1IYFA 2JU6X 5CHFA 5JHAA 5C1ZA 3DHHC 4BFRA 1OEYJ 3DWGC 4GB9A 3P63A 4KKJA 1BUIC 3QX1A 2KQ7A 4HJKA 4WAFA 3TIXA 2DZMA 4M01A 1E8WA 4C7ZA 4LNFA 2NTTA 2BWFA 4HDOA 4BBNF 1ISNA 2MX2A 3QQ8B 2G4DB 4I6LB 2K5PA 4BVUC 5BO4B 2J53A 3PS6A 4BKSD 4K7WA 4KVGB 2A5UA 3B0AA 4MGIE 2L8JA 3VUYA 1EU4A 2N9XA 4JIOU 2IGGA 3N9YC 2YEPF 5E6PA 3PHXB 3NZUA 1QKZA 3ZDTA 3ZTDA 1H8CA 2PW9A 1R4MI 4HLEA 1WXVA 1MVKA 4TSSA 3QIJA 2QCZA 1KLVA 4OZBA 4P1BC 1WRDB 2QHOA 4HK2A 3ML8A 1C4CA 2MHJA 4X57B 3I3TB 1RM6C 3I57A 4FHKA 1V49A 3SR6A 2ZJDA 5IA7A 4YT0B 1UF0A 2JPHA 4LNIA 1HEZE 1WE6A 1L0XB 3AE5B 2XEWA 1TGZB 1XD3B 4K7UA 5HG2A 1KFYB 1TJEA 3B08A 3B1LX 1M4VA 3R7QA 1VZ8A 4YTNB 1XF5L 2H88B 3OG5A 4WWNA 5T8IA 3VTWA 3AEDB 3PZ7A 2Y5BB 4MJSB 1ACCA 4EEWA 1KLGD 3CWIA 1ZXHA 2LHDA 3NG0A 1WM2A 5C23A 5FKAC 4ARIA 2KDMA 1C78A 3EA6A 3SDLC 3TEZA 2D10A 2BKRB 3GP7A 1WGYA 4L1BA 2IO2B 4GDKB 4A90A 2BW2A 2LASA 3LXFA 2JWUA 3CIRB 1F0ZA 3LYYA 4AP4C 4IM0A 4ARCA 2LXAA 1MHHE 3BIID 3GS2A 3H1UA 3JSVB 3MTNB 1KF6B 3AEAB 1L5PA 2L76A 2WU2B 4GLSC 2JZ3B 1FNVA 5LNK1 4DHJD 3RPFC 4OVVA 2KWCA 1BMLC 1EO6A 2QSDA 3SFDB 4ZRKA 2LRUA 1FEHA 2IPKD 2FIDA 3HHMA 1PGBA 3ZRFA 3PLVA 1I42A 2V3PA 4N6EB 3KWVA 4W9CA 1WMHA 3KUZA 2OHFA 1R4NI 4RGNA 3DVNU 3ZNID 2HTME 2RPVA 5G5GA 2MP2B 1OQRA 1RLFA 2C7MB 2BS4B 3P4RB 4RNAA 4WWOA 4NAWA 2HDEA 3SHQA 2L05A 4KSKC 1HTOA 2LHEA 4IG7B 3B9JA 4UDUC 1XLPA 1FIQA 2EMTA 1V1PA 2FCSA 3BVMA 3AM9A 2ZZPB 1LGRA 2AEHA 4N59A 2INDC 2PTLA 4ZYSA 2GRIA 1WYWB 1UZXB 1J8CA 3JVZX 3M63B 4PYZA 1TKYA 4DBGA 2UYZB 2JUOA 4EZLA 2DYMA 3TUOA 1FXTB 2BTEA 1WR6E 2ZNVB 2N9EB 4ACFA 3N32A 3PLUA 4JE3B 2DAJA 4KZCA 3AE8B 2HD5B 1T0SC 2OOBB 3WAPA 5J18A 2SEBD 4P7IA 3RNCC 5JZEB 5IOIA 1YIWA 4GOCA 4II3B 2WXJA 2KYWA 4K81A 2N1VA 5BYRA 4N9F4 3V6EB 3MHZA 2JWZA 2G1EA 1JWSD 3VH4B 1STEA 3AV8A 2BS3B 2AX5A 2VRRB 3DBSA 2GI9A 2HJ1A 4LCDE 1MI0A 1GUAB 4NY0A 3X0WA 3P4SB 2D11A 2KC2A 1CK1A 5AZHA 2LVOA 3ALBA 4FULA 3UI3A 4ZRJA 3IAM1 5J17A 2G9HD 3U7DA 1Z2MA 3TEWA 1QZEA 3APFA 1LO5D 2OEDA 3IG3A 1XLNA 1WI0A 3AEEB 2BB6A 2JZPA 2L32A 4A55A 2M1MA 2NBWB 2YLMA 1C79A 4ZRIA 1LXDA 3SFEB 1I4RA 1L0YB 2K6DB 1T0YA 2FCMA 2VZKB 3BK1A 1CQVA 3ML9A 4FADA 4B0MA 3RZWC 1HXYD 4IM3A 1WR1A 2I2YA 3RNEC 2N7DA 3H6NA 2CHXA 1P7FA 2PEAA 1G6JA 5IAAC 4ZHOA 4LNOA 3AN1A 1TY0A 1V6EA 1B1ZA 3ZDMC 4F8CB 1YN3A 1GAQB 2FCQA 4II2B 4MACA 3W2DA 1RFKA 4GSWA 3R3MA 4K7SA 4IW0A 5IO9A 2K25A 4AOFA 2CU3A 4FA6A 1HZ5A 1SIFA 3BY4B 1VD2A 3ENEA 3AU4A 1R7SA 3RYTA 2LGXA 3OJ4B 2JYEA 3A4SC 1EU3A 3TJPA 1FFUA 2JF5A 1IGCA 4CYEA 1JMLA 2MH7A 1EM7A 3IAS1 2PIAA 3AE7B 4M02A 3L16A 2KLGA 5FR3A 3GZNB 4DHZE 4ZOHC 2K8BA 2ASQA 2WXRA 1V2YA 2INPE 3ZIMA 2QC8A 3VRAB 3NUHB 3R2TA 1SE3A 1FXAA 1FRDA 2WXFA 2DAFA 1T0QC 3Q8EA 4LNNA 1MPEA 3PO0A 4F1SA 4WJNA 2FUHB 3P42A 1UWXA 2GBJA 1I4GA 1TYGB 1E7UA 1WJNA 2FNJB 3VTUA 2R2QA 3DVGX 4P16A 4TMAB 3HM3A 1FO4A 3LDZE 2M0AA 4XWTA 1WMHB 4EKUA 4YL8A 1TS2A 1YN5A 3GOEA 3RZFA 3HVZA 1C9FA 3Q3JA 1ZKHA 3MC8A 1QOGA 2CHWA 4KX6B 5C2TB 1P7EA 1UELA 1SF0A 2ZCBA 3MFGA 3C19A 1VCBA 2KX3A 4J3OD 4K3CA 1P9DU 2MJ3A 3V62A 3QJZA 1PDXA 2WXGA 2CHZA 3ZXRA 2FCNA 4NAWB 4MH8A 5AZFA 3ZNGC 2J42A 2LFIA 1V1PB 1QILA 1V80A 3VVWB 1N6ZA 1XQQA 3B2FA 5DPWA 1WE7A 2CS4A 3FKYA 1NEKB 2MCNB 4HPPA 4MGYE 3U30A 1SB3C 1QF6A 2XNAC 1C3TA 1Q10A 1T6BX 2QJLA 3A1QA 2JZZA 3RI7C 3DWMA 5L95C 5E6OA 3V05A 2LMCA 1XXGA 3U2SC 2IY0B 3PRMB 4PS3A 1YQ4B 2NPTA 1N63A 4JL9A 1UGMA 4N58A 4HKQA 1ZDVA 4MH0E 2RR9A 4JPSA 4ITKA 4E71A 1NYQA 1XCTL 3PPAA 3JW0X 1J7AA 4IDIA 3EFUA 4L2YA 2JRHA 4BKGA 2X38A 5BMHA 2O6VD 1WH3A 1D5ZC 4RFBA 4E74A 2D5GA 2DZIA 4IWOA 3KYDD 4E3CA 1K51A 2RMMA 4GGQA 2L1AA 3PHWB 4US8A 2K8CA 4A3PA 1VLBA 1EWCA 1SJHD 4LDTD 2JXTA 3TEXA 2LWPA 3RMKC 2KFJA 2WP9B 2M19A 3DBLI 3P4PB 5E6NA 4ANXA 3WANA 2WX0A 3NY5A 1N62A 3K9OB 1TY2A 4PS7A 3NOBA 3AE6B 3QHTA 1NBFC 1V1OA 3WAOA 3M95A 4DDID 2I38A 1WYGA 4W9IA 1WXAA 3BK2A 2NCNA 3WA0A 4PYUA 2N7JA 4KSLC 2QILA 3N1XC 3AEGB 1UGJA 2JXXA 3WIMA 5CHWA 3ZJUA 3H9DA 4XYCA 3DBHI 1YD8U 5LLIA 1JW9D 1E8XA 4MGKE 1L4DB 1HZ6A 4MSMB 2V9HA 3AE9B 1KM7A 3BYTB 2LVQA 2M56B 1J19A 3M3JA 4DWFA 1ENFA 2V3NA 2LGSA 3Q69A 3Q6BA 3RN9C 3N30A 4LNKA 4PT5A 3ZNZB 1PGXA 3NS1A 1DOXA 1ZGUB 2KTRA 2J0KA 2W55A 2NTSA 1H4RA 2N9KA 2J52A 2KT7A 2N1WA 5MPOA 2ONQA 4RCOA 3UF8A 4ZYNA 5CTRC 4HPLB 1HQRD 1WGHA 4DXFA 1MHXA 1SSNA 2LD9A 2BS2B 2KWVB 2L0FA 2MBHA 2NBVB 1WX7A 2E3TA 2BQQA 1WGKA 4KGSA 4LJPB 3PT2B 4JLCA 1QQRA 4USAA 4C7YA 4NAMA 1YN4A 1E6EB 2KHWB 2LUEA 3HVDA 4WQOB 4MT5A 2XN9C 5JXVA 2RGFA 4NPNA 4P1CC 2M0XA 1ET6A 4DXGA 1ZPSA 3P2BA 3NJTA 3O13A 3MHSD 1JWMD 2WGSA 1ROEA 3ABVB 2FAZA 1X1MA 4W9KA 5FK9C 2WS3B 3DHIC 4QAYA 1WZ3A 5EE9A 3SEBA 3TMPB 2AL6A 4W9LA 2WXPA 1C1YB 1IUEA 2C9WB 5G5HA 3EUB2 1JROA 4XC2A 1AN8A 1NVID 1TS4A 3KH0A 4IM2A 4KGRA 2PE6B 1K52A 4MM3A 2K0PA 5DPRA 2K39A 2WX1A 2MBBB 2BVCA 4TKNA 3VTVA 2G4SA 1TT5B 2RDGA 2CU1A 4G3XB 3KLSX 4S0RA 3VH3B 1SE9A 1YNTE 3I9V1 4S17A 1UBIA 2BKFA 2M8SA 3RNFC 4BOZB 2INCC 2HE7A 2BPSA 2ICIA 2LXCA 2WXKA 1WFYA 1WSPA 1MJDA 2D3AA 2BT6A 1UNSA 2LJIA 2MJEA 4TQ0A 5EDSA 4M8MA 3A1QB 2TSSA 5D3IB 2W54A 4KV2A 3W1SA 4MEMA 4HXDA 4TUUA 2NPTB 4ZHPA 5BYQA 2D3GA 2BYFA 1J0GA 4NJCA 2KVRA 1YQBA 4C00A 3NZ3A 1EF5A 5J2RA 4HROA 1WJ4A 3Q3MC 1KOTA 2IYDB 3IT6B 3WAMA 2HTHA 2LEKA 1C4AA 4AUQC 4BKSA 2BBCA 1FRRA 1V81A 2J7QB 2JX5A 3ZVVA 5G55A 4XDDA 3V3XA 2KFKA 1IBXA 3DBRI 1QLBB 3U52E 2L0TA 1JQ4A 2WWZA 3J9CA 1RWSA 2KN4A 2O2VA 2YEPB 1E5WA 2FBWB 1XCQL 2KDEB 4IWPA 4EZKA 5BYSA 2QMTA 1EF1A 3C8YA 1V97A 4A9AA 2VH2A 1TZOA 3A9KA 1D6EC 4K1RB 1Z5SB 3ZJTA 2RPQA 4HPMB 4YTPB 1QOFA 2K9XA 2PKOA 2WXQA 3Q14C 4J6IA 4HKZE 2KN5A 3WCQA 2K8HA 4OHJA 3L54A 3Q3NC 4YWGG 2BWES 1MG8A 4GIVA 2Z0EB 2OJRA 4URKA 2LZ6A 4HVBA 1SE4A 1JWBD 2DYOA 1L0VB 1PFDA 1WGRA 3CSFA 1J7CA 1KRHA 4IOIE 3NVWA 1WJUA 1UD7A 1MG4A 4AS1A 1GOZA 3M62B 2KJHB 2D2QA 5AUKA 1QT9A 1L4ZB 3DOWA 2AWTA 5HI1A 1V86A 2OJWA 3PZ8A 3NVYA 2IO0B 2DENB 4ZRQA 2MJDA 3P4QB 4EOYA 4XDCA 1WM3A 2KWDA 3ZRCA 3DVGY 3ZKJC 1NDDA 5KHQA 4ANVA 2NVUI 3NRZA 5CHVC 2AQ2B 1JRPA 1GG3A 1SIJA 4KZ0A 1DOYA 4NNJB 4YXDB 1I4HA 3AH7A 4WWPA 1SE2A 1I4QA 1R4MB 4BKTA 2MBOA 1TKEA 3OJ3A 2W9NA 2KTRB 4IWQA 4JWSC 2W3RA 3U7ZA 2VH1A 1WGGA 3EC8A 1PQSA 4EE2A 3AULA 3Q8FA 1SEBD 1ZW7A 4B0EA 3QCAA 3WALA 3Q8CA 1VZ7A 1TZ1A 3VR9B 1RYJA 1PGAA 1WX9A 1J7BA 4XX5A 1WGDA 4BAXA 3QARA 