3A4SC

The crystal structure of the sld2:ubc9 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
QELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGLESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Structural basis for regulation of poly-SUMO chain by a SUMO-like domain of Nip45
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/trnascription
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3a4sC00
2L3ZA 4GDLB 1WR1A 4MGKE 2KMAA 1VCBA 3I3TB 5DPSA 3ALBA 3U7DA 2JZ3B 3WANA 4AOFA 2W9NA 3R3MA 3IG3A 3A4SC 4GIVA 5D7GA 3QK0A 1YX6B 1Z2MA 1V5TA 2A4ZA 4IM2A 2RR9A 3AULA 2UYZB 3VTUA 2VRRB 4WAAA 4IWOA 4B9KA 1KOTA 2O6VD 3A1QB 2K8BA 3PT2B 1J19A 3KH0A 4W9EA 3PGEA 1WXMA 2KDFB 1Q5WB 2ZJDA 4ZRIA 2MSED 2BKFA 1WGHA 5BO4B 1A5RA 2M4NA 4IG7B 2K39A 3W1SA 4J6IA 4WJQA 1AARA 1YX5B 2L8JA 3BY4B 4HK2A 1C3TA 1Y8RC 2LWPA 4ZRKA 1WZ0A 3DQVA 1SE9A 4KZ0A 1UD7A 2J0KA 4NAWA 5JZEB 3ZLZA 2LXAA 2MX2A 3DBRI 4NNJB 4XZ4A 1OTRB 1SGHA 1E90A 2KTRB 2KNBA 4DK5A 4B95A 4F7ZA 5D2MB 3OJ3A 2MQJA 2JRHA 4URKA 2CHXA 5AZFA 3UIOB 1P98A 3ZTDA 2KANA 3VUXA 4DBGA 3QWZB 3NS8A 5L83A 1OQYA 3A9KA 2BGFA 2O6VA 4ICVA 4BKSD 2JWZA 4E71A 5FR6A 3V6EB 2JUOA 1V9JA 3LJ3A 1EO6A 3PHWB 4G50A 3EECA 3T8MA 1V5OA 3VH4B 1WM3A 2KWVB 2KOXA 2IBIB 3RUIB 1LFDA 3DVGX 2J0MA 4M8NA 2LXCA 4LDTD 2PPHA 2K6DB 3DOWA 4NJ6A 4AJWA 1WJNA 3PRMB 2MLBA 2YLMA 4II2B 2D2QA 2ZPNA 2K25A 4MH0E 2N9PC 3UINB 1GG3A 2LGDA 2AL3A 2BF8B 2NBVB 4EOYA 3H7PB 1R4MI 4G11A 1RRBA 4P7IA 2L76A 2KN5A 4MSMB 4BKSA 3PREA 4BKGA 2ZPYA 3IFWB 2JT4B 1TTNA 1XQQA 3HM6X 2NVUI 1Z5SB 3AI5A 1WF9A 4JQWC 2IYDB 1K8RB 3DDCB 3L08A 4FBJB 2MBHA 4HVBA 3ZO5B 2N1VA 3K9PB 2IO1B 3ZVVA 1E8ZA 2KLGA 2DX5B 2J7QB 1YJ1A 3TCAA 2DZJA 3DVGY 3HM3A 3M63B 2LRWA 4WWPA 3PPAA 1E8XA 1MG8A 2BPSA 2IZVB 5G2NA 2JRIB 2GBNA 4JL9A 3L10B 4A3PA 1LQBA 3QIJA 4HPLB 4WQOB 5LXHA 4TQ1A 3AXCA 1WMHB 2N1WA 3NZSA 1TBEA 2FIFA 4GDKA 4GXBA 4PYUA 1WE7A 4W9FA 4PYZA 2B3AA 2D10A 1I42A 4K7WA 2C5LC 1IYFA 3KUCB 3EC8A 2KFKA 2K1FA 4W9GA 5CHWA 3V6CB 4EUTA 1T0YA 2C9WB 1UZXB 2N9XA 5E6NA 4W9HA 1WGYA 2GBMA 3IHPC 4IC7B 4EZJA 4PS8A 3ZRFA 3VHTC 4MDKE 2FCMA 2Z59B 2FCNA 1NI2A 4LJOB 3IBEA 1P0RA 3V60A 1GC6A 3QCAA 4JIOU 2LVPA 4KIKA 5C23A 4F1SA 3CF6E 2MW5A 5JH5C 1WGRA 4M0WB 2CU1A 2XK5B 1WGDA 2C7NB 3RD2A 3SDLC 2AYOB 2KX0A 4BOZB 2MP2A 3JW0X 2KZRA 3HK0A 2RD0A 2KC2A 3NZUA 1F9JA 4KDIC 1ZW7A 3ENEA 1WFYA 2LASA 2M1MA 3ZNZB 2NCNA 3M95A 4CHKA 3X23A 4DHJD 4FADA 4M8MA 3U30A 2MBBB 4BVUC 1IPGA 2D3GA 5G55A 3L16A 5E6OA 1WXAA 4KVGB 4TKNA 4GDLA 2KC1A 1P9DU 4HDQA 3N30A 3RZFA 4ANWA 3JSVA 4GSWA 4AUQC 1E7VA 1HE8A 2KKCA 1YIWA 2GBJA 3SU8X 3SHQA 4K7SA 3PRZA 2BWFA 3EHVA 4HPMB 3UGBB 1IP9A 2JF5A 3CMMB 2FIDA 3TBLD 5J17A 4PS3A 4GOCA 4KZCA 3QC8B 4MEMA 4A3OA 3O65B 1WJUA 2WX0A 4RMAA 4GMVA 4FJYA 4FHKA 2KJ6A 2KHWB 1UBQA 2HTHA 2EMSA 4NQKE 2JVCA 1S3SG 3V61A 5AZHA 4EZKA 2L0FA 2DAFA 2DZKA 4GN1A 2O6VB 4ANUA 2DYBA 2IY1B 3MJWA 2BYEA 1WRDB 1SIFA 2LUEA 1V81A 3QX1A 4GGQA 4K7UA 1D3ZA 4F8CB 5CTRC 3T9LA 5IA7A 2PE9A 3M3JA 4I6NB 1WI0A 4LCDE 4YL8A 2M17A 2IO0B 4WWOA 4EKUA 2BYFA 2KJRA 3QA8A 3KVFB 2KTRA 3KW5B 4BBNC 3VFKA 2KJHB 3S2AA 1GNUA 2J0JA 2L05A 3PS6A 3ML8A 2KXJA 3EFUA 2ZVOA 5KHQA 1WZ3A 1CMXB 1E8YA 2KMCA 4BBNF 1H4RA 3C0RB 5DPWA 3DBHI 4KSKC 4X57B 2EMTA 2LVQA 1QZEA 4WJNA 5D94A 2BWES 4DWFA 2OJRA 3ZRCA 4E74A 2AEHA 2N7EA 3WAMA 3WAOA 3H7SA 2KVRA 3ZDTA 1RLFA 2NPTA 1H8CA 4II3B 3APDA 2ZCCA 2ZEQA 4OVVA 3VUYA 3A4RA 1WIAA 3JVZX 2C7HA 1Q0WB 3B1LX 2WYQA 3L54A 3ML9A 4IWPA 5D6JB 2LGXA 4WJPA 1WR6E 2D11A 3U8ZA 2REXA 4EFOA 1RFAA 3W1YA 4IUMB 1ISNA 3NY5A 1ZKHA 4NJ7A 4DDID 4LDTB 3P2BA 1WYWB 2XBBC 3WAPA 2FCQA 1E5WA 3VTVA 4FULA 3VUWA 1EF5A 3B08A 2UWQA 4DHZE 4DXAB 4BOSC 4HCPB 5L95C 3N32A 3ZNGC 3KUZA 2WDTB 4FLHA 4WJOA 4ANVA 2FNJB 4G0NB 3A33B 3ONSA 2A5UA 3H1UA 3ZNID 3Q3JA 3PSEB 4IWQA 2C7MB 3WA0A 3AU4A 5CX3A 2CS4A 5HKHA 2PEAA 2O2VB 4E3CA 3UIPB 1GJZA 3UQAA 4FJZA 3IVFA 4EEWA 3QHTA 3QJZA 3RCZA 3ZTCA 2I1KA 2M8SA 3AU5A 4B6WA 1R4NI 3APCA 4HXDA 3NHEB 3R66C 1VD2A 2HE7A 3RT3B 2LZ6A 2KDBA 4PS7A 2MBQA 1I35A 1E7UA 5TR5A 1LXDA 3PTFC 3JYUA 3A9JA 2LVOA 3PLUA 2MCNB 4W9KA 1BT0A 4OVUA 5GMVA 5LXIB 2KK8A 2MBEA 4FN2A 2NS5A 4TUUA 2HD5B 2LD9A 2LGYA 2KTFA 2MP2B 2Z0DB 5AEKB 1WGGA 4MGYE 2LI5A 3D32A 3OJ4B 3L17A 4HDOA 1ZGUB 3VAWA 3TJPA 2K8HA 1WH3A 3DCGA 4ZYNA 2FUHB 3R7RA 4KDLB 3VDZA 1LM8B 4HCNB 1EF1A 1WXVA 3BINA 2G3QB 2IY0B 3M62B 2N7DA 2DAJA 2CHZA 3N3KB 4G3XB 2CHWA 1Q1OA 4MJSA 2NBWB 2KX3A 2KO3A 2K6QA 2Z0EB 2XK5A 4N9F4 2DZIA 3DBSA 3KUDB 4W9DA 5CHVC 3ECIA 5JHAA 1GUAB 3JSVB 1RAXA 2K8CA 4BFRA 1EUVB 4WWNA 2EKEC 2DENB 4MSQB 3OAWA 4JGHB 5DCNA 1U4AA 5DPTA 5J2RA 1OEYA 3ZKJC 2MWSB 2JY6A 4I6PA 2C60A 4NAWB 2ASQA 3GOEA 4A20A 4AJYB 5LLIA 4FHJA 3WALA 3OLMD 1PQSA 2L7RA 2KFJA 3A1QA 2PE6B 4DHZB 1KJTA 4NPNA 2WX1A 3CSFA 4DHJB 4TV3A 3CSTA 2AL6A 4W9JA 3A9KB 4ZDVA 3MTNB 3ZNHB 2KQ7A 2KDIA 2LRUA 2XEWA 1J0GA 4W9CA 2RPQA 1GC7A 2Y5BB 4TQ0A 4BKTA 2MBOA 2JXXA 1L2NA 3QARA 4XX5A 4LJPB 2DYOA 2N4FA 3PLVA 2GOWA 1V86A 3PZDA 2D07B 1X1MA 3PRPB 2KQSA 3VXWA 2KD0A 2G45B 4MGIE 2AWTA 1C1YB 1L7YA 1KM7A 3APFA 1V80A 1WJ6A 3K9OB 4NY0A 1UGMA 3PVLA 4NQLB 4I6LB 2I1JA 1UH6A 1YD8U 2KWUB 3PHXB 3L13A 2L00B 2DYMA 4AP4C 3QQ8B 4CYEA 2IO3B 2G4DB 4ICUA 4KSLC 3TIXA 2GBRA 2OOBB 4KV2A 1XT9B 2FCSA 4W9IA 5JHBA 2JPHA 2NPTB 1NDDA 2BYVE 3H6NA 2NR2A 1V2YA 5E6PA 2N9EB 1OGWA 3H9DA 3PV1A 3W1SC 2DHZA 3VTWA 3Q3FA 2PJHA 3B0AA 1YQBA 1FXTB 2G4SA 2L0TA 2MRPA 2ZZPB 3NOBA 4IW0A 1TZ1A 4MGZE 2M0XA 1M94A 2CKHB 4HLEA 2HJ8A 3L0WB 4GB9A 4HWIB 2WWZA 3H7PA 2ZVNA 2R2QA 2ZNVB 3DVNU 3SD5A 1WX8A 2CR5A 5KHOA 2DZMA 2ZCBA 3VVWB 5DPRA 2MA9B 2KWCA 4ZRJA 3KYDD 1S1QB 4ASWC 1UELA 2QHOA 4K1RB 1WM2A 1XD3B 3DVNV 2YVCA 4GDKB 1P3QU 3QAQA 3HHMA 1V6EA 5AZGA 3ZW3A 4XC2A 1WJ4A 2JZZA 4IM3A 3ZDMC 4AWJA 1OEYJ 2LJ5A 3X0WA 2R2OA 2KFKB 3GZNI 4FA6A 2FAZA 2RSUA 2V1YA 5IAAC 1JRUA 4RM9A 1NBFC 1V49A 2IO2B 4RM8A 3WIMA 3ZIMA 2BKRB 2RGFA 1G6JA 3DPDA 3LDZE 3RZWC 2NBUA 3R7QA 4CO7A 1WMHA 1WX9A 2GBKA 5J18A 3ZUNA 4GU2A 4KIKB 3DBLI 5CHFA 3A9JB 2O2VA 1WXSA 4FJVB 3RYTA 3V62A 4DDGD 3UQBA 1WE6A 4MM3A 4W9LA 3VH3B 4K81A 4EZLA 1J8CA 1WY8A 1TGZB 3VQIA 4ANXA 4IM0A 2KDEB 1WX7A 1P1AA 1UBIA 1E8WA 3MHSD 2V3SA 3KYCD 1KLVA 4MELA 4HJKA 5C1ZA 3HIZA 3UF8A 4JLCA 2GMIC 2KLCA 2V4LA 2ZNVC 3RULA 3TMPB 4MJSB 5EDSA 3TL5A
chains in the Genus database with same CATH superfamily
