3A4VA

Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
311
structure length
311
Chain Sequence
b'MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
molecule tags Oxidoreductase
source organism Thermoplasma volcanium
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
total genus 122
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a4vA00
3VPXA 3AI2A 1O94A 1I3LA 2R00C 5L53A 2QYSA 4FW8A 5KKCA 1EK5A 1U1IA 3JD3A 3VH2A 4DPKA 1CDOA 1L7EA 1WLYA 1NWHA 3LT0A 2Y67A 3L6DA 1ZCJA 5CHEA 1AHIA 3WB9A 4DTIA 3WGTA 3JQAB 1K6XA 3OQBA 3T7EA 1TXGA 1HLPA 1DAOA 3RU7A 4RF5A 4WNIA 2G0TA 3H8VA 4O59O 3ZDFA 2DQ4A 4XB2A 3U3XA 1ZUD1 2AQ8A 4R68A 3STHA 1PGPA 1NBOA 4PLPA 4WLOA 3ZNNA 4R01A 2VRBA 1PL8A 1HZJA 4ZQHA 3ONFA 2JCYA 3TOXA 3U4CA 3ST7A 2AXQA 4RQTA 3U4HA 1HF3A 4M55A 4WCFC 4AJIA 1E3WB 1I32A 1YBVA 1GDHA 4FJ1A 3I23A 1U3VA 1D1TA 3ZWOA 5IZCA 2AE2A 1Y7TA 1ULSA 1W6UA 3IAHA 2WD8A 5JAMA 1YB4A 3H9GA 2VQ3A 5CDTA 4M1QA 1MFZA 2O7QA 2X5KO 2X8LA 3PJDA 4BO8A 2VHZA 1HL3A 2NVUA 3I52A 3KM0A 5IN5A 4IDEA 5KTKA 1PJ4A 2X0RA 3MJTA 4G81A 4GAEA 5FWNA 4MVJI 4OMUA 3RC7A 1LSUA 4GMGA 2OMEA 4P22A 1NAHA 1ZBQA 2B5WA 3QE3A 3H9EO 3VPGA 5HWSA 3M1AA 5JO9A 2NTVA 2WE8A 1BDMA 1VC2A 2ET6A 4Z0PA 4L8VA 1WDKA 4AJ1A 2IYPA 3SC4A 4DLAA 4YPOA 1HYHA 2GDZA 4GPD1 1NPTO 2FZWA 2WD7A 4BNHA 1Y8RA 1D4FA 3DC2A 4E2WA 1A9YA 3VVBA 3HN2A 1E0DA 5L45A 3JQ9C 4IMRA 2E4AA 1U4SA 5F1PA 4KTTE 2WD7B 3DZGA 4QUKA 5DOZA 4AJJA 2C82A 4BUCA 3D64A 3WIDA 2YHIA 4S3MA 2FPGA 5F3RA 3DFZA 4HFRA 3ZU4A 1Y5MA 1D8AA 3CTMA 3TPCA 1C0LA 1HWYA 1VE9A 3EGOA 4L9RA 5B12A 2X9GA 1X0VA 5GMOA 2B69A 3AK4A 3VZSA 3L4BA 1PJ3A 4AVYA 1ENZA 3PEFA 3VZRA 1DO8A 4Z9XA 5JYEA 1VSUA 1OFGA 1YB5A 4PVCA 4YJHA 4AJKA 3VH1A 5IAAA 5KJ1A 2X5OA 1CEQA 4HBGA 5L9AA 4MP3A 3C3XA 5FI3A 3VPSA 3ZU2A 5DDIP 5JYDA 1UXHA 3HFGA 2ZYGA 3GPIA 4FDAA 2G5CA 2Q4BA 3IP1A 3OM9A 2AEMA 3I1JA 4W9NA 2ZJ0A 4ZQBA 5L4LA 4IJVA 3WQQA 4UUPA 3DTYA 6LDHA 1KY5A 1JTVA 1JDJA 4J1SA 3ZWCA 1BTOA 3HE3A 4UEKA 4IDCA 1T2DA 4YQYA 9LDTA 4BB5A 1HDZA 4GBJA 3TFOA 1U2DA 4Q3DA 4J4TA 4XEHA 1L1FA 2BRUA 1V6AA 1ZFNA 3PK0A 4UULA 2GN9A 4XKJA 2D5AA 2G17A 4LGVA 1EVYA 1R0KA 3F1KA 3OH8A 3VKVA 3ABIA 5EL0A 1E1NA 3BMNA 1F12A 1SPXA 1ZEJA 1JLLA 2ZB4A 4GLOA 3HHPA 4PLHA 3ZV6A 3L4BC 5TLSA 5B4UA 4PRLA 1NVMB 3NT5A 1YL7A 3D1LA 3JQFC 4FFPA 4YQZA 4IXWA 2I6TA 1HRDA 3GNSA 4XYBA 4BQRA 5JBIA 3WBBA 1AXGA 1H2BA 1MC4A 4DA9A 1PSDA 1EDOA 2V6BA 1HE4A 1EVIA 4BO4A 3AUSA 5IF3A 5TQVA 2D2IA 5IDQA 3DFUA 3I9OA 5B37A 1SC6A 2WDZA 4BKQA 2EW2A 4WGGA 3LLSA 4IJUA 4QTZA 1GYQA 5K0ZA 1E5LA 1ONNA 1B0AA 5A03A 5L51A 3DBVO 1GYPA 4UREA 4DC0A 1DLJA 4PLVA 4CLRB 4QXMA 1SMKA 4EJMA 3ZWMA 1QLJA 4XDZA 4E12A 4GLLA 5GZ1A 2DM6A 1GZ6A 4JK3A 2W2LA 1PGQA 1YOVA 2BELA 2X7HA 1LQUA 3TL2A 3RBZA 3G3EA 3UW3A 3KYDA 2WYVA 3ZNPA 1B16A 3RC9A 3T7CA 3TZCA 4QT0A 2JHGA 4IIVA 1ENPA 1YQGA 4NFHA 3VAZA 4BMSA 2X9VA 2YV1A 1A4IA 3OEYA 1JVSA 4KWHA 1EFKA 5EPOA 3AI3A 4EBFA 3VC7A 2GCGA 4LRTB 2C29D 2J3KA 2QQ5A 2HK9A 5HS6A 5BNFA 1CRWG 2C07A 4CM1A 2QZ9A 2D5CA 4QEDA 3WGOA 1QYCA 4NDNE 3RWBA 1GAEO 3FNFA 4J90A 1MP0A 3GQVA 1DB3A 2C2XA 1U9JA 4XYEA 3B1FA 3U4DA 2Y1OA 2J3HA 5KWEA 4CMGA 1QYWA 2ZB7A 2Y1FA 5IDXA 2EXXA 4ND1A 3COSA 4FN4A 1JAXA 4WOKA 2HK8A 3JD2A 1AE1A 1BWSA 2AG8A 3AY7A 4I5FA 4B4VA 1A7AA 1E3WA 4BHTA 3KBOA 3WNVA 1D1SA 3ZW8A 3DAFA 1UZLA 5T67A 2G76A 4XWYA 3AOEA 4J4BA 3GN2A 1KC1A 4HY3A 4C7JA 3WYEA 4M86A 4BO0A 1ISIA 2X6TA 1GQQA 4ESOA 2PZLA 2YDYA 4E2XA 4YT8A 1ZK2A 2GRAA 4G65A 1M6HA 4KQXA 1K5HA 2PZKA 3H4VA 3V2HA 2VYNA 3AU9A 4CUKA 3IC5A 4YAGA 3R3JA 4UUMA 2PGDA 1YJ8A 5JY6A 3F9IA 4IJWA 4YJDA 5FI5A 4J2HA 5G4LA 3DZIA 1I24A 4MKZA 4Y67A 3X2FA 1UAYA 3V8BA 3ZU3A 3CXRA 4I5DA 4NQZA 1Y1PA 3GK3A 3NTRA 2JHFA 4ITUA 1A72A 1N92A 1WDMA 3HDHA 3Q1LA 3JQ8A 3MWEB 2A4KA 3A4VA 5EINA 2B4RO 3EVTA 3H9JA 1JW9B 3QVWA 5CG1A 2EERA 4R1NA 1UXIA 3QP9A 3QA9A 1HDOA 2EW8A 4WOJA 5JO0A 1B26A 3SVTA 3C7DB 5U4QA 4JJFA 4PZDA 3PWKA 1JN0A 3JD1A 1AN9A 3FN4A 4AJEA 1BDBA 4WNCA 5EESA 4TVBA 2FPIA 3BTUA 2JJYA 3QVXA 4PG8A 3QY9A 1EEHA 1WVGA 4R16A 5AOVA 4F6CA 1SEVA 3SLGA 3AJRA 4JJIA 1M66A 1P33A 2PD3A 1M75A 1ZXBA 3PWSA 3W6ZA 3C85A 1UXGA 3DWFA 3VH4A 2FMUA 4F3YA 4MOWA 4I9HA 2X9NA 4CODB 4NZ9A 1EMDA 4BNKA 1DRVA 3PHGA 3E8XA 3E9MA 4GWGA 4E5KA 4ID9A 5DT9A 4DUPA 4FR5A 4EITA 3LT1A 4EDFA 4WEQA 4LVUA 5T57A 3W8DA 2Y93A 1IL0A 3QWHA 3FBTA 1XDWA 3JD0A 1T26A 1ZJZA 4HXYA 4DQUA 2GZ3A 4J2OA 3Q3CA 3BMOA 1RKXA 1VKNA 1DOHA 4CQMD 5TGDA 3Q6IA 4J7CA 4NJMA 4KUGA 4R51A 3D5TA 3IQDB 2BF7A 4I1IA 5IN4A 1CQJA 4YACA 1MB4A 2FHSA 3C24A 1ISJA 3L9WA 1PJBA 1E7SA 1S6YA 3FTNA 4CL3A 4OH1A 4QO7A 2ZQZA 4BGUA 4N54A 2XAAA 3HNPA 3KLPX 2JCVA 2GGSA 1F8FA 2ZYDA 5L7TA 1PJ2A 1E7RA 1I2BA 4IS2A 1B15A 4XCVA 1R12A 3UF0A 2UVDA 3FF4A 3P2YA 2RBEA 5DN9A 1GD1O 1UZNA 1F17A 3WXBA 3D7LA 3RFVA 1NAIA 3OF2A 1LC0A 1PWXA 1XWFA 3C1TA 4FD3A 5A9SA 4KUHA 3GG2A 3IJRA 3QSGA 3WYCA 5BQFA 2DUWA 2O3TA 3INRA 3LC2O 3X2EA 3GDFA 4NU5A 5KJ6A 