3A4SC

The crystal structure of the sld2:ubc9 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
QELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGLESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for regulation of poly-SUMO chain by a SUMO-like domain of Nip45
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/trnascription
molecule keywords SUMO-conjugating enzyme UBC9
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3a4sC00
5JZEB 3PPAA 2HD5B 4PYUA 3ML8A 3WAPA 5AEKB 4IM3A 2PJHA 1TGZB 2I1KA 4W9EA 3QK0A 2KJRA 4M8MA 2KMAA 3JW0X 4B9KA 2KDBA 4K7WA 2PE9A 4B95A 4EZKA 1UELA 1X1MA 2KD0A 4DXAB 2CHWA 5J17A 4WWPA 1P98A 1NBFC 1P3QU 3UIPB 5C23A 4CHKA 4F1SA 3L08A 3QIJA 4BKSA 4M8NA 4HK2A 2L3ZA 3A9KB 3NS8A 3PGEA 3A33B 4MSQB 3TBLD 4DHZE 5L95C 1M94A 2GMIC 2DAJA 3PV1A 2ZNVB 2LZ6A 2CHXA 3PRMB 2BWES 4ICVA 1WJ6A 4CYEA 5LXIB 5LLIA 2C60A 1E5WA 2ZPNA 2BYEA 4AJYB 3B08A 1GNUA 2EKEC 2KFKB 1GG3A 2O6VA 1G6JA 2J0KA 1WM2A 3V6CB 4PS8A 4GDLA 3C0RB 3AI5A 3ZRFA 4TV3A 3ZW3A 3KYCD 5E6NA 5D2MB 2DZMA 3U7DA 1J8CA 3QWZB 2CHZA 5GMVA 1SE9A 5L83A 2RR9A 3VUXA 2BGFA 4BKSD 2KHWB 4W9LA 5AZHA 2UYZB 2LXCA 2A5UA 3B1LX 3BINA 4HXDA 1WXVA 2WX1A 1WH3A 2CKHB 2XK5B 4HJKA 5DPSA 1GJZA 2M0XA 4MM3A 1L2NA 3Q3JA 1WF9A 4FA6A 2Z0DB 3M62B 3ECIA 2CR5A 3OJ4B 4KV2A 4AP4C 2K1FA 4MGYE 2JWZA 4W9IA 3KVFB 2V1YA 3TJPA 4WWNA 2Z59B 3DOWA 1E8XA 1NI2A 2L0TA 2M4NA 3PVLA 3QHTA 3VTWA 4LDTB 3HHMA 3ML9A 3RYTA 2LD9A 4EKUA 2BKRB 4MH0E 2MSED 1EF5A 3VHTC 4BOSC 4ZRKA 4NJ6A 3PS6A 3QARA 2KLCA 1WR6E 1TZ1A 3L0WB 3KH0A 5DPTA 4DHZB 3A9KA 3OLMD 5DCNA 2KK8A 1YD8U 2EMTA 2FNJB 2DZKA 2RGFA 3H7PA 3ONSA 4IWOA 3ZTCA 2G3QB 3A1QB 2OOBB 2KQ7A 4W9KA 4NPNA 4E3CA 2AL3A 4TUUA 1WE7A 4KIKB 2KTRB 4WJNA 2KN5A 2KX0A 3N30A 2K39A 4K7UA 3DQVA 2FAZA 1WJUA 4HLEA 2DHZA 2G4SA 2FIDA 2REXA 3QJZA 3VUWA 1WIAA 3KUCB 4W9GA 3V60A 1C1YB 2ZZPB 3RUIB 4N9F4 2RD0A 2MW5A 2GBKA 2C7NB 3A4RA 2D07B 3KYDD 4W9CA 5D94A 3WA0A 4A20A 2KVRA 1WX7A 2JZ3B 3OJ3A 3K9OB 3SHQA 1LXDA 2G45B 2DZJA 3B0AA 1Q1OA 4EOYA 2JRIB 4MELA 2EMSA 3IHPC 4AUQC 2L05A 4PYZA 4LJPB 1WM3A 2LI5A 2HJ8A 1E8ZA 2NBWB 3SD5A 1P1AA 4LCDE 2L8JA 3R3MA 3VFKA 1WXAA 2NVUI 2JF5A 3H7SA 4X57B 3TMPB 4ANWA 1OTRB 3OAWA 2ZNVC 3KUZA 2L76A 2D2QA 4JQWC 4AWJA 1UZXB 1EUVB 2MA9B 1P0RA 2BYVE 4KIKA 3UQBA 4NAWB 3HM3A 4WJPA 4GOCA 2LVQA 3UIOB 5BO4B 4ZDVA 2JPHA 2N4FA 3PREA 3NZSA 1K8RB 3VDZA 2D11A 1ZW7A 2GBNA 2L7RA 5D6JB 1WXMA 2CS4A 2CU1A 4FULA 4MJSB 3WANA 1WJNA 3GOEA 4FN2A 3X0WA 3W1SC 4FADA 3I3TB 1R4MI 4HCNB 2KANA 2LRUA 2MX2A 4W9FA 4GB9A 1YX5B 3N32A 1H4RA 2LWPA 3CSFA 1WX8A 2LASA 2N9EB 2MCNB 3PTFC 1WFYA 1AARA 2KJ6A 1FXTB 1WGRA 4BOZB 4MGIE 3O65B 3U8ZA 1VCBA 4GDKB 1VD2A 4FJZA 3IG3A 1WR1A 2J7QB 2IO1B 2PE6B 3RD2A 2K6DB 3R7QA 3RULA 4ICUA 2IYDB 4GN1A 3PHWB 3M63B 3TCAA 2XK5A 2LGDA 4LJOB 4MGZE 1V81A 3ZRCA 1A5RA 2MLBA 4NY0A 2DYBA 2KDFB 4F8CB 1ZKHA 4MDKE 3T8MA 4DDID 3M3JA 4KZCA 2J0MA 4IM0A 2ZCBA 1Z5SB 4DDGD 2NPTB 4WWOA 2DX5B 4BFRA 4RM8A 2KFJA 2KTFA 4GDKA 3QX1A 4GSWA 3EFUA 2KZRA 3R7RA 1L7YA 3QC8B 4K7SA 1IPGA 2JVCA 2IY1B 1WGHA 1TBEA 2PPHA 3H7PB 3UF8A 4WJQA 4XC2A 2JY6A 4BKTA 2KX3A 1OGWA 3L17A 4TQ0A 3IVFA 4I6NB 2C5LC 1S1QB 4KDIC 3R66C 3UINB 3ENEA 3GZNI 4ANXA 2R2QA 1UGMA 2PEAA 1R4NI 1LQBA 5IAAC 3BY4B 4G0NB 1ISNA 2WX0A 1V86A 2WDTB 3L54A 2MRPA 2MQJA 2GOWA 2LGYA 2MP2A 1WI0A 4MGKE 4ANUA 3JSVB 3DCGA 3VH3B 1KJTA 3HM6X 3PLVA 2NS5A 2UWQA 4FJVB 4EZJA 2C7MB 1YJ1A 1WGDA 2A4ZA 2KQSA 4PS3A 4URKA 2KLGA 2WWZA 1S3SG 3ZDTA 2IZVB 3P2BA 2I1JA 3AU5A 3ZNHB 1F9JA 4DHJD 4GDLB 3KW5B 4EUTA 4DK5A 5CHWA 4W9DA 2WYQA 2ASQA 2ZCCA 2MBOA 2KXJA 1U4AA 1WGYA 4FHJA 3NOBA 4IG7B 2N7DA 5CHFA 3UQAA 2D3GA 3DVGY 4IC7B 3PZDA 3RT3B 5CHVC 2MWSB 4G11A 3UGBB 1TTNA 2N1VA 5J18A 4NQLB 2XEWA 2K8HA 2AWTA 1Q0WB 4IWPA 2KO3A 2LRWA 3L13A 2DYOA 1WJ4A 3ZTDA 4BBNC 3MTNB 2IO2B 4BVUC 4IM2A 4MEMA 2N1WA 1V5TA 4FLHA 1WXSA 5D7GA 1T0YA 4HVBA 3EECA 4W9JA 4JIOU 4XZ4A 1J19A 3X23A 1YX6B 2JXXA 2JT4B 2MBBB 2ZJDA 4JL9A 1WY8A 1UBQA 1PQSA 1Z2MA 1LFDA 1RAXA 1GUAB 3ZDMC 2KOXA 4KSKC 3PT2B 3V61A 3EC8A 4NQKE 1Q5WB 3LDZE 4I6LB 4EFOA 4F7ZA 1WMHA 3KUDB 4M0WB 1KOTA 1NDDA 2MBEA 3W1YA 3V6EB 2MBQA 1YQBA 3PSEB 3Q3FA 1WX9A 2B3AA 4GGQA 1I35A 2DZIA 3QA8A 4PS7A 5IA7A 3A1QA 1SIFA 3NZUA 1GC7A 1XQQA 4WAAA 2VRRB 2FCQA 2K6QA 1CMXB 1KM7A 3DPDA 2G4DB 4BBNF 2KFKA 2KWCA 2O6VB 2KDIA 3M95A 3DBRI 1WZ3A 2ZEQA 3K9PB 2M1MA 2KDEB 3WIMA 4K81A 2AYOB 2FCSA 3DVNU 4XX5A 5KHQA 1Y8RC 3NHEB 4NJ7A 2JZZA 4ANVA 4EEWA 5G55A 2JUOA 4HWIB 2AL6A 2J0JA 3VH4B 4DWFA 1C3TA 2Z0EB 3W1SA 4P7IA 3ZKJC 4DHJB 5JHBA 4ASWC 2ZPYA 1OEYA 2IY0B 2LGXA 1GC6A 1SGHA 2GBMA 2IBIB 3SU8X 5LXHA 2O6VD 2LUEA 4HDOA 4B6WA 3EHVA 1V49A 4K1RB 3N3KB 4HDQA 2DYMA 4E71A 2FUHB 2LXAA 2GBJA 5E6OA 2C7HA 1MG8A 3HK0A 1OEYJ 2FCNA 1QZEA 1EF1A 2FCMA 2R2OA 3AULA 4GMVA 1V9JA 4ZRJA 4W9HA 3DBHI 4OVVA 5G2NA 5HKHA 3JSVA 3CF6E 3ZVVA 4EZLA 4HPMB 3VTVA 3ZNID 3HIZA 1IYFA 3H6NA 5AZGA 2HTHA 1J0GA 4E74A 2IO3B 4GU2A 4GIVA 3VAWA 4NNJB 3VVWB 4AJWA 5KHOA 4KDLB 3LJ3A 1BT0A 1EO6A 4ZYNA 1WYWB 3JVZX 3IFWB 2D10A 3APCA 1E7UA 4MJSA 4OVUA 4II3B 2MP2B 4YL8A 1WGGA 2XBBC 2KJHB 3DVNV 1E8YA 3AU4A 3PRZA 3VXWA 4JGHB 3QCAA 2BYFA 4CO7A 3AXCA 2LJ5A 1V2YA 5DPRA 2L00B 3PRPB 2MBHA 3NY5A 2NBVB 3WALA 2BPSA 4WQOB 3APDA 3CSTA 3DBSA 4KZ0A 2ZVOA 4AOFA 3VTUA 3ALBA 2L0FA 2YLMA 3WAMA 1OQYA 1WRDB 3PHXB 4A3OA 1UH6A 2K8CA 3ZNGC 4NAWA 1XD3B 5FR6A 3S2AA 3WAOA 2NCNA 4TKNA 2O2VB 3A9JA 2KWUB 1RRBA 4GXBA 1LM8B 2V4LA 4RM9A 3QAQA 2Y5BB 2LVOA 4KVGB 3DDCB 2NR2A 5TR5A 4FJYA 1WE6A 5CTRC 2NBUA 4J6IA 5AZFA 2KKCA 4TQ1A 3DVGX 4FHKA 2N7EA 2BF8B 2DAFA 2M17A 4II2B 3L16A 1YIWA 1D3ZA 1I42A 5C1ZA 2W9NA 1V6EA 1UD7A 5E6PA 4WJOA 2RPQA 3H1UA 2GBRA 1WZ0A 1H8CA 2YVCA 3RZWC 3A4SC 1E90A 3QQ8B 3ZIMA 1RLFA 3JYUA 1UBIA 3IBEA 3MJWA 1HE8A 2BWFA 1KLVA 2ZVNA 2AEHA 5J2RA 2KTRA 2KC1A 1IP9A 4G3XB 4FBJB 2RSUA 4MSMB 1V80A 4LDTD 2N9XA 4HPLB 2K25A 3H9DA 3ZLZA 4DBGA 1ZGUB 3D32A 1XT9B 3ZO5B 2KMCA 2NPTA 2LVPA 2BKFA 2OJRA 4RMAA 3VUYA 2O2VA 1JRUA 2KWVB 1E8WA 4A3PA 2FIFA 2JRHA 4IW0A 2N9PC 2K8BA 3A9JB 3RZFA 3V62A 5EDSA 3T9LA 2KC2A 3PLUA 3RCZA 5CX3A 3MHSD 2V3SA 3APFA 2QHOA 4I6PA 3U30A 3DBLI 2KNBA 2HE7A 1E7VA 2DENB 4ZRIA 2IO0B 3CMMB 4KSLC 1P9DU 4G50A 2M8SA 1WMHB 3L10B 3TIXA 3ZUNA 1RFAA 4IUMB 3SDLC 4HCPB 5JH5C 4JLCA 1V5OA 5DPWA 4BKGA 4IWQA 5JHAA 3TL5A 3VQIA 2C9WB 3ZNZB
chains in the Genus database with same CATH superfamily