4MGKE 2KMAA 5DPSA 3U7DA 4HJGE 3R3MA 1TS5A 3A4SC 3AE7B 3QK0A 3RNEC 4LNNA 3AULA 3VTUA 4WAAA 1KOTA 2O6VD 3PT2B 2Y3AA 3PGEA 1RM6C 2KDFB 4ZRIA 1WGHA 2K39A 3W1SA 2WDVB 4WJQA 1UD7A 1TYGB 2LJIA 4RGTA 2QMTA 4DK5A 4F7ZA 5D2MB 3IXSA 2JRHA 1C77A 3ZTDA 3VUXA 1I4HA 3QWZB 3NS8A 3A9KA 2BGFA 2O6VA 2KAJA 2CJNA 1Q10A 1T0RC 1F2RI 1V9JA 1L0VB 1EO6A 3PHWB 4AQ7A 4G50A 1V5OA 1WM3A 3RUIB 2X8XX 1KH0A 2LXCA 4LDTD 2K6DB 4NJ6A 2K5PA 1SE2A 2K25A 2N9PC 3UINB 4RCOA 3NVWA 2NBVB 4G11A 4L1BA 2JT4B 3DBHB 1M4VA 3RNFC 1JWAD 1K8RB 3DDCB 3W9CB 1VZ7A 3ZO5B 1TY0A 2N1VA 2IO1B 3HRDD 2UU7A 1E8ZA 2KLGA 5IN7A 2JYEA 1WRIA 4MACA 2DZJA 4OZAA 2JRIB 1JMLA 1QQRA 4A3PA 3QIJA 3GB1A 4WQOB 1TBEA 4GDKA 5EE3A 4YSXB 1WE7A 1GOZA 2D10A 1MJDA 1D5XC 4M02A 3EC8A 1IUEA 4MM3B 2KFKA 4W9GA 5E6NA 2GBMA 4PS8A 3ZRFA 4MDKE 4MH8A 4RF0A 2W55A 3GZNB 2RMMA 1NI2A 4LJOB 2NTSA 1P0RA 3QCAA 4JIOU 4KIKA 4F1SA 1QILA 2JX5A 2XK5B 3HK0A 2KC2A 3NZUA 3BYYB 2M1MA 3ZNZB 3M95A 4DHJD 3U30A 5G55A 1NYQA 5E6OA 4KVGB 3RNBC 2KC1A 1KRHA 3RZFA 3JSVA 3V05A 2GBJA 3SHQA 4K7SA 3U7ZA 2VH2A 3EHVA 4HPMB 3CMMB 3PO0A 4KZCA 1K50A 2WP9B 5TSSA 4FJYA 2KJ6A 1TIFA 1ZXHA 2EMSA 1ESFA 1F52A 2DAFA 2L0FA 4ITKA 3U2SC 2BYEA 1V81A 4RGMA 4F8CB 1TJEA 3T9LA 4LCDE 3SEBA 1SEBD 3W5UB 2BYFA 2KJRA 3GS2A 2RDGA 1FPYA 1WWTA 2ZW1A 4BBNC 2PIAA 4TSSA 1GNUA 2J0JA 3ML8A 1DGJA 3DBRB 5KHQA 4IDIA 2KMCA 3DBHI 4X57B 4DWFA 4WJNA 4E74A 1HEZE 4ZHPA 3LYYA 3WAOA 1RLFA 2N0SB 3AEDB 2ZEQA 1SE4A 2OHFA 3B2FA 2MHJA 4IWPA 2D11A 3U8ZA 1RFAA 1NVID 4IUMB 1ISNA 4DDID 1STEA 1WYWB 4DXGA 2FCQA 4LNFA 1TT5B 1I4XA 4YSYB 2UWQA 4DXAB 2XNAC 4BOSC 1E0ZA 3KUZA 2WDTB 4ANVA 2FNJB 3ZNID 3Q3JA 4IWQA 5CX3A 5HKHA 1PGXA 3UQAA 4FJZA 3IVFA 2Y5PA 3ZTCA 2WXNA 2M8SA 4B6WA 3R66C 2HE7A 2KDBA 2DLBA 1E7UA 5TR5A 1LXDA 2LVOA 1BT0A 2G1EA 2MBEA 4FN2A 1HXYD 3N9YC 2LD9A 2IGDA 5AEKB 5EE9A 1CK1A 1SE3A 3DCGA 4ZYNA 3VDZA 1P7EA 2IY0B 3M62B 3N3KB 2CHZA 5HI1A 2NBWB 2Z0EB 4ZHOA 2XK5A 5CHVC 1VJKA 3ECIA 1RAXA 4BFRA 3I57A 2DENB 4MSQB 3AM9A 5DCNA 3ZKJC 3AB5A 2ASQA 1SIJA 3IT6B 2BS4B 4RGOS 1MFWA 3CSTA 2AL6A 3IT4B 2KDIA 1J0GA 2RPQA 4BKTA 2GOWA 3TEXA 1V86A 1C79A 3PRPB 2FUG1 3VXWA 2AWTA 3HVZA 2AQ3B 3PHXB 3L13A 1SBBB 1C4CA 3QQ8B 4KSLC 3AN1A 2FCSA 3AV8A 4US9A 2NPTB 2BYVE 1JW9D 5E6PA 2N9EB 4D2KA 3VTWA 3AE9B 1YQBA 3H8HA 2ZZPB 3RNGC 4WQMA 2CKHB 1FO4A 2J4XA 3H7PA 2R2QA 3EA6A 2PLPA 3R8BA 3N20C 1WX8A 2CR5A 5KHOA 4USAA 5DPRA 3Q8BA 1UELA 4K1RB 1WM2A 3MC0B 2YVCA 1LO5D 3MHZA 3ZW3A 4XC2A 2D3CA 4US8A 3FILA 3ZDMC 2LJ5A 2R2OA 3ZIMA 1NBFC 1V49A 3WIMA 3NVYA 3RZWC 4C4VB 3N1ZC 4CO7A 3ZUNA 1V1PB 1QOBA 1UGJA 1D5ZC 4FJVB 3NRZA 3RYTA 1TKEA 1WE6A 1FEHA 3VH3B 3P63A 2N9LA 1IBXB 1JWSD 1E8WA 2PVOD 3DHHC 5C1ZA 1AWDA 3UF8A 1T0SC 2V4LA 3DWGC 4MJSB 4O1NA 3TMPB 5EDSA 2L3ZA 3RMKC 1D6EC 3GE3C 3I3TB 1VCBA 4XWTA 5H8YE 3ETRA 1VZ8A 3WANA 4AOFA 1T6BX 2NMQA 4GIVA 2DNFA 1ZP0B 1Z2MA 1P7FA 2UYZB 5EE0A 2SEBD 3NUHB 4AS1A 1WGKA 1N60A 2K8BA 2V0GA 1V97A 3KH0A 2BTEA 1L0XB 3BVZA 1VDVA 4RH6A 2ZJDA 2MSED 5BO4B 4IG7B 4J6IA 1YX5B 4HK2A 1EU3A 1TS4A 4LLGM 3KLSX 2J0KA 5JZEB 2D5GA 2LXAA 4NNJB 1E90A 2KTRB 2WU5B 2J52A 4PK1A 5JXVA 4C56C 2CHXA 1XCTL 5AZFA 1J7AA 2AQ1B 3NVVA 4E71A 1T3QA 3V6EB 2JUOA 1ZDXA 3T8MA 1FCLA 1YQ4B 3I63C 1QOAA 4M8NA 4ACFA 2WLBA 2WXFA 3RI7C 3ZQ4A 2KDMA 2AL3A 2BF8B 1HZ5A 2WXGA 3AEEB 3MJ5A 2OJWA 1SF0A 3NG0A 2INPE 5BYSA 2L76A 2KN5A 4MSMB 3OWEB 5H92C 1TTNA 3HM6X 2J53A 2GRIA 4HVBA 2CU3A 2INNE 3ZVVA 4K3BA 1T5XD 2DX5B 1OQRA 4KGRA 2J7QB 1XF5L 1FNVA 1FFUA 4S17A 3HM3A 2WXKA 4HKZE 2BPSA 3ZYYX 2GBNA 4ZRPA 2N1WA 2V4IB 4WWMA 2QIEB 3VRAB 5BYRA 4PYZA 1I42A 4K7WA 1EU4A 2K1FA 2C9WB 2N9XA 2Z59B 2I2YA 1R4NB 3CF6E 4TMAB 3SDLC 1VZ6A 2C7NB 2AYOB 3AE5B 3AH7A 2EKIA 2MP2A 2KZRA 1CJEA 3GP7A 2JU6X 1IBXA 1ET9A 1F9JA 4M00A 1WFYA 2LASA 1C76A 4P1CC 2NCNA 3KWLA 1TS2A 5BMGA 4KKJA 2KWDA 4FADA 2FE8A 2MBBB 1VLBA 4BVUC 1IPGA 1F0ZA 3L16A 3CWIA 4RFBA 2LMCA 3TUOA 4HDQA 2KKCA 1YIWA 2N7JA 3EFCA 4JWUC 2JF5A 3AEFB 4MEMA 1JROA 4RMAA 3LB8C 4FHKA 1UBQA 5C2TB 1UF0A 2JVCA 1FM0D 2D3BA 4EZKA 3LXFA 4ANUA 3J9CA 2GI9A 4WAFA 1SIFA 4C7ZA 1D3ZA 4I6NB 1WI0A 2IO0B 2AX5A 2KTRA 3VFKA 1F1HA 2L05A 3PS6A 1CMXB 1E8YA 3BZDB 4BBNF 2WXQA 5DPWA 5FR3A 1QZEA 2OJRA 3V3XA 2AEHA 3KQ4A 3RN9C 1OQQA 1V8CA 2ZCCA 2C7HA 5AUIA 1HTOA 1Q0WB 1DOYA 5BMIA 4EFOA 3NY5A 1HQRD 3AE6B 5L95C 3ZNGC 2L83A 4FLHA 1R7SA 4G0NB 1YN3A 3RNCC 2A5UA 3PSEB 3WA0A 3R2TA 2O2VB 3RNAC 3UIPB 4E3CA 3BWUD 4EEWA 1FMAD 2I1KA 1R4NI 3APCA 3NHEB 2LZ6A 2MBQA 3PLUA 1L6UA 1TS3A 4EE2A 3EGRA 3P42A 2HD5B 2KTFA 2Z0DB 2WXOA 1DOIA 1F2RC 2L52A 1UNSA 1ZGUB 3VAWA 2INDC 2WXRA 1LM8B 4HCNB 4LNIA 2N7DA 2CHWA 2KO3A 2K6QA 2MJDA 4W9DA 3DBSA 1A70A 1KLUD 1EUVB 2EKEC 3OAWA 4JGHB 5DPTA 5J2RA 4HEA1 4BAXA 2TSSA 1RFKA 4KKIA 4NAWB 4AJYB 4FHJA 1K51A 1KJTA 5C3JB 3CSFA 4TV3A 2KQ7A 3RFZB 1XO3A 2JYTA 1L2NA 3PLVA 2D07B 1MI0A 1L5PA 2KD0A 4N6EB 1L7YA 2HJ1A 1V80A 3K9OB 2JQRB 3PVLA 1UH6A 1IGDA 1HZ6A 4AP4C 4CYEA 4C80A 4ICUA 2ICIA 4LTUA 2MH7A 4KV2A 3NS1A 4HKQA 1MHHE 1I4GA 4XE0A 5JHBA 3ZJVA 2WDQB 2V9HA 4YSZB 3Q3FA 2PJHA 3B0AA 2L0TA 5E6JA 1TZ1A 2M0XA 3Q3MC 2HJ8A 4HWIB 4IKGA 1YN5A 1KLGD 3DVNU 1B9RA 5D3IB 1GB4A 2LGIA 3SD5A 4B0MA 3N1YC 4HRSA 2DZMA 2QDFA 1S1QB 1R4MB 1XD3B 4H2AA 3QAQA 1WJ4A 2JZZA 2L32A 2HDEA 3GZNI 2RSUA 2BBCA 1N61A 1HA5A 2IO2B 1E7PB 2BKRB 4JWSC 2RGFA 3DPDA 3LDZE 4YTPB 1UUPA 3R7QA 2GBKA 4GU2A 4XDCA 1BXTA 3A9JB 3TEWA 4PT5A 2O2VA 1N63A 4MM3A 4W9LA 1WY8A 4ANXA 3BYTB 2BB5A 2H89B 3KYCD 1L0YB 1WYGA 1ZUD2 3HIZA 4P16A 4LK0M 1C4AA 2GMIC 1E9MA 2WS3B 3Q3OC 3ALBA 3AE1B 3B9JA 5MPOA 2A4ZA 1V5TA 4IM2A 2RR9A 1L4ZB 2VRRB 3Q8EA 4B9KA 3A1QB 1C78A 4JE3B 2XN9C 3BVGA 1Q5WB 2V3PA 2MJ3A 3Q14C 3BY4B 1Y8RC 2BVCA 1WSPA 1WZ0A 3DQVA 1SE9A 1GPXA 4KZ0A 1XXGA 4NAWA 1N62A 3TSSA 3ZLZA 2MX2A 3DBRI 1OTRB 1QT9A 1NYRA 4M01A 3OJ3A 2MQJA 1IGCA 4URKA 3UIOB 2KANA 1FNWA 4DBGA 4BKSD 4ICVA 2JWZA 4OVZA 2IGGA 2X38A 4YWGG 2Z8LA 3LJ3A 4FXCA 3EECA 3VH4B 2KWVB 4OHJA 2IBIB 3FKYA 1ACCA 2J0MA 3ZJTA 2PPHA 3DOWA 1CZPA 4AJWA 1WJNA 3PRMB 2YLMA 4II2B 2D2QA 1R4MI 4P7IA 4KGTA 4BKSA 3PREA 3Q8AA 4BKGA 3AE2B 3IFWB 2KMMA 1XQQA 2NVUI 1FIQA 4JQWC 3W2DA 1DYQA 3K9PB 4A6QA 2LFIA 2INCC 3FAHA 3TCAA 3TEZA 4WWPA 2Y5CA 3PPAA 3AMZA 2IZVB 4HPLB 4TQ1A 3AXCA 1B1ZA 1WMHB 3Q8FA 1MG4A 4GXBA 2B3AA 1L4DB 1IYFA 3KUCB 3TEYA 2WGSA 1I4PA 5CHWA 4EUTA 1UZXB 2WDRB 4EZJA 1WGYA 3IHPC 4IC7B 2K9XA 4JPSA 3VHTC 1EM7A 3IBEA 3V60A 2B76B 2LVPA 5C23A 4NAMA 2BB6A 3EUB2 4M0WB 5IKCM 2CU1A 3MC9A 2KX0A 1N5XA 4XYCA 4BOZB 2RD0A 3DBLB 1ENFA 1ZW7A 1JWMD 3X23A 4ZYSA 2D3GA 1P9DU 4ANWA 1SXTA 3N30A 4GSWA 4AUQC 1E7VA 3GE8C 1HTQA 1WXQA 1FRDA 3SU8X 2BWFA 3E56A 4ARIA 2WQYB 2FIDA 5J17A 1SJHD 2W3SA 4A3OA 3AECB 4J3OD 2WX0A 4A8XC 1T0QC 2KHWB 2HTHA 5G5HA 1S3SG 5AZHA 4GN1A 2O6VB 2Q5WD 2IY1B 3MJWA 3QX1A 1XLOA 5IA7A 1MHXA 2M17A 4EKUA 2RDBC 3QA8A 2R61A 3Q6BA 5IOIA 3KVFB 3VR9B 1XLQA 1QLBB 3EFUA 2M56B 2ZVOA 3AEAB 1H4RA 3C0RB 1NEKB 2EMTA 5HHDG 3IAM1 2WXLA 2N7EA 3T3OA 1H8CA 1KTKA 2KVRA 2NPTA 4II3B 2VZKD 3APDA 4OVVA 3BK1A 3A4RA 1WIAA 1I7HA 3JVZX 2D3AA 1AN8A 3L54A 1JALA 2LGXA 4YTNB 3ZJUA 1ZOYB 2REXA 3W1YA 4NJ7A 3P4QB 4LDTB 3WAPA 1SSNA 1TKYA 1EF5A 4HCPB 4WJOA 1CQVA 4WIPA 2RDHA 2PEAA 4QAYA 3QHTA 3QJZA 3RCZA 2DBYA 1BMLC 1E6EB 2ON8A 2WXJA 4C4VA 1YMHE 3CIRB 3RT3B 4PS7A 1I35A 5AUKA 2J42A 3PTFC 1V1PA 3JYUA 1FXAA 2MCNB 4XWWA 4W9KA 5GMVA 4OVUA 2KK8A 2M19A 2PMVA 2NS5A 4TUUA 3T3NA 1KF6B 1AYFA 1WGGA 2LI5A 3D32A 4HDOA 2GB1A 3TJPA 1QKZA 2K8HA 1WH3A 4C00A 4DXFA 4WURA 1N5WA 2FUHB 3R7RA 1XCQL 4KDLB 1ZE3D 1XLNA 3BINA 2DAJA 4MJSA 4BZAA 4M0WA 4N9F4 1UWMA 2DZIA 3KUDB 1BUIC 1J7BA 1GUAB 3JSVB 2K8CA 4WWNA 1ZDVA 1V1OA 4NJCA 1OEYA 3KWVA 2MWSB 5FK9C 2C60A 3GOEA 4S0RA 4A20A 5LLIA 3RPFC 3WALA 2L7RA 1QOFA 2KFJA 1C9FA 4DHZB 4P6VF 1FCCC 2WX1A 1NENB 4DHJB 4ZOHC 2BS3B 3MP9A 1PFDA 3MTNB 3ZNHB 2FBWB 5LNK1 3IAS1 1GC7A 1RYJA 2Y5BB 2MEKA 2JXXA 3QARA 4LJPB 2DYOA 3SR6A 2KQSA 2G45B 4RNAA 1QF6A 5IO9A 1KM7A 3APFA 1WJ6A 5T8IA 4NY0A 2I1JA 2KWUB 2WXPA 2L00B 2DYMA 2OEDA 2IO3B 2G4DB 2IJ0A 2SAKA 2GBRA 2OOBB 1XT9B 4YXDB 3H6NA 4KGSA 2NR2A 4WH4A 3PV1A 1OGWA 4GLSC 3W1SC 1KFYB 1UWXA 4IW0A 2MRPA 2G4SA 3NOBA 5EE1A 2ONQA 2E3TA 4OZCA 1M94A 4HLEA 4NZLB 4GB9A 1YJIA 2ZVNA 5HFYA 1PUTA 