5L40A 4PZCA 1LUAA 5J23A 4TRMA 1ZK0A 2Y99A 3W4KA 3SEFA 3F4LA 1XGKA 3SLKA 2VYND 1T24A 1DLIA 2FR0A 1ZSYA 3NV9A 1IB6A 3JQGB 1K89A 3L6OO 4D45A 2VRCA 1Y9EA 4OQYA 3DO5A 5CFZA 4J91A 2XOXA 1MX3A 2VHYA 3FCOA 1PZEA 5CDUA 3RROA 3MJCA 2HMWA 1RM5A 2Q49A 2CF5A 3WTBA 1PJQA 2SCUA 3G1TA 1T2EA 5BSFA 4Z3KA 3HDQA 3H6KA 1P1FA 3DMTA 4LRSB 3H2ZA 3E6AA 1T4DA 3BTVA 3K30A 2IE0A 5B4TA 4IBOA 2GYYA 3PZBA 4ZRNA 1J4AA 2AA3A 3GEMA 3HN7A 4NFYA 1JKIA 3FTPA 1YXMA 3GGPA 5K9ZA 3DBLB 2I5PO 2YFHA 3WMXA 5BNTA 1DC5A 4IUYA 4OXNA 3I4FA 4B4OA 2IRWA 4M87A 3WGIA 3FI9A 3NGXA 3I9JA 1C3VA 5JCJD 1FDSA 1PGJA 4UEOA 1QYVA 1EDZA 3MJSA 1T2FA 2ZTMA 4XIYA 4YBZA 1IUKA 4LVCA 5KIAA 1CJCA 3TWOA 1E7MA 4FJ0A 2QIOA 1ENYA 4TRRA 4LW8A 2AQKA 2HUNA 3ZWYA 5DP1A 4HWKA 4IQGA 4IGFA 1GEGA 3BYZA 3O8QB 1X7HA 4CR8A 4ZD6A 4BNUA 1F14A 2DVMA 2ZTVA 2WSBA 3NJ8A 2O3UA 3JQBC 2J8ZA 8ADHA 1E7QA 2G82A 3RU9A 1ADCA 2B35A 2EIHA 2H6EA 3FWZA 4PLTA 2CY0A 2HQ1A 2PH5A 4UVHA 4L4SA 4GGPA 5CDGA 1O95A 3D4NA 2YFQA 4CQMA 1LDEA 1I3KA 4RF4A 4Y98A 2VYVA 5AYVA 1J5PA 2JKVA 3ON5A 3KSDO 1O9BA 2BFPA 3PHHA 3LDHA 3NJ4A 3Q9UA 5DCUA 2NU8A 4F46A 3S1LA 3WJ7A 2BKAA 4OYRA 1R4MA 3IUPA 3OFSA 1KEWA 1QKIA 3CH6A 3ZZNA 2VHVA 2C59A 5EJ2A 4MVJM 3LC1O 2EJWA 5U1PA 3S55A 4ROSA 4A5OA 5I7SA 1LLUA 4MJLA 3JQ9A 4KUEA 4OQZA 1XR3A 2DTDA 1H0KA 3M6IA 1GZ4A 2GNAA 3KV3O 3M2TA 4RJTA 5L95A 3G17A 2FPPA 3BA1A 4AJHA 1MUUA 5EQDA 3DOJA 4N7RA 4PGFA 4R5HA 2IZ1A 4YAJA 5CP8A 3S2IA 2DUUA 2PK3A 5JLAA 5DBIA 4I5EA 5BT9A 1A9ZA 1LU9A 4WLUA 1SB8A 3V1UA 4CMIA 4JJGA 4YYZA 5EIOA 3IUSA 3KETA 3DHEA 2B5VA 4ZQGA 2QRJA 4PLWA 4CV1A 4EI2A 4TKMA 2D4AA 1GL3A 2LDXA 3CIFA 4KWIA 4WLVA 1UXKA 4DBVO 4NBRA 4NBTA 4XX0A 1WZIA 3A1NA 2VN8A 3JSAA 4Y6SA 1WXDA 1NQAO 4E32A 3UKOA 3OIGA 3BMOB 1TLTA 4IZIA 4EEXA 3AM5A 4E2ZA 2QRKA 5AXAA 3P2OA 3HSKA 5ILOA 2I3GA 2OORA 3GY0A 4EGFA 3A28A 3NX4A 4PRKA 4A7PA 5ITVA 2CNBA 1ZSNA 3VPFA 4UUOA 3DMTC 1NP3A 1N1GA 1XIVA 3I9LA 2WE7A 3N58A 2POQX 4DQVA 4WLEA 5THQA 3TZHA 2QRLA 3T4EA 4XJTA 4RF3A 1R4NB 4R1UA 2O4UX 1HLDA 4KDFA 4YDRA 1U3WA 4Q3BA 2BI8A 1LRLA 4MVJE 4DLBA 1RYEA 1I33A 2I9PA 1E1LA 4S1VA 3QHAA 3ENNA 3ROKA 2DC1A 4CQLA 3CZMA 3KO8A 2O3JA 2W98A 1DIRA 3ZU5A 1Z82A 3PLRA 2YUTA 4FQ8A 2EG9A 5ENDA 4XYGA 4D43A 4IJKA 4P4NA 2OBNA 4FGSA 2P4HX 4RPGA 5I7VA 4MP6A 4CMEA 3W4JA 4TWRA 2YQ5A 1GUFA 5C3MA 1PJLA 1Z45A 3AFNA 4YTEA 1ADFA 1PX0A 3LZ6A 2VZ8A 1W0CA 4YAEA 1NQ5A 3TF5A 1HE3A 1VLLA 5C7LO 2O3QA 4WUVA 4AJLA 3WTCA 4DIFA 1PZFA 3QVSA 3UH1A 3DHYA 2VWPA 5COQA 4B7XA 2BFOA 1XKQA 3GGGA 1BVRA 3KYDB 4OOFA 3D4PA 4DWVA 1GV0A 2A9FA 4JBGA 3GAFA 1KVTA 4P4LA 4GKBA 1YQDA 1X1TA 2Z1NA 1ZEMA 1P9LA 3E9NA 1QG6A 4EJ0A 4ND2A 3KYCB 3OJFA 3ZHZA 5I9NA 1GEEA 1DXYA 3CPSA 2QHXA 4F6LA 5K6AA 2OO5A 1HZZA 2D59A 1UXJA 2YDXA 1FDWA 3GH3A 3JV7A 5ER6A 2CVQA 2O2SA 1P3DA 2PKQO 2NADA 3GUCA 2H63A 3BHJA 4W9NC 4BNLA 3BMQB 3HUDA 3L9XA 1JAYA 4WCFA 2ZK7A 4U6QA 3KB6A 4XZ3A 2HMSA 4NHEA 1E6UA 1E92A 4J1NA 4U6SA 2E82A 3K73O 1U7TA 3IMFA 4QSMA 4MVJG 4CUZA 1MXHA 3WYBA 3GA0A 1NR7A 4M8SA 4ND4A 1FJHA 1UDBA 3OQ6A 4W7HA 5LDGA 5A02A 4MKRA 3UN1A 1X1EA 1KVSA 1H2HA 3U09A 3VHRA 4BO1A 3LQFA 3GHHA 4BO6A 3AY3A 1CWUA 1VKOA 3DQPA 1KYQA 4NK4A 1I10A 1NVGA 4IM7A 3TJRA 5BSEA 1PQWA 2Y0DA 1PL6A 4RZIA 3ROMA 3LK7A 1CETA 4D0RA 2PWZA 1XYGA 3LU1A 4MVJA 3C1AA 3ZHXA 1SZJG 3GPDG 1DIBA 4CM8B 2EKQA 3CMMA 4GMFA 3KTDA 4II3A 4X54A 4R3NA 4UUNA 1YO6A 3F47A 3K9QO 3K5PA 3V2UA 5JE8A 4PG5A 4ZICA 5JW6A 4ZU3A 4O1MA 1AHHA 2ZATA 3ADOA 1HSOA 3DBLA 4HNHA 5CEFA 4KOAA 2CMDA 5T8KA 3OHSX 2VNAA 2VT3A 1HDXA 2CVZA 4OKIA 4AJ4A 3FR7A 1LA2A 3N7UA 4HFJA 4MO2A 4CLRA 4BNGA 2OHXA 3PTZA 3VTZA 2AMFA 1GV1A 3WSWA 2VUUA 1HYGA 2PV7A 1HKUA 4CMJA 4K26A 2HMTA 3UFXA 1XQ6A 2DBZA 2VWGA 3H5RA 4DVJA 3WLEA 4EEZA 3RUHA 4KP7A 4BMNA 4BNVA 2YV3A 2EF1A 2P9EA 1R0SA 4A10A 4W4TA 3H5NA 1C0IA 1KY4A 1V35A 4K6CA 4DREA 1B8VA 2F1KA 4GSLA 4EYEA 4MVJP 4PLGA 2DKNA 3OICA 4PFJA 4K6FA 3GHYA 5IZ4A 4FC6A 4EW6A 5TIIA 2W4QA 1W73A 2ZTUA 4FPXA 5TX7A 3QQPA 1UDAA 4CV2A 4YT4A 1M2WA 1A4UA 5KKAA 4OSOA 2QG4A 1ZW1A 2NNLD 3WICA 4NNJA 3RASA 2GPTA 3JYOA 3RUDA 4PLZA 3S8MA 5IDWA 4R1TA 3JQCA 3VKUA 2VHXA 2GR9A 4Q9NA 5G4KA 1JQBA 2RH8A 1BRMA 2B4QA 4BO7A 2XXBA 2IYOA 1GCOA 2ZQYA 3ROPA 1T1RA 1EQUA 3VOSA 1SNYA 1TT5A 4PVDA 5DULA 5TS3A 4TZTA 3EZLA 2X0JA 1M67A 5G0TA 4XR4A 2P4QA 1K6JA 3F4BA 2X4GA 3PYMA 3JCZA 3R1IA 2WYWA 5H83A 5A9RA 1UJMA 4OOEA 5JNLA 4JIGA 4CQLB 4P8RA 4NIMA 1IYZA 4ZRMA 4RO0A 1KVRA 3L6EA 3PIDA 1Q1NA 4NJMB 1V0JA 1ISGA 3I9NA 4WCFB 4Y9DA 2C7GA 3PHIA 1PIWA 2IDZA 3O03A 4TKLA 5MDHA 1IZ9A 1GADO 1HT0A 4DL9A 3WQSB 5KJEA 4K9DA 1P0CA 4MPDA 4NMHA 1K3TA 1V8BA 2TMDA 4IDFA 3ETEA 3JQAA 5ILGA 1LC3A 1Y6JA 1E6EA 3ZI0A 2HMUA 2PGLA 3ZHBA 3NTOA 3JQ6A 3QWFA 4R3WA 5T5QA 4BGVA 4DYVA 2VYVD 4DYDA 5A04A 1H5QA 4QQRA 3Q9NA 4OO3A 5BSHA 1QSGA 4E21A 4I9NA 3MOGA 3DBRB 4GX5A 3OEWA 4YR9A 1Q0HA 3NEPX 2CFCA 3M1LA 4BGEA 3C7AA 5L4NA 3BHMA 3EZYA 4CLEA 1I3NA 1XU9A 3L07A 2DT5A 4ZA2A 1LRJA 1UH5A 4W6ZA 