3GE8C 3IXSA 3H8HA 1VJKA 3ETRA 3K9PB 3ZUNA 4YSZB 3AU5A 2MQJA 3V60A 1A5RA 2PVGC 1WJ6A 3I5JC 1FMAD 3W5UB 4CO7A 1HE8A 3E56A 3RFZB 1P1AA 2WDTB 5AUIA 2W3SA 5D2MB 1ZXIA 3T3OA 3EFCA 3MP9A 2B3AA 1C76A 3FC4A 4HJGE 1UWMA 2I1JA 2J4XA 1I4XA 1WRIA 3ZQ4A 1GJZA 3MJWA 4MGZE 4JGHB 4MM3B 2KANA 3A4RA 5IP4D 2WXIA 5IKCM 1FCLA 3AEFB 4IC7B 2V4LA 5LXIB 3RNAC 3TBLD 2ZVNA 3TL5A 4GMVA 2WHIA 2WXNA 3JYUA 2FIFA 2KVZA 1CMXB 1M94A 4YSXB 2MW5A 4DDGD 2DBYA 2GOWA 2IGHA 4A20A 3N3KB 3PGEA 3URYA 1R4NB 2VZKD 4GDLA 1T0RC 2ZVOA 1ZOYB 5AZGA 2MBEA 1FNUA 2ZPYA 3APCA 4WH4A 2ZEQA 4F7ZA 3L08A 1TS3A 3KQ4A 4WJPA 4CQNA 4NQKE 1FD6A 4WAAA 2L00B 1CJEA 5I4DA 4TQ1A 2GBKA 1WX8A 1SGHA 3VUWA 3BWUD 3HRDD 3AE2B 1PUTA 2K22A 3T9LA 4RGOS 3PRZA 3RNGC 4YTMB 2RD0A 1N5WA 3VFKA 2C5LC 3PRPB 3PZDA 4KDLB 1OTRB 5GXGB 4KIKA 4W9HA 1AYFA 1L2NA 2KFKB 1IBXB 4FHJA 5DCNA 1YX5B 2Y5PA 4W9FA 1XLOA 4XZ4A 2O2VB 3VUXA 3DCGA 4B9KA 1SXTA 2C7NB 3A9KB 1D5MC 4I6PA 3GB1A 1KLUD 4NJ6A 4WIPA 2IDYA 3KUCB 1IGDA 3NZSA 3SD5A 3ZO5B 4D2KA 1E90A 1N5XA 3BZDB 4RGTA 2KAJA 3AB5A 1MFWA 1WXMA 1C4PA 1WXQA 2XBBC 5DPSA 2WXMA 3KYCD 2B76B 3NS8A 4US9A 4LLGM 5LXHA 4HDQA 2MRPA 2DX5B 2YVCA 1GC7A 2J0MA 2LGYA 1YMHE 1YQ3B 2PLPA 4GU2A 1DGJA 2WYQA 4RF1A 3A9JA 2KZRA 1IPGA 3VR8B 2KMCA 4NQLB 3BVGA 4FLHA 2WQYB 3E9SA 2FE8A 5HKHA 1OFFA 3TEYA 2DNFA 4XE0A 3S2AA 2L7RA 4W9DA 4OZAA 3EECA 1T5XD 3Q3OC 1E7PB 1F2RC 1I7HA 2INNE 4JQWC 2LUMA 2BYTA 1JCKB 3VQIA 2Z8LA 1KJTA 4ICUA 1TBEA 3QA8A 3U8ZA 4WJOA 1V5OA 2BGFA 3BINA 4DHJB 4GN1A 3H7SA 4HCPB 1GNUA 1UUPA 4C56C 1YX6B 3AXCA 2LJ5A 1WY8A 4OW0A 1N61A 4CHKA 2MSED 5D7GA 2EKIA 3C0RB 3FILA 5D6JB 2L3ZA 2GBRA 3RD2A 2WU5B 3D32A 1N60A 5D94A 3HK0A 4BZAA 4OVZA 2KDIA 4PS8A 1P0RA 4G0NB 1WXSA 2H89B 5KHOA 1XEEA 2Z0DB 3HM6X 1NENB 3OWEB 2ZCCA 4NZLB 4BBNC 3I63C 1HTQA 3T3NA 4FJZA 5L83A 2MWSB 1JALA 3QK0A 4ICVA 4TV3A 2E6XA 2XK5A 3A33B 3EGRA 1L6UA 1NI2A 2ZNVC 2N4FA 3NVZA 4B95A 2SAKA 4DHZB 4ANUA 4XGAB 3R8BA 2V1YA 1PYWD 3KW5B 1XLQA 2KTFA 2JSVX 3Q3FA 4PK1A 1VR9A 2G45B 2IBIB 2KJRA 2ZPNA 1GB1A 3UIOB 3PSEB 1VRAB 2DZJA 3P1MA 3W5VB 3GZNI 3N1ZC 2KWUB 3ZXVA 2MBQA 2FUG1 3AE4B 4EFOA 3APDA 2RDHA 4P6VF 3AE3B 1YJ1A 4HEA1 1YJJA 2AQ3B 4GDLB 2IO3B 2JQRB 2JRIB 3VHTC 1WIAA 3V61A 2NMQA 2WLBA 4M0WA 2O6VA 2KMMA 1LM8B 3KUDB 2X8XX 4JWUC 1D5XC 2Y5CA 1S1QB 1ZP0B 1E0ZA 2N7EA 1QOBA 2K1FA 4OZCA 1OGWA 3FAHA 3TSSA 3DDCB 1V9JA 2LVPA 1HA5A 2PE9A 4FJVB 3ZTCA 4C80A 5E6JA 4R3DA 1KH0A 2M4NA 5HFYA 2HJ8A 3DPDA 4FXCA 4KIKB 4W9JA 2KO3A 3H7PA 1Q1OA 3BYYB 4W9EA 4MSQB 4DQOC 4ASWC 3BVZA 2IGDA 3AEBB 1OQYA 1BXTA 5DPTA 1E8ZA 1A70A 4ANWA 1KTKA 2KQ4X 1Y56A 3QWZB 5BMGA 2BF8B 1I4PA 2CKHB 3AI5A 1FFVA 1XT9B 3TCAA 1F77A 2K3UA 3MC9A 1TTNA 3AE1B 4WWMA 2CR5A 2WXOA 4K3BA 3OAWA 3R7RA 3X23A 2QEJC 1VDVA 1U4AA 2LRWA 3PVLA 4HRSA 2KMAA 5D3DA 1AARA 2V4IB 4ZDVA 3B2GA 4RF0A 3PTFC 3UGBB 1WWTA 1K53A 3NVVA 2DZKA 1ESFA 2BYEA 3PV1A 1YOVB 2C60A 2NS5A 4Q2JA 4C4VA 2NR2A 3QAQA 3A9JB 1ZE3D 1DOIA 3CSTA 3CMMB 1AW7A 3RULA 4REZA 3W1YA 1I35A 4FJYA 4H2AA 3R66C 4AWJA 2N9PC 2KQSA 2WDQB 3DBLB 4XWWA 1VZ6A 1FM0D 3KVFB 2RDBC 1TKGA 1FCCC 5FR6A 3UQAA 4B6WA 3RCZA 3ZLZA 2R61A 2LGDA 2MA9B 3ZW3A 4HWIB 1SBBB 2ZW1A 3RNBC 2WDVB 2KOXA 3V6CB 4MDKE 3GE3C 2KDFB 2LGIA 4RGMA 1Y8RC 4M00A 1JRUA 3SU8X 1UBQA 2Z59B 2LI5A 4A6QA 3DQVA 2AYOB 3IVFA 2EMSA 3W1SC 3DBHB 3O65B 1NI3A 2RSUA 1WF9A 4KDIC 1D4BA 2Q5WD 5H8YE 1K50A 3FILB 5AEKB 4FN2A 2DYBA 3T8MA 2L83A 3W9CB 3AMZA 4YSYB 4RH6A 1E10A 4IUMB 2W82A 2ON8A 4I6NB 2JYTA 1AWDA 3VXWA 1B9RA 3EHVA 3NHEB 1BT0A 2CJNA
chains in the Genus database with same CATH topology
2D07B 2LVQA 1RLFA 3T9LA 1J19A 2C7MB 2R2OA 3M3JA 3PRZA 4DWFA 1P98A 2PPHA 3IBEA 2RD0A 2KNBA 3N30A 2MP2B 3VFKA 3ZNZB 2C5LC 3PRPB 2IZVB 3PZDA 4KDLB 4NAWA 1OTRB 4WWOA 4KIKA 4W9HA 1ZGUB 2DHZA 2L05A 2KFKB 2A4ZA 4HCNB 1E7VA 4KSKC 3SHQA 4IG7B 4FHJA 2UWQA 2KTRA 2EMTA 2XK5B 5DCNA 2FCSA 1YX5B 2J0KA 4W9GA 2KD0A 2ZZPB 4W9FA 1H4RA 2AEHA 2V3SA 4M8NA 2O2VB 4XZ4A 3VUXA 2N1WA 3DCGA 2BYVE 3UF8A 2C7HA 1GC6A 1IP9A 1WYWB 4ZYNA 5CTRC 4HPLB 1OEYA 1WGHA 1L7YA 4B9KA 2MLBA 1UZXB 2C7NB 2LD9A 4BBNF 3A9KB 2KWVB 1J8CA 4G50A 2L0FA 2MBHA 2NBVB 2PJHA 1WX7A 3JVZX 4FBJB 3ECIA 2GBNA 4EZJA 3M63B 4I6PA 4MELA 4PYZA 4LJPB 3LJ3A 2KX0A 4NJ6A 3PT2B 4JLCA 4DBGA 2UYZB 2JUOA 2J0JA 4EZLA 3KUCB 2DYMA 1FXTB 1Q5WB 3NZSA 3OLMD 3SD5A 1WR6E 2ZNVB 2EKEC 3ZO5B 2KHWB 1E90A 2LUEA 2N9EB 4WQOB 2GBMA 3L17A 2RGFA 4NPNA 1WXMA 3N32A 3PLUA 4BOSC 2DAJA 4KZCA 3CF6E 2XBBC 5DPSA 2M0XA 1S3SG 2HD5B 3KYCD 2OOBB 3WAPA 3NS8A 3P2BA 5J18A 5LXHA 3MHSD 4HDQA 4P7IA 3RT3B 4W9KA 5JZEB 2MRPA 2FAZA 1X1MA 4M0WB 2DX5B 1YIWA 4GOCA 3VDZA 4II3B 2YVCA 1GC7A 2J0MA 1WZ3A 2O6VB 2LGYA 4LJOB 4RM8A 4A3OA 2KLCA 3TMPB 4K81A 1WZ0A 2AL6A 2N1VA 4W9LA 4N9F4 3V6EB 4GU2A 3ONSA 4MJSA 2WYQA 2JWZA 1C1YB 2C9WB 3A9JA 4EUTA 2G3QB 3VH4B 5JHBA 4OVUA 2KZRA 1IPGA 4XC2A 2VRRB 2KMCA 3UQBA 4RMAA 4NQLB 3DBSA 3KH0A 4FLHA 4IM2A 4LDTB 4LCDE 2KXJA 1GUAB 2PE6B 4NY0A 3X0WA 5HKHA 4MM3A 2D11A 1D3ZA 2KC2A 5DPRA 2K39A 2WX1A 1E8YA 2JY6A 5AZHA 2LVOA 2MBBB 2L7RA 3ALBA 4W9DA 3S2AA 4FULA 2NBUA 4TKNA 3EECA 4ZRJA 3VTVA 2G4SA 4GDKA 2CU1A 4JQWC 4G3XB 2I1KA 1K8RB 5J17A 4RM9A 1Z2MA 3U7DA 3VH3B 1QZEA 3H7PB 1SE9A 3APFA 5JH5C 2KDBA 3IG3A 3VQIA 1KJTA 1UBIA 4ICUA 1TBEA 2M17A 1LFDA 2BKFA 2M8SA 5TR5A 4BOZB 1WI0A 3JSVA 2HE7A 3QA8A 2BPSA 4WJOA 3U8ZA 1RRBA 5G2NA 1V5OA 2BGFA 2IY1B 2LXCA 3BINA 1EUVB 4GXBA 1WFYA 4DHJB 2K6QA 1RAXA 4GN1A 1F9JA 2M1MA 2NBWB 2YLMA 3L10B 4ZRIA 3H7SA 1LXDA 4TQ0A 5EDSA 1UH6A 4M8MA 2GMIC 4HCPB 1GNUA 2JT4B 1T0YA 2FCMA 1Q0WB 2K6DB 1YX6B 3A1QB 4FADA 3ML9A 3ZNHB 3RZWC 3AXCA 4KV2A 4NJ7A 2LJ5A 1WY8A 1V5TA 3W1SA 4IM3A 4MEMA 4CHKA 2MSED 1WR1A 4HXDA 4TUUA 2N7DA 5D7GA 2NPTB 2CHXA 3C0RB 1RFAA 3H6NA 5D6JB 2PEAA 3QC8B 2L3ZA 2D3GA 3L13A 1G6JA 2KKCA 3IHPC 2GBRA 5IAAC 2BYFA 3RD2A 1J0GA 2KVRA 1YQBA 3D32A 1EF5A 5GMVA 5D94A 1V6EA 2IO1B 3ZDMC 3HK0A 1WJ4A 5J2RA 1KOTA 4F8CB 2IYDB 5CX3A 2KDIA 2AL3A 3WAMA 2HTHA 2FCQA 2MP2A 2KK8A 3L0WB 4II2B 4PS8A 1P0RA 4G0NB 1WXSA 2KC1A 4GSWA 3HIZA 3R3MA 4AUQC 5KHOA 2Z0DB 4BKSA 1P3QU 3HM6X 4K7SA 1V81A 4IW0A 2J7QB 2K25A 4AOFA 4FA6A 4WJQA 1SIFA 2ZCCA 3BY4B 4BBNC 1VD2A 3ENEA 3AU4A 4FJZA 3UIPB 5L83A 2MWSB 2JVCA 3ZVVA 3PREA 3QK0A 4ICVA 4TV3A 5G55A 3RYTA 2KFKA 2LGXA 3OJ4B 3A4SC 3TJPA 3DBRI 2XK5A 4G11A 3A33B 2L0TA 1NI2A 