1MVKA 4HPPA 1XLPA 3BIID 3VVWB 2MA9B 4ZRJA 2V3NA 3KYDD 1XEEA 4L2YA 2QHOA 3DHIC 2KYWA 2I38A 3WCQA 2LHDA 4AWJA 1OEYJ 3BVMA 3X0WA 4FA6A 2V1YA 5IAAC 1JRUA 4RM9A 3HUIA 2NBUA 1ZPSA 5J18A 2QILA 5CHFA 4DDGD 3V62A 3AEGB 1K53A 5D3DA 1J7CA 4XDDA 4K81A 4EZLA 1GB1A 3VQIA 1VR9A 2RPVA 4REZA 1WX7A 3MHSD 1KLVA 4HJKA 1JQ4A 3C8YA 2KLCA 2ZNVC 4GDLB 1WR1A 2JZ3B 2W9NA 4N59A 3IG3A 5D7GA 4K3CA 2WHIA 2AQ2B 1YX6B 4IWOA 5IP4D 1J19A 3W5VB 3FC4A 4W9EA 3ABVB 3URYA 2L1AA 1WXMA 3PZ8A 2BKFA 1A5RA 2M4NA 1L6VA 1AARA 2L8JA 1C3TA 2JZPA 2LWPA 4ZRKA 4MT5A 1D5MC 1I4RA 4XZ4A 1SGHA 2K3UA 2KNBA 4B95A 2HTME 2N9KA 1P98A 5L83A 1JWUD 1OQYA 5FR6A 3AE8B 2W3RA 1FFVA 2KOXA 2ACZB 1LFDA 3DVGX 3UI3A 4LNOA 2MJEA 2MLBA 3I9V1 2LUMA 2ZPNA 2BQQA 4MH0E 1GG3A 2LGDA 4EOYA 3H7PB 1RRBA 3Q69A 4ZRQA 1SB3C 2PTLA 2ZPYA 2IPKD 3AI5A 1Z5SB 1WF9A 2IYDB 3L08A 4FBJB 2MBHA 3FILB 3HVDA 1YJ1A 4P1BC 1VRAB 3L4PA 2PKOA 3DVGY 3M63B 2LRWA 1FD6A 1E8XA 1MG8A 5G2NA 4JL9A 3L10B 1LQBA 5LXHA 3AE3B 3NZSA 2FIFA 4PYUA 4W9FA 4DQOC 2C5LC 4JX1C 3P4PB 1YNTE 3V6CB 2VH1A 2QJLA 1T0YA 4W9HA 1JWBD 2K0PA 2FCMA 2KVZA 2FCNA 2YEPB 1GC6A 4C7YA 2LEKA 2MW5A 5JH5C 1WGRA 1WGDA 3RD2A 3JW0X 3MC8A 2CJOA 1FXIA 2QEJC 4KDIC 3ENEA 3N1XC 4YT0B 4CHKA 2KN4A 4M8MA 3C19A 1WXAA 4TKNA 4GDLA 1PGBA 1HE8A 1ZXIA 3PRZA 3DWMA 1IP9A 1ET6A 3SFEB 3UGBB 3TBLD 4PS3A 1TKGA 4GOCA 3QC8B 3O65B 1WJUA 4OZBA 1SJED 5FKAC 4GMVA 4NQKE 3V61A 1QOGA 1OFFA 5HG2A 3VRBB 2GLSA 2DZKA 2K22A 1FNUA 2DYBA 4HROA 1WRDB 3O13A 2LUEA 2WXMA 4GGQA 4K7UA 2LHEA 5CTRC 2PE9A 3M3JA 4YL8A 4KX6B 1DOXA 4WWOA 3AEBB 2EELA 3KW5B 2YEPF 2KJHB 3S2AA 1D4BA 4UDUC 2WNMA 2KXJA 1WZ3A 1PDXA 3R2IA 2WU2B 4KSKC 3P1MA 2LVQA 5D94A 2PW9A 2BWES 3ZRCA 1NI3A 3WAMA 1JCKB 4RGNA 3ZDTA 3H7SA 2PVGC 1YOVB 3B2GA 2DWQA 2NTTA 3OG5A 3Q2AC 2KACA 3B1LX 2WYQA 3ML9A 5D6JB 4WJPA 1WR6E 1ZKHA 1YN4A 3ZGZA 3P2BA 2XBBC 1E5WA 3VTVA 4FULA 3VUWA 4B0EA 3B08A 4DHZE 3N32A 1I4QA 4YTMB 3A33B 1PYWD 3ONSA 3H1UA 1RWSA 2C7MB 3AU4A 2CS4A 1GJZA 2VZKB 1YQ3B 5BYQA 3AU5A 4HXDA 3PZ7A 1VD2A 1EWCA 4CQNA 2H88B 3DHGC 2W54A 3A9JA 2M0AA 1TY2A 5LXIB 2E6XA 2LGYA 2LGSA 2MP2B 1LGRA 3NZ3A 4MGYE 3OJ4B 3L17A 1EF1A 1WXVA 2G3QB 1PGAA 4G3XB 3VUYA 1Q1OA 2KX3A 3U4EG 5JHAA 4XGAB 3P4RB 2QSDA 2G9HD 2BS2B 2QC8A 3AE4B 4A90A 1U4AA 2JY6A 4I6PA 4A55A 2WXHA 3OLMD 1PQSA 2KQ4X 1K52A 1ROEA 3A1QA 2PE6B 1AW7A 1N6ZA 3Q8CA 4NPNA 2BYTA 2IGHA 4W9JA 3A9KB 4ZDVA 2XEWA 2LRUA 1C4PA 4W9CA 3ZXRA 4TQ0A 3ZXVA 1F77A 2MBOA 3BK2A 4XX5A 2N4FA 3PZDA 2KT7A 1X1MA 4MGIE 1C1YB 5I4DA 4L23A 1UGMA 4NQLB 4I6LB 1YD8U 2WXIA 3NJTA 3TIXA 3NVZA 4W9IA 2JPHA 1GAQB 1NDDA 1V2YA 3VR8B 2JXTA 3H9DA 3Q3NC 1EWYC 2DHZA 3MFGA 4Q2JA 1FXTB 3SFDB 1YJJA 4MGZE 3L0WB 2WWZA 2ZNVB 1FRRA 2ZCBA 3E9SA 2KWCA 4A9AA 4ASWC 1JRPA 1MPEA 5G5GA 3DVNV 3U52E 2JSVX 4R3DA 4GDKB 1P3QU 3HHMA 1V6EA 5AZGA 4IM3A 4ARCA 2KFKB 3P4SB 3I5JC 2FAZA 2IDYA 4RM8A 2QCZA 4LNKA 1G6JA 2ZW0A 1WMHA 1E10A 1WX9A 4OW0A 4KIKB 3DBLI 1WXSA 3UQBA 2W82A 5GXGB 1J8CA 1TGZB 2JWUA 4RF1A 4IM0A 2KDEB 4N58A 1P1AA 1UBIA 2V3SA 2BT6A 4MELA 1Y56A 5BMHA 4JLCA 3RULA 4IOIE 1TZOA 2BW2A 3TL5A
chains in the Genus database with same CATH topology
2L3ZA 4GDLB 1WR1A 4MGKE 2KMAA 1VCBA 3I3TB 5DPSA 3ALBA 3U7DA 2JZ3B 3WANA 4AOFA 2W9NA 3R3MA 3IG3A 3A4SC 4GIVA 5D7GA 3QK0A 1YX6B 1Z2MA 1V5TA 2A4ZA 4IM2A 2RR9A 3AULA 2UYZB 3VTUA 2VRRB 4WAAA 4IWOA 4B9KA 1KOTA 2O6VD 3A1QB 2K8BA 3PT2B 1J19A 3KH0A 4W9EA 3PGEA 1WXMA 2KDFB 1Q5WB 2ZJDA 4ZRIA 2MSED 2BKFA 1WGHA 5BO4B 1A5RA 2M4NA 4IG7B 2K39A 3W1SA 4J6IA 4WJQA 1AARA 1YX5B 2L8JA 3BY4B 4HK2A 1C3TA 1Y8RC 2LWPA 4ZRKA 1WZ0A 3DQVA 1SE9A 4KZ0A 1UD7A 2J0KA 4NAWA 5JZEB 3ZLZA 2LXAA 2MX2A 3DBRI 4NNJB 4XZ4A 1OTRB 1SGHA 1E90A 2KTRB 2KNBA 4DK5A 4B95A 4F7ZA 5D2MB 3OJ3A 2MQJA 2JRHA 4URKA 2CHXA 5AZFA 3UIOB 1P98A 3ZTDA 2KANA 3VUXA 4DBGA 3QWZB 3NS8A 5L83A 1OQYA 3A9KA 2BGFA 2O6VA 4ICVA 4BKSD 2JWZA 4E71A 5FR6A 3V6EB 2JUOA 1V9JA 3LJ3A 1EO6A 3PHWB 4G50A 3EECA 3T8MA 1V5OA 3VH4B 1WM3A 2KWVB 2KOXA 2IBIB 3RUIB 1LFDA 3DVGX 2J0MA 4M8NA 2LXCA 4LDTD 2PPHA 2K6DB 3DOWA 4NJ6A 4AJWA 1WJNA 3PRMB 2MLBA 2YLMA 4II2B 2D2QA 2ZPNA 2K25A 4MH0E 2N9PC 3UINB 1GG3A 2LGDA 2AL3A 2BF8B 2NBVB 4EOYA 3H7PB 1R4MI 4G11A 1RRBA 4P7IA 2L76A 2KN5A 4MSMB 4BKSA 3PREA 4BKGA 2ZPYA 3IFWB 2JT4B 1TTNA 1XQQA 3HM6X 2NVUI 1Z5SB 3AI5A 1WF9A 4JQWC 2IYDB 1K8RB 3DDCB 3L08A 4FBJB 2MBHA 4HVBA 3ZO5B 2N1VA 3K9PB 2IO1B 3ZVVA 1E8ZA 2KLGA 2DX5B 2J7QB 1YJ1A 3TCAA 2DZJA 3DVGY 3HM3A 3M63B 2LRWA 4WWPA 3PPAA 1E8XA 1MG8A 2BPSA 2IZVB 5G2NA 2JRIB 2GBNA 4JL9A 3L10B 4A3PA 1LQBA 3QIJA 4HPLB 4WQOB 5LXHA 4TQ1A 3AXCA 1WMHB 2N1WA 3NZSA 1TBEA 2FIFA 4GDKA 4GXBA 4PYUA 1WE7A 4W9FA 4PYZA 2B3AA 2D10A 1I42A 4K7WA 2C5LC 1IYFA 3KUCB 3EC8A 2KFKA 2K1FA 4W9GA 5CHWA 3V6CB 4EUTA 1T0YA 2C9WB 1UZXB 2N9XA 5E6NA 4W9HA 1WGYA 2GBMA 3IHPC 4IC7B 4EZJA 4PS8A 3ZRFA 3VHTC 4MDKE 2FCMA 2Z59B 2FCNA 1NI2A 4LJOB 3IBEA 1P0RA 3V60A 1GC6A 3QCAA 4JIOU 2LVPA 4KIKA 5C23A 4F1SA 3CF6E 2MW5A 5JH5C 1WGRA 4M0WB 2CU1A 2XK5B 1WGDA 2C7NB 3RD2A 3SDLC 2AYOB 2KX0A 4BOZB 2MP2A 3JW0X 2KZRA 3HK0A 2RD0A 2KC2A 3NZUA 1F9JA 4KDIC 1ZW7A 3ENEA 1WFYA 2LASA 2M1MA 3ZNZB 2NCNA 3M95A 4CHKA 3X23A 4DHJD 4FADA 4M8MA 3U30A 2MBBB 4BVUC 1IPGA 2D3GA 5G55A 3L16A 5E6OA 1WXAA 4KVGB 4TKNA 4GDLA 2KC1A 1P9DU 4HDQA 3N30A 3RZFA 4ANWA 3JSVA 4GSWA 4AUQC 1E7VA 1HE8A 2KKCA 1YIWA 2GBJA 3SU8X 3SHQA 4K7SA 3PRZA 2BWFA 3EHVA 4HPMB 3UGBB 1IP9A 2JF5A 3CMMB 2FIDA 3TBLD 5J17A 4PS3A 4GOCA 4KZCA 3QC8B 4MEMA 4A3OA 3O65B 1WJUA 2WX0A 4RMAA 4GMVA 4FJYA 4FHKA 2KJ6A 2KHWB 1UBQA 2HTHA 2EMSA 4NQKE 2JVCA 1S3SG 3V61A 5AZHA 4EZKA 2L0FA 2DAFA 2DZKA 4GN1A 2O6VB 4ANUA 2DYBA 2IY1B 3MJWA 2BYEA 1WRDB 1SIFA 2LUEA 1V81A 3QX1A 4GGQA 4K7UA 1D3ZA 4F8CB 5CTRC 3T9LA 5IA7A 2PE9A 3M3JA 4I6NB 1WI0A 4LCDE 4YL8A 2M17A 2IO0B 4WWOA 4EKUA 2BYFA 2KJRA 3QA8A 3KVFB 2KTRA 3KW5B 4BBNC 3VFKA 2KJHB 3S2AA 1GNUA 2J0JA 2L05A 3PS6A 3ML8A 2KXJA 3EFUA 2ZVOA 5KHQA 1WZ3A 1CMXB 1E8YA 2KMCA 4BBNF 1H4RA 3C0RB 5DPWA 3DBHI 4KSKC 4X57B 2EMTA 2LVQA 1QZEA 4WJNA 5D94A 2BWES 4DWFA 2OJRA 3ZRCA 4E74A 2AEHA 2N7EA 3WAMA 3WAOA 3H7SA 2KVRA 3ZDTA 1RLFA 2NPTA 1H8CA 4II3B 3APDA 2ZCCA 2ZEQA 4OVVA 3VUYA 3A4RA 1WIAA 3JVZX 2C7HA 1Q0WB 3B1LX 2WYQA 3L54A 3ML9A 4IWPA 5D6JB 2LGXA 4WJPA 1WR6E 2D11A 3U8ZA 2REXA 4EFOA 1RFAA 3W1YA 4IUMB 1ISNA 3NY5A 1ZKHA 4NJ7A 4DDID 4LDTB 3P2BA 1WYWB 2XBBC 3WAPA 2FCQA 1E5WA 3VTVA 4FULA 3VUWA 1EF5A 3B08A 2UWQA 4DHZE 4DXAB 4BOSC 4HCPB 5L95C 3N32A 3ZNGC 3KUZA 2WDTB 4FLHA 4WJOA 4ANVA 2FNJB 4G0NB 3A33B 3ONSA 2A5UA 3H1UA 3ZNID 3Q3JA 3PSEB 4IWQA 2C7MB 3WA0A 3AU4A 5CX3A 2CS4A 5HKHA 2PEAA 2O2VB 4E3CA 3UIPB 1GJZA 3UQAA 4FJZA 3IVFA 4EEWA 3QHTA 3QJZA 3RCZA 3ZTCA 2I1KA 2M8SA 3AU5A 4B6WA 1R4NI 3APCA 4HXDA 3NHEB 3R66C 1VD2A 2HE7A 3RT3B 2LZ6A 2KDBA 4PS7A 2MBQA 1I35A 1E7UA 5TR5A 1LXDA 3PTFC 3JYUA 3A9JA 2LVOA 3PLUA 2MCNB 4W9KA 1BT0A 4OVUA 5GMVA 5LXIB 2KK8A 2MBEA 4FN2A 2NS5A 4TUUA 2HD5B 2LD9A 2LGYA 2KTFA 2MP2B 2Z0DB 5AEKB 1WGGA 4MGYE 2LI5A 3D32A 3OJ4B 3L17A 4HDOA 1ZGUB 3VAWA 3TJPA 2K8HA 1WH3A 3DCGA 4ZYNA 2FUHB 3R7RA 4KDLB 3VDZA 1LM8B 4HCNB 1EF1A 1WXVA 3BINA 2G3QB 2IY0B 3M62B 2N7DA 2DAJA 2CHZA 3N3KB 4G3XB 2CHWA 1Q1OA 4MJSA 2NBWB 2KX3A 2KO3A 2K6QA 2Z0EB 2XK5A 4N9F4 2DZIA 3DBSA 3KUDB 4W9DA 5CHVC 3ECIA 5JHAA 1GUAB 3JSVB 1RAXA 2K8CA 4BFRA 1EUVB 4WWNA 2EKEC 