2WXPA 3LB8C 3WAPA 4IM3A 2I1KA 2AQ2B 4W9EA 3URYA 3JW0X 3N9YC 4K7WA 2PE9A 4B95A 1UELA 1QQRA 3GP7A 4DXAB 4KGRA 1NYRA 1C4AA 3UIPB 4CHKA 3AV8A 3L08A 3QIJA 2LEKA 4BKSA 3TEYA 4DHZE 3A33B 1YN5A 1ZPSA 2QCZA 1JWSD 5I4DA 1C4PA 1IBXB 2DAJA 3PRMB 2WDQB 2ZPNA 2RDHA 2KFKB 1JWBD 1WM2A 3V6CB 4GDLA 2KYWA 4TV3A 3ZW3A 3U7ZA 1TKGA 1J8CA 1XCQL 3QWZB 2CHZA 5GMVA 5L83A 2RR9A 4K3BA 1FPYA 2BGFA 2KHWB 3MJ5A 4YTPB 1QLBB 2K5PA 3BINA 5C2TB 1WH3A 4HJKA 5DPSA 1TS3A 3Q3JA 2Z0DB 4RGMA 3M62B 3BYYB 3ECIA 4KV2A 4WWNA 2Z59B 3DOWA 1NI2A 2M4NA 3HHMA 4EKUA 1CJEA 4BOSC 5BMIA 1BMLC 3PS6A 2PVGC 3C8YA 1IBXA 1TZ1A 5DPTA 4DHZB 3IAS1 1DOYA 4ZRQA 3OLMD 2KK8A 2FNJB 2DZKA 4W9KA 2OOBB 2FBWB 2GLSA 2KQ7A 2AL3A 2KTRB 2KN5A 2K39A 1XLOA 4K7UA 1VZ7A 1L0VB 2DHZA 3DBHB 3SFEB 1C1YB 3RUIB 2GBKA 1YN4A 1E9MA 3E56A 3A4RA 4W9CA 3WA0A 4A20A 2SAKA 1WX7A 1DOXA 4JWSC 3B0AA 1Q1OA 1N5WA 3Q8FA 1ROEA 4WIPA 4MELA 2HJ8A 2NBWB 4LCDE 1WXAA 4ANWA 2L76A 2MA9B 1P0RA 2BYVE 4KIKA 4NAWB 3UIOB 4KX6B 5BO4B 2DWQA 3RNFC 1V97A 3N1YC 5D6JB 1WXMA 3AE9B 1T5XD 3R8BA 3I3TB 3FKYA 1B9RA 2MX2A 2WDVB 1VR9A 1H4RA 2QSDA 5EE1A 1WX8A 1R7SA 2LASA 2OEDA 4YSXB 2N9EB 1JROA 1FXTB 4BOZB 4S17A 3U8ZA 4GDKB 5G5GA 4PK1A 1VD2A 3IG3A 2PE6B 3BWUD 4YT0B 2K6DB 3R7QA 2IYDB 4GN1A 4LJOB 3ZRCA 1EU4A 2KDFB 3GB1A 4DDID 4OHJA 2J0MA 2CJOA 5IOIA 4WWOA 1F77A 3EFUA 2JVCA 1WGHA 2PPHA 3H7PB 2QC8A 4YXDB 4XC2A 1HZ6A 1OGWA 3IVFA 1S1QB 4KDIC 3UINB 1SF0A 3Q8BA 1UGMA 2EKIA 2V3NA 1LQBA 4TSSA 1ET9A 3BY4B 1N63A 1GB1A 4G0NB 1V86A 2WDTB 3L54A 3AEGB 1PGAA 2LJIA 4KGTA 1WI0A 3JSVB 3HM6X 2NS5A 4EZJA 2C7MB 4US8A 3ZXVA 2KLGA 4USAA 3ZDTA 3P2BA 3P42A 4DK5A 2KQ4X 3Q3MC 4P1CC 2W54A 4FHJA 3RNCC 1U4AA 1WGYA 3KWVA 3NOBA 3VRAB 4RF1A 4IG7B 2WXNA 3AE4B 3U52E 3NG0A 3C19A 4G11A 3UGBB 1TTNA 4XWWA 4LNOA 2XEWA 1WJ4A 3MTNB 1QT9A 1QOBA 1V1OA 3NVWA 1WXSA 1AWDA 4HVBA 3NZ3A 1J7AA 1PQSA 1LFDA 3PT2B 3EC8A 1FO4A 1Q5WB 4I6LB 3TSSA 1WMHA 4M0WB 1KOTA 1C4CA 3BZDB 5IA7A 1XQQA 4WAAA 2VRRB 2K6QA 4YTMB 3KLSX 2KWCA 2O6VB 2KWDA 4OZAA 3K9PB 4LTUA 1F1HA 3EUB2 3B2FA 1Y8RC 4NJ7A 4ANVA 3N20C 4H2AA 1JALA 2J4XA 2JX5A 3MP9A 1JW9D 1FXAA 2D3CA 2WXKA 5JHBA 2L83A 4YWGG 1XEEA 2V3PA 1CK1A 2LUEA 4HDOA 4B6WA 2BW2A 4K1RB 3N3KB 4HDQA 4E71A 3RNGC 1XF5L 1MG8A 2ICIA 2KMMA 2MEKA 2R2OA 2XNAC 3DBHI 1CZPA 4OVVA 1TS5A 3JSVA 3CF6E 4HPMB 3IT4B 2LHEA 1IYFA 5AZGA 1SJED 2IO3B 4GU2A 1TKEA 4GIVA 4NNJB 4AJWA 1MPEA 1EO6A 4ZYNA 1WYWB 3APCA 3I63C 1C79A 1WGGA 2XBBC 1TY0A 4C00A 3QCAA 5DPRA 3AE1B 1QKZA 3NY5A 2BPSA 3RNBC 3V05A 3CSTA 1SE4A 3VTUA 2L52A 3PHXB 5FR6A 3DHIC 2LVOA 4KVGB 1IGCA 3AEFB 2WU5B 5TR5A 2NBUA 2INPE 2KKCA 2JQRB 4C7YA 2DAFA 2HTME 4M02A 3GS2A 2IGGA 5C1ZA 5E6PA 1UD7A 4L23A 2RPQA 2GBRA 2WXMA 1I4PA 2YVCA 1RLFA 3V3XA 1KLVA 2BWFA 3MFGA 2KTRA 1D5XC 2KC1A 3BIID 5HI1A 2WLBA 3P4PB 1PFDA 2W82A 2N9XA 3ZLZA 3P1MA 2AQ1B 2OJRA 2O2VA 3BK2A 2FIFA 2K22A 4M0WA 2K8BA 3A9JB 1WSPA 3RZFA 2BT6A 3AEDB 3MHSD 4OZCA 3APFA 3U30A 4WAFA 1P9DU 4TMAB 2VZKD 4HCPB 4JLCA 3TL5A 3ZNZB 3AEAB 2YEPF 3ABVB 5BYRA 2HD5B 4HKQA 2KDMA 2KD0A 1AN8A 3WCQA 1PGXA 1NBFC 1P3QU 1FMAD 4F1SA 4IDIA 4XE0A 2INNE 1YQ4B 2K9XA 1L5PA 1ZP0B 3PV1A 3HVDA 2CHXA 3W5UB 4ICVA 2GB1A 5IP4D 2C60A 1E5WA 4US9A 1UUPA 4OZBA 1GNUA 2EKEC 2IGDA 1GG3A 2O6VA 1G6JA 1XLNA 3RI7C 3C0RB 4XGAB 3KYCD 3AH7A 5T8IA 2M56B 2ZW0A 3VUXA 2RDGA 1SE3A 4HXDA 1VZ6A 1WXVA 2WX1A 4MM3A 1NENB 1L2NA 4FA6A 3I5JC 4C7ZA 2J42A 2INCC 2V1YA 3TJPA 4L2YA 1KLUD 2L0TA 3VTWA 3QHTA 3RYTA 2BKRB 2MSED 4ZRKA 3IAM1 3QARA 2PVOD 1WRIA 3KH0A 1E7PB 3A9KA 5DCNA 1YD8U 2RGFA 3H7PA 4E3CA 3AE6B 1WE7A 1M4VA 1IGDA 4J3OD 2G4SA 2FIDA 2REXA 1WIAA 2K0PA 3SEBA 3TEXA 3V60A 2MW5A 2Q5WD 2JU6X 1J7BA 3KYDD 2J53A 5D94A 2AX5A 2X8XX 2KVRA 2JZ3B 3K9OB 2DZJA 2WS3B 4ZHOA 2V4IB 2JRIB 2EMSA 3IHPC 4PYZA 4ZRPA 1WM3A 2LI5A 1E6EB 3SD5A 2L8JA 3R3MA 4X57B 3H7SA 2JF5A 1LGRA 4LLGM 4JQWC 1WGKA 4AQ7A 3UQBA 4ZDVA 2JPHA 2N4FA 5MPOA 2D11A 2GBNA 4MJSB 3GOEA 3AE8B 1T6BX 4W9FA 3FILB 3DWGC 3NS1A 4C80A 1T3QA 5HHDG 3Q8EA 2QEJC 2WGSA 4MGIE 1VCBA 2J7QB 2IO1B 4KKJA 3RULA 4ICUA 3PHWB 3M63B 1VJKA 2LGDA 2XK5A 4YSYB 3P4RB 1XLPA 1MG4A 1DYQA 4NY0A 2DYBA 2QDFA 1ZKHA 4MDKE 2ZCBA 2NPTB 2DX5B 2H88B 1QILA 3DBLB 4GSWA 2KZRA 3R7RA 4K7SA 1YQ3B 1UWMA 4L1BA 4WJQA 2JY6A 4BKTA 3L17A 4TQ0A 1UNSA 1QOFA 4I6NB 2VZKB 3R66C 4ANXA 2WDRB 1TZOA 2HJ1A 4ZHPA 2YEPB 1WWTA 1CQVA 1PYWD 2MRPA 3Q3OC 4MGKE 3RPFC 3HRDD 3PLVA 3PZ7A 4HKZE 3N1XC 1NVID 5FK9C 4URKA 2NTTA 1S3SG 2WXGA 3GE8C 1QOGA 1F9JA 2X38A 4GDLB 1QOAA 4S0RA 3NRZA 2BS2B 3Q3NC 2N7DA 1SIJA 4RF0A 1FXIA 4IC7B 3RT3B 4NQLB 1Q0WB 2FUG1 4IWPA 1N6ZA 3L13A 4MACA 4XDCA 4BBNC 4BVUC 1N61A 5BYSA 2N1WA 1V5TA 4FLHA 1P7EA 2ON8A 2VH1A 4W9JA 1YN3A 2JT4B 4JL9A 1UBQA 2KOXA 3FILA 3LDZE 3KUDB 3V6EB 2MBQA 2V9HA 3Q3FA 1WX9A 3QA8A 3AE5B 2I2YA 3NZUA 1GC7A 1KM7A 3DPDA 4BBNF 2KFKA 2KAJA 4UDUC 2VH2A 3DBRI 1WZ3A 3TEZA 4DXGA 4XX5A 2MJ3A 2FCSA 1VZ8A 1TKYA 4RFBA 5JXVA 3SFDB 5G55A 2JUOA 1FFVA 2J0JA 3ZKJC 2ZPYA 2IY0B 1SGHA 2GBMA 4R3DA 5LXHA 2O6VD 3ZJVA 1TIFA 1MJDA 3J9CA 3AE7B 3RNAC 2WXIA 4O1NA 2OHFA 2FCMA 3VRBB 3PZ8A 4W9HA 5HKHA 3ZNID 1EWYC 3H6NA 2WXFA 3VVWB 1HTQA 2KT7A 1YJJA 3LJ3A 3NVVA 1C76A 3IFWB 4ZYSA 2IDYA 2MP2B 4YL8A 2IGHA 1OFFA 1LO5D 2KJHB 1L0YB 3DVNV 3AU4A 1VDVA 3PRZA 1PDXA 2BYFA 4CO7A 5D3IB 2BYTA 3PRPB 3CWIA 4WQOB 3DBSA 4AOFA 3ALBA 1WRDB 1OQYA 1UH6A 5FR3A 4P6VF 3A9JA 4GXBA 4RM9A 2V4LA 3DDCB 2Y5PA 4TQ1A 4FHKA 3I9V1 4II2B 3L16A 1YIWA 1XLQA 1I42A 2N9LA 5FKAC 1H8CA 3ZIMA 3JYUA 3IBEA 3MJWA 2ZVNA 1BXTA 5J2RA 4RGNA 4G3XB 2RSUA 4MSMB 1V80A 2XN9C 1FEHA 3H9DA 2BBCA 2W3RA 4JPSA 1ZGUB 2KMCA 3Q69A 4RMAA 2PIAA 2PLPA 1HEZE 3V62A 2V0GA 3T9LA 2M0AA 3PLUA 3RCZA 2QHOA 2WXLA 3DBLI 2HE7A 2KNBA 1ZDVA 2DENB 3BVGA 4ZRIA 3W9CB 2IO0B 5G5HA 4KSLC 4G50A 3TUOA 3ZUNA 1RFAA 3SDLC 4BKGA 4IWQA 3PPAA 1GAQB 3ML8A 5AEKB 2PMVA 1TGZB 4B0MA 2IJ0A 3QK0A 2KJRA 4M8MA 2KMAA 4B9KA 2KDBA 4EZKA 5J17A 4WWPA 4OW0A 1L0XB 3AEBB 4HK2A 2L3ZA 3Q2AC 3PGEA 4MSQB 4JX1C 2Y5CA 2LZ6A 4RH6A 2BWES 1WJ6A 5LXIB 4AJYB 3B08A 2BS3B 1UWXA 1EWCA 2JYTA 4RCOA 4YSZB 3AI5A 3Q8CA 1GPXA 1SJHD 4W9LA 3B1LX 2LXCA 1EM7A 3AB5A 2CKHB 4HJGE 1WF9A 2CR5A 3OJ4B 4AP4C 5H8YE 2K1FA 4MGYE 4W9IA 3KVFB 3RNEC 1E8XA 2WXRA 3PVLA 5BMGA 3ML9A 2LD9A 4MH0E 3VHTC 5H92C 4NJ6A 2BB6A 3L4PA 3L0WB 1TS2A 3ONSA 2D3AA 4REZA 3ZTCA 2G3QB 3A1QB 1KH0A 4TUUA 4KIKB 3HVZA 1N60A 1AYFA 1WJUA 4HLEA 1FFUA 3QJZA 2WXJA 1KRHA 1K53A 1YJIA 1XCTL 2C7NB 4LNNA 3OJ3A 1LXDA 2G45B 4ACFA 4XWTA 4EOYA 1Q10A 4A9AA 1F2RI 4M01A 2LUMA 4AUQC 2L05A 5GXGB 3PO0A 2PKOA 1E8ZA 1P1AA 1I4XA 3VFKA 2NVUI 3TMPB 3OAWA 2ZNVC 4AWJA 1HQRD 1L6UA 3HM3A 4WJPA 4GOCA 3PREA 2N9KA 1ZW7A 2L7RA 2CS4A 2JZPA 1WJNA 4FN2A 2DBYA 3X0WA 3W1SC 1WXQA 4HCNB 2LRUA 2N7JA 2GI9A 1SXTA 1YX5B 3N32A 2WXOA 2LWPA 3CSFA 1VLBA 4DQOC 1J7CA 4WQMA 2KJ6A 1AARA 1UF0A 1WGRA 3AE3B 2N0SB 1WR1A 1FIQA 3RD2A 3B2GA 1JRPA 3TCAA 1MVKA 1V81A 2MLBA 2FE8A 4F8CB 3T8MA 3M3JA 3NUHB 4C4VB 1Z5SB 4RM8A 2KTFA 2R61A 4N6EB 4GDKA 3QX1A 1L7YA 3QC8B 1IPGA 4MT5A 3GE3C 3BVMA 2KX3A 4P16A 3GZNB 3RN9C 3MC9A 3ENEA 2JWUA 2PEAA 1R4NI 3ZXRA 5E6JA 1JWAD 2WHIA 1SB3C 1DGJA 2MQJA 4BZAA 3Q6BA 5HG2A 4ANUA 3VH3B 1C77A 2CU3A 2UWQA 4N58A 1YJ1A 1YOVB 2ZW1A 2KQSA 2ONQA 2WWZA 4MH8A 1FM0D 1N62A 1A70A 2IZVB 2CJNA 4DHJD 3KW5B 4EUTA 1F0ZA 4W9DA 2ASQA 2KXJA 4NJCA 2KACA 5CHFA 3UQAA 2D3GA 4A8XC 1JCKB 2MWSB 1UGJA 5J18A 1RM6C 2K8HA 2AWTA 2RDBC 2KO3A 2DYOA 3ZTDA 2IO2B 4QAYA 3H8HA 5D7GA 3AM9A 1F52A 4JIOU 4XZ4A 1J19A 1ACCA 1YX6B 2MBBB 2ZJDA 3FAHA 1Z2MA 1RAXA 1GUAB 4RGTA 4KSKC 3V61A 1KFYB 5AUKA 1NDDA 3W1YA 1YQBA 3PSEB 1I35A 3A1QA 1SIFA 2G4DB 1RFKA 1KTKA 2M1MA 2KDEB 1JMLA 3WIMA 4K81A 5KHQA 1I7HA 2WU2B 3NHEB 4HEA1 4HWIB 2AL6A 1V8CA 3ZJTA 4DWFA 4C4VA 4LNKA 4DHJB 4ARCA 4LNFA 2LGXA 1T0QC 1GC6A 2IBIB 2E3TA 1STEA 1PUTA 1V49A 1K52A 1XXGA 5E6OA 4LK0M 2C7HA 1T0RC 5EE0A 3ZYYX 2FCNA 3E9SA 1EF1A 4GMVA 4ZRJA 1AW7A 4OVZA 3LXFA 2JXTA 1FCLA 5G2NA 5BMHA 1DOIA 2M19A 2HTHA 1J0GA 4E74A 2H89B 4LNIA 5KHOA 4KDLB 1BT0A 2MJEA 1HA5A 3Q8AA 1E7UA 4OVUA 4II3B 3TEWA 2BB5A 5TSSA 4AS1A 1E8YA 1ET6A 3VXWA 2PTLA 2LJ5A 3VR9B 2QILA 3IXSA 3WALA 3APDA 4KZ0A 2ZVOA 2L0FA 4A3OA 2K8CA 3R2TA 3ZNGC 4NAWA 3S2AA 3WAOA 2NCNA 3MC0B 1RRBA 3QAQA 