1ML3A 2RH4A 2NVUB 4IDBA 4LN1A 2FP4A 2GO1A 3NRCA 1V3UA 1G0NA 1GTMA 3DMYA 2O3RA 4E3ZA 1XELA 4FGWA 3D4OA 1BXZA 3PRJA 4OHUA 3TQHA 4BS9A 3U5TA 5FYDA 4BNIA 4ZQEA 4DRYA 3LSYA 3JYQA 1P31A 5IDYA 4CL8A 4L0QA 4CM9A 3E82A 5IXYA 3OP4A 2VTDA 1OMOA 1HDRA 3ZCXA 3MTJA 3KSZO 4HFMA 5DF1A 2PGJA 2UAGA 2WEKA 4ALNA 5DNAA 5F5NA 4XGIA 2R2GA 5TC4A 1E6WA 1ORRA 3ULKA 3ZGYA 1FK8A 1QV7A 1VJ1A 3OIDA 3PJFA 2C2YA 3ZV3A 4YB8A 2ZCVA 1U2GA 3AOEC 4HFNA 5CDYA 4TRJA 5JDCA 3FD8A 3MTGA 5C7IO 1E3SA 4YT2A 3WR5A 2GN8A 3ZWVA 4CQMB 4HUJA 4XIJA 4BNJA 1E3IA 3SJ7A 2PA3A 4J6FA 4XR9A 1RJWA 2B0JA 1Q7BA 2AQIA 5JPIA 4C4OA 3QWIA 4XJSA 3PDJA 4WASA 2VHWA 4R9SA 3K6JA 1I5RA 2A92A 2YQ4A 3NDRA 1J0XO 3NYWA 3F1LA 4D3SA 3DOOA 2O3SA 2O7SA 2H9IA 3PWZA 2HJSA 1PTJA 2PZJA 4OXKA 2OGUA 3GRKA 2AEFA 1RYDA 4WECA 1DRUA 4W7IA 1TB4A 2W8ZA 2UUPA 4YCAA 1LTHR 3FNGA 4QO8A 2O48X 2Q99A 4XQGA 3NTQA 1A71A 4NG5A 4XQEA 4E6PA 4BNZA 3DAPA 5I8WA 2BMAA 3RJ9A 4U7WA 1UAGA 2FY8A 4B7UA 1DC6A 3U9LA 4LSMA 2W2LD 3HDYA 3SXPA 1RWBA 4BIIA 3PP8A 1TT5B 2Q2VA 2OOSA 5DBFA 4H7PA 5KVQA 4AICA 1XU7A 5F1KA 1YWGO 1B8PA 1OZAA 1UP7A 4IZHA 3WDSA 4JNKA 5BR7A 1H6BA 3BMCB 4XGNA 3UXYA 3ZWAA 4K1LA 3S2GA 1CQIA 1HDCA 2VWQA 1HSZA 3GFBA 1HDYA 1SBYA 2I76A 3K92A 4XQ9A 4XYLA 1T4BA 4RVFA 2C0CA 1MGOA 3HWRA 5CEEA 1UUFA 1VJ0A 2OUIA 2GERA 2PNFA 2C5AA 3DZHA 5IG2A 3ZW9A 4O0LA 7ADHA 3VDRA 2V65A 4IXTA 1KVUA 1U7HA 4FFMA 1NQTA 4Z9FA 4XRGA 5I9MA 1PL7A 2WMDA 5JDIA 5KVSA 3EK2A 1WP4A 1YL6A 3IDSA 2CD9A 1EE2A 2NUAA 3EAGA 4J16A 3TRIA 3RBVA 2P9GA 2ZKLA 3BTSA 4DIOA 1ONPA 3G79A 3P7MA 2DTXA 4CR7A 1ADGA 2JD0A 4PG4A 3WWYA 1YBMA 3GEGA 4TZKA 3EDMA 3GNQA 4ALMA 3M2PA 4L4XA 3OA0A 2FR1A 3MJVA 4PCVA 1GPJA 4KQWA 4IIUA 1B14A 3ANLA 2V6GA 5LC1A 1TEHA 3D0OA 1LSOA 1U8FO 3DAGA 3H5AA 3KXDA 4FOSA 2JL1A 4R5MA 3BMNB 4G2NA 3JQ7B 3UUWA 2HMVA 4XD2A 3RQSA 1YDWA 4QFCA 3OJOA 3I5MA 4PG6A 5TSDA 4DGSA 4J9VA 2Y66A 4NJOA 5I9LA 2PH3A 2H5LA 4CV0A 3ZWNA 1DRWA 5TRTA 2W2KA 2UUOA 1OAAA 1PZGA 1A27A 3RIHA 3INTA 4J3FA 2VNSA 3OBBA 1DHTA 4OJNA 1EVJA 2Y1EA 3OECA 3W4IA 3QW2A 2ILTA 2CDCA 2Y1GA 4H15A 2EP5A 2Y68A 3TN7A 1XHLA 3RKRA 1EZ4A 1GQ2A 5A1TA 5HBRA 1LJ8A 3CEAA 3HZZA 2NVBA 2DPHA 5JDCC 5JFOA 2HRZA 3EVNA 1Q7GA 2B83A 5T6BA 1PGOA 1DC3A 1KERA 3JQGA 3GGOA 1IULA 2NQTA 4FFNA 5A05A 4YJGB 4LISA 4E13A 3EW7A 3WFJA 2O2YA 3PQDA 4CMBA 1ADBA 3JQFA 4WPGA 2NTNA 4HV4A 2Z5LA 1ID1A 2IODA 3INGA 2YW9A 3FPLA 3D3WB 4CMKA 1R4NA 2CDAA 1G6KA 4H16A 4BNNA 1G1AA 2AE1A 2V7PA 3PJGA 3H65A 4LCJA 3BMQA 3Q11A 4YEDA 2LDBA 4UVGA 2E37A 1ZH8A 2E48A 3JQ7A 4N18A 3O38A 1YS4A 1JWAB 4NK5A 3WFIA 3RVDA 5U9CA 3PYLA 1IPEA 3HDJA 1X7DA 1XQ1A 3KYCA 3FPCA 3KEOA 4PLCA 2B36A 3FNHA 1I8TA 3V1TC 1O5IA 5DZSA 3F5QA 2QW8A 2Y05A 2P9CA 4WE3A 2OBYA 1DFIA 3LF1A 5DBGA 5EERA 1J49A 4ND3A 4AJ2A 4B4WA 4BKPA 1KIFA 5FFFA 3RI3A 2OXIA 2FZEA 3I6QA 5FF9A 1X13A 5H82A 2Z1MA 3EYWA 3U4IA 1PU2A 3ROQA 3K2EA 4RL6A 3TZ6A 1P0FA 2UV8A 3RCBA 1Z7BA 2G1UA 1VJTA 3UICA 4LMRA 1MA0A 4BVAA 1FDTA 2GF2A 2UDPA 1U8XX 3TZQA 4ALLA 1A7KA 2DU8A 3V2GA 2P68A 2X23A 3GMDA 4ZVVA 3OJ0A 3WX0A 4EUFA 4GVLA 3MJ4A 2R6JA 4GX2A 1HEUA 4QECA 4RPLA 3RFTA 1X15A 4ALIA 4D44A 1XCBA 4JXKA 3P5SA 3UCEA 4D79A 5DCWA 3RUEA 4P4GA 4GL4A 1DDOA 4DPLA 4Q3NA 3A9WA 1MG0A 3PJEA 3O9ZA 1MFPA 1P77A 1S7CA 3P19A 1QMGA 1KEPA 3C1OA 5A5EA 2DBRA 1ISHA 1R0LA 1E77A 1BW9B 4BV8A 4Q3CA 1SOVA 4FJ2A 4N5MA 1ZK3A 1DBVO 2QYTA 1MLDA 1GFSA 3DHNA 3WBFA 1BXGA 3OJEA 1DHRA 3IJPA 2WYUA 2OL4A 3WNQA 3AOGA 4B4UA 4D3DA 1GR0A 4PZEA 1U3UA 1R16A 1GY8A 3CE6A 2P91A 4J4HA 2NV6A 4GQAA 3RD5A 2NM0A 2WM3A 3U0BA 5IZCC 7MDHA 5EQFA 1JKFA 1K2WA 1PEDA 4LSWA 4YWJA 4G5HA 1H6CA 1ZMOA 3ZWXA 2EGHA 3WSVA 4CM5A 4L73A 4YAIA 3F6YA 4L4RA 4DXHA 4TVOA 2J5RA 3Q0EA 1ZSVA 4DPMA 3WJAA 4XYMA 3VZQA 4A0SA 3JYNA 5MGBA 1CERA 3BHIA 3WGHA 4D41A 1EVZA 5JC1A 4W99A 4CLXA 1EE9A 2IXAA 3PZRA 4IS3A 4RVUA 4RDHA 2VOEA 1BXKA 1HYEA 2DPGA 4CM8A 2JFFA 3PQEA 4BV9A 2C7VA 5JAIA 1M76A 3NDIA 2Q4EA 4J1TA 4R54A 3K2BA 3IKTA 4QFDA 4RLSA 1ULUA 1DPGA 4GVXA 1VSVA 3RFXA 5JMWA 2J3IA 1FXSA 2NACA 1CF2O 1R4MB 1HE5A 4YJGA 1P1RA 4BNXA 1C14A 3K8ZA 4MKXA 1QP8A 2B37A 4ND5A 3AUTA 4UEJA 1QV6A 1I30A 5AXDA 4FS3A 1NX6A 1JA9A 2JAHA 2F00A 1TT7A 1LLCA 2EGGA 1E1MA 2A94A 3GOHA 3GZNA 4GWKA 5JSFA 1AXEA 1GZ3A 1RM3A 4CM4A 1P74A 2GN6A 1YKFA 3AUAA 1VL0A 2BFAA 2HJRA 2W2KB 2XF8A 4JBIA 1KVQA 4IQ0A 2OP1A 3O26A 4ALJA 3Q2IA 2JD2A 1NHGA 3ZWWA 2VRCD 4D42A 2OZPA 2YHUA 5CG2A 3PLNA 2YV2A 3LYLA 3DTTA 3HQ4O 4YJFB 2PY6A 2TMGA 4DQXA 4RPKA 3D5QA 1MC5A 3HJAA 4J7UA 2Q1UA 1DJNA 4FC7A 1UR5A 3E9QA 1X0XA 4BQPA 5GY7A 1HETA 1LDNA 5TNXA 4ZJUA 3FRJA 2JFGA 3DZBA 4E5YA 1Q0LA 1T25A 2BHLA 1WDLA 1F0YA 2EP7A 4UVDA 4Z0HO 3GVHA 4JLWA 2ZB8A 2HO5A 3W8FA 3GVPA 4EJ6A 5JY1A 4HKTA 4A73A 4W82A 1QR6A 2Z95A 1WWKA 5EN4A 4BNTA 3ETDA 5IXSA 4UAGA 5THKA 4IDDA 4OL9A 5COBA 3ASVA 1N7GA 4L76A 1KS9A 1P45A 5LCXA 3RAJA 4CM9D 5JAZA 3BIOA 2QX7A 1WZEA 4YT5A 3SC6A 4Z6KA 4BB6A 1BG6A 3WWZA 4CMCA 4JROA 4RPHA 3SX2A 3H9UA 4Y8VA 