2DENB 4MSQB 3OAWA 4JGHB 5DCNA 1U4AA 5DPTA 5J2RA 1OEYA 3ZKJC 2MWSB 2JY6A 4I6PA 2C60A 4NAWB 2ASQA 3GOEA 4A20A 4AJYB 5LLIA 4FHJA 3WALA 3OLMD 1PQSA 2L7RA 2KFJA 3A1QA 2PE6B 4DHZB 1KJTA 4NPNA 2WX1A 3CSFA 4DHJB 4TV3A 3CSTA 2AL6A 4W9JA 3A9KB 4ZDVA 3MTNB 3ZNHB 2KQ7A 2KDIA 2LRUA 2XEWA 1J0GA 4W9CA 2RPQA 1GC7A 2Y5BB 4TQ0A 4BKTA 2MBOA 2JXXA 1L2NA 3QARA 4XX5A 4LJPB 2DYOA 2N4FA 3PLVA 2GOWA 1V86A 3PZDA 2D07B 1X1MA 3PRPB 2KQSA 3VXWA 2KD0A 2G45B 4MGIE 2AWTA 1C1YB 1L7YA 1KM7A 3APFA 1V80A 1WJ6A 3K9OB 4NY0A 1UGMA 3PVLA 4NQLB 4I6LB 2I1JA 1UH6A 1YD8U 2KWUB 3PHXB 3L13A 2L00B 2DYMA 4AP4C 3QQ8B 4CYEA 2IO3B 2G4DB 4ICUA 4KSLC 3TIXA 2GBRA 2OOBB 4KV2A 1XT9B 2FCSA 4W9IA 5JHBA 2JPHA 2NPTB 1NDDA 2BYVE 3H6NA 2NR2A 1V2YA 5E6PA 2N9EB 1OGWA 3H9DA 3PV1A 3W1SC 2DHZA 3VTWA 3Q3FA 2PJHA 3B0AA 1YQBA 1FXTB 2G4SA 2L0TA 2MRPA 2ZZPB 3NOBA 4IW0A 1TZ1A 4MGZE 2M0XA 1M94A 2CKHB 4HLEA 2HJ8A 3L0WB 4GB9A 4HWIB 2WWZA 3H7PA 2ZVNA 2R2QA 2ZNVB 3DVNU 3SD5A 1WX8A 2CR5A 5KHOA 2DZMA 2ZCBA 3VVWB 5DPRA 2MA9B 2KWCA 4ZRJA 3KYDD 1S1QB 4ASWC 1UELA 2QHOA 4K1RB 1WM2A 1XD3B 3DVNV 2YVCA 4GDKB 1P3QU 3QAQA 3HHMA 1V6EA 5AZGA 3ZW3A 4XC2A 1WJ4A 2JZZA 4IM3A 3ZDMC 4AWJA 1OEYJ 2LJ5A 3X0WA 2R2OA 2KFKB 3GZNI 4FA6A 2FAZA 2RSUA 2V1YA 5IAAC 1JRUA 4RM9A 1NBFC 1V49A 2IO2B 4RM8A 3WIMA 3ZIMA 2BKRB 2RGFA 1G6JA 3DPDA 3LDZE 3RZWC 2NBUA 3R7QA 4CO7A 1WMHA 1WX9A 2GBKA 5J18A 3ZUNA 4GU2A 4KIKB 3DBLI 5CHFA 3A9JB 2O2VA 1WXSA 4FJVB 3RYTA 3V62A 4DDGD 3UQBA 1WE6A 4MM3A 4W9LA 3VH3B 4K81A 4EZLA 1J8CA 1WY8A 1TGZB 3VQIA 4ANXA 4IM0A 2KDEB 1WX7A 1P1AA 1UBIA 1E8WA 3MHSD 2V3SA 3KYCD 1KLVA 4MELA 4HJKA 5C1ZA 3HIZA 3UF8A 4JLCA 2GMIC 2KLCA 2V4LA 2ZNVC 3RULA 3TMPB 4MJSB 5EDSA 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3Z A;  4GDL B;  1WR1 A;  4MGK E;  2KMA A;  1VCB A;  3I3T B;  5DPS A;  3ALB A;  3U7D A;  2JZ3 B;  3WAN A;  4AOF A;  2W9N A;  3R3M A;  3IG3 A;  3A4S C;  4GIV A;  5D7G A;  3QK0 A;  1YX6 B;  1Z2M A;  1V5T A;  2A4Z A;  4IM2 A;  2RR9 A;  3AUL A;  2UYZ B;  3VTU A;  2VRR B;  4WAA A;  4IWO A;  4B9K A;  1KOT A;  2O6V D;  3A1Q B;  2K8B A;  3PT2 B;  1J19 A;  3KH0 A;  4W9E A;  3PGE A;  1WXM A;  2KDF B;  1Q5W B;  2ZJD A;  4ZRI A;  2MSE D;  2BKF A;  1WGH A;  5BO4 B;  1A5R A;  2M4N A;  4IG7 B;  2K39 A;  3W1S A;  4J6I A;  4WJQ A;  1AAR A;  1YX5 B;  2L8J A;  3BY4 B;  4HK2 A;  1C3T A;  1Y8R C;  2LWP A;  4ZRK A;  1WZ0 A;  3DQV A;  1SE9 A;  4KZ0 A;  1UD7 A;  2J0K A;  4NAW A;  5JZE B;  3ZLZ A;  2LXA A;  2MX2 A;  3DBR I;  4NNJ B;  4XZ4 A;  1OTR B;  1SGH A;  1E90 A;  2KTR B;  2KNB A;  4DK5 A;  4B95 A;  4F7Z A;  5D2M B;  3OJ3 A;  2MQJ A;  2JRH A;  4URK A;  2CHX A;  5AZF A;  3UIO B;  1P98 A;  3ZTD A;  2KAN A;  3VUX A;  4DBG A;  3QWZ B;  3NS8 A;  5L83 A;  1OQY A;  3A9K A;  2BGF A;  2O6V A;  4ICV A;  4BKS D;  2JWZ A;  4E71 A;  5FR6 A;  3V6E B;  2JUO A;  1V9J A;  3LJ3 A;  1EO6 A;  3PHW B;  4G50 A;  3EEC A;  3T8M A;  1V5O A;  3VH4 B;  1WM3 A;  2KWV B;  2KOX A;  2IBI B;  3RUI B;  1LFD A;  3DVG X;  2J0M A;  4M8N A;  2LXC A;  4LDT D;  2PPH A;  2K6D B;  3DOW A;  4NJ6 A;  4AJW A;  1WJN A;  3PRM B;  2MLB A;  2YLM A;  4II2 B;  2D2Q A;  2ZPN A;  2K25 A;  4MH0 E;  2N9P C;  3UIN B;  1GG3 A;  2LGD A;  2AL3 A;  2BF8 B;  2NBV B;  4EOY A;  3H7P B;  1R4M I;  4G11 A;  1RRB A;  4P7I A;  2L76 A;  2KN5 A;  4MSM B;  4BKS A;  3PRE A;  4BKG A;  2ZPY A;  3IFW B;  2JT4 B;  1TTN A;  1XQQ A;  3HM6 X;  2NVU I;  1Z5S B;  3AI5 A;  1WF9 A;  4JQW C;  2IYD B;  1K8R B;  3DDC B;  3L08 A;  4FBJ B;  2MBH A;  4HVB A;  3ZO5 B;  2N1V A;  3K9P B;  2IO1 B;  3ZVV A;  1E8Z A;  2KLG A;  2DX5 B;  2J7Q B;  1YJ1 A;  3TCA A;  2DZJ A;  3DVG Y;  3HM3 A;  3M63 B;  2LRW A;  4WWP A;  3PPA A;  1E8X A;  1MG8 A;  2BPS A;  2IZV B;  5G2N A;  2JRI B;  2GBN A;  4JL9 A;  3L10 B;  4A3P A;  1LQB A;  3QIJ A;  4HPL B;  4WQO B;  5LXH A;  4TQ1 A;  3AXC A;  1WMH B;  2N1W A;  3NZS A;  1TBE A;  2FIF A;  4GDK A;  4GXB A;  4PYU A;  1WE7 A;  4W9F A;  4PYZ A;  2B3A A;  2D10 A;  1I42 A;  4K7W A;  2C5L C;  1IYF A;  3KUC B;  3EC8 A;  2KFK A;  2K1F A;  4W9G A;  5CHW A;  3V6C B;  4EUT A;  1T0Y A;  2C9W B;  1UZX B;  2N9X A;  5E6N A;  4W9H A;  1WGY A;  2GBM A;  3IHP C;  4IC7 B;  4EZJ A;  4PS8 A;  3ZRF A;  3VHT C;  4MDK E;  2FCM A;  2Z59 B;  2FCN A;  1NI2 A;  4LJO B;  3IBE A;  1P0R A;  3V60 A;  1GC6 A;  3QCA A;  4JIO U;  2LVP A;  4KIK A;  5C23 A;  4F1S A;  3CF6 E;  2MW5 A;  5JH5 C;  1WGR A;  4M0W B;  2CU1 A;  2XK5 B;  1WGD A;  2C7N B;  3RD2 A;  3SDL C;  2AYO B;  2KX0 A;  4BOZ B;  2MP2 A;  3JW0 X;  2KZR A;  3HK0 A;  2RD0 A;  2KC2 A;  3NZU A;  1F9J A;  4KDI C;  1ZW7 A;  3ENE A;  1WFY A;  2LAS A;  2M1M A;  3ZNZ B;  2NCN A;  3M95 A;  4CHK A;  3X23 A;  4DHJ D;  4FAD A;  4M8M A;  3U30 A;  2MBB B;  4BVU C;  1IPG A;  2D3G A;  5G55 A;  3L16 A;  5E6O A;  1WXA A;  4KVG B;  4TKN A;  4GDL A;  2KC1 A;  1P9D U;  4HDQ A;  3N30 A;  3RZF A;  4ANW A;  3JSV A;  4GSW A;  4AUQ C;  1E7V A;  1HE8 A;  2KKC A;  1YIW A;  2GBJ A;  3SU8 X;  3SHQ A;  4K7S A;  3PRZ A;  2BWF A;  3EHV A;  4HPM B;  3UGB B;  1IP9 A;  2JF5 A;  3CMM B;  2FID A;  3TBL D;  5J17 A;  4PS3 A;  4GOC A;  4KZC A;  3QC8 B;  4MEM A;  4A3O A;  3O65 B;  1WJU A;  2WX0 A;  4RMA A;  4GMV A;  4FJY A;  4FHK A;  2KJ6 A;  2KHW B;  1UBQ A;  2HTH A;  2EMS A;  4NQK E;  2JVC A;  1S3S G;  3V61 A;  5AZH A;  4EZK A;  2L0F A;  2DAF A;  2DZK A;  4GN1 A;  2O6V B;  4ANU A;  2DYB A;  2IY1 B;  3MJW A;  2BYE A;  1WRD B;  1SIF A;  2LUE A;  1V81 A;  3QX1 A;  4GGQ A;  4K7U A;  1D3Z A;  4F8C B;  5CTR C;  3T9L A;  5IA7 A;  2PE9 A;  3M3J A;  4I6N B;  1WI0 A;  4LCD E;  4YL8 A;  2M17 A;  2IO0 B;  4WWO A;  4EKU A;  2BYF A;  2KJR A;  3QA8 A;  3KVF B;  2KTR A;  3KW5 B;  4BBN C;  3VFK A;  2KJH B;  3S2A A;  1GNU A;  2J0J A;  2L05 A;  3PS6 A;  3ML8 A;  2KXJ A;  3EFU A;  2ZVO A;  5KHQ A;  1WZ3 A;  1CMX B;  1E8Y A;  2KMC A;  4BBN F;  1H4R A;  3C0R B;  5DPW A;  3DBH I;  4KSK C;  4X57 B;  2EMT A;  2LVQ A;  1QZE A;  4WJN A;  5D94 A;  2BWE S;  4DWF A;  2OJR A;  3ZRC A;  4E74 A;  2AEH A;  2N7E A;  3WAM A;  3WAO A;  3H7S A;  2KVR A;  3ZDT A;  1RLF A;  2NPT A;  1H8C A;  4II3 B;  3APD A;  2ZCC A;  2ZEQ A;  4OVV A;  3VUY A;  3A4R A;  1WIA A;  3JVZ X;  2C7H A;  1Q0W B;  3B1L X;  2WYQ A;  3L54 A;  3ML9 A;  4IWP A;  5D6J B;  2LGX A;  4WJP A;  1WR6 E;  2D11 A;  3U8Z A;  2REX A;  4EFO A;  1RFA A;  3W1Y A;  4IUM B;  1ISN A;  3NY5 A;  1ZKH A;  4NJ7 A;  4DDI D;  4LDT B;  3P2B A;  1WYW B;  2XBB C;  3WAP A;  2FCQ A;  1E5W A;  3VTV A;  4FUL A;  3VUW A;  1EF5 A;  3B08 A;  2UWQ A;  4DHZ E;  4DXA B;  4BOS C;  4HCP B;  5L95 C;  3N32 A;  3ZNG C;  3KUZ A;  2WDT B;  4FLH A;  4WJO A;  4ANV A;  2FNJ B;  4G0N B;  3A33 B;  3ONS A;  2A5U A;  3H1U A;  3ZNI D;  3Q3J A;  3PSE B;  4IWQ A;  2C7M B;  3WA0 A;  3AU4 A;  5CX3 A;  2CS4 A;  5HKH A;  2PEA A;  2O2V B;  4E3C A;  3UIP B;  1GJZ A;  3UQA A;  4FJZ A;  3IVF A;  4EEW A;  3QHT A;  3QJZ A;  3RCZ A;  3ZTC A;  2I1K A;  2M8S A;  3AU5 A;  4B6W A;  1R4N I;  3APC A;  4HXD A;  3NHE B;  3R66 C;  1VD2 A;  2HE7 A;  3RT3 B;  2LZ6 A;  2KDB A;  4PS7 A;  2MBQ A;  1I35 A;  1E7U A;  5TR5 A;  1LXD A;  3PTF C;  3JYU A;  3A9J A;  2LVO A;  3PLU A;  2MCN B;  4W9K A;  