3W2DA 3T3OA 1WE6A 4J6IA 1L4DB 3NJTA 5AZFA 1ZDXA 3DVGX 2BF8B 1D3ZA 3BVZA 2KVZA 4ITKA 4WJOA 3H1UA 5BYQA 2K3UA 4B0EA 1WZ0A 3A4SC 1E90A 1UBIA 2EELA 1HE8A 1TJEA 2LMCA 1IP9A 2RPVA 4FBJB 2QIEB 2K25A 4DBGA 3D32A 1XT9B 2NPTA 3VUYA 1E8WA 2JRHA 3BYTB 3HUIA 1KF6B 4GLSC 5IO9A 2L1AA 1HXYD 2KC2A 5CX3A 3NVZA 4I6PA 3CMMB 1I4QA 1WMHB 3EFCA 3L10B 2LGIA 1OQQA 1V5OA 5JHAA 4RNAA 4GB9A 2C9WB 2B76B 4FXCA 5JZEB 3U2SC 4PYUA 2SEBD 4WH4A 1BUIC 2PJHA 1XO3A 2TSSA 2W3SA 3DHGC 1GB4A 1X1MA 2CHWA 1P98A 5C23A 4M8NA 1L4ZB 1JWUD 3A9KB 3NS8A 3TBLD 2PW9A 5L95C 1M94A 2GMIC 1TT5B 2ZNVB 3CIRB 3MC8A 4HROA 4CYEA 5LLIA 2BVCA 2BYEA 3RMKC 2NTSA 2J0KA 4PS8A 3ZRFA 1SEBD 5E6NA 5D2MB 2DZMA 1GOZA 3U7DA 1SE9A 4BKSD 5AZHA 1NYQA 1YMHE 2UYZB 2A5UA 1FNWA 2XK5B 1GJZA 2M0XA 1ENFA 2WP9B 2AQ3B 2JWZA 4M00A 1JQ4A 4LDTB 3Q14C 2ACZB 1EF5A 1T0SC 1OQRA 2KLCA 1WR6E 1HTOA 3NVYA 4ARIA 1ESFA 2EMTA 4IWOA 4NPNA 2DLBA 4WJNA 2KX0A 3N30A 1MHHE 3DQVA 3N1ZC 2FAZA 4KGSA 1IUEA 3LYYA 2DNFA 3VUWA 3KUCB 4W9GA 2ZZPB 4N9F4 2RD0A 2D07B 4HRSA 4IOIE 3SHQA 3T3NA 2L32A 1B1ZA 2UU7A 4XDDA 2BTEA 4LJPB 5HFYA 2G9HD 3AEEB 3KWLA 3ETRA 1OTRB 4WWMA 3KUZA 2D2QA 1UZXB 1EUVB 1FRDA 1MI0A 2LVQA 1PGBA 1YNTE 3NZSA 1K8RB 3VDZA 1VRAB 2Y3AA 4FULA 2CU1A 3WANA 2D5GA 4FADA 3P63A 1R4MI 2RMMA 1JWMD 2KANA 1FCCC 4YTNB 1P7FA 1C78A 2MCNB 4WURA 3PTFC 1WFYA 1FNVA 3O65B 4FJZA 3AECB 4A6QA 3AE2B 1I4GA 5LNK1 4A90A 4MGZE 1A5RA 4BAXA 2W55A 4KZCA 4IM0A 1ZXHA 4DDGD 4P1BC 4BFRA 2KFJA 3KQ4A 2WNMA 1N5XA 2LFIA 1D6EC 1HZ5A 2IY1B 1TBEA 5IKCM 3UF8A 1K50A 2JSVX 3W5VB 1NEKB 2C5LC 2INDC 1KLGD 3GZNI 4A55A 2R2QA 3EGRA 2J52A 1TS4A 1R4NB 5IAAC 1FD6A 1ISNA 2WX0A 1TY2A 5IN7A 3DHHC 2GOWA 2LGYA 2MP2A 3DCGA 1KJTA 4FJVB 2WXHA 1WGDA 2A4ZA 2BQQA 4PS3A 5C3JB 1ZOYB 4HPPA 2OJWA 2I1JA 3AU5A 3ZNHB 3DWMA 5CHWA 4CQNA 2WYQA 3VR8B 2ZCCA 2MBOA 1I4HA 4D2KA 3DVGY 3PZDA 3ZJUA 5CHVC 2N1VA 3R2IA 5EE3A 2LRWA 1SE2A 1ZUD2 2QMTA 4IM2A 4MEMA 1D4BA 3OWEB 1T0YA 3EECA 4NAMA 3X23A 1MFWA 2JXXA 4Q2JA 1WY8A 1SSNA 3ZDMC 4NQKE 4EFOA 4F7ZA 2MBEA 1TYGB 1F2RC 4GGQA 2B3AA 2DZIA 4PS7A 1FRRA 2FCQA 1E0ZA 1CMXB 2KDIA 3M95A 2ZEQA 4N59A 1K51A 2AYOB 3DVNU 4PT5A 2MHJA 4KKIA 2JZZA 4EEWA 2MH7A 3VH4B 1C3TA 2Z0EB 3W1SA 4P7IA 2JYEA 4ASWC 1OEYA 1SBBB 4ZOHC 5EE9A 2G1EA 3SU8X 1E10A 4IKGA 3EHVA 5AUIA 2NMQA 1C9FA 2DYMA 2FUHB 2LXAA 2GBJA 2E6XA 2KN4A 1FNUA 3HK0A 2QJLA 1OEYJ 1QF6A 1QZEA 3DBRB 3AULA 1V9JA 4XYCA 3OG5A 3ZGZA 4JWUC 4EZLA 3ZVVA 3VTVA 3HIZA 3P4SB 3VAWA 2Z8LA 2BS4B 3JVZX 3UI3A 1RWSA 3P4QB 2D10A 4MJSA 3EA6A 4JGHB 3AXCA 1V2YA 2L00B 2MBHA 1V1PA 2NBVB 3I57A 1NI3A 2D3BA 2GRIA 2YLMA 3WAMA 1XD3B 1ZE3D 4TKNA 2O2VB 4DXFA 2KWUB 4MM3B 1LM8B 3BK1A 2Y5BB 1RYJA 3IT6B 3O13A 2NR2A 2HDEA 4FJYA 5CTRC 3MHZA 4NZLB 3B9JA 3AN1A 2LGSA 1R4MB 2N7EA 2M17A 1Y56A 3ZQ4A 1MHXA 1EU3A 1V1PB 2W9NA 1V6EA 2LHDA 2I38A 2WXQA 3RZWC 3QQ8B 2AEHA 4JE3B 1ZXIA 4LDTD 4HPLB 2IPKD 3U4EG 1D5MC 4RGOS 3FC4A 3ZO5B 3SR6A 2LVPA 2BKFA 5D3DA 1L6VA 1JRUA 2KWVB 4A3PA 4IW0A 2N9PC 2MJDA 5EDSA 4C56C 3AMZA 2V3SA 1E7VA 4K3CA 3RFZB 1I4RA 2M8SA 3TIXA 1D5ZC 1WYGA 4IUMB 5JH5C 2WQYB 5DPWA 3VQIA 4EE2A
chains in the Genus database with same CATH topology
5JZEB 3PPAA 2HD5B 4PYUA 3ML8A 3WAPA 5AEKB 4IM3A 2PJHA 1TGZB 2I1KA 4W9EA 3QK0A 2KJRA 4M8MA 2KMAA 3JW0X 4B9KA 2KDBA 4K7WA 2PE9A 4B95A 4EZKA 1UELA 1X1MA 2KD0A 4DXAB 2CHWA 5J17A 4WWPA 1P98A 1NBFC 1P3QU 3UIPB 5C23A 4CHKA 4F1SA 3L08A 3QIJA 4BKSA 4M8NA 4HK2A 2L3ZA 3A9KB 3NS8A 3PGEA 3A33B 4MSQB 3TBLD 4DHZE 5L95C 1M94A 2GMIC 2DAJA 3PV1A 2ZNVB 2LZ6A 2CHXA 3PRMB 2BWES 4ICVA 1WJ6A 4CYEA 5LXIB 5LLIA 2C60A 1E5WA 2ZPNA 2BYEA 4AJYB 3B08A 1GNUA 2EKEC 2KFKB 1GG3A 2O6VA 1G6JA 2J0KA 1WM2A 3V6CB 4PS8A 4GDLA 3C0RB 3AI5A 3ZRFA 4TV3A 3ZW3A 3KYCD 5E6NA 5D2MB 2DZMA 3U7DA 1J8CA 3QWZB 2CHZA 5GMVA 1SE9A 5L83A 2RR9A 3VUXA 2BGFA 4BKSD 2KHWB 4W9LA 5AZHA 2UYZB 2LXCA 2A5UA 3B1LX 3BINA 4HXDA 1WXVA 2WX1A 1WH3A 2CKHB 2XK5B 4HJKA 5DPSA 1GJZA 2M0XA 4MM3A 1L2NA 3Q3JA 1WF9A 4FA6A 2Z0DB 3M62B 3ECIA 2CR5A 3OJ4B 4KV2A 4AP4C 2K1FA 4MGYE 2JWZA 4W9IA 3KVFB 2V1YA 3TJPA 4WWNA 2Z59B 3DOWA 1E8XA 1NI2A 2L0TA 2M4NA 3PVLA 3QHTA 3VTWA 4LDTB 3HHMA 3ML9A 3RYTA 2LD9A 4EKUA 2BKRB 4MH0E 2MSED 1EF5A 3VHTC 4BOSC 4ZRKA 4NJ6A 3PS6A 3QARA 2KLCA 1WR6E 1TZ1A 3L0WB 3KH0A 5DPTA 4DHZB 3A9KA 3OLMD 5DCNA 2KK8A 1YD8U 2EMTA 2FNJB 2DZKA 2RGFA 3H7PA 3ONSA 4IWOA 3ZTCA 2G3QB 3A1QB 2OOBB 2KQ7A 4W9KA 4NPNA 4E3CA 2AL3A 4TUUA 1WE7A 4KIKB 2KTRB 4WJNA 2KN5A 2KX0A 3N30A 2K39A 4K7UA 3DQVA 2FAZA 1WJUA 4HLEA 2DHZA 2G4SA 2FIDA 2REXA 3QJZA 3VUWA 1WIAA 3KUCB 4W9GA 3V60A 1C1YB 2ZZPB 3RUIB 4N9F4 2RD0A 2MW5A 2GBKA 2C7NB 3A4RA 2D07B 3KYDD 4W9CA 5D94A 3WA0A 4A20A 2KVRA 1WX7A 2JZ3B 3OJ3A 3K9OB 3SHQA 1LXDA 2G45B 2DZJA 3B0AA 1Q1OA 4EOYA 2JRIB 4MELA 2EMSA 3IHPC 4AUQC 2L05A 4PYZA 4LJPB 1WM3A 2LI5A 2HJ8A 1E8ZA 2NBWB 3SD5A 1P1AA 4LCDE 2L8JA 3R3MA 3VFKA 1WXAA 2NVUI 2JF5A 3H7SA 4X57B 3TMPB 4ANWA 1OTRB 3OAWA 2ZNVC 3KUZA 2L76A 2D2QA 4JQWC 4AWJA 1UZXB 1EUVB 2MA9B 1P0RA 2BYVE 4KIKA 3UQBA 4NAWB 3HM3A 4WJPA 4GOCA 2LVQA 3UIOB 5BO4B 4ZDVA 2JPHA 2N4FA 3PREA 3NZSA 1K8RB 3VDZA 2D11A 1ZW7A 2GBNA 2L7RA 5D6JB 1WXMA 2CS4A 2CU1A 4FULA 4MJSB 3WANA 1WJNA 3GOEA 4FN2A 3X0WA 3W1SC 4FADA 3I3TB 1R4MI 4HCNB 2KANA 2LRUA 2MX2A 4W9FA 4GB9A 1YX5B 3N32A 1H4RA 2LWPA 3CSFA 1WX8A 2LASA 2N9EB 2MCNB 3PTFC 1WFYA 1AARA 2KJ6A 1FXTB 1WGRA 4BOZB 4MGIE 3O65B 3U8ZA 1VCBA 4GDKB 1VD2A 4FJZA 3IG3A 1WR1A 2J7QB 2IO1B 2PE6B 3RD2A 2K6DB 3R7QA 3RULA 4ICUA 2IYDB 4GN1A 3PHWB 3M63B 3TCAA 2XK5A 2LGDA 4LJOB 4MGZE 1V81A 3ZRCA 1A5RA 2MLBA 4NY0A 2DYBA 2KDFB 4F8CB 1ZKHA 4MDKE 3T8MA 4DDID 3M3JA 4KZCA 2J0MA 4IM0A 2ZCBA 1Z5SB 4DDGD 2NPTB 4WWOA 2DX5B 4BFRA 4RM8A 2KFJA 2KTFA 4GDKA 3QX1A 4GSWA 3EFUA 2KZRA 3R7RA 1L7YA 3QC8B 4K7SA 1IPGA 2JVCA 2IY1B 1WGHA 1TBEA 2PPHA 3H7PB 3UF8A 4WJQA 4XC2A 2JY6A 4BKTA 2KX3A 1OGWA 3L17A 4TQ0A 3IVFA 4I6NB 2C5LC 1S1QB 4KDIC 3R66C 3UINB 3ENEA 3GZNI 4ANXA 2R2QA 1UGMA 2PEAA 1R4NI 1LQBA 5IAAC 3BY4B 4G0NB 1ISNA 2WX0A 1V86A 2WDTB 3L54A 2MRPA 2MQJA 2GOWA 2LGYA 2MP2A 1WI0A 4MGKE 4ANUA 3JSVB 3DCGA 3VH3B 1KJTA 3HM6X 3PLVA 2NS5A 2UWQA 4FJVB 4EZJA 2C7MB 1YJ1A 1WGDA 2A4ZA 2KQSA 4PS3A 4URKA 2KLGA 2WWZA 1S3SG 3ZDTA 2IZVB 3P2BA 2I1JA 3AU5A 3ZNHB 1F9JA 4DHJD 4GDLB 3KW5B 4EUTA 4DK5A 5CHWA 4W9DA 2WYQA 2ASQA 2ZCCA 2MBOA 2KXJA 1U4AA 1WGYA 4FHJA 3NOBA 4IG7B 2N7DA 5CHFA 3UQAA 2D3GA 3DVGY 4IC7B 3PZDA 3RT3B 5CHVC 2MWSB 4G11A 3UGBB 1TTNA 2N1VA 5J18A 4NQLB 2XEWA 2K8HA 2AWTA 1Q0WB 4IWPA 2KO3A 2LRWA 3L13A 2DYOA 1WJ4A 3ZTDA 4BBNC 3MTNB 2IO2B 4BVUC 4IM2A 4MEMA 2N1WA 1V5TA 4FLHA 1WXSA 5D7GA 1T0YA 4HVBA 3EECA 4W9JA 4JIOU 4XZ4A 1J19A 3X23A 1YX6B 2JXXA 2JT4B 2MBBB 2ZJDA 4JL9A 1WY8A 1UBQA 1PQSA 1Z2MA 1LFDA 1RAXA 1GUAB 3ZDMC 2KOXA 4KSKC 3PT2B 3V61A 3EC8A 4NQKE 1Q5WB 3LDZE 4I6LB 4EFOA 4F7ZA 1WMHA 3KUDB 4M0WB 1KOTA 1NDDA 2MBEA 3W1YA 3V6EB 2MBQA 1YQBA 3PSEB 3Q3FA 1WX9A 2B3AA 4GGQA 1I35A 2DZIA 3QA8A 4PS7A 5IA7A 3A1QA 1SIFA 3NZUA 1GC7A 1XQQA 4WAAA 2VRRB 2FCQA 2K6QA 1CMXB 1KM7A 3DPDA 2G4DB 4BBNF 2KFKA 2KWCA 2O6VB 2KDIA 3M95A 3DBRI 1WZ3A 2ZEQA 3K9PB 2M1MA 2KDEB 3WIMA 4K81A 2AYOB 2FCSA 3DVNU 4XX5A 5KHQA 1Y8RC 3NHEB 4NJ7A 2JZZA 4ANVA 4EEWA 5G55A 2JUOA 4HWIB 2AL6A 2J0JA 3VH4B 4DWFA 1C3TA 2Z0EB 3W1SA 4P7IA 3ZKJC 4DHJB 5JHBA 4ASWC 2ZPYA 1OEYA 2IY0B 2LGXA 1GC6A 