2JF5A 2WWZA 2ZNVC 4CYEA 2N4FA 2O2VA 1E5WA 4IWPA 2KDEB 4EZKA 4B95A 1EF1A 4DHZB 3L16A 2KLGA 4ANUA 3UINB 2V1YA 3A9KA 3IFWB 3KW5B 4AJWA 4K1RB 1Z5SB 2KTFA 2KJ6A 4DHZE 3Q3FA 2K8BA 2RPQA 2ASQA 1V2YA 1LQBA 2G45B 2IBIB 4HPMB 3ZIMA 4DXAB 2KJRA 4DK5A 3DVNV 2ZPNA 3UIOB 3PSEB 4J6IA 3VAWA 2DZJA 2KN5A 3GZNI 2REXA 2DAFA 2K8HA 2KWUB 3L54A 2MBQA 4F1SA 4AJYB 4EFOA 3RUIB 3APDA 2BWES 4WJNA 1IYFA 1MG8A 4GIVA 2Z0EB 2OJRA 2FUHB 1YJ1A 5CHFA 4URKA 5JHAA 2LZ6A 2GBJA 4HVBA 4BFRA 5C1ZA 4GDLB 1E7UA 1WJNA 2DYOA 2IO3B 1WGRA 2FNJB 1OEYJ 2JRIB 3CSFA 3VHTC 3VTUA 1WIAA 2R2QA 3DVGX 3V61A 3HM3A 1WJUA 1UD7A 4GB9A 3M62B 2KJHB 3QX1A 2D2QA 3LDZE 1WMHB 2KQ7A 4EKUA 4YL8A 2O6VA 4HJKA 3GOEA 3RZFA 3DOWA 1LM8B 3KUDB 2AWTA 3Q3JA 3TIXA 1ZKHA 2DZMA 1V86A 2CHWA 2DENB 2IO0B 1UELA 2ZCBA 1S1QB 1VCBA 2KX3A 4EOYA 1E8WA 1WM3A 2BWFA 4HDOA 3DVGY 1ISNA 2MX2A 3ZKJC 3ZRCA 2N7EA 1NDDA 1P9DU 2G4DB 2K1FA 3QQ8B 5KHQA 4ANVA 3V62A 2NVUI 5CHVC 3QJZA 1OGWA 4I6LB 1GG3A 4BVUC 3DDCB 1V9JA 3PS6A 2CHZA 5BO4B 4K7WA 4BKSD 2LVPA 2PE9A 4FJVB 4KZ0A 4NNJB 3ZTCA 4KVGB 2FCNA 2A5UA 4WWPA 2M4NA 3B0AA 2HJ8A 2L8JA 4MGIE 4NAWB 3DPDA 4W9JA 4KIKB 5AZFA 3VUYA 3ZNGC 4BKTA 2KO3A 2N9XA 4JIOU 2MBOA 3H7PA 3OJ3A 2W9NA 2KTRB 4IWQA 5E6PA 1Q1OA 1WGGA 3EC8A 1PQSA 4W9EA 3AULA 3PHXB 1V80A 4MSQB 3VVWB 1XQQA 3NZUA 4ASWC 5DPWA 3ZDTA 3ZTDA 1H8CA 1WE7A 1R4MI 4HLEA 1WXVA 1OQYA 2CS4A 1ZW7A 5DPTA 3QIJA 1KLVA 1E8ZA 3QCAA 2MCNB 3WALA 4ANWA 1TZ1A 1WRDB 4MGYE 3U30A 2QHOA 3QWZB 4HK2A 1C3TA 3ML8A 2BF8B 4X57B 1WX9A 3I3TB 3A1QA 2JZZA 4FHKA 2CKHB 3AI5A 1V49A 5L95C 5E6OA 1XT9B 4XX5A 3TCAA 2ZJDA 2IY0B 5IA7A 3PRMB 1WGDA 4PS3A 3QARA 2JPHA 1TTNA 2NPTA 2CR5A 4JL9A 1UGMA 3OAWA 3R7RA 3X23A 1WE6A 1U4AA 3K9PB 2LRWA 3PVLA 4MH0E 3ZUNA 2RR9A 2MQJA 3AU5A 2XEWA 2KMAA 1TGZB 1AARA 3V60A 1A5RA 4E71A 1XD3B 1WJ6A 4K7UA 4ZDVA 3PPAA 3JW0X 3B08A 3B1LX 3PTFC 3R7QA 4CO7A 1HE8A 3UGBB 3EFUA 2JRHA 4WWNA 3VTWA 2DZKA 3PV1A 2BYEA 4BKGA 2C60A 2NS5A 1P1AA 2O6VD 1WH3A 2NR2A 2WDTB 2Y5BB 4MJSB 3QAQA 3A9JB 5D2MB 4EEWA 4E74A 3CSTA 2B3AA 3CMMB 3RULA 2DZIA 1WM2A 2I1JA 5C23A 3W1YA 4IWOA 3KYDD 4FJYA 4E3CA 1I35A 3R66C 4AWJA 1GJZA 2N9PC 3MJWA 4MGZE 4GGQA 4JGHB 2KQSA 3PHWB 2KANA 3A4RA 3SDLC 2K8CA 4A3PA 4LDTD 3KVFB 2D10A 2BKRB 1WGYA 2IO2B 4GDKB 5FR6A 2LWPA 3UQAA 4B6WA 2KFJA 2LASA 3RCZA 3ZLZA 2LGDA 3DBLI 2MA9B 4IC7B 4AP4C 4IM0A 2V4LA 4HWIB 3ZW3A 2LXAA 5E6NA 4ANXA 3WANA 5LXIB 2WX0A 3NY5A 3H1UA 3JSVB 3MTNB 2KOXA 3K9OB 4PS7A 3TBLD 3NOBA 2ZVNA 3TL5A 4GMVA 3V6CB 2L76A 4MDKE 3QHTA 2JZ3B 3JYUA 2FIFA 2KDFB 1NBFC 1CMXB 1M94A 3WAOA 3M95A 4DHJD 1Y8RC 2MW5A 1JRUA 4DDGD 3SU8X 1UBQA 4DDID 2GOWA 4OVVA 2Z59B 4A20A 2KWCA 2LI5A 3N3KB 4W9IA 1WXAA 3PGEA 2NCNA 3WA0A 4PYUA 4GDLA 3DQVA 2AYOB 4KSLC 3IVFA 2EMSA 1EO6A 2ZVOA 3W1SC 4ZRKA 2LRUA 3O65B 5AZGA 3HHMA 2FIDA 3ZRFA 2MBEA 2RSUA 1WF9A 3PLVA 4KDIC 1I42A 2ZPYA 5AEKB 1L2NA 3APCA 2ZEQA 4F7ZA 4FN2A 2DYBA 3L08A 3T8MA 4W9CA 1WMHA 3KUZA 2JXXA 4WJPA 1R4NI 3WIMA 4IUMB 4NQKE 4I6NB 5CHWA 3H9DA 3DBHI 1YD8U 4WAAA 3VXWA 2L00B 3DVNU 5LLIA 4MGKE 1E8XA 3EHVA 3ZNID 3NHEB 4TQ1A 1BT0A 1WX8A 2GBKA 4MSMB 1SGHA 3VUWA 1KM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D07 B;  2LVQ A;  1RLF A;  3T9L A;  1J19 A;  2C7M B;  2R2O A;  3M3J A;  3PRZ A;  4DWF A;  1P98 A;  2PPH A;  3IBE A;  2RD0 A;  2KNB A;  3N30 A;  2MP2 B;  3VFK A;  3ZNZ B;  2C5L C;  3PRP B;  2IZV B;  3PZD A;  4KDL B;  4NAW A;  1OTR B;  4WWO A;  4KIK A;  4W9H A;  1ZGU B;  2DHZ A;  2L05 A;  2KFK B;  2A4Z A;  4HCN B;  1E7V A;  4KSK C;  3SHQ A;  4IG7 B;  4FHJ A;  2UWQ A;  2KTR A;  2EMT A;  2XK5 B;  5DCN A;  2FCS A;  1YX5 B;  2J0K A;  4W9G A;  2KD0 A;  2ZZP B;  4W9F A;  1H4R A;  2AEH A;  2V3S A;  4M8N A;  2O2V B;  4XZ4 A;  3VUX A;  2N1W A;  3DCG A;  2BYV E;  3UF8 A;  2C7H A;  1GC6 A;  1IP9 A;  1WYW B;  4ZYN A;  5CTR C;  4HPL B;  1OEY A;  1WGH A;  1L7Y A;  4B9K A;  2MLB A;  1UZX B;  2C7N B;  2LD9 A;  4BBN F;  3A9K B;  2KWV B;  1J8C A;  4G50 A;  2L0F A;  2MBH A;  2NBV B;  2PJH A;  1WX7 A;  3JVZ X;  4FBJ B;  3ECI A;  2GBN A;  4EZJ A;  3M63 B;  4I6P A;  4MEL A;  4PYZ A;  4LJP B;  3LJ3 A;  2KX0 A;  4NJ6 A;  3PT2 B;  4JLC A;  4DBG A;  2UYZ B;  2JUO A;  2J0J A;  4EZL A;  3KUC B;  2DYM A;  1FXT B;  1Q5W B;  3NZS A;  3OLM D;  3SD5 A;  1WR6 E;  2ZNV B;  2EKE C;  3ZO5 B;  2KHW B;  1E90 A;  2LUE A;  2N9E B;  4WQO B;  2GBM A;  3L17 A;  2RGF A;  4NPN A;  1WXM A;  3N32 A;  3PLU A;  4BOS C;  2DAJ A;  4KZC A;  3CF6 E;  2XBB C;  5DPS A;  2M0X A;  1S3S G;  2HD5 B;  3KYC D;  2OOB B;  3WAP A;  3NS8 A;  3P2B A;  5J18 A;  5LXH A;  3MHS D;  4HDQ A;  4P7I A;  3RT3 B;  4W9K A;  5JZE B;  2MRP A;  2FAZ A;  1X1M A;  4M0W B;  2DX5 B;  1YIW A;  4GOC A;  3VDZ A;  4II3 B;  2YVC A;  1GC7 A;  2J0M A;  1WZ3 A;  2O6V B;  2LGY A;  4LJO B;  4RM8 A;  4A3O A;  2KLC A;  3TMP B;  4K81 A;  1WZ0 A;  2AL6 A;  2N1V A;  4W9L A;  4N9F 4;  3V6E B;  4GU2 A;  3ONS A;  4MJS A;  2WYQ A;  2JWZ A;  1C1Y B;  2C9W B;  3A9J A;  4EUT A;  2G3Q B;  3VH4 B;  5JHB A;  4OVU A;  2KZR A;  1IPG A;  4XC2 A;  2VRR B;  2KMC A;  3UQB A;  4RMA A;  4NQL B;  3DBS A;  3KH0 A;  4FLH A;  4IM2 A;  4LDT B;  4LCD E;  2KXJ A;  1GUA B;  2PE6 B;  4NY0 A;  3X0W A;  5HKH A;  4MM3 A;  2D11 A;  1D3Z A;  2KC2 A;  5DPR A;  2K39 A;  2WX1 A;  1E8Y A;  2JY6 A;  5AZH A;  2LVO A;  2MBB B;  2L7R A;  3ALB A;  4W9D A;  3S2A A;  4FUL A;  2NBU A;  4TKN A;  3EEC A;  4ZRJ A;  3VTV A;  2G4S A;  4GDK A;  2CU1 A;  4JQW C;  4G3X B;  2I1K A;  1K8R B;  5J17 A;  4RM9 A;  1Z2M A;  3U7D A;  3VH3 B;  1QZE A;  3H7P B;  1SE9 A;  3APF A;  5JH5 C;  2KDB A;  3IG3 A;  3VQI A;  1KJT A;  1UBI A;  4ICU A;  1TBE A;  2M17 A;  1LFD A;  2BKF A;  2M8S A;  5TR5 A;  4BOZ B;  1WI0 A;  3JSV A;  2HE7 A;  3QA8 A;  2BPS A;  4WJO A;  3U8Z A;  1RRB A;  5G2N A;  1V5O A;  2BGF A;  2IY1 B;  2LXC A;  3BIN A;  1EUV B;  4GXB A;  1WFY A;  4DHJ B;  2K6Q A;  1RAX A;  4GN1 A;  1F9J A;  2M1M A;  2NBW B;  2YLM A;  3L10 B;  4ZRI A;  3H7S A;  1LXD A;  4TQ0 A;  5EDS A;  1UH6 A;  4M8M A;  2GMI C;  4HCP B;  1GNU A;  2JT4 B;  1T0Y A;  2FCM A;  1Q0W B;  2K6D B;  1YX6 B;  3A1Q B;  4FAD A;  3ML9 A;  3ZNH B;  3RZW C;  3AXC A;  4KV2 A;  4NJ7 A;  2LJ5 A;  1WY8 A;  1V5T A;  3W1S A;  4IM3 A;  4MEM A;  4CHK A;  2MSE D;  1WR1 A;  