1BT0 A;  4OVU A;  5GMV A;  5LXI B;  2KK8 A;  2MBE A;  4FN2 A;  2NS5 A;  4TUU A;  2HD5 B;  2LD9 A;  2LGY A;  2KTF A;  2MP2 B;  2Z0D B;  5AEK B;  1WGG A;  4MGY E;  2LI5 A;  3D32 A;  3OJ4 B;  3L17 A;  4HDO A;  1ZGU B;  3VAW A;  3TJP A;  2K8H A;  1WH3 A;  3DCG A;  4ZYN A;  2FUH B;  3R7R A;  4KDL B;  3VDZ A;  1LM8 B;  4HCN B;  1EF1 A;  1WXV A;  3BIN A;  2G3Q B;  2IY0 B;  3M62 B;  2N7D A;  2DAJ A;  2CHZ A;  3N3K B;  4G3X B;  2CHW A;  1Q1O A;  4MJS A;  2NBW B;  2KX3 A;  2KO3 A;  2K6Q A;  2Z0E B;  2XK5 A;  4N9F 4;  2DZI A;  3DBS A;  3KUD B;  4W9D A;  5CHV C;  3ECI A;  5JHA A;  1GUA B;  3JSV B;  1RAX A;  2K8C A;  4BFR A;  1EUV B;  4WWN A;  2EKE C;  2DEN B;  4MSQ B;  3OAW A;  4JGH B;  5DCN A;  1U4A A;  5DPT A;  5J2R A;  1OEY A;  3ZKJ C;  2MWS B;  2JY6 A;  4I6P A;  2C60 A;  4NAW B;  2ASQ A;  3GOE A;  4A20 A;  4AJY B;  5LLI A;  4FHJ A;  3WAL A;  3OLM D;  1PQS A;  2L7R A;  2KFJ A;  3A1Q A;  2PE6 B;  4DHZ B;  1KJT A;  4NPN A;  2WX1 A;  3CSF A;  4DHJ B;  4TV3 A;  3CST A;  2AL6 A;  4W9J A;  3A9K B;  4ZDV A;  3MTN B;  3ZNH B;  2KQ7 A;  2KDI A;  2LRU A;  2XEW A;  1J0G A;  4W9C A;  2RPQ A;  1GC7 A;  2Y5B B;  4TQ0 A;  4BKT A;  2MBO A;  2JXX A;  1L2N A;  3QAR A;  4XX5 A;  4LJP B;  2DYO A;  2N4F A;  3PLV A;  2GOW A;  1V86 A;  3PZD A;  2D07 B;  1X1M A;  3PRP B;  2KQS A;  3VXW A;  2KD0 A;  2G45 B;  4MGI E;  2AWT A;  1C1Y B;  1L7Y A;  1KM7 A;  3APF A;  1V80 A;  1WJ6 A;  3K9O B;  4NY0 A;  1UGM A;  3PVL A;  4NQL B;  4I6L B;  2I1J A;  1UH6 A;  1YD8 U;  2KWU B;  3PHX B;  3L13 A;  2L00 B;  2DYM A;  4AP4 C;  3QQ8 B;  4CYE A;  2IO3 B;  2G4D B;  4ICU A;  4KSL C;  3TIX A;  2GBR A;  2OOB B;  4KV2 A;  1XT9 B;  2FCS A;  4W9I A;  5JHB A;  2JPH A;  2NPT B;  1NDD A;  2BYV E;  3H6N A;  2NR2 A;  1V2Y A;  5E6P A;  2N9E B;  1OGW A;  3H9D A;  3PV1 A;  3W1S C;  2DHZ A;  3VTW A;  3Q3F A;  2PJH A;  3B0A A;  1YQB A;  1FXT B;  2G4S A;  2L0T A;  2MRP A;  2ZZP B;  3NOB A;  4IW0 A;  1TZ1 A;  4MGZ E;  2M0X A;  1M94 A;  2CKH B;  4HLE A;  2HJ8 A;  3L0W B;  4GB9 A;  4HWI B;  2WWZ A;  3H7P A;  2ZVN A;  2R2Q A;  2ZNV B;  3DVN U;  3SD5 A;  1WX8 A;  2CR5 A;  5KHO A;  2DZM A;  2ZCB A;  3VVW B;  5DPR A;  2MA9 B;  2KWC A;  4ZRJ A;  3KYD D;  1S1Q B;  4ASW C;  1UEL A;  2QHO A;  4K1R B;  1WM2 A;  1XD3 B;  3DVN V;  2YVC A;  4GDK B;  1P3Q U;  3QAQ A;  3HHM A;  1V6E A;  5AZG A;  3ZW3 A;  4XC2 A;  1WJ4 A;  2JZZ A;  4IM3 A;  3ZDM C;  4AWJ A;  1OEY J;  2LJ5 A;  3X0W A;  2R2O A;  2KFK B;  3GZN I;  4FA6 A;  2FAZ A;  2RSU A;  2V1Y A;  5IAA C;  1JRU A;  4RM9 A;  1NBF C;  1V49 A;  2IO2 B;  4RM8 A;  3WIM A;  3ZIM A;  2BKR B;  2RGF A;  1G6J A;  3DPD A;  3LDZ E;  3RZW C;  2NBU A;  3R7Q A;  4CO7 A;  1WMH A;  1WX9 A;  2GBK A;  5J18 A;  3ZUN A;  4GU2 A;  4KIK B;  3DBL I;  5CHF A;  3A9J B;  2O2V A;  1WXS A;  4FJV B;  3RYT A;  3V62 A;  4DDG D;  3UQB A;  1WE6 A;  4MM3 A;  4W9L A;  3VH3 B;  4K81 A;  4EZL A;  1J8C A;  1WY8 A;  1TGZ B;  3VQI A;  4ANX A;  4IM0 A;  2KDE B;  1WX7 A;  1P1A A;  1UBI A;  1E8W A;  3MHS D;  2V3S A;  3KYC D;  1KLV A;  4MEL A;  4HJK A;  5C1Z A;  3HIZ A;  3UF8 A;  4JLC A;  2GMI C;  2KLC A;  2V4L A;  2ZNV C;  3RUL A;  3TMP B;  4MJS B;  5EDS A;  3TL5 A; 
#chains in the Genus database with same CATH topology
 4MGK E;  2KMA A;  5DPS A;  3U7D A;  4HJG E;  3R3M A;  1TS5 A;  3A4S C;  3AE7 B;  3QK0 A;  3RNE C;  4LNN A;  3AUL A;  3VTU A;  4WAA A;  1KOT A;  2O6V D;  3PT2 B;  2Y3A A;  3PGE A;  1RM6 C;  2KDF B;  4ZRI A;  1WGH A;  2K39 A;  3W1S A;  2WDV B;  4WJQ A;  1UD7 A;  1TYG B;  2LJI A;  4RGT A;  2QMT A;  4DK5 A;  4F7Z A;  5D2M B;  3IXS A;  2JRH A;  1C77 A;  3ZTD A;  3VUX A;  1I4H A;  3QWZ B;  3NS8 A;  3A9K A;  2BGF A;  2O6V A;  2KAJ A;  2CJN A;  1Q10 A;  1T0R C;  1F2R I;  1V9J A;  1L0V B;  1EO6 A;  3PHW B;  4AQ7 A;  4G50 A;  1V5O A;  1WM3 A;  3RUI B;  2X8X X;  1KH0 A;  2LXC A;  4LDT D;  2K6D B;  4NJ6 A;  2K5P A;  1SE2 A;  2K25 A;  2N9P C;  3UIN B;  4RCO A;  3NVW A;  2NBV B;  4G11 A;  4L1B A;  2JT4 B;  3DBH B;  1M4V A;  3RNF C;  1JWA D;  1K8R B;  3DDC B;  3W9C B;  1VZ7 A;  3ZO5 B;  1TY0 A;  2N1V A;  2IO1 B;  3HRD D;  2UU7 A;  1E8Z A;  2KLG A;  5IN7 A;  2JYE A;  1WRI A;  4MAC A;  2DZJ A;  4OZA A;  2JRI B;  1JML A;  1QQR A;  4A3P A;  3QIJ A;  3GB1 A;  4WQO B;  1TBE A;  4GDK A;  5EE3 A;  4YSX B;  1WE7 A;  1GOZ A;  2D10 A;  1MJD A;  1D5X C;  4M02 A;  3EC8 A;  1IUE A;  4MM3 B;  2KFK A;  4W9G A;  5E6N A;  2GBM A;  4PS8 A;  3ZRF A;  4MDK E;  4MH8 A;  4RF0 A;  2W55 A;  3GZN B;  2RMM A;  1NI2 A;  4LJO B;  2NTS A;  1P0R A;  3QCA A;  4JIO U;  4KIK A;  4F1S A;  1QIL A;  2JX5 A;  2XK5 B;  3HK0 A;  2KC2 A;  3NZU A;  3BYY B;  2M1M A;  3ZNZ B;  3M95 A;  4DHJ D;  3U30 A;  5G55 A;  1NYQ A;  5E6O A;  4KVG B;  3RNB C;  2KC1 A;  1KRH A;  3RZF A;  3JSV A;  3V05 A;  2GBJ A;  3SHQ A;  4K7S A;  3U7Z A;  2VH2 A;  3EHV A;  4HPM B;  3CMM B;  3PO0 A;  4KZC A;  1K50 A;  2WP9 B;  5TSS A;  4FJY A;  2KJ6 A;  1TIF A;  1ZXH A;  2EMS A;  1ESF A;  1F52 A;  2DAF A;  2L0F A;  4ITK A;  3U2S C;  2BYE A;  1V81 A;  4RGM A;  4F8C B;  1TJE A;  3T9L A;  4LCD E;  3SEB A;  1SEB D;  3W5U B;  2BYF A;  2KJR A;  3GS2 A;  2RDG A;  1FPY A;  1WWT A;  2ZW1 A;  4BBN C;  2PIA A;  4TSS A;  1GNU A;  2J0J A;  3ML8 A;  1DGJ A;  3DBR B;  5KHQ A;  4IDI A;  2KMC A;  3DBH I;  4X57 B;  4DWF A;  4WJN A;  4E74 A;  1HEZ E;  4ZHP A;  3LYY A;  3WAO A;  1RLF A;  2N0S B;  3AED B;  2ZEQ A;  1SE4 A;  2OHF A;  3B2F A;  2MHJ A;  4IWP A;  2D11 A;  3U8Z A;  1RFA A;  1NVI D;  4IUM B;  1ISN A;  4DDI D;  1STE A;  1WYW B;  4DXG A;  2FCQ A;  4LNF A;  1TT5 B;  1I4X A;  4YSY B;  2UWQ A;  4DXA B;  2XNA C;  4BOS C;  1E0Z A;  3KUZ A;  2WDT B;  4ANV A;  2FNJ B;  3ZNI D;  3Q3J A;  4IWQ A;  5CX3 A;  5HKH A;  1PGX A;  3UQA A;  4FJZ A;  3IVF A;  2Y5P A;  3ZTC A;  2WXN A;  2M8S A;  4B6W A;  3R66 C;  2HE7 A;  2KDB A;  2DLB A;  1E7U A;  5TR5 A;  1LXD A;  2LVO A;  1BT0 A;  2G1E A;  2MBE A;  4FN2 A;  1HXY D;  3N9Y C;  2LD9 A;  2IGD A;  5AEK B;  5EE9 A;  1CK1 A;  1SE3 A;  3DCG A;  4ZYN A;  3VDZ A;  1P7E A;  2IY0 B;  3M62 B;  3N3K B;  2CHZ A;  5HI1 A;  2NBW B;  2Z0E B;  4ZHO A;  2XK5 A;  5CHV C;  1VJK A;  3ECI A;  1RAX A;  4BFR A;  3I57 A;  2DEN B;  4MSQ B;  3AM9 A;  5DCN A;  3ZKJ C;  3AB5 A;  2ASQ A;  1SIJ A;  3IT6 B;  2BS4 B;  4RGO S;  1MFW A;  3CST A;  2AL6 A;  3IT4 B;  2KDI A;  1J0G A;  2RPQ A;  4BKT A;  2GOW A;  3TEX A;  1V86 A;  1C79 A;  3PRP B;  2FUG 1;  3VXW A;  2AWT A;  3HVZ A;  2AQ3 B;  3PHX B;  3L13 A;  1SBB B;  1C4C A;  3QQ8 B;  4KSL C;  3AN1 A;  2FCS A;  3AV8 A;  4US9 A;  2NPT B;  2BYV E;  1JW9 D;  5E6P A;  2N9E B;  4D2K A;  3VTW A;  3AE9 B;  1YQB A;  3H8H A;  2ZZP B;  3RNG C;  4WQM A;  2CKH B;  1FO4 A;  2J4X A;  3H7P A;  2R2Q A;  3EA6 A;  2PLP A;  3R8B A;  3N20 C;  1WX8 A;  2CR5 A;  5KHO A;  4USA A;  5DPR A;  3Q8B A;  1UEL A;  4K1R B;  1WM2 A;  3MC0 B;  2YVC A;  1LO5 D;  3MHZ A;  3ZW3 A;  4XC2 A;  2D3C A;  4US8 A;  3FIL A;  3ZDM C;  2LJ5 A;  2R2O A;  3ZIM A;  1NBF C;  1V49 A;  3WIM A;  3NVY A;  3RZW C;  4C4V B;  3N1Z C;  4CO7 A;  3ZUN A;  1V1P B;  1QOB A;  1UGJ A;  1D5Z C;  4FJV B;  3NRZ A;  3RYT A;  1TKE A;  1WE6 A;  1FEH A;  