1SGHA 2GBMA 2IBIB 3SU8X 5LXHA 2O6VD 2LUEA 4HDOA 4B6WA 3EHVA 1V49A 4K1RB 3N3KB 4HDQA 2DYMA 4E71A 2FUHB 2LXAA 2GBJA 5E6OA 2C7HA 1MG8A 3HK0A 1OEYJ 2FCNA 1QZEA 1EF1A 2FCMA 2R2OA 3AULA 4GMVA 1V9JA 4ZRJA 4W9HA 3DBHI 4OVVA 5G2NA 5HKHA 3JSVA 3CF6E 3ZVVA 4EZLA 4HPMB 3VTVA 3ZNID 3HIZA 1IYFA 3H6NA 5AZGA 2HTHA 1J0GA 4E74A 2IO3B 4GU2A 4GIVA 3VAWA 4NNJB 3VVWB 4AJWA 5KHOA 4KDLB 3LJ3A 1BT0A 1EO6A 4ZYNA 1WYWB 3JVZX 3IFWB 2D10A 3APCA 1E7UA 4MJSA 4OVUA 4II3B 2MP2B 4YL8A 1WGGA 2XBBC 2KJHB 3DVNV 1E8YA 3AU4A 3PRZA 3VXWA 4JGHB 3QCAA 2BYFA 4CO7A 3AXCA 2LJ5A 1V2YA 5DPRA 2L00B 3PRPB 2MBHA 3NY5A 2NBVB 3WALA 2BPSA 4WQOB 3APDA 3CSTA 3DBSA 4KZ0A 2ZVOA 4AOFA 3VTUA 3ALBA 2L0FA 2YLMA 3WAMA 1OQYA 1WRDB 3PHXB 4A3OA 1UH6A 2K8CA 3ZNGC 4NAWA 1XD3B 5FR6A 3S2AA 3WAOA 2NCNA 4TKNA 2O2VB 3A9JA 2KWUB 1RRBA 4GXBA 1LM8B 2V4LA 4RM9A 3QAQA 2Y5BB 2LVOA 4KVGB 3DDCB 2NR2A 5TR5A 4FJYA 1WE6A 5CTRC 2NBUA 4J6IA 5AZFA 2KKCA 4TQ1A 3DVGX 4FHKA 2N7EA 2BF8B 2DAFA 2M17A 4II2B 3L16A 1YIWA 1D3ZA 1I42A 5C1ZA 2W9NA 1V6EA 1UD7A 5E6PA 4WJOA 2RPQA 3H1UA 2GBRA 1WZ0A 1H8CA 2YVCA 3RZWC 3A4SC 1E90A 3QQ8B 3ZIMA 1RLFA 3JYUA 1UBIA 3IBEA 3MJWA 1HE8A 2BWFA 1KLVA 2ZVNA 2AEHA 5J2RA 2KTRA 2KC1A 1IP9A 4G3XB 4FBJB 2RSUA 4MSMB 1V80A 4LDTD 2N9XA 4HPLB 2K25A 3H9DA 3ZLZA 4DBGA 1ZGUB 3D32A 1XT9B 3ZO5B 2KMCA 2NPTA 2LVPA 2BKFA 2OJRA 4RMAA 3VUYA 2O2VA 1JRUA 2KWVB 1E8WA 4A3PA 2FIFA 2JRHA 4IW0A 2N9PC 2K8BA 3A9JB 3RZFA 3V62A 5EDSA 3T9LA 2KC2A 3PLUA 3RCZA 5CX3A 3MHSD 2V3SA 3APFA 2QHOA 4I6PA 3U30A 3DBLI 2KNBA 2HE7A 1E7VA 2DENB 4ZRIA 2IO0B 3CMMB 4KSLC 1P9DU 4G50A 2M8SA 1WMHB 3L10B 3TIXA 3ZUNA 1RFAA 4IUMB 3SDLC 4HCPB 5JH5C 4JLCA 1V5OA 5DPWA 4BKGA 4IWQA 5JHAA 3TL5A 3VQIA 2C9WB 3ZNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JZE B;  3PPA A;  2HD5 B;  4PYU A;  3ML8 A;  3WAP A;  5AEK B;  4IM3 A;  2PJH A;  1TGZ B;  2I1K A;  4W9E A;  3QK0 A;  2KJR A;  4M8M A;  2KMA A;  3JW0 X;  4B9K A;  2KDB A;  4K7W A;  2PE9 A;  4B95 A;  4EZK A;  1UEL A;  1X1M A;  2KD0 A;  4DXA B;  2CHW A;  5J17 A;  4WWP A;  1P98 A;  1NBF C;  1P3Q U;  3UIP B;  5C23 A;  4CHK A;  4F1S A;  3L08 A;  3QIJ A;  4BKS A;  4M8N A;  4HK2 A;  2L3Z A;  3A9K B;  3NS8 A;  3PGE A;  3A33 B;  4MSQ B;  3TBL D;  4DHZ E;  5L95 C;  1M94 A;  2GMI C;  2DAJ A;  3PV1 A;  2ZNV B;  2LZ6 A;  2CHX A;  3PRM B;  2BWE S;  4ICV A;  1WJ6 A;  4CYE A;  5LXI B;  5LLI A;  2C60 A;  1E5W A;  2ZPN A;  2BYE A;  4AJY B;  3B08 A;  1GNU A;  2EKE C;  2KFK B;  1GG3 A;  2O6V A;  1G6J A;  2J0K A;  1WM2 A;  3V6C B;  4PS8 A;  4GDL A;  3C0R B;  3AI5 A;  3ZRF A;  4TV3 A;  3ZW3 A;  3KYC D;  5E6N A;  5D2M B;  2DZM A;  3U7D A;  1J8C A;  3QWZ B;  2CHZ A;  5GMV A;  1SE9 A;  5L83 A;  2RR9 A;  3VUX A;  2BGF A;  4BKS D;  2KHW B;  4W9L A;  5AZH A;  2UYZ B;  2LXC A;  2A5U A;  3B1L X;  3BIN A;  4HXD A;  1WXV A;  2WX1 A;  1WH3 A;  2CKH B;  2XK5 B;  4HJK A;  5DPS A;  1GJZ A;  2M0X A;  4MM3 A;  1L2N A;  3Q3J A;  1WF9 A;  4FA6 A;  2Z0D B;  3M62 B;  3ECI A;  2CR5 A;  3OJ4 B;  4KV2 A;  4AP4 C;  2K1F A;  4MGY E;  2JWZ A;  4W9I A;  3KVF B;  2V1Y A;  3TJP A;  4WWN A;  2Z59 B;  3DOW A;  1E8X A;  1NI2 A;  2L0T A;  2M4N A;  3PVL A;  3QHT A;  3VTW A;  4LDT B;  3HHM A;  3ML9 A;  3RYT A;  2LD9 A;  4EKU A;  2BKR B;  4MH0 E;  2MSE D;  1EF5 A;  3VHT C;  4BOS C;  4ZRK A;  4NJ6 A;  3PS6 A;  3QAR A;  2KLC A;  1WR6 E;  1TZ1 A;  3L0W B;  3KH0 A;  5DPT A;  4DHZ B;  3A9K A;  3OLM D;  5DCN A;  2KK8 A;  1YD8 U;  2EMT A;  2FNJ B;  2DZK A;  2RGF A;  3H7P A;  3ONS A;  4IWO A;  3ZTC A;  2G3Q B;  3A1Q B;  2OOB B;  2KQ7 A;  4W9K A;  4NPN A;  4E3C A;  2AL3 A;  4TUU A;  1WE7 A;  4KIK B;  2KTR B;  4WJN A;  2KN5 A;  2KX0 A;  3N30 A;  2K39 A;  4K7U A;  3DQV A;  2FAZ A;  1WJU A;  4HLE A;  2DHZ A;  2G4S A;  2FID A;  2REX A;  3QJZ A;  3VUW A;  1WIA A;  3KUC B;  4W9G A;  3V60 A;  1C1Y B;  2ZZP B;  3RUI B;  4N9F 4;  2RD0 A;  2MW5 A;  2GBK A;  2C7N B;  3A4R A;  2D07 B;  3KYD D;  4W9C A;  5D94 A;  3WA0 A;  4A20 A;  2KVR A;  1WX7 A;  2JZ3 B;  3OJ3 A;  3K9O B;  3SHQ A;  1LXD A;  2G45 B;  2DZJ A;  3B0A A;  1Q1O A;  4EOY A;  2JRI B;  4MEL A;  2EMS A;  3IHP C;  4AUQ C;  2L05 A;  4PYZ A;  4LJP B;  1WM3 A;  2LI5 A;  2HJ8 A;  1E8Z A;  2NBW B;  3SD5 A;  1P1A A;  4LCD E;  2L8J A;  3R3M A;  3VFK A;  1WXA A;  2NVU I;  2JF5 A;  3H7S A;  4X57 B;  3TMP B;  4ANW A;  1OTR B;  3OAW A;  2ZNV C;  3KUZ A;  2L76 A;  2D2Q A;  4JQW C;  4AWJ A;  1UZX B;  1EUV B;  2MA9 B;  1P0R A;  2BYV E;  4KIK A;  3UQB A;  4NAW B;  3HM3 A;  4WJP A;  4GOC A;  2LVQ A;  3UIO B;  5BO4 B;  4ZDV A;  2JPH A;  2N4F A;  3PRE A;  3NZS A;  1K8R B;  3VDZ A;  2D11 A;  1ZW7 A;  2GBN A;  2L7R A;  5D6J B;  1WXM A;  2CS4 A;  2CU1 A;  4FUL A;  4MJS B;  3WAN A;  1WJN A;  3GOE A;  4FN2 A;  3X0W A;  3W1S C;  4FAD A;  3I3T B;  1R4M I;  4HCN B;  2KAN A;  2LRU A;  2MX2 A;  4W9F A;  4GB9 A;  1YX5 B;  3N32 A;  1H4R A;  2LWP A;  3CSF A;  1WX8 A;  2LAS A;  2N9E B;  2MCN B;  3PTF C;  1WFY A;  1AAR A;  2KJ6 A;  1FXT B;  1WGR A;  4BOZ B;  4MGI E;  3O65 B;  3U8Z A;  1VCB A;  4GDK B;  1VD2 A;  4FJZ A;  3IG3 A;  1WR1 A;  2J7Q B;  2IO1 B;  2PE6 B;  3RD2 A;  2K6D B;  3R7Q A;  3RUL A;  4ICU A;  2IYD B;  4GN1 A;  3PHW B;  3M63 B;  3TCA A;  2XK5 A;  2LGD A;  4LJO B;  4MGZ E;  1V81 A;  3ZRC A;  1A5R A;  2MLB A;  4NY0 A;  2DYB A;  2KDF B;  4F8C B;  1ZKH A;  4MDK E;  3T8M A;  4DDI D;  3M3J A;  4KZC A;  2J0M A;  4IM0 A;  2ZCB A;  1Z5S B;  4DDG D;  2NPT B;  4WWO A;  2DX5 B;  4BFR A;  4RM8 A;  2KFJ A;  2KTF A;  4GDK A;  3QX1 A;  4GSW A;  3EFU A;  2KZR A;  3R7R A;  1L7Y A;  3QC8 B;  4K7S A;  1IPG A;  2JVC A;  2IY1 B;  1WGH A;  1TBE A;  2PPH A;  3H7P B;  3UF8 A;  4WJQ A;  4XC2 A;  2JY6 A;  4BKT A;  2KX3 A;  1OGW A;  3L17 A;  4TQ0 A;  3IVF A;  4I6N B;  2C5L C;  1S1Q B;  4KDI C;  3R66 C;  3UIN B;  3ENE A;  3GZN I;  4ANX A;  2R2Q A;  1UGM A;  2PEA A;  1R4N I;  1LQB A;  5IAA C;  3BY4 B;  4G0N B;  1ISN A;  2WX0 A;  1V86 A;  2WDT B;  3L54 A;  2MRP A;  2MQJ A;  2GOW A;  2LGY A;  2MP2 A;  1WI0 A;  4MGK E;  4ANU A;  3JSV B;  3DCG A;  3VH3 B;  1KJT A;  3HM6 X;  3PLV A;  2NS5 A;  2UWQ A;  4FJV B;  4EZJ A;  2C7M B;  1YJ1 A;  1WGD A;  2A4Z A;  2KQS A;  4PS3 A;  4URK A;  2KLG A;  2WWZ A;  1S3S G;  3ZDT A;  2IZV B;  3P2B A;  2I1J A;  3AU5 A;  3ZNH B;  1F9J A;  4DHJ D;  4GDL B;  3KW5 B;  4EUT A;  4DK5 A;  5CHW A;  4W9D A;  2WYQ A;  2ASQ A;  2ZCC A;  2MBO A;  2KXJ A;  1U4A A;  1WGY A;  4FHJ A;  3NOB A;  4IG7 B;  2N7D A;  5CHF A;  3UQA A;  2D3G A;  3DVG Y;  4IC7 B;  3PZD A;  3RT3 B;  5CHV C;  2MWS B;  4G11 A;  3UGB B;  1TTN A;  2N1V A;  5J18 A;  4NQL B;  2XEW A;  2K8H A;  2AWT A;  1Q0W B;  4IWP A;  2KO3 A;  2LRW A;  3L13 A;  2DYO A;  1WJ4 A;  3ZTD A;  4BBN C;  3MTN B;  2IO2 B;  4BVU C;  4IM2 A;  4MEM A;  2N1W A;  1V5T A;  4FLH A;  1WXS A;  5D7G A;  1T0Y A;  4HVB A;  3EEC A;  4W9J A;  4JIO U;  4XZ4 A;  1J19 A;  3X23 A;  1YX6 B;  2JXX A;  2JT4 B;  2MBB B;  2ZJD A;  4JL9 A;  1WY8 A;  1UBQ A;  1PQS A;  1Z2M A;  1LFD A;  1RAX A;  1GUA B;  3ZDM C;  2KOX A;  4KSK C;  3PT2 B;  3V61 A;  3EC8 A;  4NQK E;  1Q5W B;  3LDZ E;  4I6L B;  4EFO A;  4F7Z A;  1WMH A;  3KUD B;  4M0W B;  1KOT A;  1NDD A;  2MBE A;  3W1Y A;  3V6E