4HXD A;  4TUU A;  2N7D A;  5D7G A;  2NPT B;  2CHX A;  3C0R B;  1RFA A;  3H6N A;  5D6J B;  2PEA A;  3QC8 B;  2L3Z A;  2D3G A;  3L13 A;  1G6J A;  2KKC A;  3IHP C;  2GBR A;  5IAA C;  2BYF A;  3RD2 A;  1J0G A;  2KVR A;  1YQB A;  3D32 A;  1EF5 A;  5GMV A;  5D94 A;  1V6E A;  2IO1 B;  3ZDM C;  3HK0 A;  1WJ4 A;  5J2R A;  1KOT A;  4F8C B;  2IYD B;  5CX3 A;  2KDI A;  2AL3 A;  3WAM A;  2HTH A;  2FCQ A;  2MP2 A;  2KK8 A;  3L0W B;  4II2 B;  4PS8 A;  1P0R A;  4G0N B;  1WXS A;  2KC1 A;  4GSW A;  3HIZ A;  3R3M A;  4AUQ C;  5KHO A;  2Z0D B;  4BKS A;  1P3Q U;  3HM6 X;  4K7S A;  1V81 A;  4IW0 A;  2J7Q B;  2K25 A;  4AOF A;  4FA6 A;  4WJQ A;  1SIF A;  2ZCC A;  3BY4 B;  4BBN C;  1VD2 A;  3ENE A;  3AU4 A;  4FJZ A;  3UIP B;  5L83 A;  2MWS B;  2JVC A;  3ZVV A;  3PRE A;  3QK0 A;  4ICV A;  4TV3 A;  5G55 A;  3RYT A;  2KFK A;  2LGX A;  3OJ4 B;  3A4S C;  3TJP A;  3DBR I;  2XK5 A;  4G11 A;  3A33 B;  2L0T A;  1NI2 A;  2JF5 A;  2WWZ A;  2ZNV C;  4CYE A;  2N4F A;  2O2V A;  1E5W A;  4IWP A;  2KDE B;  4EZK A;  4B95 A;  1EF1 A;  4DHZ B;  3L16 A;  2KLG A;  4ANU A;  3UIN B;  2V1Y A;  3A9K A;  3IFW B;  3KW5 B;  4AJW A;  4K1R B;  1Z5S B;  2KTF A;  2KJ6 A;  4DHZ E;  3Q3F A;  2K8B A;  2RPQ A;  2ASQ A;  1V2Y A;  1LQB A;  2G45 B;  2IBI B;  4HPM B;  3ZIM A;  4DXA B;  2KJR A;  4DK5 A;  3DVN V;  2ZPN A;  3UIO B;  3PSE B;  4J6I A;  3VAW A;  2DZJ A;  2KN5 A;  3GZN I;  2REX A;  2DAF A;  2K8H A;  2KWU B;  3L54 A;  2MBQ A;  4F1S A;  4AJY B;  4EFO A;  3RUI B;  3APD A;  2BWE S;  4WJN A;  1IYF A;  1MG8 A;  4GIV A;  2Z0E B;  2OJR A;  2FUH B;  1YJ1 A;  5CHF A;  4URK A;  5JHA A;  2LZ6 A;  2GBJ A;  4HVB A;  4BFR A;  5C1Z A;  4GDL B;  1E7U A;  1WJN A;  2DYO A;  2IO3 B;  1WGR A;  2FNJ B;  1OEY J;  2JRI B;  3CSF A;  3VHT C;  3VTU A;  1WIA A;  2R2Q A;  3DVG X;  3V61 A;  3HM3 A;  1WJU A;  1UD7 A;  4GB9 A;  3M62 B;  2KJH B;  3QX1 A;  2D2Q A;  3LDZ E;  1WMH B;  2KQ7 A;  4EKU A;  4YL8 A;  2O6V A;  4HJK A;  3GOE A;  3RZF A;  3DOW A;  1LM8 B;  3KUD B;  2AWT A;  3Q3J A;  3TIX A;  1ZKH A;  2DZM A;  1V86 A;  2CHW A;  2DEN B;  2IO0 B;  1UEL A;  2ZCB A;  1S1Q B;  1VCB A;  2KX3 A;  4EOY A;  1E8W A;  1WM3 A;  2BWF A;  4HDO A;  3DVG Y;  1ISN A;  2MX2 A;  3ZKJ C;  3ZRC A;  2N7E A;  1NDD A;  1P9D U;  2G4D B;  2K1F A;  3QQ8 B;  5KHQ A;  4ANV A;  3V62 A;  2NVU I;  5CHV C;  3QJZ A;  1OGW A;  4I6L B;  1GG3 A;  4BVU C;  3DDC B;  1V9J A;  3PS6 A;  2CHZ A;  5BO4 B;  4K7W A;  4BKS D;  2LVP A;  2PE9 A;  4FJV B;  4KZ0 A;  4NNJ B;  3ZTC A;  4KVG B;  2FCN A;  2A5U A;  4WWP A;  2M4N A;  3B0A A;  2HJ8 A;  2L8J A;  4MGI E;  4NAW B;  3DPD A;  4W9J A;  4KIK B;  5AZF A;  3VUY A;  3ZNG C;  4BKT A;  2KO3 A;  2N9X A;  4JIO U;  2MBO A;  3H7P A;  3OJ3 A;  2W9N A;  2KTR B;  4IWQ A;  5E6P A;  1Q1O A;  1WGG A;  3EC8 A;  1PQS A;  4W9E A;  3AUL A;  3PHX B;  1V80 A;  4MSQ B;  3VVW B;  1XQQ A;  3NZU A;  4ASW C;  5DPW A;  3ZDT A;  3ZTD A;  1H8C A;  1WE7 A;  1R4M I;  4HLE A;  1WXV A;  1OQY A;  2CS4 A;  1ZW7 A;  5DPT A;  3QIJ A;  1KLV A;  1E8Z A;  3QCA A;  2MCN B;  3WAL A;  4ANW A;  1TZ1 A;  1WRD B;  4MGY E;  3U30 A;  2QHO A;  3QWZ B;  4HK2 A;  1C3T A;  3ML8 A;  2BF8 B;  4X57 B;  1WX9 A;  3I3T B;  3A1Q A;  2JZZ A;  4FHK A;  2CKH B;  3AI5 A;  1V49 A;  5L95 C;  5E6O A;  1XT9 B;  4XX5 A;  3TCA A;  2ZJD A;  2IY0 B;  5IA7 A;  3PRM B;  1WGD A;  4PS3 A;  3QAR A;  2JPH A;  1TTN A;  2NPT A;  2CR5 A;  4JL9 A;  1UGM A;  3OAW A;  3R7R A;  3X23 A;  1WE6 A;  1U4A A;  3K9P B;  2LRW A;  3PVL A;  4MH0 E;  3ZUN A;  2RR9 A;  2MQJ A;  3AU5 A;  2XEW A;  2KMA A;  1TGZ B;  1AAR A;  3V60 A;  1A5R A;  4E71 A;  1XD3 B;  1WJ6 A;  4K7U A;  4ZDV A;  3PPA A;  3JW0 X;  3B08 A;  3B1L X;  3PTF C;  3R7Q A;  4CO7 A;  1HE8 A;  3UGB B;  3EFU A;  2JRH A;  4WWN A;  3VTW A;  2DZK A;  3PV1 A;  2BYE A;  4BKG A;  2C60 A;  2NS5 A;  1P1A A;  2O6V D;  1WH3 A;  2NR2 A;  2WDT B;  2Y5B B;  4MJS B;  3QAQ A;  3A9J B;  5D2M B;  4EEW A;  4E74 A;  3CST A;  2B3A A;  3CMM B;  3RUL A;  2DZI A;  1WM2 A;  2I1J A;  5C23 A;  3W1Y A;  4IWO A;  3KYD D;  4FJY A;  4E3C A;  1I35 A;  3R66 C;  4AWJ A;  1GJZ A;  2N9P C;  3MJW A;  4MGZ E;  4GGQ A;  4JGH B;  2KQS A;  3PHW B;  2KAN A;  3A4R A;  3SDL C;  2K8C A;  4A3P A;  4LDT D;  3KVF B;  2D10 A;  2BKR B;  1WGY A;  2IO2 B;  4GDK B;  5FR6 A;  2LWP A;  3UQA A;  4B6W A;  2KFJ A;  2LAS A;  3RCZ A;  3ZLZ A;  2LGD A;  3DBL I;  2MA9 B;  4IC7 B;  4AP4 C;  4IM0 A;  2V4L A;  4HWI B;  3ZW3 A;  2LXA A;  5E6N A;  4ANX A;  3WAN A;  5LXI B;  2WX0 A;  3NY5 A;  3H1U A;  3JSV B;  3MTN B;  2KOX A;  3K9O B;  4PS7 A;  3TBL D;  3NOB A;  2ZVN A;  3TL5 A;  4GMV A;  3V6C B;  2L76 A;  4MDK E;  3QHT A;  2JZ3 B;  3JYU A;  2FIF A;  2KDF B;  1NBF C;  1CMX B;  1M94 A;  3WAO A;  3M95 A;  4DHJ D;  1Y8R C;  2MW5 A;  1JRU A;  4DDG D;  3SU8 X;  1UBQ A;  4DDI D;  2GOW A;  4OVV A;  2Z59 B;  4A20 A;  2KWC A;  2LI5 A;  3N3K B;  4W9I A;  1WXA A;  3PGE A;  2NCN A;  3WA0 A;  4PYU A;  4GDL A;  3DQV A;  2AYO B;  4KSL C;  3IVF A;  2EMS A;  1EO6 A;  2ZVO A;  3W1S C;  4ZRK A;  2LRU A;  3O65 B;  5AZG A;  3HHM A;  2FID A;  3ZRF A;  2MBE A;  2RSU A;  1WF9 A;  3PLV A;  4KDI C;  1I42 A;  2ZPY A;  5AEK B;  1L2N A;  3APC A;  2ZEQ A;  4F7Z A;  4FN2 A;  2DYB A;  3L08 A;  3T8M A;  4W9C A;  1WMH A;  3KUZ A;  2JXX A;  4WJP A;  1R4N I;  3WIM A;  4IUM B;  4NQK E;  4I6N B;  5CHW A;  3H9D A;  3DBH I;  1YD8 U;  4WAA A;  3VXW A;  2L00 B;  3DVN U;  5LLI A;  4MGK E;  1E8X A;  3EHV A;  3ZNI D;  3NHE B;  4TQ1 A;  1BT0 A;  1WX8 A;  2GBK A;  4MSM B;  1SGH A;  3VUW A;  1KM7 A; 
#chains in the Genus database with same CATH topology