3VH3 B;  3P63 A;  2N9L A;  1IBX B;  1JWS D;  1E8W A;  2PVO D;  3DHH C;  5C1Z A;  1AWD A;  3UF8 A;  1T0S C;  2V4L A;  3DWG C;  4MJS B;  4O1N A;  3TMP B;  5EDS A;  2L3Z A;  3RMK C;  1D6E C;  3GE3 C;  3I3T B;  1VCB A;  4XWT A;  5H8Y E;  3ETR A;  1VZ8 A;  3WAN A;  4AOF A;  1T6B X;  2NMQ A;  4GIV A;  2DNF A;  1ZP0 B;  1Z2M A;  1P7F A;  2UYZ B;  5EE0 A;  2SEB D;  3NUH B;  4AS1 A;  1WGK A;  1N60 A;  2K8B A;  2V0G A;  1V97 A;  3KH0 A;  2BTE A;  1L0X B;  3BVZ A;  1VDV A;  4RH6 A;  2ZJD A;  2MSE D;  5BO4 B;  4IG7 B;  4J6I A;  1YX5 B;  4HK2 A;  1EU3 A;  1TS4 A;  4LLG M;  3KLS X;  2J0K A;  5JZE B;  2D5G A;  2LXA A;  4NNJ B;  1E90 A;  2KTR B;  2WU5 B;  2J52 A;  4PK1 A;  5JXV A;  4C56 C;  2CHX A;  1XCT L;  5AZF A;  1J7A A;  2AQ1 B;  3NVV A;  4E71 A;  1T3Q A;  3V6E B;  2JUO A;  1ZDX A;  3T8M A;  1FCL A;  1YQ4 B;  3I63 C;  1QOA A;  4M8N A;  4ACF A;  2WLB A;  2WXF A;  3RI7 C;  3ZQ4 A;  2KDM A;  2AL3 A;  2BF8 B;  1HZ5 A;  2WXG A;  3AEE B;  3MJ5 A;  2OJW A;  1SF0 A;  3NG0 A;  2INP E;  5BYS A;  2L76 A;  2KN5 A;  4MSM B;  3OWE B;  5H92 C;  1TTN A;  3HM6 X;  2J53 A;  2GRI A;  4HVB A;  2CU3 A;  2INN E;  3ZVV A;  4K3B A;  1T5X D;  2DX5 B;  1OQR A;  4KGR A;  2J7Q B;  1XF5 L;  1FNV A;  1FFU A;  4S17 A;  3HM3 A;  2WXK A;  4HKZ E;  2BPS A;  3ZYY X;  2GBN A;  4ZRP A;  2N1W A;  2V4I B;  4WWM A;  2QIE B;  3VRA B;  5BYR A;  4PYZ A;  1I42 A;  4K7W A;  1EU4 A;  2K1F A;  2C9W B;  2N9X A;  2Z59 B;  2I2Y A;  1R4N B;  3CF6 E;  4TMA B;  3SDL C;  1VZ6 A;  2C7N B;  2AYO B;  3AE5 B;  3AH7 A;  2EKI A;  2MP2 A;  2KZR A;  1CJE A;  3GP7 A;  2JU6 X;  1IBX A;  1ET9 A;  1F9J A;  4M00 A;  1WFY A;  2LAS A;  1C76 A;  4P1C C;  2NCN A;  3KWL A;  1TS2 A;  5BMG A;  4KKJ A;  2KWD A;  4FAD A;  2FE8 A;  2MBB B;  1VLB A;  4BVU C;  1IPG A;  1F0Z A;  3L16 A;  3CWI A;  4RFB A;  2LMC A;  3TUO A;  4HDQ A;  2KKC A;  1YIW A;  2N7J A;  3EFC A;  4JWU C;  2JF5 A;  3AEF B;  4MEM A;  1JRO A;  4RMA A;  3LB8 C;  4FHK A;  1UBQ A;  5C2T B;  1UF0 A;  2JVC A;  1FM0 D;  2D3B A;  4EZK A;  3LXF A;  4ANU A;  3J9C A;  2GI9 A;  4WAF A;  1SIF A;  4C7Z A;  1D3Z A;  4I6N B;  1WI0 A;  2IO0 B;  2AX5 A;  2KTR A;  3VFK A;  1F1H A;  2L05 A;  3PS6 A;  1CMX B;  1E8Y A;  3BZD B;  4BBN F;  2WXQ A;  5DPW A;  5FR3 A;  1QZE A;  2OJR A;  3V3X A;  2AEH A;  3KQ4 A;  3RN9 C;  1OQQ A;  1V8C A;  2ZCC A;  2C7H A;  5AUI A;  1HTO A;  1Q0W B;  1DOY A;  5BMI A;  4EFO A;  3NY5 A;  1HQR D;  3AE6 B;  5L95 C;  3ZNG C;  2L83 A;  4FLH A;  1R7S A;  4G0N B;  1YN3 A;  3RNC C;  2A5U A;  3PSE B;  3WA0 A;  3R2T A;  2O2V B;  3RNA C;  3UIP B;  4E3C A;  3BWU D;  4EEW A;  1FMA D;  2I1K A;  1R4N I;  3APC A;  3NHE B;  2LZ6 A;  2MBQ A;  3PLU A;  1L6U A;  1TS3 A;  4EE2 A;  3EGR A;  3P42 A;  2HD5 B;  2KTF A;  2Z0D B;  2WXO A;  1DOI A;  1F2R C;  2L52 A;  1UNS A;  1ZGU B;  3VAW A;  2IND C;  2WXR A;  1LM8 B;  4HCN B;  4LNI A;  2N7D A;  2CHW A;  2KO3 A;  2K6Q A;  2MJD A;  4W9D A;  3DBS A;  1A70 A;  1KLU D;  1EUV B;  2EKE C;  3OAW A;  4JGH B;  5DPT A;  5J2R A;  4HEA 1;  4BAX A;  2TSS A;  1RFK A;  4KKI A;  4NAW B;  4AJY B;  4FHJ A;  1K51 A;  1KJT A;  5C3J B;  3CSF A;  4TV3 A;  2KQ7 A;  3RFZ B;  1XO3 A;  2JYT A;  1L2N A;  3PLV A;  2D07 B;  1MI0 A;  1L5P A;  2KD0 A;  4N6E B;  1L7Y A;  2HJ1 A;  1V80 A;  3K9O B;  2JQR B;  3PVL A;  1UH6 A;  1IGD A;  1HZ6 A;  4AP4 C;  4CYE A;  4C80 A;  4ICU A;  2ICI A;  4LTU A;  2MH7 A;  4KV2 A;  3NS1 A;  4HKQ A;  1MHH E;  1I4G A;  4XE0 A;  5JHB A;  3ZJV A;  2WDQ B;  2V9H A;  4YSZ B;  3Q3F A;  2PJH A;  3B0A A;  2L0T A;  5E6J A;  1TZ1 A;  2M0X A;  3Q3M C;  2HJ8 A;  4HWI B;  4IKG A;  1YN5 A;  1KLG D;  3DVN U;  1B9R A;  5D3I B;  1GB4 A;  2LGI A;  3SD5 A;  4B0M A;  3N1Y C;  4HRS A;  2DZM A;  2QDF A;  1S1Q B;  1R4M B;  1XD3 B;  4H2A A;  3QAQ A;  1WJ4 A;  2JZZ A;  2L32 A;  2HDE A;  3GZN I;  2RSU A;  2BBC A;  1N61 A;  1HA5 A;  2IO2 B;  1E7P B;  2BKR B;  4JWS C;  2RGF A;  3DPD A;  3LDZ E;  4YTP B;  1UUP A;  3R7Q A;  2GBK A;  4GU2 A;  4XDC A;  1BXT A;  3A9J B;  3TEW A;  4PT5 A;  2O2V A;  1N63 A;  4MM3 A;  4W9L A;  1WY8 A;  4ANX A;  3BYT B;  2BB5 A;  2H89 B;  3KYC D;  1L0Y B;  1WYG A;  1ZUD 2;  3HIZ A;  4P16 A;  4LK0 M;  1C4A A;  2GMI C;  1E9M A;  2WS3 B;  3Q3O C;  3ALB A;  3AE1 B;  3B9J A;  5MPO A;  2A4Z A;  1V5T A;  4IM2 A;  2RR9 A;  1L4Z B;  2VRR B;  3Q8E A;  4B9K A;  3A1Q B;  1C78 A;  4JE3 B;  2XN9 C;  3BVG A;  1Q5W B;  2V3P A;  2MJ3 A;  3Q14 C;  3BY4 B;  1Y8R C;  2BVC A;  1WSP A;  1WZ0 A;  3DQV A;  1SE9 A;  1GPX A;  4KZ0 A;  1XXG A;  4NAW A;  1N62 A;  3TSS A;  3ZLZ A;  2MX2 A;  3DBR I;  1OTR B;  1QT9 A;  1NYR A;  4M01 A;  3OJ3 A;  2MQJ A;  1IGC A;  4URK A;  3UIO B;  2KAN A;  1FNW A;  4DBG A;  4BKS D;  4ICV A;  2JWZ A;  4OVZ A;  2IGG A;  2X38 A;  4YWG G;  2Z8L A;  3LJ3 A;  4FXC A;  3EEC A;  3VH4 B;  2KWV B;  4OHJ A;  2IBI B;  3FKY A;  1ACC A;  2J0M A;  3ZJT A;  2PPH A;  3DOW A;  1CZP A;  4AJW A;  1WJN A;  3PRM B;  2YLM A;  4II2 B;  2D2Q A;  1R4M I;  4P7I A;  4KGT A;  4BKS A;  3PRE A;  3Q8A A;  4BKG A;  3AE2 B;  3IFW B;  2KMM A;  1XQQ A;  2NVU I;  1FIQ A;  4JQW C;  3W2D A;  1DYQ A;  3K9P B;  4A6Q A;  2LFI A;  2INC C;  3FAH A;  3TCA A;  3TEZ A;  4WWP A;  2Y5C A;  3PPA A;  3AMZ A;  2IZV B;  4HPL B;  4TQ1 A;  3AXC A;  1B1Z A;  1WMH B;  3Q8F A;  1MG4 A;  4GXB A;  2B3A A;  1L4D B;  1IYF A;  3KUC B;  3TEY A;  2WGS A;  1I4P A;  5CHW A;  4EUT A;  1UZX B;  2WDR B;  4EZJ A;  1WGY A;  3IHP C;  4IC7 B;  2K9X A;  4JPS A;  3VHT C;  1EM7 A;  3IBE A;  3V60 A;  2B76 B;  2LVP A;  5C23 A;  4NAM A;  2BB6 A;  3EUB 2;  4M0W B;  5IKC M;  2CU1 A;  3MC9 A;  2KX0 A;  1N5X A;  4XYC A;  4BOZ B;  2RD0 A;  3DBL B;  1ENF A;  1ZW7 A;  1JWM D;  3X23 A;  4ZYS A;  2D3G A;  1P9D U;  4ANW A;  1SXT A;  3N30 A;  4GSW A;  4AUQ C;  1E7V A;  3GE8 C;  1HTQ A;  1WXQ A;  1FRD A;  3SU8 X;  2BWF A;  3E56 A;  4ARI A;  2WQY B;  2FID A;  5J17 A;  1SJH D;  2W3S A;  4A3O A;  3AEC B;  4J3O D;  2WX0 A;  4A8X C;  1T0Q C;  2KHW B;  2HTH A;  5G5H A;  1S3S G;  5AZH A;  4GN1 A;  2O6V B;  2Q5W D;  2IY1 B;  3MJW A;  3QX1 A;  1XLO A;  5IA7 A;  1MHX A;  2M17 A;  4EKU A;  2RDB C;  3QA8 A;  2R61 A;  3Q6B A;  5IOI A;  3KVF B;  3VR9 B;  1XLQ A;  1QLB B;  3EFU A;  2M56 B;  2ZVO A;  3AEA B;  1H4R A;  3C0R B;  1NEK B;  2EMT A;  5HHD G;  3IAM 1;  2WXL A;  2N7E A;  3T3O A;  1H8C A;  1KTK A;  2KVR A;  2NPT A;  4II3 B;  2VZK D;  3APD A;  4OVV A;  3BK1 A;  3A4R A;  1WIA A;  1I7H A;  3JVZ X;  2D3A A;  1AN8 A;  3L54 A;  1JAL A;  2LGX A;  4YTN B;  3ZJU A;  1ZOY B;  2REX A;  3W1Y A;  4NJ7 A;  3P4Q B;  4LDT B;  3WAP A;  1SSN A;  1TKY A;  1EF5 A;  4HCP B;  4WJO A;  1CQV A;  4WIP A;  2RDH A;  2PEA A;  4QAY A;  3QHT A;  3QJZ A;  3RCZ A;  2DBY A;  1BML C;  1E6E B;  2ON8 A;  2WXJ A;  4C4V A;  1YMH E;  3CIR B;  3RT3 B;  4PS7 A;  1I35 A;  5AUK A;  2J42 A;  3PTF C;  1V1P A;  3JYU A;  1FXA A;  2MCN B;  4XWW A;  4W9K A;  5GMV A;  4OVU A;  2KK8 A;  2M19 A;  2PMV A;  2NS5 A;  4TUU A;  3T3N A;  1KF6 B;  1AYF A;  1WGG A;  2LI5 A;  3D32 A;  4HDO A;  2GB1 A;  3TJP A;  1QKZ A;  2K8H A;  1WH3 A;  4C00 A;  4DXF A;  4WUR A;  1N5W A;  2FUH B;  3R7R A;  1XCQ L;  4KDL B;  1ZE3 