B;  2MBQ A;  1YQB A;  3PSE B;  3Q3F A;  1WX9 A;  2B3A A;  4GGQ A;  1I35 A;  2DZI A;  3QA8 A;  4PS7 A;  5IA7 A;  3A1Q A;  1SIF A;  3NZU A;  1GC7 A;  1XQQ A;  4WAA A;  2VRR B;  2FCQ A;  2K6Q A;  1CMX B;  1KM7 A;  3DPD A;  2G4D B;  4BBN F;  2KFK A;  2KWC A;  2O6V B;  2KDI A;  3M95 A;  3DBR I;  1WZ3 A;  2ZEQ A;  3K9P B;  2M1M A;  2KDE B;  3WIM A;  4K81 A;  2AYO B;  2FCS A;  3DVN U;  4XX5 A;  5KHQ A;  1Y8R C;  3NHE B;  4NJ7 A;  2JZZ A;  4ANV A;  4EEW A;  5G55 A;  2JUO A;  4HWI B;  2AL6 A;  2J0J A;  3VH4 B;  4DWF A;  1C3T A;  2Z0E B;  3W1S A;  4P7I A;  3ZKJ C;  4DHJ B;  5JHB A;  4ASW C;  2ZPY A;  1OEY A;  2IY0 B;  2LGX A;  1GC6 A;  1SGH A;  2GBM A;  2IBI B;  3SU8 X;  5LXH A;  2O6V D;  2LUE A;  4HDO A;  4B6W A;  3EHV A;  1V49 A;  4K1R B;  3N3K B;  4HDQ A;  2DYM A;  4E71 A;  2FUH B;  2LXA A;  2GBJ A;  5E6O A;  2C7H A;  1MG8 A;  3HK0 A;  1OEY J;  2FCN A;  1QZE A;  1EF1 A;  2FCM A;  2R2O A;  3AUL A;  4GMV A;  1V9J A;  4ZRJ A;  4W9H A;  3DBH I;  4OVV A;  5G2N A;  5HKH A;  3JSV A;  3CF6 E;  3ZVV A;  4EZL A;  4HPM B;  3VTV A;  3ZNI D;  3HIZ A;  1IYF A;  3H6N A;  5AZG A;  2HTH A;  1J0G A;  4E74 A;  2IO3 B;  4GU2 A;  4GIV A;  3VAW A;  4NNJ B;  3VVW B;  4AJW A;  5KHO A;  4KDL B;  3LJ3 A;  1BT0 A;  1EO6 A;  4ZYN A;  1WYW B;  3JVZ X;  3IFW B;  2D10 A;  3APC A;  1E7U A;  4MJS A;  4OVU A;  4II3 B;  2MP2 B;  4YL8 A;  1WGG A;  2XBB C;  2KJH B;  3DVN V;  1E8Y A;  3AU4 A;  3PRZ A;  3VXW A;  4JGH B;  3QCA A;  2BYF A;  4CO7 A;  3AXC A;  2LJ5 A;  1V2Y A;  5DPR A;  2L00 B;  3PRP B;  2MBH A;  3NY5 A;  2NBV B;  3WAL A;  2BPS A;  4WQO B;  3APD A;  3CST A;  3DBS A;  4KZ0 A;  2ZVO A;  4AOF A;  3VTU A;  3ALB A;  2L0F A;  2YLM A;  3WAM A;  1OQY A;  1WRD B;  3PHX B;  4A3O A;  1UH6 A;  2K8C A;  3ZNG C;  4NAW A;  1XD3 B;  5FR6 A;  3S2A A;  3WAO A;  2NCN A;  4TKN A;  2O2V B;  3A9J A;  2KWU B;  1RRB A;  4GXB A;  1LM8 B;  2V4L A;  4RM9 A;  3QAQ A;  2Y5B B;  2LVO A;  4KVG B;  3DDC B;  2NR2 A;  5TR5 A;  4FJY A;  1WE6 A;  5CTR C;  2NBU A;  4J6I A;  5AZF A;  2KKC A;  4TQ1 A;  3DVG X;  4FHK A;  2N7E A;  2BF8 B;  2DAF A;  2M17 A;  4II2 B;  3L16 A;  1YIW A;  1D3Z A;  1I42 A;  5C1Z A;  2W9N A;  1V6E A;  1UD7 A;  5E6P A;  4WJO A;  2RPQ A;  3H1U A;  2GBR A;  1WZ0 A;  1H8C A;  2YVC A;  3RZW C;  3A4S C;  1E90 A;  3QQ8 B;  3ZIM A;  1RLF A;  3JYU A;  1UBI A;  3IBE A;  3MJW A;  1HE8 A;  2BWF A;  1KLV A;  2ZVN A;  2AEH A;  5J2R A;  2KTR A;  2KC1 A;  1IP9 A;  4G3X B;  4FBJ B;  2RSU A;  4MSM B;  1V80 A;  4LDT D;  2N9X A;  4HPL B;  2K25 A;  3H9D A;  3ZLZ A;  4DBG A;  1ZGU B;  3D32 A;  1XT9 B;  3ZO5 B;  2KMC A;  2NPT A;  2LVP A;  2BKF A;  2OJR A;  4RMA A;  3VUY A;  2O2V A;  1JRU A;  2KWV B;  1E8W A;  4A3P A;  2FIF A;  2JRH A;  4IW0 A;  2N9P C;  2K8B A;  3A9J B;  3RZF A;  3V62 A;  5EDS A;  3T9L A;  2KC2 A;  3PLU A;  3RCZ A;  5CX3 A;  3MHS D;  2V3S A;  3APF A;  2QHO A;  4I6P A;  3U30 A;  3DBL I;  2KNB A;  2HE7 A;  1E7V A;  2DEN B;  4ZRI A;  2IO0 B;  3CMM B;  4KSL C;  1P9D U;  4G50 A;  2M8S A;  1WMH B;  3L10 B;  3TIX A;  3ZUN A;  1RFA A;  4IUM B;  3SDL C;  4HCP B;  5JH5 C;  4JLC A;  1V5O A;  5DPW A;  4BKG A;  4IWQ A;  5JHA A;  3TL5 A;  3VQI A;  2C9W B;  3ZNZ B; 
#chains in the Genus database with same CATH topology
 2WXP A;  3LB8 C;  3WAP A;  4IM3 A;  2I1K A;  2AQ2 B;  4W9E A;  3URY A;  3JW0 X;  3N9Y C;  4K7W A;  2PE9 A;  4B95 A;  1UEL A;  1QQR A;  3GP7 A;  4DXA B;  4KGR A;  1NYR A;  1C4A A;  3UIP B;  4CHK A;  3AV8 A;  3L08 A;  3QIJ A;  2LEK A;  4BKS A;  3TEY A;  4DHZ E;  3A33 B;  1YN5 A;  1ZPS A;  2QCZ A;  1JWS D;  5I4D A;  1C4P A;  1IBX B;  2DAJ A;  3PRM B;  2WDQ B;  2ZPN A;  2RDH A;  2KFK B;  1JWB D;  1WM2 A;  3V6C B;  4GDL A;  2KYW A;  4TV3 A;  3ZW3 A;  3U7Z A;  1TKG A;  1J8C A;  1XCQ L;  3QWZ B;  2CHZ A;  5GMV A;  5L83 A;  2RR9 A;  4K3B A;  1FPY A;  2BGF A;  2KHW B;  3MJ5 A;  4YTP B;  1QLB B;  2K5P A;  3BIN A;  5C2T B;  1WH3 A;  4HJK A;  5DPS A;  1TS3 A;  3Q3J A;  2Z0D B;  4RGM A;  3M62 B;  3BYY B;  3ECI A;  4KV2 A;  4WWN A;  2Z59 B;  3DOW A;  1NI2 A;  2M4N A;  3HHM A;  4EKU A;  1CJE A;  4BOS C;  5BMI A;  1BML C;  3PS6 A;  2PVG C;  3C8Y A;  1IBX A;  1TZ1 A;  5DPT A;  4DHZ B;  3IAS 1;  1DOY A;  4ZRQ A;  3OLM D;  2KK8 A;  2FNJ B;  2DZK A;  4W9K A;  2OOB B;  2FBW B;  2GLS A;  2KQ7 A;  2AL3 A;  2KTR B;  2KN5 A;  2K39 A;  1XLO A;  4K7U A;  1VZ7 A;  1L0V B;  2DHZ A;  3DBH B;  3SFE B;  1C1Y B;  3RUI B;  2GBK A;  1YN4 A;  1E9M A;  3E56 A;  3A4R A;  4W9C A;  3WA0 A;  4A20 A;  2SAK A;  1WX7 A;  1DOX A;  4JWS C;  3B0A A;  1Q1O A;  1N5W A;  3Q8F A;  1ROE A;  4WIP A;  4MEL A;  2HJ8 A;  2NBW B;  4LCD E;  1WXA A;  4ANW A;  2L76 A;  2MA9 B;  1P0R A;  2BYV E;  4KIK A;  4NAW B;  3UIO B;  4KX6 B;  5BO4 B;  2DWQ A;  3RNF C;  1V97 A;  3N1Y C;  5D6J B;  1WXM A;  3AE9 B;  1T5X D;  3R8B A;  3I3T B;  3FKY A;  1B9R A;  2MX2 A;  2WDV B;  1VR9 A;  1H4R A;  2QSD A;  5EE1 A;  1WX8 A;  1R7S A;  2LAS A;  2OED A;  4YSX B;  2N9E B;  1JRO A;  1FXT B;  4BOZ B;  4S17 A;  3U8Z A;  4GDK B;  5G5G A;  4PK1 A;  1VD2 A;  3IG3 A;  2PE6 B;  3BWU D;  4YT0 B;  2K6D B;  3R7Q A;  2IYD B;  4GN1 A;  4LJO B;  3ZRC A;  1EU4 A;  2KDF B;  3GB1 A;  4DDI D;  4OHJ A;  2J0M A;  2CJO A;  5IOI A;  4WWO A;  1F77 A;  3EFU A;  2JVC A;  1WGH A;  2PPH A;  3H7P B;  2QC8 A;  4YXD B;  4XC2 A;  1HZ6 A;  1OGW A;  3IVF A;  1S1Q B;  4KDI C;  3UIN B;  1SF0 A;  3Q8B A;  1UGM A;  2EKI A;  2V3N A;  1LQB A;  4TSS A;  1ET9 A;  3BY4 B;  1N63 A;  1GB1 A;  4G0N B;  1V86 A;  2WDT B;  3L54 A;  3AEG B;  1PGA A;  2LJI A;  4KGT A;  1WI0 A;  3JSV B;  3HM6 X;  2NS5 A;  4EZJ A;  2C7M B;  4US8 A;  3ZXV A;  2KLG A;  4USA A;  3ZDT A;  3P2B A;  3P42 A;  4DK5 A;  2KQ4 X;  3Q3M C;  4P1C C;  2W54 A;  4FHJ A;  3RNC C;  1U4A A;  1WGY A;  3KWV A;  3NOB A;  3VRA B;  4RF1 A;  4IG7 B;  2WXN A;  3AE4 B;  3U52 E;  3NG0 A;  3C19 A;  4G11 A;  3UGB B;  1TTN A;  4XWW A;  4LNO A;  2XEW A;  1WJ4 A;  3MTN B;  1QT9 A;  1QOB A;  1V1O A;  3NVW A;  1WXS A;  1AWD A;  4HVB A;  3NZ3 A;  1J7A A;  1PQS A;  1LFD A;  3PT2 B;  3EC8 A;  1FO4 A;  1Q5W B;  4I6L B;  3TSS A;  1WMH A;  4M0W B;  1KOT A;  1C4C A;  3BZD B;  5IA7 A;  1XQQ A;  4WAA A;  2VRR B;  2K6Q A;  4YTM B;  3KLS X;  2KWC A;  2O6V B;  2KWD A;  4OZA A;  3K9P B;  4LTU A;  1F1H A;  3EUB 2;  3B2F A;  1Y8R C;  4NJ7 A;  4ANV A;  3N20 C;  4H2A A;  1JAL A;  2J4X A;  2JX5 A;  3MP9 A;  1JW9 D;  1FXA A;  2D3C A;  2WXK A;  5JHB A;  2L83 A;  4YWG G;  1XEE A;  2V3P A;  1CK1 A;  2LUE A;  4HDO A;  4B6W A;  2BW2 A;  4K1R B;  3N3K B;  4HDQ A;  4E71 A;  3RNG C;  1XF5 L;  1MG8 A;  2ICI A;  2KMM A;  2MEK A;  2R2O A;  2XNA C;  3DBH I;  1CZP A;  4OVV A;  1TS5 A;  3JSV A;  3CF6 E;  4HPM B;  3IT4 B;  2LHE A;  1IYF A;  5AZG A;  1SJE D;  2IO3 B;  4GU2 A;  1TKE A;  4GIV A;  4NNJ B;  4AJW A;  1MPE A;  1EO6 A;  4ZYN A;  1WYW B;  3APC A;  3I63 C;  1C79 A;  1WGG A;  2XBB C;  1TY0 A;  4C00 A;  3QCA A;  5DPR A;  3AE1 B;  1QKZ A;  3NY5 A;  2BPS A;  3RNB C;  3V05 A;  3CST A;  1SE4 A;  3VTU A;  2L52 A;  3PHX B;  5FR6 A;  3DHI C;  2LVO A;  4KVG B;  1IGC A;  3AEF B;  2WU5 B;  5TR5 A;  2NBU A;  2INP E;  2KKC A;  2JQR B;  4C7Y