5GZ3A 2DBVO 4OGWA 1NVTA 1NFFA 1XLTA 4E4YA 1QLHA 1A5ZA 4EZBA 4OM8A 1I36A 5AXBA 3K96A 3RUAA 3TOZA 1F06A 2O23A 3IP3A 4B3JA 1EBFA 1YGYA 3PVZA 5G0UA 2EV9A 4BNMA 1YQXA 2NU6A 4INAA 2DAPA 5CPFA 1LSJA 3KOUA 1E5QA 1RM4A 4MIYA 1N8KA 2WTBA 4QX6A 5I7FA 4KDEA 3UCFA 3EHEA 4WKGA 1YL5A 2NTJA 4Y6PA 2OP0A 5A9TA 3W6UA 8LDHA 4FFLA 3CKYA 3QWBA 3JQAD 3ZHYA 4BKOA 3UCXA 2IZZA 4KTVE 3E5RA 1ISFA 4PIVA 4CM3A 4CV3A 1HXHA 1QRRA 4FBGA 1LX6A 4IPTA 4BO2A 1P1HA 4Y6RA 4E5MA 3CINA 3A06A 1DEHA 1EQ2A 1NTOA 3PFFA 4NI5A 4II2A 4WCDA 1SAYA 2JAPA 3B6ZA 4GX0A 3KLMX 4AG3A 3KYBA 4XDYA 3ICPA 5BNIA 1LEHA 1PJSA 2RHRA 3GG9A 1NFQA 2NVWA 1XA0A 5L4SA 1LLQA 1N5DA 5JCXA 3RUCA 2I66A 4JBHA 2DFVA 1Q2XA 5ER9A 4B8ZA 5COAA 3DBHB 5EMHA 1C1DB 2B4TO 3DEYX 2VTEA 3L4SO 3RBXA 1EUZA 1VL6A 3KHUA 1NASA 2ZJ1A 3PDUA 1IHYA 3RC1A 1C1DA 2YZ7A 4CLDA 3QJ5A 3HB4X 2AQHA 3BXXA 4O6VA 4AJPA 1H93A 1BVUA 1DC4A 5C7OO 1Y9AA 1WMBA 2JCXA 3HADA 1M6WA 2P5UA 4M49A 4FB5A 1CYDA 1I0ZA 5B4VA 2NQ8A 4R69A 2PR2A 2EWMA 3BAZA 3GAZA 1H94A 1Z7EA 3TL3A 3CSDA 3FR8A 3MZ0A 4FOOA 2J5KA 5TJHA 4E2YA 1ZIDA 1BHSA 2JD1A 2XPCA 3GR6A 5L7YA 1P1IA 4C7KA 4GH5A 2NLOA 1J6UA 1Z75A 1GU7A 1SEPA 2P2SA 4BNWA 1FF9A 4IINA 1W8DA 3UHAA 1R37A 3OQ1A 4GX1A 1YB1A 1DFHA 4GSKA 2R00A 1DAPA 1P1JA 3FHLA 1JVBA 5IJZA 1QYXA 4RV9A 2NSDA 4ALKA 1NWCA 4IGEA 4CM6A 1V9LA 4PG7A 2PD6A 4E30A 3GMSA 4ONEA 4PLYA 3WGZA 1YJQA 3HB5X 3E48A 1Y8QB 1PQUA 4TQGA 3AU8A 3EC7A 4XA8A 4Z0TA 2NU9A 5G2OA 4E0BA 3JQ8B 4MVJH 1JKJA 1NFRA 3DBRA 4UVIA 4IQ8A 4NBVA 3DXFA 4YA6A 2H1SA 3AFMA 1Z74A 3LT4A 3TSCA 3PGXA 5G0SA 2HCTA 5T8KC 3GF4A 2O4CA 4TMFA 1PGNA 1IOLA 1Z73A 1LI4A 3RC2A 2C54A 3ZV5A 2C5EA 1E7YA 3TZKA 1WPQA 2FSSA 4A03A 4LK3A 2J3JA 3LVFO 3GRPA 4MDHA 4GKVA 3MEQA 4CM7A 1KBZA 1WMAA 2GZ2A 1I2CA 3H3JA 1F8GA 3KSUA 3JQBA 3RSHA 2BGLA 2J5QA 5KNLA 3WOHA 2Y0CA 4MP8A 1E1KA 1TI7A 3ADPA 3ZNQA 5ITWA 5FEUA 2I67A 3S2EA 3L0DA 2VUTA 2YHIB 2C20A 1K0UA 1QXSA 3N74A 5KJFA 2HSDA 3OSUA 1GYRA 4U5QA 4JN6B 5DP2A 1QORA 2PTGA 3GDOA 1NPDA 4LMPA 4YJFA 3ORFA 4IDAA 4IMPA 4M54A 5CAEA 5H81A 4TRNA 4ILKA 3GDGA 1LDMA 3GEDA 3GVCA 2Q1TA 4J0EA 4N5LA 1YBAA 2ZYAA 3IL2A 3PPIA 2X22A 2EKLA 4NFSA 5A3VA 3I9KA 3VTFA 3OJLA 2VZ0A 3OIFA 4BNFA 5A5FA 1TVEA 3D3WA 3ITDA 3MJEA 4O5OA 5A3JA 5TT1A 2I3AA 4NBWA 3MOIA 2NU7A 3H3FA 3GZNB 1NQOA 2IZ0A 1N9GA 2IEDA 1DIAA 2D8AA 1U3TA 2PLAA 4YRBA 1X7GA 4YAKA 2W90A 1XEAA 3OETA 1TA4A 4JCOA 3LT2A 3FBGA 4U0KA 4D7AA 5HA5A 1YOVB 3ZH2A 3VZPA 4KMSA 2GSDA 4FFOA 1PJCA 2YYYA 3BTOA 2RHCA 2PZMA 1LNQA 5TF4A 2X86A 2BH9A 3G0OA 3I83A 3Q2KA 3NT4A 2EJVA 3ONEA 4CLOB 1KETA 4RVGA 1U5AA 1ZKMA 5TJ9A 4ZN6A 2V6FA 2Y1CA 1LDBA 3RUFA 4UVEA 1ARZA 4AL4A 3B20A 1UP4A 1VM6A 5L3ZA 1GUYA 5LDHA 3F5SA 1Y8RB 1FDVA 1VRWA 4Q3EA 1U28A 5HRUA 5CDSA 5ADHA 4YXFA 3GN1A 3CUKA 1ONOA 3LLVA 3TDKA 4K28A 1SO8A 1O89A 4BL5A 1EUDA 2P5YA 2PKQP 4BKRA 1N1EA 3NGLA 1P1KA 3EY4A 1IHXA 3DDNA 3PQFA 3B70A 5JCJA 1R6DA 5IFLA 1YE3A 3T4XA 4WJZA 1W4ZA 1MXFA 2Q50A 2BFMA 1NXQA 4LCEA 4NPCA 2IXBA 2RCYA 4JQCA 4WEOA 2RIRA 1JWBB 3IIEA 4RF2A 3PHJA 2VWHA 3PYXA 5T64A 1V3VA 2HK7A 3PIIA 2Y0EA 4WLFA 1N7HA 1BXGB 4YRAA 1T1SA 4TSKA 1YDEA 4BGIA 1GUZA 1NNUA 1PR3A 5L7WA 1LRKA 3JYLA 3V5NA 1EFLA 2DLDA 3ZV4A 1GCUA 2AW5A 2ZCUA 4R41A 2VOJA 3CMCO 4NU6A 4DIBA 3G49A 5G4KB 1EK6A 1LQTA 4MVJD 4Q39A 2D3TA 5I8ZA 4R1SA 2Q2WA 2HLPA 3E5MA 1I3MA 1JU9A 3BMCA 1RPNA 1B3RA 2AHRA 4J9UE 3WS7A 1VL8A 2X0NA 1NM5A 2YJZA 2X58A 4OSPA 3C8MA 1OOEA 1YH3A 3QV1A 4FSHA 4BO9A 5ICSA 1HE2A 1OC4A 3MWDB 3ANMA 4XQCA 1LDYA 3PI7A 4RDIA 4H3VA 3IS3A 4J49A 1XSEA 1C0KA 3JTMA 3GFGA 2D1YA 4RVSA 5KOIA 1QYDA 3IKVA 3PFWO 3DL2A 2V6MA 2VCYA 4AJNA 3AY6A 3GVXA 3QVTA 1D7OA 2BI7A 1DIHA 3UAGA 4BOYA 1Y8QA 4HX5A 2AG5A 2PD4A 2RAFA 1YRLA 3VVCA 1I01A 1DFGA 1U4OA 1E3JA 4CLHA 3WMWA 1PS8A 4B8WA 1H9BA 4J1QA 4OKNA 4E5PA 1FDUA 3JQDA 3DZJA 1HDGO 1GQYA 2J6IA 4HADA 2VZ9A 3ZN2A 1O8CA 2Q45A 2ZB3A 3W1VA 3ZWBA 5I7EA 3QWAA 1O0SA 5CEJA 1LSSA 1B3BA 2X1HA 5A4DA 5K6AC 3WLFA 3DOCA 5HTOA 4AJOA 1ZJYA 3DZKA 3IOYA 1CIVA 2X5JO 5F21A 1H6AA 1NHWA 3S2FA 5C5IA 3L77A 3V1YA 3ZWPA 2QZZA 4HNGA 3H7AA 4A2CA 3ASUA 4B3IA 2Q46A 3E18A 3I3OA 4O63O 1WW8A 4J0FA 1PS9A 3WG9A 4L74A 3O4RA 5B1YA 3C7CB 1K6IA 4WK6A 5A06A 4RORA 1D3AA 2Y1DA 4PN3A 1ZVMA 5AXCA 4CPDA 5A9SB 5JDIC 2DFDA 3U49A 2GLXA 4D3FA 3W8EA 1ISMA 3HG7A 1H6DA 1WNTA 3DR3A 2A35A 3R3SA 4RPJA 2CSUA 4CMEC 3QVOA 5DCYA 5JXWA 1XG5A 4E5NA 2VT2A 1ZO8A 2JFHA 3R0IA 9LDBA 2GASA 3DBHA 4IY1A 4HP8A 2BD0A 3JQEA 1IE3A 2X0IA 5ENVA 4E31A 2BGKA 2HKIA 3QRWA 2XXJA 3UVEA 4JP3A 1VI2A 3O8QA 3WGYA 5F5LA 1V3TA 1ZXLA 3SJUA 1KOLA 4L75A 1KC3A 5G0WA 1UZMA 1NPYA 4RVHA 4CMIB 2Q1SA 1SCUA 3KZVA 3H2SA 3H9QA 3FSRA 3EUWA 1E3LA 3I4CA 4I9UA 2GZ1A 3QLJA 1KEVA 1VPDA 3VDQA 2IEBA 5KJCA 2OFPA 4URFA 3ICCA 3GVIA 4FIZA 5GZ6A 3NUGA 1N2SA 4EUEA 1IZ0A 3KVOA 4GGOA 1OBFO 4PLFA 6ADHA 2EKPA 4TROA 1WAMA 3R6DA 4MVJF 3PXXA 1X14A 2BLLA 5JS6A 3CZRA 3F46A 4MINA 1R15A 1BW9A 5ES3A 1DSSG 2PFGA 4MIOA 5F1OA 2O50A 