 2D07 B;  2R2O A;  1P98 A;  2PPH A;  3IBE A;  4A8X C;  2QDF A;  3HUI A;  2KNB A;  1E9M A;  2IZV B;  1EWY C;  2DHZ A;  4HCN B;  5EE0 A;  2A4Z A;  2EEL A;  1E7V A;  1V8C A;  2UWQ A;  2XK5 B;  4W9G A;  2KD0 A;  2V3S A;  4M8N A;  4AQ7 A;  2D3C A;  2BYV E;  1IP9 A;  2C7H A;  1GC6 A;  1FXI A;  1OEY A;  1L7Y A;  2MLB A;  2PMV A;  3MJ5 A;  1XO3 A;  4G50 A;  2PJH A;  4FBJ B;  3Q2A C;  3ECI A;  2GBN A;  4EZJ A;  1YJI A;  4MEL A;  3LJ3 A;  2KX0 A;  1DYQ A;  1CZP A;  2WXL A;  3IT4 B;  1FNW A;  2J0J A;  4LK0 M;  3R2I A;  1Q5W B;  3OLM D;  4IKG A;  2EKE C;  2IJ0 A;  2DWQ A;  2WNM A;  2GBM A;  3L17 A;  2V0G A;  3N20 C;  4BOS C;  3ZJV A;  3CF6 E;  4LTU A;  1QOA A;  2MEK A;  1S3S G;  1OQQ A;  3RT3 B;  4O1N A;  4M0W B;  3VDZ A;  1ZUD 2;  4RM8 A;  2O6V B;  4LJO B;  4A3O A;  2KLC A;  1WZ0 A;  2WDR B;  2N9L A;  2CJO A;  4MJS A;  3ONS A;  5H92 C;  2N0S B;  4WUR A;  4EUT A;  2G3Q B;  5JHB A;  4OVU A;  3N1Y C;  3UQB A;  4RMA A;  4JX1 C;  4LDT B;  2KXJ A;  1D3Z A;  1E8Y A;  2JY6 A;  4KGT A;  2ACZ B;  3ZYY X;  2NBU A;  4GDK A;  1F1H A;  5IN7 A;  2I1K A;  1K8R B;  4RM9 A;  3H7P B;  3Q8B A;  5EE1 A;  5JH5 C;  2KDB A;  4WQM A;  1F2R I;  2M17 A;  1LFD A;  5TR5 A;  3L4P A;  1L6V A;  3JSV A;  5C3J B;  1RRB A;  2AQ1 B;  1T3Q A;  5G2N A;  2IY1 B;  1EUV B;  4GXB A;  1FPY A;  2K6Q A;  1RAX A;  1F9J A;  3L10 B;  1UH6 A;  2GMI C;  1GPX A;  2JT4 B;  1Q0W B;  3ZNH B;  2GB1 A;  4NJ7 A;  1V5T A;  1NYR A;  3MC0 B;  4L23 A;  2DLB A;  3U4E G;  2D3B A;  1RFA A;  3QC8 B;  1GB4 A;  3L13 A;  2KKC A;  3IHP C;  4ZRP A;  1JWA D;  5GMV A;  2IO1 B;  5CX3 A;  2AL3 A;  5BMI A;  2MP2 A;  3L0W B;  2KK8 A;  2KC1 A;  3HIZ A;  4C4V B;  1P3Q U;  5EE3 A;  3DBR B;  4WJQ A;  3LB8 C;  2GLS A;  3UIP B;  2JVC A;  3PRE A;  3VRB B;  2KAC A;  1ZDX A;  4KKI A;  2WXH A;  3AEC B;  3KWL A;  4G11 A;  2PVO D;  1TIF A;  1F52 A;  2Y3A A;  3UIN B;  3IFW B;  4AJW A;  2ZW0 A;  2KJ6 A;  2UU7 A;  1SJE D;  1JWU D;  1LQB A;  3Q8A A;  4DXA B;  4DK5 A;  2BB5 A;  3DVN V;  3ZGZ A;  1TS5 A;  3VAW A;  2L52 A;  1ET9 A;  1C77 A;  2QIE B;  2REX A;  3DHG C;  5HHD G;  5TSS A;  4AJY B;  3RUI B;  1IYF A;  2JU6 X;  5CHF A;  5JHA A;  5C1Z A;  3DHH C;  4BFR A;  1OEY J;  3DWG C;  4GB9 A;  3P63 A;  4KKJ A;  1BUI C;  3QX1 A;  2KQ7 A;  4HJK A;  4WAF A;  3TIX A;  2DZM A;  4M01 A;  1E8W A;  4C7Z A;  4LNF A;  2NTT A;  2BWF A;  4HDO A;  4BBN F;  1ISN A;  2MX2 A;  3QQ8 B;  2G4D B;  4I6L B;  2K5P A;  4BVU C;  5BO4 B;  2J53 A;  3PS6 A;  4BKS D;  4K7W A;  4KVG B;  2A5U A;  3B0A A;  4MGI E;  2L8J A;  3VUY A;  1EU4 A;  2N9X A;  4JIO U;  2IGG A;  3N9Y C;  2YEP F;  5E6P A;  3PHX B;  3NZU A;  1QKZ A;  3ZDT A;  3ZTD A;  1H8C A;  2PW9 A;  1R4M I;  4HLE A;  1WXV A;  1MVK A;  4TSS A;  3QIJ A;  2QCZ A;  1KLV A;  4OZB A;  4P1B C;  1WRD B;  2QHO A;  4HK2 A;  3ML8 A;  1C4C A;  2MHJ A;  4X57 B;  3I3T B;  1RM6 C;  3I57 A;  4FHK A;  1V49 A;  3SR6 A;  2ZJD A;  5IA7 A;  4YT0 B;  1UF0 A;  2JPH A;  4LNI A;  1HEZ E;  1WE6 A;  1L0X B;  3AE5 B;  2XEW A;  1TGZ B;  1XD3 B;  4K7U A;  5HG2 A;  1KFY B;  1TJE A;  3B08 A;  3B1L X;  1M4V A;  3R7Q A;  1VZ8 A;  4YTN B;  1XF5 L;  2H88 B;  3OG5 A;  4WWN A;  5T8I A;  3VTW A;  3AED B;  3PZ7 A;  2Y5B B;  4MJS B;  1ACC A;  4EEW A;  1KLG D;  3CWI A;  1ZXH A;  2LHD A;  3NG0 A;  1WM2 A;  5C23 A;  5FKA C;  4ARI A;  2KDM A;  1C78 A;  3EA6 A;  3SDL C;  3TEZ A;  2D10 A;  2BKR B;  3GP7 A;  1WGY A;  4L1B A;  2IO2 B;  4GDK B;  4A90 A;  2BW2 A;  2LAS A;  3LXF A;  2JWU A;  3CIR B;  1F0Z A;  3LYY A;  4AP4 C;  4IM0 A;  4ARC A;  2LXA A;  1MHH E;  3BII D;  3GS2 A;  3H1U A;  3JSV B;  3MTN B;  1KF6 B;  3AEA B;  1L5P A;  2L76 A;  2WU2 B;  4GLS C;  2JZ3 B;  1FNV A;  5LNK 1;  4DHJ D;  3RPF C;  4OVV A;  2KWC A;  1BML C;  1EO6 A;  2QSD A;  3SFD B;  4ZRK A;  2LRU A;  1FEH A;  2IPK D;  2FID A;  3HHM A;  1PGB A;  3ZRF A;  3PLV A;  1I42 A;  2V3P A;  4N6E B;  3KWV A;  4W9C A;  1WMH A;  3KUZ A;  2OHF A;  1R4N I;  4RGN A;  3DVN U;  3ZNI D;  2HTM E;  2RPV A;  5G5G A;  2MP2 B;  1OQR A;  1RLF A;  2C7M B;  2BS4 B;  3P4R B;  4RNA A;  4WWO A;  4NAW A;  2HDE A;  3SHQ A;  2L05 A;  4KSK C;  1HTO A;  2LHE A;  4IG7 B;  3B9J A;  4UDU C;  1XLP A;  1FIQ A;  2EMT A;  1V1P A;  2FCS A;  3BVM A;  3AM9 A;  2ZZP B;  1LGR A;  2AEH A;  4N59 A;  2IND C;  2PTL A;  4ZYS A;  2GRI A;  1WYW B;  1UZX B;  1J8C A;  3JVZ X;  3M63 B;  4PYZ A;  1TKY A;  4DBG A;  2UYZ B;  2JUO A;  4EZL A;  2DYM A;  3TUO A;  1FXT B;  2BTE A;  1WR6 E;  2ZNV B;  2N9E B;  4ACF A;  3N32 A;  3PLU A;  4JE3 B;  2DAJ A;  4KZC A;  3AE8 B;  2HD5 B;  1T0S C;  2OOB B;  3WAP A;  5J18 A;  2SEB D;  4P7I A;  3RNC C;  5JZE B;  5IOI A;  1YIW A;  4GOC A;  4II3 B;  2WXJ A;  2KYW A;  4K81 A;  2N1V A;  5BYR A;  4N9F 4;  3V6E B;  3MHZ A;  2JWZ A;  2G1E A;  1JWS D;  3VH4 B;  1STE A;  3AV8 A;  2BS3 B;  2AX5 A;  2VRR B;  3DBS A;  2GI9 A;  2HJ1 A;  4LCD E;  1MI0 A;  1GUA B;  4NY0 A;  3X0W A;  3P4S B;  2D11 A;  2KC2 A;  1CK1 A;  5AZH A;  2LVO A;  3ALB A;  4FUL A;  3UI3 A;  4ZRJ A;  3IAM 1;  5J17 A;  2G9H D;  3U7D A;  1Z2M A;  3TEW A;  1QZE A;  3APF A;  1LO5 D;  2OED A;  3IG3 A;  1XLN A;  1WI0 A;  3AEE B;  2BB6 A;  2JZP A;  2L32 A;  4A55 A;  2M1M A;  2NBW B;  2YLM A;  1C79 A;  4ZRI A;  1LXD A;  3SFE B;  1I4R A;  1L0Y B;  2K6D B;  1T0Y A;  2FCM A;  2VZK B;  3BK1 A;  1CQV A;  3ML9 A;  4FAD A;  4B0M A;  3RZW C;  1HXY D;  4IM3 A;  1WR1 A;  2I2Y A;  3RNE C;  2N7D A;  3H6N A;  2CHX A;  1P7F A;  2PEA A;  1G6J A;  5IAA C;  4ZHO A;  4LNO A;  3AN1 A;  1TY0 A;  1V6E A;  1B1Z A;  3ZDM C;  4F8C B;  1YN3 A;  1GAQ B;  2FCQ A;  4II2 B;  4MAC A;  3W2D A;  1RFK A;  4GSW A;  3R3M A;  4K7S A;  4IW0 A;  5IO9 A;  2K25 A;  4AOF A;  2CU3 A;  4FA6 A;  1HZ5 A;  1SIF A;  3BY4 B;  1VD2 A;  3ENE A;  3AU4 A;  1R7S A;  3RYT A;  2LGX A;  3OJ4 B;  2JYE A;  3A4S C;  1EU3 A;  3TJP A;  1FFU A;  2JF5 A;  1IGC A;  4CYE A;  1JML A;  2MH7 A;  1EM7 A;  3IAS 1;  2PIA A;  3AE7 B;  4M02 A;  3L16 A;  2KLG A;  5FR3 A;  3GZN B;  4DHZ E;  4ZOH C;  2K8B A;  2ASQ A;  2WXR A;  1V2Y A;  2INP E;  3ZIM A;  2QC8 A;  3VRA B;  3NUH B;  3R2T A;  1SE3 A;  1FXA A;  1FRD A;  2WXF A;  2DAF A;  1T0Q C;  3Q8E A;  4LNN A;  1MPE A;  3PO0 A;  4F1S A;  4WJN A;  2FUH B;  3P42 A;  1UWX A;  2GBJ A;  1I4G A;  1TYG B;  1E7U A;  1WJN A;  2FNJ B;  3VTU A;  2R2Q A;  3DVG X;  4P16 A;  4TMA B;  3HM3 A;  1FO4 A;  3LDZ E;  2M0A A;  4XWT A;  1WMH B;  4EKU A;  4YL8 A;  1TS2 A;  1YN5 A;  3GOE A;  3RZF A;  3HVZ A;  1C9F A;  3Q3J A;  1ZKH A;  3MC8 A;  1QOG A;  2CHW A;  4KX6 B;  5C2T B;  1P7E A;  1UEL A;  1SF0 A;  2ZCB A;  3MFG A;  3C19 A;  1VCB A;  2KX3 A;  4J3O D;  4K3C A;  1P9D U;  2MJ3 A;  3V62 A;  3QJZ A;  1PDX A;  2WXG A;  2CHZ A;  3ZXR A;  2FCN A;  4NAW B;  4MH8 A;  5AZF A;  3ZNG C;  2J42 A;  2LFI A;  