A;  2DAF A;  2HTM E;  4M02 A;  3GS2 A;  2IGG A;  5C1Z A;  5E6P A;  1UD7 A;  4L23 A;  2RPQ A;  2GBR A;  2WXM A;  1I4P A;  2YVC A;  1RLF A;  3V3X A;  1KLV A;  2BWF A;  3MFG A;  2KTR A;  1D5X C;  2KC1 A;  3BII D;  5HI1 A;  2WLB A;  3P4P B;  1PFD A;  2W82 A;  2N9X A;  3ZLZ A;  3P1M A;  2AQ1 B;  2OJR A;  2O2V A;  3BK2 A;  2FIF A;  2K22 A;  4M0W A;  2K8B A;  3A9J B;  1WSP A;  3RZF A;  2BT6 A;  3AED B;  3MHS D;  4OZC A;  3APF A;  3U30 A;  4WAF A;  1P9D U;  4TMA B;  2VZK D;  4HCP B;  4JLC A;  3TL5 A;  3ZNZ B;  3AEA B;  2YEP F;  3ABV B;  5BYR A;  2HD5 B;  4HKQ A;  2KDM A;  2KD0 A;  1AN8 A;  3WCQ A;  1PGX A;  1NBF C;  1P3Q U;  1FMA D;  4F1S A;  4IDI A;  4XE0 A;  2INN E;  1YQ4 B;  2K9X A;  1L5P A;  1ZP0 B;  3PV1 A;  3HVD A;  2CHX A;  3W5U B;  4ICV A;  2GB1 A;  5IP4 D;  2C60 A;  1E5W A;  4US9 A;  1UUP A;  4OZB A;  1GNU A;  2EKE C;  2IGD A;  1GG3 A;  2O6V A;  1G6J A;  1XLN A;  3RI7 C;  3C0R B;  4XGA B;  3KYC D;  3AH7 A;  5T8I A;  2M56 B;  2ZW0 A;  3VUX A;  2RDG A;  1SE3 A;  4HXD A;  1VZ6 A;  1WXV A;  2WX1 A;  4MM3 A;  1NEN B;  1L2N A;  4FA6 A;  3I5J C;  4C7Z A;  2J42 A;  2INC C;  2V1Y A;  3TJP A;  4L2Y A;  1KLU D;  2L0T A;  3VTW A;  3QHT A;  3RYT A;  2BKR B;  2MSE D;  4ZRK A;  3IAM 1;  3QAR A;  2PVO D;  1WRI A;  3KH0 A;  1E7P B;  3A9K A;  5DCN A;  1YD8 U;  2RGF A;  3H7P A;  4E3C A;  3AE6 B;  1WE7 A;  1M4V A;  1IGD A;  4J3O D;  2G4S A;  2FID A;  2REX A;  1WIA A;  2K0P A;  3SEB A;  3TEX A;  3V60 A;  2MW5 A;  2Q5W D;  2JU6 X;  1J7B A;  3KYD D;  2J53 A;  5D94 A;  2AX5 A;  2X8X X;  2KVR A;  2JZ3 B;  3K9O B;  2DZJ A;  2WS3 B;  4ZHO A;  2V4I B;  2JRI B;  2EMS A;  3IHP C;  4PYZ A;  4ZRP A;  1WM3 A;  2LI5 A;  1E6E B;  3SD5 A;  2L8J A;  3R3M A;  4X57 B;  3H7S A;  2JF5 A;  1LGR A;  4LLG M;  4JQW C;  1WGK A;  4AQ7 A;  3UQB A;  4ZDV A;  2JPH A;  2N4F A;  5MPO A;  2D11 A;  2GBN A;  4MJS B;  3GOE A;  3AE8 B;  1T6B X;  4W9F A;  3FIL B;  3DWG C;  3NS1 A;  4C80 A;  1T3Q A;  5HHD G;  3Q8E A;  2QEJ C;  2WGS A;  4MGI E;  1VCB A;  2J7Q B;  2IO1 B;  4KKJ A;  3RUL A;  4ICU A;  3PHW B;  3M63 B;  1VJK A;  2LGD A;  2XK5 A;  4YSY B;  3P4R B;  1XLP A;  1MG4 A;  1DYQ A;  4NY0 A;  2DYB A;  2QDF A;  1ZKH A;  4MDK E;  2ZCB A;  2NPT B;  2DX5 B;  2H88 B;  1QIL A;  3DBL B;  4GSW A;  2KZR A;  3R7R A;  4K7S A;  1YQ3 B;  1UWM A;  4L1B A;  4WJQ A;  2JY6 A;  4BKT A;  3L17 A;  4TQ0 A;  1UNS A;  1QOF A;  4I6N B;  2VZK B;  3R66 C;  4ANX A;  2WDR B;  1TZO A;  2HJ1 A;  4ZHP A;  2YEP B;  1WWT A;  1CQV A;  1PYW D;  2MRP A;  3Q3O C;  4MGK E;  3RPF C;  3HRD D;  3PLV A;  3PZ7 A;  4HKZ E;  3N1X C;  1NVI D;  5FK9 C;  4URK A;  2NTT A;  1S3S G;  2WXG A;  3GE8 C;  1QOG A;  1F9J A;  2X38 A;  4GDL B;  1QOA A;  4S0R A;  3NRZ A;  2BS2 B;  3Q3N C;  2N7D A;  1SIJ A;  4RF0 A;  1FXI A;  4IC7 B;  3RT3 B;  4NQL B;  1Q0W B;  2FUG 1;  4IWP A;  1N6Z A;  3L13 A;  4MAC A;  4XDC A;  4BBN C;  4BVU C;  1N61 A;  5BYS A;  2N1W A;  1V5T A;  4FLH A;  1P7E A;  2ON8 A;  2VH1 A;  4W9J A;  1YN3 A;  2JT4 B;  4JL9 A;  1UBQ A;  2KOX A;  3FIL A;  3LDZ E;  3KUD B;  3V6E B;  2MBQ A;  2V9H A;  3Q3F A;  1WX9 A;  3QA8 A;  3AE5 B;  2I2Y A;  3NZU A;  1GC7 A;  1KM7 A;  3DPD A;  4BBN F;  2KFK A;  2KAJ A;  4UDU C;  2VH2 A;  3DBR I;  1WZ3 A;  3TEZ A;  4DXG A;  4XX5 A;  2MJ3 A;  2FCS A;  1VZ8 A;  1TKY A;  4RFB A;  5JXV A;  3SFD B;  5G55 A;  2JUO A;  1FFV A;  2J0J A;  3ZKJ C;  2ZPY A;  2IY0 B;  1SGH A;  2GBM A;  4R3D A;  5LXH A;  2O6V D;  3ZJV A;  1TIF A;  1MJD A;  3J9C A;  3AE7 B;  3RNA C;  2WXI A;  4O1N A;  2OHF A;  2FCM A;  3VRB B;  3PZ8 A;  4W9H A;  5HKH A;  3ZNI D;  1EWY C;  3H6N A;  2WXF A;  3VVW B;  1HTQ A;  2KT7 A;  1YJJ A;  3LJ3 A;  3NVV A;  1C76 A;  3IFW B;  4ZYS A;  2IDY A;  2MP2 B;  4YL8 A;  2IGH A;  1OFF A;  1LO5 D;  2KJH B;  1L0Y B;  3DVN V;  3AU4 A;  1VDV A;  3PRZ A;  1PDX A;  2BYF A;  4CO7 A;  5D3I B;  2BYT A;  3PRP B;  3CWI A;  4WQO B;  3DBS A;  4AOF A;  3ALB A;  1WRD B;  1OQY A;  1UH6 A;  5FR3 A;  4P6V F;  3A9J A;  4GXB A;  4RM9 A;  2V4L A;  3DDC B;  2Y5P A;  4TQ1 A;  4FHK A;  3I9V 1;  4II2 B;  3L16 A;  1YIW A;  1XLQ A;  1I42 A;  2N9L A;  5FKA C;  1H8C A;  3ZIM A;  3JYU A;  3IBE A;  3MJW A;  2ZVN A;  1BXT A;  5J2R A;  4RGN A;  4G3X B;  2RSU A;  4MSM B;  1V80 A;  2XN9 C;  1FEH A;  3H9D A;  2BBC A;  2W3R A;  4JPS A;  1ZGU B;  2KMC A;  3Q69 A;  4RMA A;  2PIA A;  2PLP A;  1HEZ E;  3V62 A;  2V0G A;  3T9L A;  2M0A A;  3PLU A;  3RCZ A;  2QHO A;  2WXL A;  3DBL I;  2HE7 A;  2KNB A;  1ZDV A;  2DEN B;  3BVG A;  4ZRI A;  3W9C B;  2IO0 B;  5G5H A;  4KSL C;  4G50 A;  3TUO A;  3ZUN A;  1RFA A;  3SDL C;  4BKG A;  4IWQ A;  3PPA A;  1GAQ B;  3ML8 A;  5AEK B;  2PMV A;  1TGZ B;  4B0M A;  2IJ0 A;  3QK0 A;  2KJR A;  4M8M A;  2KMA A;  4B9K A;  2KDB A;  4EZK A;  5J17 A;  4WWP A;  4OW0 A;  1L0X B;  3AEB B;  4HK2 A;  2L3Z A;  3Q2A C;  3PGE A;  4MSQ B;  4JX1 C;  2Y5C A;  2LZ6 A;  4RH6 A;  2BWE S;  1WJ6 A;  5LXI B;  4AJY B;  3B08 A;  2BS3 B;  1UWX A;  1EWC A;  2JYT A;  4RCO A;  4YSZ B;  3AI5 A;  3Q8C A;  1GPX A;  1SJH D;  4W9L A;  3B1L X;  2LXC A;  1EM7 A;  3AB5 A;  2CKH B;  4HJG E;  1WF9 A;  2CR5 A;  3OJ4 B;  4AP4 C;  5H8Y E;  2K1F A;  4MGY E;  4W9I A;  3KVF B;  3RNE C;  1E8X A;  2WXR A;  3PVL A;  5BMG A;  3ML9 A;  2LD9 A;  4MH0 E;  3VHT C;  5H92 C;  4NJ6 A;  2BB6 A;  3L4P A;  3L0W B;  1TS2 A;  3ONS A;  2D3A A;  4REZ A;  3ZTC A;  2G3Q B;  3A1Q B;  1KH0 A;  4TUU A;  4KIK B;  3HVZ A;  1N60 A;  1AYF A;  1WJU A;  4HLE A;  1FFU A;  3QJZ A;  2WXJ A;  1KRH A;  1K53 A;  1YJI A;  1XCT L;  2C7N B;  4LNN A;  3OJ3 A;  1LXD A;  2G45 B;  4ACF A;  4XWT A;  4EOY A;  1Q10 A;  4A9A A;  1F2R I;  4M01 A;  2LUM A;  4AUQ C;  2L05 A;  5GXG B;  3PO0 A;  2PKO A;  1E8Z A;  1P1A A;  1I4X A;  3VFK A;  2NVU I;  3TMP B;  3OAW A;  2ZNV C;  4AWJ A;  1HQR D;  1L6U A;  3HM3 A;  4WJP A;  4GOC A;  3PRE A;  2N9K A;  1ZW7 A;  2L7R A;  2CS4 A;  2JZP A;  1WJN A;  4FN2 A;  2DBY A;  3X0W A;  3W1S C;  1WXQ A;  4HCN B;  2LRU A;  2N7J A;  2GI9 A;  1SXT A;  1YX5 B;  3N32 A;  2WXO A;  2LWP A;  3CSF A;  1VLB A;  4DQO C;  1J7C A;  4WQM A;  2KJ6 A;  1AAR A;  1UF0 A;  1WGR A;  3AE3 B;  2N0S B;  1WR1 A;  1FIQ A;  3RD2 A;  3B2G A;  1JRP A;  3TCA A;  1MVK A;  1V81 A;  2MLB A;  2FE8 A;  4F8C B;  3T8M A;  3M3J A;  3NUH B;  4C4V B;  1Z5S B;  4RM8 A;  2KTF A;  2R61 A;  4N6E B;  4GDK A;  3QX1 A;  1L7Y A;  3QC8 B;  1IPG A;  4MT5 A;  3GE3 C;  3BVM A;  2KX3 A;  4P16 A;  3GZN B;  3RN9 C;  3MC9 A;  3ENE A;  2JWU A;  2PEA A;  1R4N I;  3ZXR A;  5E6J A;  1JWA D;  2WHI A;  1SB3 C;  1DGJ A;  2MQJ A;  4BZA A;  3Q6B A;  5HG2 A;  4ANU A;  3VH3 B;  1C77 A;  2CU3 A;  2UWQ A;  4N58 A;  1YJ1 A;  1YOV B;  2ZW1 A;  2KQS A;  2ONQ A;  2WWZ A;  4MH8 A;  1FM0 D;  1N62 A;  1A70 A;  2IZV B;  2CJN A;  4DHJ D;  3KW5 B;  4EUT A;  1F0Z A;  4W9D A;  2ASQ A;  2KXJ A;  4NJC A;  2KAC A;  5CHF A;  3UQA A;  2D3G A;  4A8X C;  1JCK B;  2MWS B;  1UGJ A;  5J18 A;  1RM6 C;  2K8H A;  2AWT A;  2RDB C;  2KO3 A;  2DYO A;  3ZTD A;  2IO2 B;  4QAY A;  3H8H A;  5D7G A;  3AM9 A;  1F52 A;  4JIO U;  4XZ4 A;  1J19 A;  1ACC A;  1YX6 B;  2MBB B;  2ZJD A;  3FAH A;  1Z2M A;  1RAX A;  1GUA B;  4RGT A;  