4BO5A 4DC1A 1EBUA 4GI2A 4RCVA 1E7WA 1O6ZA 3ZNOA 2FWMX 1PZHA 2WWRA 3WGQA 5C37A 1ZNQO 1BGVA 1GPDG 4Q3AA 4CLOA 4N5NA 1LXCA 4XB1A 1NYTA 3LC7O 1UP6A 4RZHA 3RKUA 4D0SA 5JAQA 4CMAA 3DONA 5TT0A 4P38A 3F3SA 1HTBA 5JC8A 3EMKA 1T2AA 1KEUA 3G1UA 3SBOA 3ENKA 2CF6A 3TNLA 5JMPA 4CUJA 2YY7A 1AGNA 4XRRA 5ICMA 1LBEA 2WJPA 1UDCA 3E03A 3AM3A 3FWNA 1LDGA 2UYYA 4KZPA 2GUGA 2PKRA 3U62A 1FMCA 3GLQA 3OA2A 4U0JA 5G0VA 4R4JA 4JP2A 5HS4A 3DZFA 3VH3A 4M89A 1Z6ZA 4YJHB 2DTEA 1DJQA 3MCVA 4BNYA 3GT0A 3NKLA 3ETGA 3NT2A 4BKUA 1B2LA 3GUYA 2I99A 4NH4A 1MV8A 3JYPA 2Q2QA 4RLHA 1ZZEA 4I8XA 1P44A 2CUKA 5BSGA 4AFNA 2FN7A 3KEQA 5DOVA 1BMDA 1PR9A 2HDHA 4CMHA 3AM4A 2VUSA 3WQRA 4OXYA 2AEJA 4YRDA 3UOGA 4A26A 1Y81A 4RQUA 2E49A 2FOIA 1MG5A 3I9MA 2GN4A 4FFRA 2NWQA 5HM8A 2Q3EA 2D0IA 3I6IA 1R66A 1B7GO 4CR6A 3LF2A 3PHLA 3WIEA 4MIEA 2EEZA 4BO3A 1PWZA 4OAQA 4IDGA 1I2ZA 1YONA 2CDBA 4JX8A 5AVOA 1PS0A 4B7CA 4RGBA 3RJ5A 1DIGA 1Q7CA 3GZ4A 3KRTA 3NDJA 1IPFA 3B1KA 3RUIA 4CM4B 2CZCA 2FRDA 4JGBA 4DLLA 3NAQA 5CPBA 1PQPA 1EUCA 1B8UA 2EHDA 1YVEI 3AW9A 2ZTLA 1SB9A 1OC2A 4I08A 3E1KA 1L7DA 3GNTA 3UGKA 4E33A 2DBQA 1Y5RA 2BGMA 1T2CA 5AQ1A 3QIVA 4DMMA 3K31A 4U8GA 3DB2A 2HRBA 1NR1A 1N9GB 3D3EA 4YVFA 4CJXA 2ZIZA 3GC6A 4NR0A 2HU2A 2HAEA 3AI1A 3AUUA 4R9RA 4FCCA 3VPHA 5KVCA 3KUXA 4F45A 1ENOA 3B1JA 3OMLA 4XGKA 1E3EA 4B3HA 4D46A 4Z9YA 5KCZA 1OI7A 2GD1O 4I5GA 1Q0QA 3PGJA 4ZHSA 4EUHA 3ONDA 1ZK4A 4ZGWA 4B79A 3ITKA 5KVVA 1RM0A 1C0PA 1IY8A 2I65A 4J7XA 4ZQFA 1H9AA 4A27A 2FSVA 3ANNA 1LLDA 4Z3DA 4BMVA 4RVDA 1AUPA 4NBUA 2CVOA 3BZUA 3WGGA 1ZMTA 3AWDA 3A14A 4OIMA 2E6UX 1G0OA 1BSVA 4DBZA 1SOWA 2FR8A 3HFSA 1C1XA 3JD4A 4WLNA 2Q1WA 3TFQA 3FNEA 1U5CA 1PJTA 4J43A 1ZK1A 1C1XB 4DMLA
chains in the Genus database with same CATH superfamily
1O94A 2VF5X 4AO7A 5FUWA 2QYSA 4FW8A 3K0FA 1EK5A 4OUDB 4L0CA 1BN7A 2PWBA 2WIDA 1I4OA 4PSUA 1GKLA 3OZTA 2QSUA 3AB3A 4U2BA 2WSSD 3VH2A 1L7EA 4AIIA 2VXBA 3CT4A 4OXIA 3L6DA 1DL5A 1NSYA 1CQZA 1D9XA 1EK2A 3GFOA 4RE6A 4QJ5A 1AHIA 3WB9A 4AP9A 4BX2A 3K9FC 4DTIA 4X20B 2D0DA 3LBIA 3T7EA 5JRZA 2JNWA 5K6RA 4OD0A 1IOVA 1J97A 4KO3S 3E81A 3RU7A 1GTRA 3CO0S 4OBXA 1C7IA 1VHQA 2ON6A 4C2TA 4O59O 1X94A 3D1JA 3PNOA 2H1VA 2YNMD 3EW9A 2DF8A 4HH4A 1ULZA 1ZUD1 2E0IA 4INPA 2PBZA 3B7PA 3MIZA 3ZNNA 4QPPA 3E2MA 2GAAA 2GEBA 4LV5B 4Q24A 5DBEX 1RSZA 4ZQHA 3STYA 2CHFA 3WGJA 5TXGA 5DTIA 2FWNA 3MUEA 3P9IA 4M55A 4D3XA 3G68A 621PA 2QW1A 2Y2UA 1X8LA 3BK7A 1YJXA 1I32A 1USUA 2X77A 5H3CA 1GDHA 3I9FA 3NH6A 4FD2A 4FJ1A 4M9RA 2WHPA 3SBXA 1C81A 3ZWOA 3A4MA 3KR1A 4FZ5A 4GKAA 1Z28A 2XZLA 1Y7TA 5I47A 1W6UA 4GXTA 4PGMA 4U00A 1CUGA 2WD8A 3UWOA 1JE0A 1TL7C 1TCVA 3TLCA 2YVLA 5JAMA 1DUIA 1N8SA 1XMJA 1JB1A 3E0QA 3RYIA 3TTSA 2WHQA 1MFZA 4DKJA 1CUHA 2ZZMA 2QLMA 3PJDA 1A1SA 2V9ZA 2B9VA 3N8HA 2VHZA 4PPGA 2QPOA 4IDNA 4RABA 1HL3A 1K27A 4EGCB 2M6SA 4YRRA 3SEQA 3SJZA 4WNAB 2NZYA 2X0RA 3MJTA 3KTOA 1XKXA 3E5HA 4PPNA 4RY0A 3T1VA 3WYDA 1F51E 3PICA 1O9HA 2ZRKA 5F23A 5FWNA 3N7AA 1QX3A 3KQSA 3RF7A 3A26A 3HWWA 3W2HA 3QE3A 1SC9A 5HWSA 4XARA 2I7TA 2WE8A 4Z0PA 5TGTA 4UTPA 4DLAA 4L8VA 2B8TA 4BBZA 1RXWA 2LCIA 4FYMA 3KAQA 4I6JA 3RAPR 3HXPA 1HYHA 1ND6A 2GDZA 2FZWA 3KXKA 3N3AC 4OREX 3T9BA 1D4FA 1QO0D 2GZDA 3DC2A 1A9YA 4S0ZA 5C7YA 1E0DA 4ZGBA 3EEFA 3A1VA 3JQ9C 5L45A 3H4TA 5F1PA 4AJJA 5DOZA 5FO0A 3M4NA 3ZUGA 3OU2A 4D8TA 1PR1A 1VLHA 3PD1A 3UPDA 2VDMB 4FFWA 1Y3HA 5HNKA 3A1EA 2XCIA 2H7CA 4IHJA 3NMUF 2HDNB 3GUUA 4E4TA 4CKZA 3ZU4A 5CVUA 1T6ZA 2ZANA 1HWYA 1Q11A 1VE9A 5HILA 4CEJA 5JWHA 2WINI 1NNSA 1Q0RA 4B8YA 4QL3A 1CEEA 4JEUA 1EM8A 1V1MB 2M9MA 3L4BA 4LPKA 4PHFA 2HZBA 1PDVA 2VT7A 2ZG6A 1ENZA 3PEFA 5TVGA 3WV5A 4Z9XA 5CXUA 1VB5A 5JYEA 3N75A 1YB5A 2G80A 2JIMA 2OAP1 3NDPA 5KOJB 1YQEA 4MP3A 1I6MA 3UJBA 2H85A 3GA5A 5FI3A 4RHFA 1VE7A 1TCCA 2ORVA 2Y1LA 2QTFA 5ESDA 3ZU2A 1P8JA 4WA7A 3WLQA 4C0HA 4CDMA 2ZYGA 2VI5A 4DM4A 2A2ZA 1WG8A 1X7XA 3EIUA 4F0JA 5F98A 2ZI6A 2Q4BA 3FUUA 4ZV7A 2AFIA 2QAGB 2AEMA 2JGLA 4ZQBA 5M7EA 1QVRA 2GS9A 4HNRA 3WQQA 1DAFA 1TW2A 4UUPA 4F4HA 5FTWA 6LDHA 1OLSA 2CVHA 2HLHA 4P08A 4TKUA 4J1SA 3AB8A 3HEMA 1BTOA 4ESEA 5K7SA 1HG0A 5DGCA 1U2DA 3T7SA 1JMKC 4TKVB 4XEHA 3QG5A 5A3QA 3CC8A 1MIOA 1V6AA 3I1IA 3LY5A 3MN1A 4UULA 4UZEA 5JNSA 2D5AA 4JLBA 3CX3A 3TLXA 3JAKB 4LGVA 1JQJC 4EA7A 3G2PA 5JS2A 1PE0A 1R0KA 3L7AA 3O4VA 1I7NA 2OM2A 2Y1WA 4PW0A 2G5TA 3LHFA 3EGEA 4PE5B 5KO2A 1M8KA 1XTVA 1Z07A 4PLHA 1BQ4A 3IH5A 3BDIA 3CG0A 5CM9C 2XE8A 3L4BC 3WHLA 4DIMA 3V4FA 4DJTA 5LA6B 4R2XA 1C9YA 3JQFC 2IYXA 4MMYB 2P4UA 4GM1A 1OWPA 4IXWA 4JC4A 4LRQA 2YVAA 4LBZA 3IVCA 1UJ2A 3KJHA 3RG8A 4EG3A 4GQBA 1JHRA 1YMVA 4RFVA 2DPXA 2JJ2A 4DA9A 1P4SA 3GMIA 2FUKA 2D2IA 4J8PA 5IDQA 2V74B 3DFUA 3QW4B 5B37A 1KY3A 2WDZA 4BCDA 2EW2A 4DR5B 4Q6BA 3L0ZA 1TLFA 3MWEA 8AT1A 2OCGA 1ZOIA 3T1HB 1WSDA 4QTZA 2BGUA 1GYQA 3EJ6A 5DHFA 1T3SA 1ONNA 3EIFA 5DTJA 1JMVA 3NW9A 1V4BA 4JT2A 1DLJA 3Q2OA 2A0XA 4PLVA 3VVLA 4WESB 2F64A 2VPTA 4Q34A 