1V1P B;  1QIL A;  1V80 A;  3VVW B;  1N6Z A;  1XQQ A;  3B2F A;  5DPW A;  1WE7 A;  2CS4 A;  3FKY A;  1NEK B;  2MCN B;  4HPP A;  4MGY E;  3U30 A;  1SB3 C;  1QF6 A;  2XNA C;  1C3T A;  1Q10 A;  1T6B X;  2QJL A;  3A1Q A;  2JZZ A;  3RI7 C;  3DWM A;  5L95 C;  5E6O A;  3V05 A;  2LMC A;  1XXG A;  3U2S C;  2IY0 B;  3PRM B;  4PS3 A;  1YQ4 B;  2NPT A;  1N63 A;  4JL9 A;  1UGM A;  4N58 A;  4HKQ A;  1ZDV A;  4MH0 E;  2RR9 A;  4JPS A;  4ITK A;  4E71 A;  1NYQ A;  1XCT L;  3PPA A;  3JW0 X;  1J7A A;  4IDI A;  3EFU A;  4L2Y A;  2JRH A;  4BKG A;  2X38 A;  5BMH A;  2O6V D;  1WH3 A;  1D5Z C;  4RFB A;  4E74 A;  2D5G A;  2DZI A;  4IWO A;  3KYD D;  4E3C A;  1K51 A;  2RMM A;  4GGQ A;  2L1A A;  3PHW B;  4US8 A;  2K8C A;  4A3P A;  1VLB A;  1EWC A;  1SJH D;  4LDT D;  2JXT A;  3TEX A;  2LWP A;  3RMK C;  2KFJ A;  2WP9 B;  2M19 A;  3DBL I;  3P4P B;  5E6N A;  4ANX A;  3WAN A;  2WX0 A;  3NY5 A;  1N62 A;  3K9O B;  1TY2 A;  4PS7 A;  3NOB A;  3AE6 B;  3QHT A;  1NBF C;  1V1O A;  3WAO A;  3M95 A;  4DDI D;  2I38 A;  1WYG A;  4W9I A;  1WXA A;  3BK2 A;  2NCN A;  3WA0 A;  4PYU A;  2N7J A;  4KSL C;  2QIL A;  3N1X C;  3AEG B;  1UGJ A;  2JXX A;  3WIM A;  5CHW A;  3ZJU A;  3H9D A;  4XYC A;  3DBH I;  1YD8 U;  5LLI A;  1JW9 D;  1E8X A;  4MGK E;  1L4D B;  1HZ6 A;  4MSM B;  2V9H A;  3AE9 B;  1KM7 A;  3BYT B;  2LVQ A;  2M56 B;  1J19 A;  3M3J A;  4DWF A;  1ENF A;  2V3N A;  2LGS A;  3Q69 A;  3Q6B A;  3RN9 C;  3N30 A;  4LNK A;  4PT5 A;  3ZNZ B;  1PGX A;  3NS1 A;  1DOX A;  1ZGU B;  2KTR A;  2J0K A;  2W55 A;  2NTS A;  1H4R A;  2N9K A;  2J52 A;  2KT7 A;  2N1W A;  5MPO A;  2ONQ A;  4RCO A;  3UF8 A;  4ZYN A;  5CTR C;  4HPL B;  1HQR D;  1WGH A;  4DXF A;  1MHX A;  1SSN A;  2LD9 A;  2BS2 B;  2KWV B;  2L0F A;  2MBH A;  2NBV B;  1WX7 A;  2E3T A;  2BQQ A;  1WGK A;  4KGS A;  4LJP B;  3PT2 B;  4JLC A;  1QQR A;  4USA A;  4C7Y A;  4NAM A;  1YN4 A;  1E6E B;  2KHW B;  2LUE A;  3HVD A;  4WQO B;  4MT5 A;  2XN9 C;  5JXV A;  2RGF A;  4NPN A;  4P1C C;  2M0X A;  1ET6 A;  4DXG A;  1ZPS A;  3P2B A;  3NJT A;  3O13 A;  3MHS D;  1JWM D;  2WGS A;  1ROE A;  3ABV B;  2FAZ A;  1X1M A;  4W9K A;  5FK9 C;  2WS3 B;  3DHI C;  4QAY A;  1WZ3 A;  5EE9 A;  3SEB A;  3TMP B;  2AL6 A;  4W9L A;  2WXP A;  1C1Y B;  1IUE A;  2C9W B;  5G5H A;  3EUB 2;  1JRO A;  4XC2 A;  1AN8 A;  1NVI D;  1TS4 A;  3KH0 A;  4IM2 A;  4KGR A;  2PE6 B;  1K52 A;  4MM3 A;  2K0P A;  5DPR A;  2K39 A;  2WX1 A;  2MBB B;  2BVC A;  4TKN A;  3VTV A;  2G4S A;  1TT5 B;  2RDG A;  2CU1 A;  4G3X B;  3KLS X;  4S0R A;  3VH3 B;  1SE9 A;  1YNT E;  3I9V 1;  4S17 A;  1UBI A;  2BKF A;  2M8S A;  3RNF C;  4BOZ B;  2INC C;  2HE7 A;  2BPS A;  2ICI A;  2LXC A;  2WXK A;  1WFY A;  1WSP A;  1MJD A;  2D3A A;  2BT6 A;  1UNS A;  2LJI A;  2MJE A;  4TQ0 A;  5EDS A;  4M8M A;  3A1Q B;  2TSS A;  5D3I B;  2W54 A;  4KV2 A;  3W1S A;  4MEM A;  4HXD A;  4TUU A;  2NPT B;  4ZHP A;  5BYQ A;  2D3G A;  2BYF A;  1J0G A;  4NJC A;  2KVR A;  1YQB A;  4C00 A;  3NZ3 A;  1EF5 A;  5J2R A;  4HRO A;  1WJ4 A;  3Q3M C;  1KOT A;  2IYD B;  3IT6 B;  3WAM A;  2HTH A;  2LEK A;  1C4A A;  4AUQ C;  4BKS A;  2BBC A;  1FRR A;  1V81 A;  2J7Q B;  2JX5 A;  3ZVV A;  5G55 A;  4XDD A;  3V3X A;  2KFK A;  1IBX A;  3DBR I;  1QLB B;  3U52 E;  2L0T A;  1JQ4 A;  2WWZ A;  3J9C A;  1RWS A;  2KN4 A;  2O2V A;  2YEP B;  1E5W A;  2FBW B;  1XCQ L;  2KDE B;  4IWP A;  4EZK A;  5BYS A;  2QMT A;  1EF1 A;  3C8Y A;  1V97 A;  4A9A A;  2VH2 A;  1TZO A;  3A9K A;  1D6E C;  4K1R B;  1Z5S B;  3ZJT A;  2RPQ A;  4HPM B;  4YTP B;  1QOF A;  2K9X A;  2PKO A;  2WXQ A;  3Q14 C;  4J6I A;  4HKZ E;  2KN5 A;  3WCQ A;  2K8H A;  4OHJ A;  3L54 A;  3Q3N C;  4YWG G;  2BWE S;  1MG8 A;  4GIV A;  2Z0E B;  2OJR A;  4URK A;  2LZ6 A;  4HVB A;  1SE4 A;  1JWB D;  2DYO A;  1L0V B;  1PFD A;  1WGR A;  3CSF A;  1J7C A;  1KRH A;  4IOI E;  3NVW A;  1WJU A;  1UD7 A;  1MG4 A;  4AS1 A;  1GOZ A;  3M62 B;  2KJH B;  2D2Q A;  5AUK A;  1QT9 A;  1L4Z B;  3DOW A;  2AWT A;  5HI1 A;  1V86 A;  2OJW A;  3PZ8 A;  3NVY A;  2IO0 B;  2DEN B;  4ZRQ A;  2MJD A;  3P4Q B;  4EOY A;  4XDC A;  1WM3 A;  2KWD A;  3ZRC A;  3DVG Y;  3ZKJ C;  1NDD A;  5KHQ A;  4ANV A;  2NVU I;  3NRZ A;  5CHV C;  2AQ2 B;  1JRP A;  1GG3 A;  1SIJ A;  4KZ0 A;  1DOY A;  4NNJ B;  4YXD B;  1I4H A;  3AH7 A;  4WWP A;  1SE2 A;  1I4Q A;  1R4M B;  4BKT A;  2MBO A;  1TKE A;  3OJ3 A;  2W9N A;  2KTR B;  4IWQ A;  4JWS C;  2W3R A;  3U7Z A;  2VH1 A;  1WGG A;  3EC8 A;  1PQS A;  4EE2 A;  3AUL A;  3Q8F A;  1SEB D;  1ZW7 A;  4B0E A;  3QCA A;  3WAL A;  3Q8C A;  1VZ7 A;  1TZ1 A;  3VR9 B;  1RYJ A;  1PGA A;  1WX9 A;  1J7B A;  4XX5 A;  1WGD A;  4BAX A;  3QAR A;  3GE8 C;  3IXS A;  3H8H A;  1VJK A;  3ETR A;  3K9P B;  3ZUN A;  4YSZ B;  3AU5 A;  2MQJ A;  3V60 A;  1A5R A;  2PVG C;  1WJ6 A;  3I5J C;  1FMA D;  3W5U B;  4CO7 A;  1HE8 A;  3E56 A;  3RFZ B;  1P1A A;  2WDT B;  5AUI A;  2W3S A;  5D2M B;  1ZXI A;  3T3O A;  3EFC A;  3MP9 A;  2B3A A;  1C76 A;  3FC4 A;  4HJG E;  1UWM A;  2I1J A;  2J4X A;  1I4X A;  1WRI A;  3ZQ4 A;  1GJZ A;  3MJW A;  4MGZ E;  4JGH B;  4MM3 B;  2KAN A;  3A4R A;  5IP4 D;  2WXI A;  5IKC M;  1FCL A;  3AEF B;  4IC7 B;  2V4L A;  5LXI B;  3RNA C;  3TBL D;  2ZVN A;  3TL5 A;  4GMV A;  2WHI A;  2WXN A;  3JYU A;  2FIF A;  2KVZ A;  1CMX B;  1M94 A;  4YSX B;  2MW5 A;  4DDG D;  2DBY A;  2GOW A;  2IGH A;  4A20 A;  3N3K B;  3PGE A;  3URY A;  1R4N B;  2VZK D;  4GDL A;  1T0R C;  2ZVO A;  1ZOY B;  5AZG A;  2MBE A;  1FNU A;  2ZPY A;  3APC A;  4WH4 A;  2ZEQ A;  4F7Z A;  3L08 A;  1TS3 A;  3KQ4 A;  4WJP A;  4CQN A;  4NQK E;  1FD6 A;  4WAA A;  2L00 B;  1CJE A;  5I4D A;  4TQ1 A;  2GBK A;  1WX8 A;  1SGH A;  3VUW A;  3BWU D;  3HRD D;  3AE2 B;  1PUT A;  2K22 A;  3T9L A;  4RGO S;  3PRZ A;  3RNG C;  4YTM B;  2RD0 A;  1N5W A;  3VFK A;  2C5L C;  3PRP B;  3PZD A;  4KDL B;  1OTR B;  5GXG B;  4KIK A;  4W9H A;  1AYF A;  1L2N A;  2KFK B;  1IBX B;  4FHJ A;  5DCN A;  1YX5 B;  2Y5P A;  4W9F A;  1XLO A;  4XZ4 A;  2O2V B;  3VUX A;  3DCG A;  4B9K A;  1SXT A;  2C7N B;  3A9K B;  1D5M C;  4I6P A;  3GB1 A;  1KLU D;  4NJ6 A;  4WIP A;  2IDY A;  3KUC B;  1IGD A;  3NZS A;  3SD5 A;  3ZO5 B;  4D2K A;  1E90 A;  1N5X A;  3BZD B;  4RGT