4KSK C;  3V61 A;  1KFY B;  5AUK A;  1NDD A;  3W1Y A;  1YQB A;  3PSE B;  1I35 A;  3A1Q A;  1SIF A;  2G4D B;  1RFK A;  1KTK A;  2M1M A;  2KDE B;  1JML A;  3WIM A;  4K81 A;  5KHQ A;  1I7H A;  2WU2 B;  3NHE B;  4HEA 1;  4HWI B;  2AL6 A;  1V8C A;  3ZJT A;  4DWF A;  4C4V A;  4LNK A;  4DHJ B;  4ARC A;  4LNF A;  2LGX A;  1T0Q C;  1GC6 A;  2IBI B;  2E3T A;  1STE A;  1PUT A;  1V49 A;  1K52 A;  1XXG A;  5E6O A;  4LK0 M;  2C7H A;  1T0R C;  5EE0 A;  3ZYY X;  2FCN A;  3E9S A;  1EF1 A;  4GMV A;  4ZRJ A;  1AW7 A;  4OVZ A;  3LXF A;  2JXT A;  1FCL A;  5G2N A;  5BMH A;  1DOI A;  2M19 A;  2HTH A;  1J0G A;  4E74 A;  2H89 B;  4LNI A;  5KHO A;  4KDL B;  1BT0 A;  2MJE A;  1HA5 A;  3Q8A A;  1E7U A;  4OVU A;  4II3 B;  3TEW A;  2BB5 A;  5TSS A;  4AS1 A;  1E8Y A;  1ET6 A;  3VXW A;  2PTL A;  2LJ5 A;  3VR9 B;  2QIL A;  3IXS A;  3WAL A;  3APD A;  4KZ0 A;  2ZVO A;  2L0F A;  4A3O A;  2K8C A;  3R2T A;  3ZNG C;  4NAW A;  3S2A A;  3WAO A;  2NCN A;  3MC0 B;  1RRB A;  3QAQ A;  3W2D A;  3T3O A;  1WE6 A;  4J6I A;  1L4D B;  3NJT A;  5AZF A;  1ZDX A;  3DVG X;  2BF8 B;  1D3Z A;  3BVZ A;  2KVZ A;  4ITK A;  4WJO A;  3H1U A;  5BYQ A;  2K3U A;  4B0E A;  1WZ0 A;  3A4S C;  1E90 A;  1UBI A;  2EEL A;  1HE8 A;  1TJE A;  2LMC A;  1IP9 A;  2RPV A;  4FBJ B;  2QIE B;  2K25 A;  4DBG A;  3D32 A;  1XT9 B;  2NPT A;  3VUY A;  1E8W A;  2JRH A;  3BYT B;  3HUI A;  1KF6 B;  4GLS C;  5IO9 A;  2L1A A;  1HXY D;  2KC2 A;  5CX3 A;  3NVZ A;  4I6P A;  3CMM B;  1I4Q A;  1WMH B;  3EFC A;  3L10 B;  2LGI A;  1OQQ A;  1V5O A;  5JHA A;  4RNA A;  4GB9 A;  2C9W B;  2B76 B;  4FXC A;  5JZE B;  3U2S C;  4PYU A;  2SEB D;  4WH4 A;  1BUI C;  2PJH A;  1XO3 A;  2TSS A;  2W3S A;  3DHG C;  1GB4 A;  1X1M A;  2CHW A;  1P98 A;  5C23 A;  4M8N A;  1L4Z B;  1JWU D;  3A9K B;  3NS8 A;  3TBL D;  2PW9 A;  5L95 C;  1M94 A;  2GMI C;  1TT5 B;  2ZNV B;  3CIR B;  3MC8 A;  4HRO A;  4CYE A;  5LLI A;  2BVC A;  2BYE A;  3RMK C;  2NTS A;  2J0K A;  4PS8 A;  3ZRF A;  1SEB D;  5E6N A;  5D2M B;  2DZM A;  1GOZ A;  3U7D A;  1SE9 A;  4BKS D;  5AZH A;  1NYQ A;  1YMH E;  2UYZ B;  2A5U A;  1FNW A;  2XK5 B;  1GJZ A;  2M0X A;  1ENF A;  2WP9 B;  2AQ3 B;  2JWZ A;  4M00 A;  1JQ4 A;  4LDT B;  3Q14 C;  2ACZ B;  1EF5 A;  1T0S C;  1OQR A;  2KLC A;  1WR6 E;  1HTO A;  3NVY A;  4ARI A;  1ESF A;  2EMT A;  4IWO A;  4NPN A;  2DLB A;  4WJN A;  2KX0 A;  3N30 A;  1MHH E;  3DQV A;  3N1Z C;  2FAZ A;  4KGS A;  1IUE A;  3LYY A;  2DNF A;  3VUW A;  3KUC B;  4W9G A;  2ZZP B;  4N9F 4;  2RD0 A;  2D07 B;  4HRS A;  4IOI E;  3SHQ A;  3T3N A;  2L32 A;  1B1Z A;  2UU7 A;  4XDD A;  2BTE A;  4LJP B;  5HFY A;  2G9H D;  3AEE B;  3KWL A;  3ETR A;  1OTR B;  4WWM A;  3KUZ A;  2D2Q A;  1UZX B;  1EUV B;  1FRD A;  1MI0 A;  2LVQ A;  1PGB A;  1YNT E;  3NZS A;  1K8R B;  3VDZ A;  1VRA B;  2Y3A A;  4FUL A;  2CU1 A;  3WAN A;  2D5G A;  4FAD A;  3P63 A;  1R4M I;  2RMM A;  1JWM D;  2KAN A;  1FCC C;  4YTN B;  1P7F A;  1C78 A;  2MCN B;  4WUR A;  3PTF C;  1WFY A;  1FNV A;  3O65 B;  4FJZ A;  3AEC B;  4A6Q A;  3AE2 B;  1I4G A;  5LNK 1;  4A90 A;  4MGZ E;  1A5R A;  4BAX A;  2W55 A;  4KZC A;  4IM0 A;  1ZXH A;  4DDG D;  4P1B C;  4BFR A;  2KFJ A;  3KQ4 A;  2WNM A;  1N5X A;  2LFI A;  1D6E C;  1HZ5 A;  2IY1 B;  1TBE A;  5IKC M;  3UF8 A;  1K50 A;  2JSV X;  3W5V B;  1NEK B;  2C5L C;  2IND C;  1KLG D;  3GZN I;  4A55 A;  2R2Q A;  3EGR A;  2J52 A;  1TS4 A;  1R4N B;  5IAA C;  1FD6 A;  1ISN A;  2WX0 A;  1TY2 A;  5IN7 A;  3DHH C;  2GOW A;  2LGY A;  2MP2 A;  3DCG A;  1KJT A;  4FJV B;  2WXH A;  1WGD A;  2A4Z A;  2BQQ A;  4PS3 A;  5C3J B;  1ZOY B;  4HPP A;  2OJW A;  2I1J A;  3AU5 A;  3ZNH B;  3DWM A;  5CHW A;  4CQN A;  2WYQ A;  3VR8 B;  2ZCC A;  2MBO A;  1I4H A;  4D2K A;  3DVG Y;  3PZD A;  3ZJU A;  5CHV C;  2N1V A;  3R2I A;  5EE3 A;  2LRW A;  1SE2 A;  1ZUD 2;  2QMT A;  4IM2 A;  4MEM A;  1D4B A;  3OWE B;  1T0Y A;  3EEC A;  4NAM A;  3X23 A;  1MFW A;  2JXX A;  4Q2J A;  1WY8 A;  1SSN A;  3ZDM C;  4NQK E;  4EFO A;  4F7Z A;  2MBE A;  1TYG B;  1F2R C;  4GGQ A;  2B3A A;  2DZI A;  4PS7 A;  1FRR A;  2FCQ A;  1E0Z A;  1CMX B;  2KDI A;  3M95 A;  2ZEQ A;  4N59 A;  1K51 A;  2AYO B;  3DVN U;  4PT5 A;  2MHJ A;  4KKI A;  2JZZ A;  4EEW A;  2MH7 A;  3VH4 B;  1C3T A;  2Z0E B;  3W1S A;  4P7I A;  2JYE A;  4ASW C;  1OEY A;  1SBB B;  4ZOH C;  5EE9 A;  2G1E A;  3SU8 X;  1E10 A;  4IKG A;  3EHV A;  5AUI A;  2NMQ A;  1C9F A;  2DYM A;  2FUH B;  2LXA A;  2GBJ A;  2E6X A;  2KN4 A;  1FNU A;  3HK0 A;  2QJL A;  1OEY J;  1QF6 A;  1QZE A;  3DBR B;  3AUL A;  1V9J A;  4XYC A;  3OG5 A;  3ZGZ A;  4JWU C;  4EZL A;  3ZVV A;  3VTV A;  3HIZ A;  3P4S B;  3VAW A;  2Z8L A;  2BS4 B;  3JVZ X;  3UI3 A;  1RWS A;  3P4Q B;  2D10 A;  4MJS A;  3EA6 A;  4JGH B;  3AXC A;  1V2Y A;  2L00 B;  2MBH A;  1V1P A;  2NBV B;  3I57 A;  1NI3 A;  2D3B A;  2GRI A;  2YLM A;  3WAM A;  1XD3 B;  1ZE3 D;  4TKN A;  2O2V B;  4DXF A;  2KWU B;  4MM3 B;  1LM8 B;  3BK1 A;  2Y5B B;  1RYJ A;  3IT6 B;  3O13 A;  2NR2 A;  2HDE A;  4FJY A;  5CTR C;  3MHZ A;  4NZL B;  3B9J A;  3AN1 A;  2LGS A;  1R4M B;  2N7E A;  2M17 A;  1Y56 A;  3ZQ4 A;  1MHX A;  1EU3 A;  1V1P B;  2W9N A;  1V6E A;  2LHD A;  2I38 A;  2WXQ A;  3RZW C;  3QQ8 B;  2AEH A;  4JE3 B;  1ZXI A;  4LDT D;  4HPL B;  2IPK D;  3U4E G;  1D5M C;  4RGO S;  3FC4 A;  3ZO5 B;  3SR6 A;  2LVP A;  2BKF A;  5D3D A;  1L6V A;  1JRU A;  2KWV B;  4A3P A;  4IW0 A;  2N9P C;  2MJD A;  5EDS A;  4C56 C;  3AMZ A;  2V3S A;  1E7V A;  4K3C A;  3RFZ B;  1I4R A;  2M8S A;  3TIX A;  1D5Z C;  1WYG A;  4IUM B;  5JH5 C;  2WQY B;  5DPW A;  3VQI A;  4EE2 A; 
#chains in the Genus database with same CATH homology
 5JZE B;  3PPA A;  2HD5 B;  4PYU A;  3ML8 A;  3WAP A;  5AEK B;  4IM3 A;  2PJH A;  1TGZ B;  2I1K A;  4W9E A;  3QK0 A;  2KJR A;  4M8M A;  2KMA A;  3JW0 X;  4B9K A;  2KDB A;  4K7W A;  2PE9 A;  4B95 A;  4EZK A;  1UEL A;  1X1M A;  2KD0 A;  4DXA B;  2CHW A;  5J17 A;  4WWP A;  1P98 A;  1NBF C;  1P3Q U;  3UIP B;  5C23 A;  4CHK A;  4F1S A;  3L08 A;  3QIJ A;  4BKS A;  4M8N A;  4HK2 A;  2L3Z A;  3A9K B;  3NS8 A;  3PGE A;  3A33 B;  4MSQ B;  3TBL D;  4DHZ E;  5L95 C;  1M94 A;  2GMI C;  2DAJ A;  3PV1 A;  2ZNV B;  2LZ6 A;  2CHX A;  3PRM B;  2BWE S;  4ICV A;  1WJ6 A;  4CYE A;  5LXI B;  5LLI A;  2C60 A;  1E5W A;  2ZPN A;  2BYE A;  4AJY B;  3B08 A;  1GNU A;  2EKE C;  2KFK B;  1GG3 A;  2O6V A;  1G6J A;  2J0K A;  1WM2 A;  3V6C B;  4PS8 A;  4GDL A;  3C0R B;  3AI5 A;  3ZRF A;  4TV3 A;  3ZW3 A;  3KYC D;  5E6N A;  5D2M B;  2DZM A;  3U7D A;  1J8C A;  3QWZ B;  2CHZ A;  5GMV A;  1SE9 A;  5L83 A;  2RR9 A;  3VUX A;  2BGF A;  4BKS D;  2KHW B;  4W9L A;  5AZH A;  2UYZ B;  2LXC A;  2A5U A;  3B1L X;  3BIN A;  4HXD A;  1WXV A;  2WX1 A;  1WH3 A;  2CKH B;  2XK5 B;  4HJK A;  5DPS A;  1GJZ A;  2M0X A;  4MM3 A;  1L2N A;  3Q3J A;  1WF9 A;  4FA6 A;  2Z0D B;  3M62 B;  3ECI A;  2CR5 A;  3OJ4 B;  4KV2 A;  4AP4 C;  2K1F A;  4MGY E;  2JWZ A;  4W9I A;  3KVF B;  2V1Y A;  3TJP A;  4WWN A;  2Z59 B;  3DOW A;  1E8X A;  1NI2 A;  2L0T A;  2M4N A;  3PVL A;  3QHT A;  3VTW A;  4LDT B;  3HHM A;  3ML9 A;  3RYT A;  2LD9 A;  4EKU A;  2BKR B;  4MH0 E;  2MSE D;  1EF5 A;  3VHT C;  