3CB2A 4CLRB 3T34A 4C4YA 4O2AA 3RYHA 2I34A 3FMPB 4V0LA 4JK3A 2W2LA 1LK5A 1XLTC 1OA1A 3NBKA 2ATCA 1G8FA 4KN9S 4FK8A 3TL2A 1BRTA 5AO9A 2CEAA 3G3EA 3X1YA 5BN3A 3RC9A 4ESHA 5G1NA 2JHGA 4BMSA 1ORVA 4DA7A 2X9VA 1KPIA 2YV1A 1AKUA 2JKZA 4IILA 3OEYA 1B6RA 1JVSA 3IAM6 1EFKA 3PE6A 1V9SA 4WA8A 2Q07A 3AI3A 4JHXA 2GCGA 4WI1A 4EBFA 5G3YA 2QQ5A 1KK1A 2QMEA 1TTPB 2HK9A 2QRMA 4U02A 2QZ9A 3HNRA 2I29A 3LZDA 4F91B 1IPHA 3JZFA 4X0EA 1CE8B 5CTJA 4LF7B 3N07A 1GAEO 3REQB 5JCZA 1M2NA 2DFNA 3T7DA 2RMKA 3SIPA 2GBPA 2J41A 4P84A 3SIXA 1FDOA 2FW6A 3C87A 3CLUD 1HT3A 2X8JA 3FIUA 2C2XA 1MAHA 3B6MA 4PNPA 4XYEA 3L6UA 5GONF 1YCDA 5B53A 2PEYA 2A7XA 2PX6A 2J3HA 2Y1OA 5L3QB 4M0DA 5LXTA 1C7QA 2C61A 2Y1FA 4ZRDA 4F7WA 5IDXA 5H68A 4HLNA 4Z4EA 4S35A 3T8YA 1BQEA 3COSA 4FN4A 4X90A 5BMVF 1MA3A 5ALOA 3D6TB 2AG8A 2VK2A 4I5FA 3QIAA 1GTG1 2QIPA 3KEMA 3ZGXA 3CKLA 2OBFA 4UQLA 4Y30A 1YGPA 1D1SA 2AFRA 2ZBQA 3WJ1A 1WB4A 1EFUA 3HCBA 4JX9A 2PS3A 3EE6A 1DPFA 3ZDDA 3K0EA 1P81A 4Q4DA 1VIDA 1GCAA 1U31A 5BSWA 3GZJA 2XT0A 4KRYA 4FMCB 4CKBB 1R6TA 3BGOS 5C8YF 3HSYA 3VNQA 3AR3A 4RCZA 3OE7D 5B3AA 2WF7A 5TPZA 5SY9A 4MO9A 2XCQA 5IAGA 3SZLA 5KNBD 1IRXA 2X6TA 4ESOA 1P5HA 1QG4A 3DDOA 4JELA 1WXIA 1T5BA 1ZK2A 4H3KB 5H4GA 4Q93A 3L5OA 4KQXA 1TEZA 4FP9A 4BLWA 3V2HA 1V1RB 3EH2A 5FWDA 1RJGA 1U98A 2ZJYA 4E3WA 3AU9A 5CH5A 2IHKA 3D4BA 1Y4UA 3OLWA 4X20A 2GD0A 3W34A 2JLCA 3W5UA 4F9GA 4YAGA 2PGDA 1RKBA 4F93B 1BAPA 4ETIA 2F55A 4YJDA 1E96A 5FI5A 5G4LA 1JIIA 2HIAA 3X2FA 1NX9A 1IZZA 4K9KA 3ZU3A 4NZPA 5KTYA 1WZUA 1FLNA 5CBPA 1Y1PA 2XMZA 3GK3A 5DXFA 3TLGB 5IT4A 1N92A 3WL5A 5HIMA 4WBXC 1H2RS 1WVIA 1GKYA 1P5JA 4ZEXA 2B4RO 1Q22A 1EGVB 3C3KA 1SQ6A 4ZU1X 3TPZA 2VP5A 3EVTA 5E95A 2ZVQX 5AVZA 5JNRA 1G64A 2EX0A 2IEYA 5DT2A 5EZYB 1L8OA 4JWTA 3LUPA 1FS4A 1CJVC 1W0KA 5FPSA 3QP9A 1IVSA 4WOJA 3TKYA 3SM3A 4FDTA 3N8GA 2AMLA 2D8MA 3C7DB 4KXFB 1IDN1 4YP1A 1AS2A 4YFVA 3ZKAA 3EG9A 4PZDA 4RZXA 4NG4A 5JATA 3JD1A 1AN9A 2AJCA 2MYTA 3W9UA 4A16A 5EESA 2SKDA 4A92A 2FPIA 3BTUA 4OJYA 3FPEA 3ZE0B 3VYVA 4BTLA 1EEHA 1WVGA 5AOVA 1PNVA 3U6KA 3HK2A 2R6ZA 3KU1A 3AJRA 4JJIA 2Q4DA 1M66A 4OY3A 4D9EA 1M75A 1USWA 3FGPA 2Q5EA 3NATA 3C85A 3PE4A 2OB2A 4N03A 3TTXA 2FMUA 1U7DA 3C3PA 1NJ8A 3KXIA 4I5IA 3VH4A 1DJMA 4CODB 3QEAZ 3EPHA 4MAAA 1M34E 2QE7D 3WHKA 1R5OA 3PDCA 1WW2A 3IIIA 3E9MA 3STUA 3I53A 4ID9A 4BE4A 4DA4A 1JG4A 1UT5A 2X1MA 1CZLA 2YOHA 2NYRA 5ANRB 4EITA 1GDTA 1KQ3A 1UJ5A 3L8FA 2MSEB 4WEQA 3LT5A 1P5RA 4KPYA 1C9NA 2I6QA 5HEKA 3WO1A 3LPNA 3KT6A 2DX7A 5ALHA 4AM8A 2YR0A 4DC9A 1KJ9A 4NMMA 2DOKA 4O29A 2WHRA 1ZJZA 1JS1X 2HREA 3O7WA 1FUKA 2HN9A 3WOVA 4ZZ1A 3R8CA 4DG5A 4JP1A 3OO1A 1TQ2A 3CUUA 3DKVA 3Q3CA 1FFYA 4KCGA 2AW3A 1RKXA 3BIXA 4HDKB 1VKNA 4OF4A 1KAHA 1DOHA 3L0OA 4RIEA 3E7WA 2JAUA 4HQFA 4CQMD 3Q6IA 3R5TA 4R51A 4C4ZA 2VJMA 2NUTA 3QI7A 4LQ4A 2O7RA 4XD7A 1SJ9A 3IQDB 4QGAA 2BF7A 3E3NA 4I1IA 1QVWA 1CQJA 3U6BA 4AROA 1O96A 4YACA 1ISJA 1ZIXA 3E4DA 1E7SA 5ERYA 4C4SA 5C18A 5BQ5A 3MRTA 2PUEA 1V11B 2I03A 5A5GA 4AZ3A 1PJAA 3ZR4B 4I1YA 3RYCA 2ZYDA 2XQJA 3OSZA 4OQEA 1I2BA 2IY8A 5CVJA 4KVAA 4PO9A 3DYBA 5DFAA 1R12A 2UVDA 1MKYA 2ETVA 2HF8A 3FF4A 3M5CA 4NENB 2PMCA 2HTEA 5AHOA 4X63A 5D1HA 3V7NA 3P2YA 3F7OA 2CXNA 4DQDA 3B1ZA 4D0LB 1QU3A 3MQFA 1BH6A 1F17A 3D7LA 3UTCA 4Z1MA 3UENA 1LC0A 2JGNA 4EENA 2FMFA 3PFCA 4KUHA 5A9SA 3IJRA 1IJEA 4RTMA 4OJKA 5BQFA 4UQPA 4TWZA 5L40A 1JU3A 1LUAA 1ZC4A 4PZCA 4NABA 4QDXA 1BCSB 2N46A 1ZK0A 4TRMA 4TRNA 2HNAA 2W6JD 1JWLA 2EKBA 1DQYA 2F90A 4DHEA 2VLIA 1DLIA 2FR0A 4KQJA 4GGMX 1ZM4A 3GRZA 4HDMB 1NSTA 1JBEA 1UJ4A 3D8UA 5CH3A 5CAEB 3UK7A 3B1XA 3FGOA 5KU7A 4MKHA 1FTQA 4ARAA 4H1TA 5AK4A 5LMCA 4HC4A 3L6OO 1WUIS 5BN4B 3UUEA 1DKNA 1EXNA 2XF2A 4J91A 1E9AA 3PTAA 2VHYA 3K0AB 4B17A 3W5CA 3P52A 3RROA 5FPKA 2HMYB 1YU6A 2ZRBA 2OKGA 1RM5A 4OJMX 3LCRA 3LUJA 4WADA 3I12A 1QMPA 1IK4A 2FXIA 5ALVA 4YCNA 1L5YA 2P75A 2SCUA 1JHYA 1T2EA 2X6QA 2DGDA 4XAQA 3B7GA 4LJ8A 3VKFA 3H6KA 1P1FA 4EG1A 2Q9CA 2NAPA 1T4DA 4Y2PA 5DK4A 3KKEA 3IP6A 4DIDA 1T4GA 4UM5A 1NVAA 4LMBA 2ODWA 3U1VA 1N2GA 2AFHB 1RBQA 1VDZA 2DRIA 2GYYA 4WDQA 4KU4A 3GEMA 3DLCA 1NXOA 2C7QA 4JUIA 4NFYA 4LYDA 1IEQA 2PPVA 1AQJA 4PBTA 1AGYA 1QGYA 2EZ9A 3MTEA 2I5PO 4KKXB 3WMXA 2CXSA 2F3TA 5BNTA 3HXLA 3ZIAA 3TTTA 2GPSA 4HI0E 5MFPA 2W6JA 4U9HS 4XWTA 1Q20A 3I4FA 3CZPA 1CIJA 4EKEA 5BSUA 3CURA 5FNVA 4FE4A 4B4OA 5J1SB 4KODA 5C46F 2IRWA 1FQKA 3H83A 1W30A 3R9KA 3ZHCA 4NYIR 5KSOA 3NGXA 4YJ3B 1PF7E 5ABPA 5K0JA 2F8SA 3IMCA 4ZOLB 5JCJD 1PGJA 3H1GA 4UU7A 5DSXA 1QYVA 2V0CA 4AN1A 2QTCA 3V00A 4XIYA 5CJJA 5CB4A 4PFKA 1IUKA 2VSNA 2VDRB 3R3UA 2G4LA 2YWXA 4GWLA 1QHIA 1SVUA 4H1HA 2AQKA 4LECA 4IVPA 3WLLA 3ZWYA 1MJGM 2O7NA 3CPEA 2OCIA 4C05A 4V1CA 4IQGA 3D81A 4MS3A 3O8QB 1DBWA 1X7HA 5LU9A 4YMSA 5DM1A 2BIFA 1JIQA 2ZSFA 1YVPA 4NV0A 2VPPA 1ZISA 2WSBA 2O3UA 3BDAA 4Q05A 8ADHA 3P20A 1VA5A 2EIHA 2H6EA 4O1HA 3FWZA 2VJNA 1N6OA 4PLTA 2HQ1A 1ZD9A 3U7HB 1UKCA 1Y7PA 3KSMA 