A;  2KAJ A;  3AB5 A;  1MFW A;  1WXM A;  1C4P A;  1WXQ A;  2XBB C;  5DPS A;  2WXM A;  3KYC D;  2B76 B;  3NS8 A;  4US9 A;  4LLG M;  5LXH A;  4HDQ A;  2MRP A;  2DX5 B;  2YVC A;  1GC7 A;  2J0M A;  2LGY A;  1YMH E;  1YQ3 B;  2PLP A;  4GU2 A;  1DGJ A;  2WYQ A;  4RF1 A;  3A9J A;  2KZR A;  1IPG A;  3VR8 B;  2KMC A;  4NQL B;  3BVG A;  4FLH A;  2WQY B;  3E9S A;  2FE8 A;  5HKH A;  1OFF A;  3TEY A;  2DNF A;  4XE0 A;  3S2A A;  2L7R A;  4W9D A;  4OZA A;  3EEC A;  1T5X D;  3Q3O C;  1E7P B;  1F2R C;  1I7H A;  2INN E;  4JQW C;  2LUM A;  2BYT A;  1JCK B;  3VQI A;  2Z8L A;  1KJT A;  4ICU A;  1TBE A;  3QA8 A;  3U8Z A;  4WJO A;  1V5O A;  2BGF A;  3BIN A;  4DHJ B;  4GN1 A;  3H7S A;  4HCP B;  1GNU A;  1UUP A;  4C56 C;  1YX6 B;  3AXC A;  2LJ5 A;  1WY8 A;  4OW0 A;  1N61 A;  4CHK A;  2MSE D;  5D7G A;  2EKI A;  3C0R B;  3FIL A;  5D6J B;  2L3Z A;  2GBR A;  3RD2 A;  2WU5 B;  3D32 A;  1N60 A;  5D94 A;  3HK0 A;  4BZA A;  4OVZ A;  2KDI A;  4PS8 A;  1P0R A;  4G0N B;  1WXS A;  2H89 B;  5KHO A;  1XEE A;  2Z0D B;  3HM6 X;  1NEN B;  3OWE B;  2ZCC A;  4NZL B;  4BBN C;  3I63 C;  1HTQ A;  3T3N A;  4FJZ A;  5L83 A;  2MWS B;  1JAL A;  3QK0 A;  4ICV A;  4TV3 A;  2E6X A;  2XK5 A;  3A33 B;  3EGR A;  1L6U A;  1NI2 A;  2ZNV C;  2N4F A;  3NVZ A;  4B95 A;  2SAK A;  4DHZ B;  4ANU A;  4XGA B;  3R8B A;  2V1Y A;  1PYW D;  3KW5 B;  1XLQ A;  2KTF A;  2JSV X;  3Q3F A;  4PK1 A;  1VR9 A;  2G45 B;  2IBI B;  2KJR A;  2ZPN A;  1GB1 A;  3UIO B;  3PSE B;  1VRA B;  2DZJ A;  3P1M A;  3W5V B;  3GZN I;  3N1Z C;  2KWU B;  3ZXV A;  2MBQ A;  2FUG 1;  3AE4 B;  4EFO A;  3APD A;  2RDH A;  4P6V F;  3AE3 B;  1YJ1 A;  4HEA 1;  1YJJ A;  2AQ3 B;  4GDL B;  2IO3 B;  2JQR B;  2JRI B;  3VHT C;  1WIA A;  3V61 A;  2NMQ A;  2WLB A;  4M0W A;  2O6V A;  2KMM A;  1LM8 B;  3KUD B;  2X8X X;  4JWU C;  1D5X C;  2Y5C A;  1S1Q B;  1ZP0 B;  1E0Z A;  2N7E A;  1QOB A;  2K1F A;  4OZC A;  1OGW A;  3FAH A;  3TSS A;  3DDC B;  1V9J A;  2LVP A;  1HA5 A;  2PE9 A;  4FJV B;  3ZTC A;  4C80 A;  5E6J A;  4R3D A;  1KH0 A;  2M4N A;  5HFY A;  2HJ8 A;  3DPD A;  4FXC A;  4KIK B;  4W9J A;  2KO3 A;  3H7P A;  1Q1O A;  3BYY B;  4W9E A;  4MSQ B;  4DQO C;  4ASW C;  3BVZ A;  2IGD A;  3AEB B;  1OQY A;  1BXT A;  5DPT A;  1E8Z A;  1A70 A;  4ANW A;  1KTK A;  2KQ4 X;  1Y56 A;  3QWZ B;  5BMG A;  2BF8 B;  1I4P A;  2CKH B;  3AI5 A;  1FFV A;  1XT9 B;  3TCA A;  1F77 A;  2K3U A;  3MC9 A;  1TTN A;  3AE1 B;  4WWM A;  2CR5 A;  2WXO A;  4K3B A;  3OAW A;  3R7R A;  3X23 A;  2QEJ C;  1VDV A;  1U4A A;  2LRW A;  3PVL A;  4HRS A;  2KMA A;  5D3D A;  1AAR A;  2V4I B;  4ZDV A;  3B2G A;  4RF0 A;  3PTF C;  3UGB B;  1WWT A;  1K53 A;  3NVV A;  2DZK A;  1ESF A;  2BYE A;  3PV1 A;  1YOV B;  2C60 A;  2NS5 A;  4Q2J A;  4C4V A;  2NR2 A;  3QAQ A;  3A9J B;  1ZE3 D;  1DOI A;  3CST A;  3CMM B;  1AW7 A;  3RUL A;  4REZ A;  3W1Y A;  1I35 A;  4FJY A;  4H2A A;  3R66 C;  4AWJ A;  2N9P C;  2KQS A;  2WDQ B;  3DBL B;  4XWW A;  1VZ6 A;  1FM0 D;  3KVF B;  2RDB C;  1TKG A;  1FCC C;  5FR6 A;  3UQA A;  4B6W A;  3RCZ A;  3ZLZ A;  2R61 A;  2LGD A;  2MA9 B;  3ZW3 A;  4HWI B;  1SBB B;  2ZW1 A;  3RNB C;  2WDV B;  2KOX A;  3V6C B;  4MDK E;  3GE3 C;  2KDF B;  2LGI A;  4RGM A;  1Y8R C;  4M00 A;  1JRU A;  3SU8 X;  1UBQ A;  2Z59 B;  2LI5 A;  4A6Q A;  3DQV A;  2AYO B;  3IVF A;  2EMS A;  3W1S C;  3DBH B;  3O65 B;  1NI3 A;  2RSU A;  1WF9 A;  4KDI C;  1D4B A;  2Q5W D;  5H8Y E;  1K50 A;  3FIL B;  5AEK B;  4FN2 A;  2DYB A;  3T8M A;  2L83 A;  3W9C B;  3AMZ A;  4YSY B;  4RH6 A;  1E10 A;  4IUM B;  2W82 A;  2ON8 A;  4I6N B;  2JYT A;  1AWD A;  3VXW A;  1B9R A;  3EHV A;  3NHE B;  1BT0 A;  2CJN A; 
#chains in the Genus database with same CATH homology
 2D07 B;  2LVQ A;  1RLF A;  3T9L A;  1J19 A;  2C7M B;  2R2O A;  3M3J A;  3PRZ A;  4DWF A;  1P98 A;  2PPH A;  3IBE A;  2RD0 A;  2KNB A;  3N30 A;  2MP2 B;  3VFK A;  3ZNZ B;  2C5L C;  3PRP B;  2IZV B;  3PZD A;  4KDL B;  4NAW A;  1OTR B;  4WWO A;  4KIK A;  4W9H A;  1ZGU B;  2DHZ A;  2L05 A;  2KFK B;  2A4Z A;  4HCN B;  1E7V A;  4KSK C;  3SHQ A;  4IG7 B;  4FHJ A;  2UWQ A;  2KTR A;  2EMT A;  2XK5 B;  5DCN A;  2FCS A;  1YX5 B;  2J0K A;  4W9G A;  2KD0 A;  2ZZP B;  4W9F A;  1H4R A;  2AEH A;  2V3S A;  4M8N A;  2O2V B;  4XZ4 A;  3VUX A;  2N1W A;  3DCG A;  2BYV E;  3UF8 A;  2C7H A;  1GC6 A;  1IP9 A;  1WYW B;  4ZYN A;  5CTR C;  4HPL B;  1OEY A;  1WGH A;  1L7Y A;  4B9K A;  2MLB A;  1UZX B;  2C7N B;  2LD9 A;  4BBN F;  3A9K B;  2KWV B;  1J8C A;  4G50 A;  2L0F A;  2MBH A;  2NBV B;  2PJH A;  1WX7 A;  3JVZ X;  4FBJ B;  3ECI A;  2GBN A;  4EZJ A;  3M63 B;  4I6P A;  4MEL A;  4PYZ A;  4LJP B;  3LJ3 A;  2KX0 A;  4NJ6 A;  3PT2 B;  4JLC A;  4DBG A;  2UYZ B;  2JUO A;  2J0J A;  4EZL A;  3KUC B;  2DYM A;  1FXT B;  1Q5W B;  3NZS A;  3OLM D;  3SD5 A;  1WR6 E;  2ZNV B;  2EKE C;  3ZO5 B;  2KHW B;  1E90 A;  2LUE A;  2N9E B;  4WQO B;  2GBM A;  3L17 A;  2RGF A;  4NPN A;  1WXM A;  3N32 A;  3PLU A;  4BOS C;  2DAJ A;  4KZC A;  3CF6 E;  2XBB C;  5DPS A;  2M0X A;  1S3S G;  2HD5 B;  3KYC D;  2OOB B;  3WAP A;  3NS8 A;  3P2B A;  5J18 A;  5LXH A;  3MHS D;  4HDQ A;  4P7I A;  3RT3 B;  4W9K A;  5JZE B;  2MRP A;  2FAZ A;  1X1M A;  4M0W B;  2DX5 B;  1YIW A;  4GOC A;  3VDZ A;  4II3 B;  2YVC A;  1GC7 A;  2J0M A;  1WZ3 A;  2O6V B;  2LGY A;  4LJO B;  4RM8 A;  4A3O A;  2KLC A;  3TMP B;  4K81 A;  1WZ0 A;  2AL6 A;  2N1V A;  4W9L A;  4N9F 4;  3V6E B;  4GU2 A;  3ONS A;  4MJS A;  2WYQ A;  2JWZ A;  1C1Y B;  2C9W B;  3A9J A;  4EUT A;  2G3Q B;  3VH4 B;  5JHB A;  4OVU A;  2KZR A;  1IPG A;  4XC2 A;  2VRR B;  2KMC A;  3UQB A;  4RMA A;  4NQL B;  3DBS A;  3KH0 A;  4FLH A;  4IM2 A;  4LDT B;  4LCD E;  2KXJ A;  1GUA B;  2PE6 B;  4NY0 A;  3X0W A;  5HKH A;  4MM3 A;  2D11 A;  1D3Z A;  2KC2 A;  5DPR A;  2K39 A;  2WX1 A;  1E8Y A;  2JY6 A;  5AZH A;  2LVO A;  2MBB B;  2L7R A;  3ALB A;  4W9D A;  3S2A A;  4FUL A;  2NBU A;  4TKN A;  3EEC A;  4ZRJ A;  3VTV A;  2G4S A;  4GDK A;  2CU1 A;  4JQW C;  4G3X B;  2I1K A;  1K8R B;  5J17 A;  4RM9 A;  1Z2M A;  3U7D A;  3VH3 B;  1QZE A;  3H7P B;  1SE9 A;  3APF A;  5JH5 C;  2KDB A;  3IG3 A;  3VQI A;  1KJT A;  1UBI A;  4ICU A;  1TBE A;  2M17 A;  1LFD A;  2BKF A;  