4BOS C;  4ZRK A;  4NJ6 A;  3PS6 A;  3QAR A;  2KLC A;  1WR6 E;  1TZ1 A;  3L0W B;  3KH0 A;  5DPT A;  4DHZ B;  3A9K A;  3OLM D;  5DCN A;  2KK8 A;  1YD8 U;  2EMT A;  2FNJ B;  2DZK A;  2RGF A;  3H7P A;  3ONS A;  4IWO A;  3ZTC A;  2G3Q B;  3A1Q B;  2OOB B;  2KQ7 A;  4W9K A;  4NPN A;  4E3C A;  2AL3 A;  4TUU A;  1WE7 A;  4KIK B;  2KTR B;  4WJN A;  2KN5 A;  2KX0 A;  3N30 A;  2K39 A;  4K7U A;  3DQV A;  2FAZ A;  1WJU A;  4HLE A;  2DHZ A;  2G4S A;  2FID A;  2REX A;  3QJZ A;  3VUW A;  1WIA A;  3KUC B;  4W9G A;  3V60 A;  1C1Y B;  2ZZP B;  3RUI B;  4N9F 4;  2RD0 A;  2MW5 A;  2GBK A;  2C7N B;  3A4R A;  2D07 B;  3KYD D;  4W9C A;  5D94 A;  3WA0 A;  4A20 A;  2KVR A;  1WX7 A;  2JZ3 B;  3OJ3 A;  3K9O B;  3SHQ A;  1LXD A;  2G45 B;  2DZJ A;  3B0A A;  1Q1O A;  4EOY A;  2JRI B;  4MEL A;  2EMS A;  3IHP C;  4AUQ C;  2L05 A;  4PYZ A;  4LJP B;  1WM3 A;  2LI5 A;  2HJ8 A;  1E8Z A;  2NBW B;  3SD5 A;  1P1A A;  4LCD E;  2L8J A;  3R3M A;  3VFK A;  1WXA A;  2NVU I;  2JF5 A;  3H7S A;  4X57 B;  3TMP B;  4ANW A;  1OTR B;  3OAW A;  2ZNV C;  3KUZ A;  2L76 A;  2D2Q A;  4JQW C;  4AWJ A;  1UZX B;  1EUV B;  2MA9 B;  1P0R A;  2BYV E;  4KIK A;  3UQB A;  4NAW B;  3HM3 A;  4WJP A;  4GOC A;  2LVQ A;  3UIO B;  5BO4 B;  4ZDV A;  2JPH A;  2N4F A;  3PRE A;  3NZS A;  1K8R B;  3VDZ A;  2D11 A;  1ZW7 A;  2GBN A;  2L7R A;  5D6J B;  1WXM A;  2CS4 A;  2CU1 A;  4FUL A;  4MJS B;  3WAN A;  1WJN A;  3GOE A;  4FN2 A;  3X0W A;  3W1S C;  4FAD A;  3I3T B;  1R4M I;  4HCN B;  2KAN A;  2LRU A;  2MX2 A;  4W9F A;  4GB9 A;  1YX5 B;  3N32 A;  1H4R A;  2LWP A;  3CSF A;  1WX8 A;  2LAS A;  2N9E B;  2MCN B;  3PTF C;  1WFY A;  1AAR A;  2KJ6 A;  1FXT B;  1WGR A;  4BOZ B;  4MGI E;  3O65 B;  3U8Z A;  1VCB A;  4GDK B;  1VD2 A;  4FJZ A;  3IG3 A;  1WR1 A;  2J7Q B;  2IO1 B;  2PE6 B;  3RD2 A;  2K6D B;  3R7Q A;  3RUL A;  4ICU A;  2IYD B;  4GN1 A;  3PHW B;  3M63 B;  3TCA A;  2XK5 A;  2LGD A;  4LJO B;  4MGZ E;  1V81 A;  3ZRC A;  1A5R A;  2MLB A;  4NY0 A;  2DYB A;  2KDF B;  4F8C B;  1ZKH A;  4MDK E;  3T8M A;  4DDI D;  3M3J A;  4KZC A;  2J0M A;  4IM0 A;  2ZCB A;  1Z5S B;  4DDG D;  2NPT B;  4WWO A;  2DX5 B;  4BFR A;  4RM8 A;  2KFJ A;  2KTF A;  4GDK A;  3QX1 A;  4GSW A;  3EFU A;  2KZR A;  3R7R A;  1L7Y A;  3QC8 B;  4K7S A;  1IPG A;  2JVC A;  2IY1 B;  1WGH A;  1TBE A;  2PPH A;  3H7P B;  3UF8 A;  4WJQ A;  4XC2 A;  2JY6 A;  4BKT A;  2KX3 A;  1OGW A;  3L17 A;  4TQ0 A;  3IVF A;  4I6N B;  2C5L C;  1S1Q B;  4KDI C;  3R66 C;  3UIN B;  3ENE A;  3GZN I;  4ANX A;  2R2Q A;  1UGM A;  2PEA A;  1R4N I;  1LQB A;  5IAA C;  3BY4 B;  4G0N B;  1ISN A;  2WX0 A;  1V86 A;  2WDT B;  3L54 A;  2MRP A;  2MQJ A;  2GOW A;  2LGY A;  2MP2 A;  1WI0 A;  4MGK E;  4ANU A;  3JSV B;  3DCG A;  3VH3 B;  1KJT A;  3HM6 X;  3PLV A;  2NS5 A;  2UWQ A;  4FJV B;  4EZJ A;  2C7M B;  1YJ1 A;  1WGD A;  2A4Z A;  2KQS A;  4PS3 A;  4URK A;  2KLG A;  2WWZ A;  1S3S G;  3ZDT A;  2IZV B;  3P2B A;  2I1J A;  3AU5 A;  3ZNH B;  1F9J A;  4DHJ D;  4GDL B;  3KW5 B;  4EUT A;  4DK5 A;  5CHW A;  4W9D A;  2WYQ A;  2ASQ A;  2ZCC A;  2MBO A;  2KXJ A;  1U4A A;  1WGY A;  4FHJ A;  3NOB A;  4IG7 B;  2N7D A;  5CHF A;  3UQA A;  2D3G A;  3DVG Y;  4IC7 B;  3PZD A;  3RT3 B;  5CHV C;  2MWS B;  4G11 A;  3UGB B;  1TTN A;  2N1V A;  5J18 A;  4NQL B;  2XEW A;  2K8H A;  2AWT A;  1Q0W B;  4IWP A;  2KO3 A;  2LRW A;  3L13 A;  2DYO A;  1WJ4 A;  3ZTD A;  4BBN C;  3MTN B;  2IO2 B;  4BVU C;  4IM2 A;  4MEM A;  2N1W A;  1V5T A;  4FLH A;  1WXS A;  5D7G A;  1T0Y A;  4HVB A;  3EEC A;  4W9J A;  4JIO U;  4XZ4 A;  1J19 A;  3X23 A;  1YX6 B;  2JXX A;  2JT4 B;  2MBB B;  2ZJD A;  4JL9 A;  1WY8 A;  1UBQ A;  1PQS A;  1Z2M A;  1LFD A;  1RAX A;  1GUA B;  3ZDM C;  2KOX A;  4KSK C;  3PT2 B;  3V61 A;  3EC8 A;  4NQK E;  1Q5W B;  3LDZ E;  4I6L B;  4EFO A;  4F7Z A;  1WMH A;  3KUD B;  4M0W B;  1KOT A;  1NDD A;  2MBE A;  3W1Y A;  3V6E B;  2MBQ A;  1YQB A;  3PSE B;  3Q3F A;  1WX9 A;  2B3A A;  4GGQ A;  1I35 A;  2DZI A;  3QA8 A;  4PS7 A;  5IA7 A;  3A1Q A;  1SIF A;  3NZU A;  1GC7 A;  1XQQ A;  4WAA A;  2VRR B;  2FCQ A;  2K6Q A;  1CMX B;  1KM7 A;  3DPD A;  2G4D B;  4BBN F;  2KFK A;  2KWC A;  2O6V B;  2KDI A;  3M95 A;  3DBR I;  1WZ3 A;  2ZEQ A;  3K9P B;  2M1M A;  2KDE B;  3WIM A;  4K81 A;  2AYO B;  2FCS A;  3DVN U;  4XX5 A;  5KHQ A;  1Y8R C;  3NHE B;  4NJ7 A;  2JZZ A;  4ANV A;  4EEW A;  5G55 A;  2JUO A;  4HWI B;  2AL6 A;  2J0J A;  3VH4 B;  4DWF A;  1C3T A;  2Z0E B;  3W1S A;  4P7I A;  3ZKJ C;  4DHJ B;  5JHB A;  4ASW C;  2ZPY A;  1OEY A;  2IY0 B;  2LGX A;  1GC6 A;  1SGH A;  2GBM A;  2IBI B;  3SU8 X;  5LXH A;  2O6V D;  2LUE A;  4HDO A;  4B6W A;  3EHV A;  1V49 A;  4K1R B;  3N3K B;  4HDQ A;  2DYM A;  4E71 A;  2FUH B;  2LXA A;  2GBJ A;  5E6O A;  2C7H A;  1MG8 A;  3HK0 A;  1OEY J;  2FCN A;  1QZE A;  1EF1 A;  2FCM A;  2R2O A;  3AUL A;  4GMV A;  1V9J A;  4ZRJ A;  4W9H A;  3DBH I;  4OVV A;  5G2N A;  5HKH A;  3JSV A;  3CF6 E;  3ZVV A;  4EZL A;  4HPM B;  3VTV A;  3ZNI D;  3HIZ A;  1IYF A;  3H6N A;  5AZG A;  2HTH A;  1J0G A;  4E74 A;  2IO3 B;  4GU2 A;  4GIV A;  3VAW A;  4NNJ B;  3VVW B;  4AJW A;  5KHO A;  4KDL B;  3LJ3 A;  1BT0 A;  1EO6 A;  4ZYN A;  1WYW B;  3JVZ X;  3IFW B;  2D10 A;  3APC A;  1E7U A;  4MJS A;  4OVU A;  4II3 B;  2MP2 B;  4YL8 A;  1WGG A;  2XBB C;  2KJH B;  3DVN V;  1E8Y A;  3AU4 A;  3PRZ A;  3VXW A;  4JGH B;  3QCA A;  2BYF A;  4CO7 A;  3AXC A;  2LJ5 A;  1V2Y A;  5DPR A;  2L00 B;  3PRP B;  2MBH A;  3NY5 A;  2NBV B;  3WAL A;  2BPS A;  4WQO B;  3APD A;  3CST A;  3DBS A;  4KZ0 A;  2ZVO A;  4AOF A;  3VTU A;  3ALB A;  2L0F A;  2YLM A;  3WAM A;  1OQY A;  1WRD B;  3PHX B;  4A3O A;  1UH6 A;  2K8C A;  3ZNG C;  4NAW A;  1XD3 B;  5FR6 A;  3S2A A;  3WAO A;  2NCN A;  4TKN A;  2O2V B;  3A9J A;  2KWU B;  1RRB A;  4GXB A;  1LM8 B;  2V4L A;  4RM9 A;  3QAQ A;  2Y5B B;  2LVO A;  4KVG B;  3DDC B;  2NR2 A;  5TR5 A;  4FJY A;  1WE6 A;  5CTR C;  2NBU A;  4J6I A;  5AZF A;  2KKC A;  4TQ1 A;  3DVG X;  4FHK A;  2N7E A;  2BF8 B;  2DAF A;  2M17 A;  4II2 B;  3L16 A;  1YIW A;  1D3Z A;  1I42 A;  5C1Z A;  2W9N A;  1V6E A;  1UD7 A;  5E6P A;  4WJO A;  2RPQ A;  3H1U A;  2GBR A;  1WZ0 A;  1H8C A;  2YVC A;  3RZW C;  3A4S C;  1E90 A;  3QQ8 B;  3ZIM A;  1RLF A;  3JYU A;  1UBI A;  3IBE A;  3MJW A;  1HE8 A;  2BWF A;  1KLV A;  2ZVN A;  2AEH A;  5J2R A;  2KTR A;  2KC1 A;  1IP9 A;  4G3X B;  4FBJ B;  2RSU A;  4MSM B;  1V80 A;  4LDT D;  2N9X A;  4HPL B;  2K25 A;  3H9D A;  3ZLZ A;  4DBG A;  1ZGU B;  3D32 A;  1XT9 B;  3ZO5 B;  2KMC A;  2NPT A;  2LVP A;  2BKF A;  2OJR A;  4RMA A;  3VUY A;  2O2V A;  1JRU A;  2KWV B;  1E8W A;  4A3P A;  2FIF A;  2JRH A;  4IW0 A;  2N9P C;  2K8B A;  3A9J B;  3RZF A;  3V62 A;  5EDS A;  3T9L A;  2KC2 A;  3PLU A;  3RCZ A;  5CX3 A;  3MHS D;  2V3S A;  3APF A;  2QHO A;  4I6P A;  3U30 A;  3DBL I;  2KNB A;  2HE7 A;  1E7V A;  2DEN B;  4ZRI A;  2IO0 B;  3CMM B;  4KSL C;  1P9D U;  4G50 A;  2M8S A;  1WMH B;  3L10 B;  3TIX A;  3ZUN A;  1RFA A;  4IUM B;  3SDL C;  4HCP B;  5JH5 C;  4JLC A;  1V5O A;  5DPW A;  4BKG A;  4IWQ A;  5JHA A;  3TL5 A;  3VQI A;  2C9W B;  3ZNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...