4JP8A 1A2OA 2DPYA 2IYZA 4GGPA 4EM6A 1G20A 2XVYA 4UCWA 3IUBA 2ERXA 2O2EA 2FWIA 2GYVA 3WAKA 4CQMA 4JI4B 4UATA 4NAUA 4EOGA 1JHAA 3ON5A 1T5LA 3LKBA 2ADMA 1INLA 2C3YA 1SU7A 4WK2B 4OHXA 4Y2QA 1I9GA 2NU8A 1MJFA 2K2WA 3LYAA 3WJ7A 1G4AE 4KBGA 3UIEA 1NULA 5KNBA 5KTNA 1KEWA 1QKIA 3CH6A 2GX6A 1GKUB 2V98A 2C59A 4M98A 4MVJM 4UNRA 2MCFA 3EDYA 1Q19A 4JC0A 4PYLA 3OUUA 3PEUA 2MIIA 3Q72A 3ZZTA 1S9DA 4XVCA 5FUBA 1XR3A 2PE5A 2DTDA 4TWIA 1G9SA 4EFLA 3RV3A 4WN9A 4FONA 1U0HC 4LXQA 1JSLA 3D8NA 2R8XA 3EVBA 1GT91 3M89A 3D54D 4WACA 4Y6QA 5F35A 4AJHA 3KPYA 1GPAA 4NCXA 3ABQB 1GA6A 4B44A 2QTVB 3HO8A 3BK2A 3DOJA 4KH0A 4PCUA 4YREA 4F9FA 4Q1BA 5DMHA 1G20E 1HG1A 3PUWA 4YP5A 4C22A 3AESA 4HLCA 1CZNA 1WB6A 2PK3A 5ECGC 1K7CA 5DBIA 1B6GA 1LU9A 4OHBA 3PPVA 5DBHX 4A91A 4DG9A 1FSFA 1X1SA 1TM3E 4N7MA 2JBAB 3I2FA 2AK2A 2HQRA 4QICA 1N0WA 4HZGA 1LWOA 2ABWA 3R4CA 4I6GA 4ZQGA 3V1LA 1PKEA 3AF0A 1SC1A 2ZBFA 2V0NA 4I0WB 4N48A 2D4AA 4KWIA 4X95A 2WTAA 1NUPA 1TVMA 4KR6A 3A9CA 2XUIA 4LJSA 3P2KA 1CIPA 5AW9A 3UXEA 1TLTA 3FDIA 2QVYX 3JWPA 4W9RA 3UAYA 3AM5A 2HHLA 2ISQA 2VP4A 2QRKA 3P2OA 3WXMA 4NP6A 1J70A 2I3GA 4MUYA 1GG9A 1JR4A 4GMHA 1UOQA 4IGKA 5AI6A 5FADA 2TS1A 3V97A 4EGFA 1E32A 1ZSNA 3K3PA 4NCIA 1X3LA 5ESXA 4LRYA 1VKJA 3EF0A 1RACA 2FPPB 5TMPA 3OX2A 3R3HA 2RG7A 1N1MA 4B83A 2WDPA 1GRRA 3ZDQA 1Y5LA 2UYHA 4LYAA 4L2IA 4WLEA 3TSZA 2VF7A 4JOQA 5BO5A 3U5ZB 4HG2A 3T4EA 4XJTA 3W5DA 1VKRA 1EDBA 1V16A 2O4UX 3KR2A 1EESA 2WV9A 1H0SA 1H2EA 2ZYRA 1U3WA 2FZKA 2H5EA 3ND9A 4KRXA 1YE5A 1RYEA 2CB0A 1E1LA 4N82A 4S1VA 3QHAA 5BWNA 5IULC 4LF5B 2I1WA 3IT0A 1TKBA 5T4EA 5C8VA 3DS8A 3WIVA 5KYVA 4PS1A 3OOSA 3ADBA 2YUTA 2B6HA 1LTQA 3MPOA 2WF8A 1TYZA 3URKA 5AKXA 3RJTA 4FGSA 2X8JB 4BCCA 2O0KA 6Q21A 1M8JA 1HQDA 4TT3D 5B64A 3FTDA 4LC1A 4OV6B 1FFBA 5I45A 4H08A 2PS1A 3LIIA 4AY6A 1CUEA 2JJ1D 3T5DA 1COWD 1PJLA 1F2DA 2G36A 4ETNA 3ETJA 1W5BA 3Q3IA 4HRVA 1G16A 1C8LA 5KI6A 4YAEA 2ONYA 1EDDA 3UJ9A 3VOBA 5JROA 2BLNA 1YSCA 3VOAA 1HE3A 3N2KA 5A6VA 1LCIA 4OJTA 6NULA 1GPNA 3DV2A 5C5EA 3IAXA 1QO0A 3TOSA 4AJLA 2IXFA 4DIFA 1PW7A 2VWPA 4X8MA 2BFOA 2QX4A 4YCJA 5KEIA 3KYDB 4OOFA 3RABA 4DWWA 1GV0A 4CKWB 1IOZA 3M7IA 3IHKA 5IKMA 3LDFA 3VKHA 1UPFA 1KVTA 1U6KA 4P4LA 2WZQA 4G9GA 1KKLA 4GKBA 4FYYA 1SKYB 5JH7A 4QM6A 2D2VA 4O4JF 4BNDA 4I50A 4EJ0A 1U2DC 2X14A 3SR4A 2YXNA 3EZGA 3CPSA 3GX1A 5BV1A 5K6AA 5F3WB 1KAGA 3AXSA 1E6LA 1HZZA 2FPSA 4LRXA 4QRDA 1Y7LA 2XBLA 5A2GA 2ZDQA 3PQ5A 5ER6A 2JFQA 2PKQO 3HDTA 2PMDA 1TC2A 1IHOA 4D80A 3ZLJA 4W9NC 5E4TA 2HCRA 3ZX4A 2ZYUX 4BNLA 1UBTS 3OKCA 4ZYUA 2FMIA 2BGGA 4XZ3A 1IVYA 4B2YA 1BHQ1 2HMSA 2J30A 5B3JC 4NHEA 3R7WA 4U2DA 5JCOC 2KJQA 4CTNA 1FQWA 2HB6A 3PXAA 4Q9IA 1JGTA 2JLVA 1EDEA 1UEXC 1G20B 2FMTA 4G8DA 1KFBB 2E82A 4WZAE 4QSMA 3IMFA 4MVWA 3CV3A 4O4JB 5G1OA 4CUZA 4FYHA 1EX6A 3WYBA 3IV7A 2O2HA 4Y0AA 3KD2A 4J0JA 4KJXA 3VBCA 4YQFA 5JTTA 4CTJA 2YC4C 1ZESA 2WMYA 3E84A 2O6HA 4EG6A 5LIRA 1CUXA 4Y9UA 1Z5NA 3U09A 3QYJA 3LQFA 4JR0A 1KO8A 1NYRA 3HBAA 4G67A 1IWOA 3MWFA 5CXXA 4BO6A 2IY7A 1BVHA 1G2PA 4B4DA 2COKA 2QUIA 3ZGZA 2FVXA 3LHDA 4NK4A 1I10A 2C8JA 4IM7A 4DUGA 3PFKA 4L8FA 2R1VB 4FEGA 3ROMA 2MSDB 3P0JA 2R79A 3LK7A 4UBNA 3TYXA 5BT8A 4BU0A 1N0HA 4FT4A 1XKLA 2BUCA 4M8NE 3SVLA 1T3TA 1BJRE 2P8SA 2WSSA 3EULA 1UINA 2H1FA 1M1ZA 2YJTD 3QUBA 4S1WA 4DDTA 4ZMBA 5CVTA 5I4IA 4IV0A 3KU4A 1W581 3FUVA 5K4GA 3F47A 3TXAA 3V2UA 5LOVA 3A05A 1ZWKA 2QU7A 1FP4B 2IHJA 4UTZA 3JY6A 3NORA 4IKEA 1ZCAA 2A84A 4ZU3A 5FWYA 2NTYC 3FKSA 1C3EA 1N5RA 4KOAA 1X39A 1M2HA 1WM1A 4XXHA 3OHSX 2ZSEA 2NXCA 3GP3A 1KOJA 5HF9A 3TW6A 3N7UA 2ZSAA 4Z7NB 3N5CA 4G84A 1EJ0A 2IIQA 1E9FA 3MTBA 4G37A 5HCIA 1S2NA 1T4CB 2OHXA 3PTZA 3VTZA 4OHYA 2AMFA 1NR5A 5DNDA 2CLHB 1N77A 1GV1A 1QZZA 2VUUA 4E2FA 4A0HA 1T4CA 4CMJA 2PJRA 4HDKA 4QUDA 3R7NA 1P1CA 1P80A 1WX1A 2DBZA 2I8LA 2VWGA 3H5RA 4QWMA 4RAOA 4B48A 4DUGD 5LQMA 4KWCA 5BW4A 1GG5A 1G7CA 4BMNA 1NUHA 1F9EA 2EF1A 2YKGA 4RL4A 3PGVA 1DOAA 1R0SA 1KY4A 1NDQA 2JIZA 4FFBA 3HKDB 3OICA 1NVUQ 2HOQA 3D2BA 4K6FA 3F9RA 1RKVA 1CHNA 2H5JA 4EW6A 3KAKA 2AR9A 2W4QA 4F97A 4ZKDA 4JXXA 4LYHA 2ZTUA 3GRRA 5TX7A 5E9AA 5BW6B 2WWVD 4WK0B 1M2WA 1IIBA 1YASA 1ES9A 1K5GA 3H5OA 3IP5A 2II6A 3IQWA 1KI2A 1UBLS 2WG1A 2HLDD 2DWCA 2PM8A 2JLRA 2RIPA 4MR7A 3RUDA 1P3Y1 3L8MA 5IDWA 2H4JA 3HL4A 4RX1A 3IVXA 3VKUA 3EUAA 1T1JA 4UTOA 3GDHA 4LHSA 5G4KA 4F3RA 2A4MA 1JQBA 3R40A 2RH8A 2DB3A 3PD7A 1NXVA 1QLWA 1U1CA 4MW7A 4WJKB 2ZBEA 4BO7A 2G1PA 1WZ2A 1U0TA 2QE6A 5KQMA 3HZHA 1T1RA 4AY2A 1EQUA 1N6IA 4XCQA 1H1LB 2J0UA 2QAIA 1TT5A 4OG2A 3WRYC 4CNQA 3F49S 3OT1A 1P7ZA 5A4JA 2JEYA 4ISCA 1V37A 1C7JA 2DSTA 4XR4A 2QRVB 1PR2A 1N0IA 4JOSA 5E1BA 2CXXA 2EL7A 3QPVA 1TU3A 3R1IA 1XZ8A 2L0XA 4X1KA 2WYWA 3FYUA 2JGFA 2RGNC 3PS9A 1QPZA 2BKLA 1CDZA 1JEOA 4OOEA 3TOCA 1G7SA 4AQYB 3FPFA 4J29A 1KVRA 1JIKA 2QROA 5JJ5A 4IRUB 4EVIA 4YMIA 2J9FA 4JR2A 3LVQE 1V0JA 3I9NA 1GR1A 2MTBA 1PIWA 3FTEA 2B9EA 3IT2A 4BYGA 1GADO 