2M8S A;  5TR5 A;  4BOZ B;  1WI0 A;  3JSV A;  2HE7 A;  3QA8 A;  2BPS A;  4WJO A;  3U8Z A;  1RRB A;  5G2N A;  1V5O A;  2BGF A;  2IY1 B;  2LXC A;  3BIN A;  1EUV B;  4GXB A;  1WFY A;  4DHJ B;  2K6Q A;  1RAX A;  4GN1 A;  1F9J A;  2M1M A;  2NBW B;  2YLM A;  3L10 B;  4ZRI A;  3H7S A;  1LXD A;  4TQ0 A;  5EDS A;  1UH6 A;  4M8M A;  2GMI C;  4HCP B;  1GNU A;  2JT4 B;  1T0Y A;  2FCM A;  1Q0W B;  2K6D B;  1YX6 B;  3A1Q B;  4FAD A;  3ML9 A;  3ZNH B;  3RZW C;  3AXC A;  4KV2 A;  4NJ7 A;  2LJ5 A;  1WY8 A;  1V5T A;  3W1S A;  4IM3 A;  4MEM A;  4CHK A;  2MSE D;  1WR1 A;  4HXD A;  4TUU A;  2N7D A;  5D7G A;  2NPT B;  2CHX A;  3C0R B;  1RFA A;  3H6N A;  5D6J B;  2PEA A;  3QC8 B;  2L3Z A;  2D3G A;  3L13 A;  1G6J A;  2KKC A;  3IHP C;  2GBR A;  5IAA C;  2BYF A;  3RD2 A;  1J0G A;  2KVR A;  1YQB A;  3D32 A;  1EF5 A;  5GMV A;  5D94 A;  1V6E A;  2IO1 B;  3ZDM C;  3HK0 A;  1WJ4 A;  5J2R A;  1KOT A;  4F8C B;  2IYD B;  5CX3 A;  2KDI A;  2AL3 A;  3WAM A;  2HTH A;  2FCQ A;  2MP2 A;  2KK8 A;  3L0W B;  4II2 B;  4PS8 A;  1P0R A;  4G0N B;  1WXS A;  2KC1 A;  4GSW A;  3HIZ A;  3R3M A;  4AUQ C;  5KHO A;  2Z0D B;  4BKS A;  1P3Q U;  3HM6 X;  4K7S A;  1V81 A;  4IW0 A;  2J7Q B;  2K25 A;  4AOF A;  4FA6 A;  4WJQ A;  1SIF A;  2ZCC A;  3BY4 B;  4BBN C;  1VD2 A;  3ENE A;  3AU4 A;  4FJZ A;  3UIP B;  5L83 A;  2MWS B;  2JVC A;  3ZVV A;  3PRE A;  3QK0 A;  4ICV A;  4TV3 A;  5G55 A;  3RYT A;  2KFK A;  2LGX A;  3OJ4 B;  3A4S C;  3TJP A;  3DBR I;  2XK5 A;  4G11 A;  3A33 B;  2L0T A;  1NI2 A;  2JF5 A;  2WWZ A;  2ZNV C;  4CYE A;  2N4F A;  2O2V A;  1E5W A;  4IWP A;  2KDE B;  4EZK A;  4B95 A;  1EF1 A;  4DHZ B;  3L16 A;  2KLG A;  4ANU A;  3UIN B;  2V1Y A;  3A9K A;  3IFW B;  3KW5 B;  4AJW A;  4K1R B;  1Z5S B;  2KTF A;  2KJ6 A;  4DHZ E;  3Q3F A;  2K8B A;  2RPQ A;  2ASQ A;  1V2Y A;  1LQB A;  2G45 B;  2IBI B;  4HPM B;  3ZIM A;  4DXA B;  2KJR A;  4DK5 A;  3DVN V;  2ZPN A;  3UIO B;  3PSE B;  4J6I A;  3VAW A;  2DZJ A;  2KN5 A;  3GZN I;  2REX A;  2DAF A;  2K8H A;  2KWU B;  3L54 A;  2MBQ A;  4F1S A;  4AJY B;  4EFO A;  3RUI B;  3APD A;  2BWE S;  4WJN A;  1IYF A;  1MG8 A;  4GIV A;  2Z0E B;  2OJR A;  2FUH B;  1YJ1 A;  5CHF A;  4URK A;  5JHA A;  2LZ6 A;  2GBJ A;  4HVB A;  4BFR A;  5C1Z A;  4GDL B;  1E7U A;  1WJN A;  2DYO A;  2IO3 B;  1WGR A;  2FNJ B;  1OEY J;  2JRI B;  3CSF A;  3VHT C;  3VTU A;  1WIA A;  2R2Q A;  3DVG X;  3V61 A;  3HM3 A;  1WJU A;  1UD7 A;  4GB9 A;  3M62 B;  2KJH B;  3QX1 A;  2D2Q A;  3LDZ E;  1WMH B;  2KQ7 A;  4EKU A;  4YL8 A;  2O6V A;  4HJK A;  3GOE A;  3RZF A;  3DOW A;  1LM8 B;  3KUD B;  2AWT A;  3Q3J A;  3TIX A;  1ZKH A;  2DZM A;  1V86 A;  2CHW A;  2DEN B;  2IO0 B;  1UEL A;  2ZCB A;  1S1Q B;  1VCB A;  2KX3 A;  4EOY A;  1E8W A;  1WM3 A;  2BWF A;  4HDO A;  3DVG Y;  1ISN A;  2MX2 A;  3ZKJ C;  3ZRC A;  2N7E A;  1NDD A;  1P9D U;  2G4D B;  2K1F A;  3QQ8 B;  5KHQ A;  4ANV A;  3V62 A;  2NVU I;  5CHV C;  3QJZ A;  1OGW A;  4I6L B;  1GG3 A;  4BVU C;  3DDC B;  1V9J A;  3PS6 A;  2CHZ A;  5BO4 B;  4K7W A;  4BKS D;  2LVP A;  2PE9 A;  4FJV B;  4KZ0 A;  4NNJ B;  3ZTC A;  4KVG B;  2FCN A;  2A5U A;  4WWP A;  2M4N A;  3B0A A;  2HJ8 A;  2L8J A;  4MGI E;  4NAW B;  3DPD A;  4W9J A;  4KIK B;  5AZF A;  3VUY A;  3ZNG C;  4BKT A;  2KO3 A;  2N9X A;  4JIO U;  2MBO A;  3H7P A;  3OJ3 A;  2W9N A;  2KTR B;  4IWQ A;  5E6P A;  1Q1O A;  1WGG A;  3EC8 A;  1PQS A;  4W9E A;  3AUL A;  3PHX B;  1V80 A;  4MSQ B;  3VVW B;  1XQQ A;  3NZU A;  4ASW C;  5DPW A;  3ZDT A;  3ZTD A;  1H8C A;  1WE7 A;  1R4M I;  4HLE A;  1WXV A;  1OQY A;  2CS4 A;  1ZW7 A;  5DPT A;  3QIJ A;  1KLV A;  1E8Z A;  3QCA A;  2MCN B;  3WAL A;  4ANW A;  1TZ1 A;  1WRD B;  4MGY E;  3U30 A;  2QHO A;  3QWZ B;  4HK2 A;  1C3T A;  3ML8 A;  2BF8 B;  4X57 B;  1WX9 A;  3I3T B;  3A1Q A;  2JZZ A;  4FHK A;  2CKH B;  3AI5 A;  1V49 A;  5L95 C;  5E6O A;  1XT9 B;  4XX5 A;  3TCA A;  2ZJD A;  2IY0 B;  5IA7 A;  3PRM B;  1WGD A;  4PS3 A;  3QAR A;  2JPH A;  1TTN A;  2NPT A;  2CR5 A;  4JL9 A;  1UGM A;  3OAW A;  3R7R A;  3X23 A;  1WE6 A;  1U4A A;  3K9P B;  2LRW A;  3PVL A;  4MH0 E;  3ZUN A;  2RR9 A;  2MQJ A;  3AU5 A;  2XEW A;  2KMA A;  1TGZ B;  1AAR A;  3V60 A;  1A5R A;  4E71 A;  1XD3 B;  1WJ6 A;  4K7U A;  4ZDV A;  3PPA A;  3JW0 X;  3B08 A;  3B1L X;  3PTF C;  3R7Q A;  4CO7 A;  1HE8 A;  3UGB B;  3EFU A;  2JRH A;  4WWN A;  3VTW A;  2DZK A;  3PV1 A;  2BYE A;  4BKG A;  2C60 A;  2NS5 A;  1P1A A;  2O6V D;  1WH3 A;  2NR2 A;  2WDT B;  2Y5B B;  4MJS B;  3QAQ A;  3A9J B;  5D2M B;  4EEW A;  4E74 A;  3CST A;  2B3A A;  3CMM B;  3RUL A;  2DZI A;  1WM2 A;  2I1J A;  5C23 A;  3W1Y A;  4IWO A;  3KYD D;  4FJY A;  4E3C A;  1I35 A;  3R66 C;  4AWJ A;  1GJZ A;  2N9P C;  3MJW A;  4MGZ E;  4GGQ A;  4JGH B;  2KQS A;  3PHW B;  2KAN A;  3A4R A;  3SDL C;  2K8C A;  4A3P A;  4LDT D;  3KVF B;  2D10 A;  2BKR B;  1WGY A;  2IO2 B;  4GDK B;  5FR6 A;  2LWP A;  3UQA A;  4B6W A;  2KFJ A;  2LAS A;  3RCZ A;  3ZLZ A;  2LGD A;  3DBL I;  2MA9 B;  4IC7 B;  4AP4 C;  4IM0 A;  2V4L A;  4HWI B;  3ZW3 A;  2LXA A;  5E6N A;  4ANX A;  3WAN A;  5LXI B;  2WX0 A;  3NY5 A;  3H1U A;  3JSV B;  3MTN B;  2KOX A;  3K9O B;  4PS7 A;  3TBL D;  3NOB A;  2ZVN A;  3TL5 A;  4GMV A;  3V6C B;  2L76 A;  4MDK E;  3QHT A;  2JZ3 B;  3JYU A;  2FIF A;  2KDF B;  1NBF C;  1CMX B;  1M94 A;  3WAO A;  3M95 A;  4DHJ D;  1Y8R C;  2MW5 A;  1JRU A;  4DDG D;  3SU8 X;  1UBQ A;  4DDI D;  2GOW A;  4OVV A;  2Z59 B;  4A20 A;  2KWC A;  2LI5 A;  3N3K B;  4W9I A;  1WXA A;  3PGE A;  2NCN A;  3WA0 A;  4PYU A;  4GDL A;  3DQV A;  2AYO B;  4KSL C;  3IVF A;  2EMS A;  1EO6 A;  2ZVO A;  3W1S C;  4ZRK A;  2LRU A;  3O65 B;  5AZG A;  3HHM A;  2FID A;  3ZRF A;  2MBE A;  2RSU A;  1WF9 A;  3PLV A;  4KDI C;  1I42 A;  2ZPY A;  5AEK B;  1L2N A;  3APC A;  2ZEQ A;  4F7Z A;  4FN2 A;  2DYB A;  3L08 A;  3T8M A;  4W9C A;  1WMH A;  3KUZ A;  2JXX A;  4WJP A;  1R4N I;  3WIM A;  4IUM B;  4NQK E;  4I6N B;  5CHW A;  3H9D A;  3DBH I;  1YD8 U;  4WAA A;  3VXW A;  2L00 B;  3DVN U;  5LLI A;  4MGK E;  1E8X A;  3EHV A;  3ZNI D;  3NHE B;  4TQ1 A;  1BT0 A;  1WX8 A;  2GBK A;  4MSM B;  1SGH A;  3VUW A;  1KM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...