D;  1XLN A;  3BIN A;  2DAJ A;  4MJS A;  4BZA A;  4M0W A;  4N9F 4;  1UWM A;  2DZI A;  3KUD B;  1BUI C;  1J7B A;  1GUA B;  3JSV B;  2K8C A;  4WWN A;  1ZDV A;  1V1O A;  4NJC A;  1OEY A;  3KWV A;  2MWS B;  5FK9 C;  2C60 A;  3GOE A;  4S0R A;  4A20 A;  5LLI A;  3RPF C;  3WAL A;  2L7R A;  1QOF A;  2KFJ A;  1C9F A;  4DHZ B;  4P6V F;  1FCC C;  2WX1 A;  1NEN B;  4DHJ B;  4ZOH C;  2BS3 B;  3MP9 A;  1PFD A;  3MTN B;  3ZNH B;  2FBW B;  5LNK 1;  3IAS 1;  1GC7 A;  1RYJ A;  2Y5B B;  2MEK A;  2JXX A;  3QAR A;  4LJP B;  2DYO A;  3SR6 A;  2KQS A;  2G45 B;  4RNA A;  1QF6 A;  5IO9 A;  1KM7 A;  3APF A;  1WJ6 A;  5T8I A;  4NY0 A;  2I1J A;  2KWU B;  2WXP A;  2L00 B;  2DYM A;  2OED A;  2IO3 B;  2G4D B;  2IJ0 A;  2SAK A;  2GBR A;  2OOB B;  1XT9 B;  4YXD B;  3H6N A;  4KGS A;  2NR2 A;  4WH4 A;  3PV1 A;  1OGW A;  4GLS C;  3W1S C;  1KFY B;  1UWX A;  4IW0 A;  2MRP A;  2G4S A;  3NOB A;  5EE1 A;  2ONQ A;  2E3T A;  4OZC A;  1M94 A;  4HLE A;  4NZL B;  4GB9 A;  1YJI A;  2ZVN A;  5HFY A;  1PUT A;  1MVK A;  4HPP A;  1XLP A;  3BII D;  3VVW B;  2MA9 B;  4ZRJ A;  2V3N A;  3KYD D;  1XEE A;  4L2Y A;  2QHO A;  3DHI C;  2KYW A;  2I38 A;  3WCQ A;  2LHD A;  4AWJ A;  1OEY J;  3BVM A;  3X0W A;  4FA6 A;  2V1Y A;  5IAA C;  1JRU A;  4RM9 A;  3HUI A;  2NBU A;  1ZPS A;  5J18 A;  2QIL A;  5CHF A;  4DDG D;  3V62 A;  3AEG B;  1K53 A;  5D3D A;  1J7C A;  4XDD A;  4K81 A;  4EZL A;  1GB1 A;  3VQI A;  1VR9 A;  2RPV A;  4REZ A;  1WX7 A;  3MHS D;  1KLV A;  4HJK A;  1JQ4 A;  3C8Y A;  2KLC A;  2ZNV C;  4GDL B;  1WR1 A;  2JZ3 B;  2W9N A;  4N59 A;  3IG3 A;  5D7G A;  4K3C A;  2WHI A;  2AQ2 B;  1YX6 B;  4IWO A;  5IP4 D;  1J19 A;  3W5V B;  3FC4 A;  4W9E A;  3ABV B;  3URY A;  2L1A A;  1WXM A;  3PZ8 A;  2BKF A;  1A5R A;  2M4N A;  1L6V A;  1AAR A;  2L8J A;  1C3T A;  2JZP A;  2LWP A;  4ZRK A;  4MT5 A;  1D5M C;  1I4R A;  4XZ4 A;  1SGH A;  2K3U A;  2KNB A;  4B95 A;  2HTM E;  2N9K A;  1P98 A;  5L83 A;  1JWU D;  1OQY A;  5FR6 A;  3AE8 B;  2W3R A;  1FFV A;  2KOX A;  2ACZ B;  1LFD A;  3DVG X;  3UI3 A;  4LNO A;  2MJE A;  2MLB A;  3I9V 1;  2LUM A;  2ZPN A;  2BQQ A;  4MH0 E;  1GG3 A;  2LGD A;  4EOY A;  3H7P B;  1RRB A;  3Q69 A;  4ZRQ A;  1SB3 C;  2PTL A;  2ZPY A;  2IPK D;  3AI5 A;  1Z5S B;  1WF9 A;  2IYD B;  3L08 A;  4FBJ B;  2MBH A;  3FIL B;  3HVD A;  1YJ1 A;  4P1B C;  1VRA B;  3L4P A;  2PKO A;  3DVG Y;  3M63 B;  2LRW A;  1FD6 A;  1E8X A;  1MG8 A;  5G2N A;  4JL9 A;  3L10 B;  1LQB A;  5LXH A;  3AE3 B;  3NZS A;  2FIF A;  4PYU A;  4W9F A;  4DQO C;  2C5L C;  4JX1 C;  3P4P B;  1YNT E;  3V6C B;  2VH1 A;  2QJL A;  1T0Y A;  4W9H A;  1JWB D;  2K0P A;  2FCM A;  2KVZ A;  2FCN A;  2YEP B;  1GC6 A;  4C7Y A;  2LEK A;  2MW5 A;  5JH5 C;  1WGR A;  1WGD A;  3RD2 A;  3JW0 X;  3MC8 A;  2CJO A;  1FXI A;  2QEJ C;  4KDI C;  3ENE A;  3N1X C;  4YT0 B;  4CHK A;  2KN4 A;  4M8M A;  3C19 A;  1WXA A;  4TKN A;  4GDL A;  1PGB A;  1HE8 A;  1ZXI A;  3PRZ A;  3DWM A;  1IP9 A;  1ET6 A;  3SFE B;  3UGB B;  3TBL D;  4PS3 A;  1TKG A;  4GOC A;  3QC8 B;  3O65 B;  1WJU A;  4OZB A;  1SJE D;  5FKA C;  4GMV A;  4NQK E;  3V61 A;  1QOG A;  1OFF A;  5HG2 A;  3VRB B;  2GLS A;  2DZK A;  2K22 A;  1FNU A;  2DYB A;  4HRO A;  1WRD B;  3O13 A;  2LUE A;  2WXM A;  4GGQ A;  4K7U A;  2LHE A;  5CTR C;  2PE9 A;  3M3J A;  4YL8 A;  4KX6 B;  1DOX A;  4WWO A;  3AEB B;  2EEL A;  3KW5 B;  2YEP F;  2KJH B;  3S2A A;  1D4B A;  4UDU C;  2WNM A;  2KXJ A;  1WZ3 A;  1PDX A;  3R2I A;  2WU2 B;  4KSK C;  3P1M A;  2LVQ A;  5D94 A;  2PW9 A;  2BWE S;  3ZRC A;  1NI3 A;  3WAM A;  1JCK B;  4RGN A;  3ZDT A;  3H7S A;  2PVG C;  1YOV B;  3B2G A;  2DWQ A;  2NTT A;  3OG5 A;  3Q2A C;  2KAC A;  3B1L X;  2WYQ A;  3ML9 A;  5D6J B;  4WJP A;  1WR6 E;  1ZKH A;  1YN4 A;  3ZGZ A;  3P2B A;  2XBB C;  1E5W A;  3VTV A;  4FUL A;  3VUW A;  4B0E A;  3B08 A;  4DHZ E;  3N32 A;  1I4Q A;  4YTM B;  3A33 B;  1PYW D;  3ONS A;  3H1U A;  1RWS A;  2C7M B;  3AU4 A;  2CS4 A;  1GJZ A;  2VZK B;  1YQ3 B;  5BYQ A;  3AU5 A;  4HXD A;  3PZ7 A;  1VD2 A;  1EWC A;  4CQN A;  2H88 B;  3DHG C;  2W54 A;  3A9J A;  2M0A A;  1TY2 A;  5LXI B;  2E6X A;  2LGY A;  2LGS A;  2MP2 B;  1LGR A;  3NZ3 A;  4MGY E;  3OJ4 B;  3L17 A;  1EF1 A;  1WXV A;  2G3Q B;  1PGA A;  4G3X B;  3VUY A;  1Q1O A;  2KX3 A;  3U4E G;  5JHA A;  4XGA B;  3P4R B;  2QSD A;  2G9H D;  2BS2 B;  2QC8 A;  3AE4 B;  4A90 A;  1U4A A;  2JY6 A;  4I6P A;  4A55 A;  2WXH A;  3OLM D;  1PQS A;  2KQ4 X;  1K52 A;  1ROE A;  3A1Q A;  2PE6 B;  1AW7 A;  1N6Z A;  3Q8C A;  4NPN A;  2BYT A;  2IGH A;  4W9J A;  3A9K B;  4ZDV A;  2XEW A;  2LRU A;  1C4P A;  4W9C A;  3ZXR A;  4TQ0 A;  3ZXV A;  1F77 A;  2MBO A;  3BK2 A;  4XX5 A;  2N4F A;  3PZD A;  2KT7 A;  1X1M A;  4MGI E;  1C1Y B;  5I4D A;  4L23 A;  1UGM A;  4NQL B;  4I6L B;  1YD8 U;  2WXI A;  3NJT A;  3TIX A;  3NVZ A;  4W9I A;  2JPH A;  1GAQ B;  1NDD A;  1V2Y A;  3VR8 B;  2JXT A;  3H9D A;  3Q3N C;  1EWY C;  2DHZ A;  3MFG A;  4Q2J A;  1FXT B;  3SFD B;  1YJJ A;  4MGZ E;  3L0W B;  2WWZ A;  2ZNV B;  1FRR A;  2ZCB A;  3E9S A;  2KWC A;  4A9A A;  4ASW C;  1JRP A;  1MPE A;  5G5G A;  3DVN V;  3U52 E;  2JSV X;  4R3D A;  4GDK B;  1P3Q U;  3HHM A;  1V6E A;  5AZG A;  4IM3 A;  4ARC A;  2KFK B;  3P4S B;  3I5J C;  2FAZ A;  2IDY A;  4RM8 A;  2QCZ A;  4LNK A;  1G6J A;  2ZW0 A;  1WMH A;  1E10 A;  1WX9 A;  4OW0 A;  4KIK B;  3DBL I;  1WXS A;  3UQB A;  2W82 A;  5GXG B;  1J8C A;  1TGZ B;  2JWU A;  4RF1 A;  4IM0 A;  2KDE B;  4N58 A;  1P1A A;  1UBI A;  2V3S A;  2BT6 A;  4MEL A;  1Y56 A;  5BMH A;  4JLC A;  3RUL A;  4IOI E;  1TZO A;  2BW2 A;  3TL5 A; 
#chains in the Genus database with same CATH homology
 2L3Z A;  4GDL B;  1WR1 A;  4MGK E;  2KMA A;  1VCB A;  3I3T B;  5DPS A;  3ALB A;  3U7D A;  2JZ3 B;  3WAN A;  4AOF A;  2W9N A;  3R3M A;  3IG3 A;  3A4S C;  4GIV A;  5D7G A;  3QK0 A;  1YX6 B;  1Z2M A;  1V5T A;  2A4Z A;  4IM2 A;  2RR9 A;  3AUL A;  2UYZ B;  3VTU A;  2VRR B;  4WAA A;  4IWO A;  4B9K A;  1KOT A;  2O6V D;  3A1Q B;  2K8B A;  3PT2 B;  1J19 A;  3KH0 A;  4W9E A;  3PGE A;  1WXM A;  2KDF B;  1Q5W B;  2ZJD A;  4ZRI A;  2MSE D;  2BKF A;  1WGH A;  5BO4 B;  1A5R A;  2M4N A;  4IG7 B;  2K39 A;  3W1S A;  4J6I A;  4WJQ A;  1AAR A;  1YX5 B;  2L8J A;  3BY4 B;  4HK2 A;  1C3T A;  1Y8R C;  2LWP A;  4ZRK A;  1WZ0 A;  3DQV A;  1SE9 A;  4KZ0 A;  1UD7 A;  2J0K A;  4NAW A;  5JZE B;  3ZLZ A;  2LXA A;  2MX2 A;  3DBR I;  4NNJ B;  4XZ4 A;  1OTR B;  1SGH A;  1E90 A;  2KTR B;  2KNB A;  4DK5 A;  4B95 A;  4F7Z A;  5D2M B;  3OJ3 A;  2MQJ A;  2JRH A;  4URK A;  2CHX A;  5AZF A;  3UIO B;  1P98 A;  3ZTD A;  2KAN A;  3VUX A;  4DBG A;  3QWZ B;  3NS8 A;  5L83 A;  1OQY A;  3A9K A;  2BGF A;  2O6V A;  4ICV A;  4BKS D;  2JWZ A;  4E71 A;  5FR6 A;  3V6E B;  2JUO A;  1V9J A;  3LJ3 A;  1EO6 A;  3PHW B;  4G50 A;  3EEC A;  3T8M A;  1V5O A;  3VH4 B;  1WM3 A;  2KWV B;  2KOX A;  2IBI B;  3RUI B;  1LFD A;  3DVG X;  2J0M A;  4M8N A;  2LXC A;  4LDT D;  2PPH A;  2K6D B;  3DOW A;  4NJ6 A;  4AJW A;  1WJN A;  3PRM B;  2MLB A;  2YLM A;  4II2 B;  2D2Q A;  2ZPN A;  2K25 A;  4MH0 E;  2N9P C;  3UIN B;  1GG3 A;  2LGD A;  2AL3 A;  2BF8 B;  2NBV B;  4EOY A;  3H7P B;  1R4M I;  4G11 A;  1RRB A;  4P7I A;  2L76 A;  2KN5 A;  4MSM B;  4BKS A;  3PRE A;  4BKG A;  2ZPY A;  3IFW B;  2JT4 B;  1TTN A;  1XQQ A;  3HM6 X;  2NVU I;  1Z5S B;  3AI5 A;  1WF9 A;  4JQW C;  2IYD B;  1K8R B;  3DDC B;  3L08 A;  4FBJ B;  2MBH A;  4HVB A;  3ZO5 B;  2N1V A;  3K9P B;  2IO1 B;  3ZVV A;  1E8Z A;  2KLG A;  2DX5 B;  2J7Q B;  1YJ1 A;  3TCA A;  2DZJ A;  3DVG Y;  3HM3 A;  3M63 B;  2LRW A;  4WWP A;  3PPA A;  1E8X A;  1MG8 A;  2BPS A;  2IZV B;  5G2N A;  2JRI B;  2GBN A;  4JL9 A;  3L10 B;  4A3P A;  1LQB A;  3QIJ A;  4HPL B;  4WQO B;  5LXH A;  4TQ1 A;  3AXC A;  1WMH B;  2N1W A;  3NZS A;  1TBE A;  2FIF A;  4GDK A;  4GXB A;  4PYU A;  1WE7 A;  4W9F A;  4PYZ A;  2B3A A;  2D10 A;  1I42 A;  4K7W A;  2C5L C;  1IYF A;  3KUC B;  3EC8 A;  2KFK A;  2K1F A;  4W9G A;  5CHW A;  3V6C B;  4EUT A;  1T0Y A;  2C9W B;  1UZX B;  2N9X A;  5E6N A;  4W9H A;  1WGY A;  2GBM A;  3IHP C;  4IC7 B;  4EZJ A;  4PS8 A;  3ZRF A;  3VHT C;  4MDK E;  2FCM A;  2Z59 B;  2FCN A;  1NI2 A;  4LJO B;  3IBE A;  1P0R A;  3V60 A;  1GC6 A;  3QCA A;  4JIO U;  2LVP A;  4KIK A;  5C23 A;  4F1S A;  3CF6 E;  2MW5 A;  5JH5 C;  1WGR A;  4M0W B;  2CU1 A;  2XK5 B;  1WGD A;  2C7N B;  3RD2 A;  3SDL C;  2AYO B;  2KX0 A;  4BOZ B;  2MP2 A;  3JW0 X;  2KZR A;  3HK0 A;  2RD0 A;  2KC2 A;  3NZU A;  1F9J A;  4KDI C;  1ZW7 A;  3ENE A;  1WFY A;  2LAS A;  2M1M A;  3ZNZ B;  2NCN A;  3M95 A;  4CHK A;  3X23 A;  4DHJ D;  4FAD A;  4M8M A;  3U30 A;  2MBB B;  4BVU C;  1IPG A;  2D3G A;  5G55 A;  3L16 A;  5E6O A;  1WXA A;  4KVG B;  4TKN A;  4GDL A;  2KC1 A;  1P9D U;  4HDQ A;  3N30 A;  3RZF A;  4ANW A;  3JSV A;  4GSW A;  4AUQ C;  1E7V A;  1HE8 A;  2KKC A;  1YIW A;  2GBJ A;  3SU8 X;  3SHQ A;  4K7S A;  3PRZ A;  2BWF A;  3EHV A;  4HPM B;  3UGB B;  1IP9 A;  2JF5 A;  3CMM B;  2FID A;  3TBL D;  5J17 A;  4PS3 A;  4GOC A;  4KZC A;  3QC8 B;  4MEM A;  4A3O A;  3O65 B;  1WJU A;  2WX0 A;  4RMA A;  4GMV A;  4FJY A;  4FHK A;  2KJ6 A;  2KHW B;  1UBQ A;  2HTH A;  2EMS A;  4NQK E;  2JVC A;  1S3S G;  3V61 A;  5AZH A;  4EZK A;  2L0F A;  2DAF A;  2DZK A;  4GN1 A;  2O6V B;  4ANU A;  2DYB A;  2IY1 B;  3MJW A;  2BYE A;  1WRD B;  1SIF A;  2LUE A;  1V81 A;  3QX1 A;  4GGQ A;  4K7U A;  1D3Z A;  4F8C B;  5CTR C;  3T9L A;  5IA7 A;  2PE9 A;  3M3J A;  4I6N B;  1WI0 A;  4LCD E;  4YL8 A;  2M17 A;  2IO0 B;  4WWO A;  4EKU A;  2BYF A;  2KJR A;  3QA8 A;  3KVF B;  2KTR A;  3KW5 B;  4BBN C;  3VFK A;  2KJH B;  3S2A A;  1GNU A;  2J0J A;  2L05 A;  3PS6 A;  3ML8 A;  2KXJ A;  3EFU A;  2ZVO A;  5KHQ A;  1WZ3 A;  1CMX B;  1E8Y A;  2KMC A;  4BBN F;  1H4R A;  3C0R B;  5DPW A;  3DBH I;  4KSK C;  4X57 B;  2EMT A;  2LVQ A;  1QZE A;  4WJN A;  5D94 A;  2BWE S;  4DWF A;  2OJR A;  3ZRC A;  4E74 A;  2AEH A;  2N7E A;  3WAM A;  3WAO A;  3H7S A;  2KVR A;  3ZDT A;  1RLF A;  2NPT A;  1H8C A;  4II3 B;  3APD A;  2ZCC A;  2ZEQ A;  4OVV A;  3VUY A;  3A4R A;  1WIA A;  3JVZ X;  2C7H A;  1Q0W B;  3B1L X;  2WYQ A;  3L54 A;  3ML9 A;  4IWP A;  5D6J B;  2LGX A;  4WJP A;  1WR6 E;  2D11 A;  3U8Z A;  2REX A;  4EFO A;  1RFA A;  3W1Y A;  4IUM B;  1ISN A;  3NY5 A;  1ZKH A;  4NJ7 A;  4DDI D;  4LDT B;  3P2B A;  1WYW B;  2XBB C;  3WAP A;  2FCQ A;  1E5W A;  3VTV A;  4FUL A;  3VUW A;  1EF5 A;  3B08 A;  2UWQ A;  4DHZ E;  4DXA B;  4BOS C;  4HCP B;  5L95 C;  3N32 A;  3ZNG C;  3KUZ A;  2WDT B;  4FLH A;  4WJO A;  4ANV A;  2FNJ B;  4G0N B;  3A33 B;  3ONS A;  2A5U A;  3H1U A;  3ZNI D;  3Q3J A;  3PSE B;  4IWQ A;  2C7M B;  3WA0 A;  3AU4 A;  5CX3 A;  2CS4 A;  5HKH A;  2PEA A;  2O2V B;  4E3C A;  3UIP B;  1GJZ A;  3UQA A;  4FJZ A;  3IVF A;  4EEW A;  3QHT A;  3QJZ A;  3RCZ A;  3ZTC A;  2I1K A;  2M8S A;  3AU5 A;  4B6W A;  1R4N I;  3APC A;  4HXD A;  3NHE B;  3R66 C;  1VD2 A;  2HE7 A;  3RT3 B;  2LZ6 A;  2KDB A;  4PS7 A;  2MBQ A;  1I35 A;  1E7U A;  5TR5 A;  1LXD A;  3PTF C;  3JYU A;  3A9J A;  2LVO A;  3PLU A;  2MCN B;  4W9K A;  1BT0 A;  4OVU A;  5GMV A;  5LXI B;  2KK8 A;  2MBE A;  4FN2 A;  2NS5 A;  4TUU A;  2HD5 B;  2LD9 A;  2LGY A;  2KTF A;  2MP2 B;  2Z0D B;  5AEK B;  1WGG A;  4MGY E;  2LI5 A;  3D32 A;  3OJ4 B;  3L17 A;  4HDO A;  1ZGU B;  3VAW A;  3TJP A;  2K8H A;  1WH3 A;  3DCG A;  4ZYN A;  2FUH B;  3R7R A;  4KDL B;  3VDZ A;  1LM8 B;  4HCN B;  1EF1 A;  1WXV A;  3BIN A;  2G3Q B;  2IY0 B;  3M62 B;  2N7D A;  2DAJ A;  2CHZ A;  3N3K B;  4G3X B;  2CHW A;  1Q1O A;  4MJS A;  2NBW B;  2KX3 A;  2KO3 A;  2K6Q A;  2Z0E B;  2XK5 A;  4N9F 4;  2DZI A;  3DBS A;  3KUD B;  4W9D A;  5CHV C;  3ECI A;  5JHA A;  1GUA B;  3JSV B;  1RAX A;  2K8C A;  4BFR A;  1EUV B;  4WWN A;  2EKE C;  2DEN B;  4MSQ B;  3OAW A;  4JGH B;  5DCN A;  1U4A A;  5DPT A;  5J2R A;  1OEY A;  3ZKJ C;  2MWS B;  2JY6 A;  4I6P A;  2C60 A;  4NAW B;  2ASQ A;  3GOE A;  4A20 A;  4AJY B;  5LLI A;  4FHJ A;  3WAL A;  3OLM D;  1PQS A;  2L7R A;  2KFJ A;  3A1Q A;  2PE6 B;  4DHZ B;  1KJT A;  4NPN A;  2WX1 A;  3CSF A;  4DHJ B;  4TV3 A;  3CST A;  2AL6 A;  4W9J A;  3A9K B;  4ZDV A;  3MTN B;  3ZNH B;  2KQ7 A;  2KDI A;  2LRU A;  2XEW A;  1J0G A;  4W9C A;  2RPQ A;  1GC7 A;  2Y5B B;  4TQ0 A;  4BKT A;  2MBO A;  2JXX A;  1L2N A;  3QAR A;  4XX5 A;  4LJP B;  2DYO A;  2N4F A;  3PLV A;  2GOW A;  1V86 A;  3PZD A;  2D07 B;  1X1M A;  3PRP B;  2KQS A;  3VXW A;  2KD0 A;  2G45 B;  4MGI E;  2AWT A;  1C1Y B;  1L7Y A;  1KM7 A;  3APF A;  1V80 A;  1WJ6 A;  3K9O B;  4NY0 A;  1UGM A;  3PVL A;  4NQL B;  4I6L B;  2I1J A;  1UH6 A;  1YD8 U;  2KWU B;  3PHX B;  3L13 A;  2L00 B;  2DYM A;  4AP4 C;  3QQ8 B;  4CYE A;  2IO3 B;  2G4D B;  4ICU A;  4KSL C;  3TIX A;  2GBR A;  2OOB B;  4KV2 A;  1XT9 B;  2FCS A;  4W9I A;  5JHB A;  2JPH A;  2NPT B;  1NDD A;  2BYV E;  3H6N A;  2NR2 A;  1V2Y A;  5E6P A;  2N9E B;  1OGW A;  3H9D A;  3PV1 A;  3W1S C;  2DHZ A;  3VTW A;  3Q3F A;  2PJH A;  3B0A A;  1YQB A;  1FXT B;  2G4S A;  2L0T A;  2MRP A;  2ZZP B;  3NOB A;  4IW0 A;  1TZ1 A;  4MGZ E;  2M0X A;  1M94 A;  2CKH B;  4HLE A;  2HJ8 A;  3L0W B;  4GB9 A;  4HWI B;  2WWZ A;  3H7P A;  2ZVN A;  2R2Q A;  2ZNV B;  3DVN U;  3SD5 A;  1WX8 A;  2CR5 A;  5KHO A;  2DZM A;  2ZCB A;  3VVW B;  5DPR A;  2MA9 B;  2KWC A;  4ZRJ A;  3KYD D;  1S1Q B;  4ASW C;  1UEL A;  2QHO A;  4K1R B;  1WM2 A;  1XD3 B;  3DVN V;  2YVC A;  4GDK B;  1P3Q U;  3QAQ A;  3HHM A;  1V6E A;  5AZG A;  3ZW3 A;  4XC2 A;  1WJ4 A;  2JZZ A;  4IM3 A;  3ZDM C;  4AWJ A;  1OEY J;  2LJ5 A;  3X0W A;  2R2O A;  2KFK B;  3GZN I;  4FA6 A;  2FAZ A;  2RSU A;  2V1Y A;  5IAA C;  1JRU A;  4RM9 A;  1NBF C;  1V49 A;  2IO2 B;  4RM8 A;  3WIM A;  3ZIM A;  2BKR B;  2RGF A;  1G6J A;  3DPD A;  3LDZ E;  3RZW C;  2NBU A;  3R7Q A;  4CO7 A;  1WMH A;  1WX9 A;  2GBK A;  5J18 A;  3ZUN A;  4GU2 A;  4KIK B;  3DBL I;  5CHF A;  3A9J B;  2O2V A;  1WXS A;  4FJV B;  3RYT A;  3V62 A;  4DDG D;  3UQB A;  1WE6 A;  4MM3 A;  4W9L A;  3VH3 B;  4K81 A;  4EZL A;  1J8C A;  1WY8 A;  1TGZ B;  3VQI A;  4ANX A;  4IM0 A;  2KDE B;  1WX7 A;  1P1A A;  1UBI A;  1E8W A;  3MHS D;  2V3S A;  3KYC D;  1KLV A;  4MEL A;  4HJK A;  5C1Z A;  3HIZ A;  3UF8 A;  4JLC A;  2GMI C;  2KLC A;  2V4L A;  2ZNV C;  3RUL A;  3TMP B;  4MJS B;  5EDS A;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...