1HT0A 1FNSA 2WTEA 3KE8A 4MB2A 1OVMA 3N7TA 4N49A 5KJEA 2IHZA 3G6WA 3AIOA 5ALWA 1S1CA 3KUKA 4NMHA 1RMYA 1V8BA 3TXXA 2ZREA 3QE0A 1G8MA 1U1EA 3AERB 1ADYA 4IDFA 2HCFA 3IMKA 3P9YA 1T8PA 3ZI0A 4BATA 1EZZA 3MGBA 3NTOA 4HDNA 3JQ6A 4TT3A 4DSUA 5CRIA 3GRVA 4L95C 3BCHA 2VP0A 2RGCA 4B3XA 5AW8A 3VNBA 1T8SA 3RHZA 2DH5A 3B85A 3BFKA 2BFBA 4QQRA 4EHFA 4F3CA 3PR3A 3PEYA 3ZZUA 3ZQJA 2FDCA 2ZTSA 3NVKI 1JKJB 3DBRB 3GJSA 4JVNA 5IP5A 2A1UB 1E9DA 3OEWA 4NJEA 2NN3C 4UMVA 3HJBA 5SYAA 4OX9B 2CFCA 2VH5R 4RLFA 3BZWA 5FIUA 5L4NA 1FUUA 2VP9A 3AKCA 2UYCA 4FCVA 3S4YA 4CG2A 2IQ5A 1XU9A 1LRJA 3R7BA 4BCBA 2GXAA 4Z2YA 1B1CA 3GGSA 1OD6A 1QQTA 4MITA 4BX3A 1O4WA 2AUTA 1KR5A 3P96A 2NVUB 2ZYTX 1V3UA 2O9JA 2O3RA 3SF0A 4E3ZA 1XELA 4OHUA 3D4OA 3ZU6A 2FG6C 1S8AA 2W2NA 2P2DA 4Q0MA 4PTLA 5ECWA 3QFHA 4ZQEA 5ALNA 3HXTA 1JDBC 3SGLA 1L3IA 4EZEA 4DABA 3CLRD 4BRZA 4BVBA 1E2FA 1G9XA 2BSXA 4L0QA 4MDFA 5JLJA 1SU6A 4LCBA 2G5PA 1JJBA 1KFJB 4GF5A 1Z0IA 2RI6A 4CM9A 5IXYA 1OMOA 2D6FA 4ERNA 3ZCXA 2RGWA 1JH9A 4BFVA 1ACJA 2PGJA 5DF1A 4AURA 3REGA 1HH4A 5F5NA 5AI0A 1B41A 1JIVA 1KK2A 2QM3A 4G36A 4MWZA 4BPBA 4F84A 1KMQA 2I33A 3ULKA 4GECA 3PNBA 1VJ1A 1Q7RA 3ZKWA 3I9V1 2HEIA 3OIDA 1SUAA 3PJFA 1JG6A 5DTRA 2C2YA 1CCWA 3KSAC 4YB8A 2OAQ1 3GJRA 3FY4A 3MUNA 1S9HA 3A10A 2HGZA 4ZOLA 5C7IO 2AR0A 2MYUA 2FPGB 3E1SA 3WR5A 2JAOA 2GN8A 3ZWVA 4CQMB 1T34A 2YX1A 5IPFA 4HUJA 2G67A 1ABEA 3FJ1A 4WW0A 4Q9AA 3SJ7A 5F4BA 2WYOA 4CF7A 4Q01A 2AQIA 2ZJ7A 1IEVA 3O4GA 3ROGA 3WZMA 1V5FA 4UBJA 2AN1A 2P62A 1JR3A 4P33A 3TLJA 2IZ5A 4B47A 2VAVA 2IW3A 1UC5B 2VHWA 3JRXA 3NDRA 4R9SA 1Q15A 1J0XO 1I4WA 3U1BA 3EODA 2H9YA 4R1PA 1H4SA 3PWZA 1VBFA 2H9IA 2FW9A 2HJSA 2OGUA 2TMKA 2ZIUB 3OQNA 1RYDA 1DRUA 4B76A 1Q14A 2ZBDA 1YCFA 4HR7A 4QPCA 1LTHR 1OIVA 3D7SA 3N6XA 3THWB 2I91A 3OCWA 1T0BA 4XQEA 4E6PA 1CNEA 2QMUA 1X1CA 5BQPA 3A3YA 1ODTC 3AEUA 4U7WA 3QLUA 1XA3A 1G5HA 1XQ9A 2ZJ2A 5LLSA 4EABA 1E2JA 4YUWA 1XEFA 2YRFA 3EGXB 4H4EA 3U9LA 1VXOA 3LIPA 1IN4A 1NY6A 4MB0A 4A4DA 4JAVC 1TT5B 2LIVA 4DCJA 3DXXA 2XRMA 5KVQA 4UOEA 2Q62A 2G08A 1R18A 5F1KA 5CVDA 4JNKA 2Z8YA 1CX9B 2P2LA 3TE6A 3EFOA 5F4ZA 3UXYA 5LJLA 5CYGA 3ZWAA 3GWGA 4IEIA 4LY6A 4PU0A 1VYHA 2Y27A 4QTTB 2B1RA 2RGEA 2F8MA 1B1AA 4XX1A 3WGUA 2C04A 3PC2A 5ETJA 2QQFA 5JMTA 1NW7A 1HSZA 4MRNA 4FLMA 2WOOA 3MPUA 4GMKA 2ANBA 3NC0C 1KDZA 1YIAA 3K92A 2J45A 4L02A 4QYIB 4XQ9A 3WIBA 3ZTTA 3G9ZA 3JASB 3A4NA 2JA1A 5DM2A 1GQFA 2XITA 2PG3A 4EPRA 1UUFA 2Y9MB 3QX3A 1QU2A 1GGMA 1TCBA 2Q29A 3HSSA 2GERA 2PNFA 3CT6A 3DZHA 1V5GA 5EE0A 3LDAA 2G9ZA 4IYRA 4O0LA 2QTGA 3VDRA 5JQGA 2V65A 1DG1G 3P9XA 4XM2A 3UYLA 1N3YA 1MDBA 2P6RA 1RNLA 1YZKA 2YN2A 3N0VA 1Y5IA 2A9OA 2WUGA 3O8BA 5FUYA 4XRGA 2WMDA 4D9JA 1L4KA 2R751 2RHHA 3EK2A 1O7JA 4HPWA 3DMFA 4ND6A 4MYCA 3Q6NA 1UC4B 3T38A 4JXZA 2XKKA 4KXXA 2JAQA 4B46A 3A1WA 4HPJB 4LTMA 3ESDA 4H7IA 3VZDA 4DIOA 3QVJA 3G79A 3OLQA 4JKOA 2XZOA 5KSPA 1ADGA 1E0SA 4TWAA 2FR8C 1ONSA 3E22A 3N2NA 4KVFA 5I4KA 4HRYA 3EDMA 3IDFA 3LUHA 5KQSA 3IUMA 3MAGA 4L4XA 4UUBA 5HCNA 3J81k 3OA0A 1JI3A 3MJVA 4H4CA 1GTZA 3N6VA 1UZAA 2WAOA 3I32A 2ZBUA 4JA2A 5F5XA 1RRCA 3CN7A 1B14A 2RGGA 2Q4TA 1TEHA 1ZL0A 1LSOA 3D0OA 3PHCA 3H5AA 4FOSA 4CEHB 1K08A 2J6HA 3H84A 3T5AA 4R5MA 4UBKA 4ZXFA 4OYYA 4D9CA 4KR3A 1K8XB 3L6BA 1XDGA 3JQ7B 1CEYA 2H4ZA 4NCKA 3KPJA 3Q8KA 1J0DA 2WA1A 3B3AA 3JAKA 3OJOA 5EWJA 5TSDA 4DGSA 4D26A 1OT3A 2Y66A 4FN5A 4PFQA 3G8YA 1CULC 4CV0A 4RKWA 4LOKA 1A69A 3B3QA 3V9PA 1HGXA 1PVVA 1AGXA 2UUOA 4LRWA 4PF1A 4RYLA 2P6PA 2M6LA 3SS8A 4XWGA 4D4LA 1PZGA 2JW5A 3AR8A 3KQNA 4J3FA 1TK9A 3LPAA 3CH7A 2ILTA 2CDCA 5DISB 1T9AA 2EP5A 2Y68A 1XHLA 1EZ4A 3DXYA 5LB4A 4AWBA 5A1TA 3LWZA 2PBRA 5HBRA 4DMKA 3CEAA 4EFMA 3DWEX 1OI3A 2TYSB 3AMVA 4E07A 4EG8A 2E3JA 1QQ7A 1NT2A 5T6BA 4EB0A 1BYUA 4E13A 1TUGA 3R2JA 4LISA 4WQMA 1ZY2A 3EW7A 3WFJA 1ZLXA 1KA9H 4IIXA 3ESXA 3MB8A 2PT5A 2FWAA 1E0AA 1WXQA 3D7NA 3DD1A 4HV4A 1ID1A 1RMQA 1QB7A 2F7SA 1R5BA 3B3GA 4E5VA 4MQLA 1Y8CA 5BV2P 1R4NA 4FYVA 1M2FA 3OE7A 1AKMA 4H16A 4LWPA 3FCEA 3UV3A 1A5SB 3A25A 2AB0A 3T06B 3PJGA 2OSBA 5FL7D 1WKVA 4YI5A 1R1DA 5LNK1 2PKYX 3BMQA 3Q11A 4C6SA 2FRXA 4UVGA 4FOLA 2E48A 1ZH8A 3U48A 3U4AA 1LS1A 4DUZB 3MMZA 3O38A 4NEGA 2O8BA 4OLAA 3HY6A 3JQQA 1CJSA 4JBYA 2EFYA 2VSYA 1VPLA 2PRSA 4M38A 2GPYA 2D7CA 2ZYWX 5U9CA 1OZFA 2XE6A 1N5LA 4MQFA 2XXAB 4ZP1A 4QUHA 4L16A 3KOYA 1RHMA 4I50B 4H60A 4PLCA 4RD6A 4EY7A 4JLNA 4K9PA 3TVDA 5AD1A 1I8TA 4KPFC 3VNVA 2A5LA 4UU8A 2V97A 1W87A 3VJKA 1F8YA 1OH5A 2X2FA 4AUNA 2Y05A 2MU1A 4WE3A 1XZAA 4NBSA 4BKPA 2XCLA 3E15A 4NEQA 2VO1A 1KJZA 4MZDA 3VR2A 3H1TA 4MHSA 2ISCA 4XPIA 4TQUS 3M5PA 3GRYA 1X13A 2G72A 3PF9A 1DARA 5SYMA 2WZCA 3R75A 2BJHA 1YDGA 1X1QA 5E6RB 3ZY5A 1L7RA 4TVSA 5EJ7A 4Y18A 2UV8A 3RCBA 1TTQB 3O95A 3ONWA 1Z7BA 2G1UA 1VJTA 3SYRA 4LMRA 1I7DA 4G56A 4Z99A 3O74A 1EHYA 3NWBA 1CC1S 5WRFA 3PT5A 3AX6A 1ODFA 1QG0A 1RJFA 3H87A 3VDXA 3FDXA 3MJ4A 4MRMB 4D44A 4HDRB 2CHGA 4MYDA 4Q48A 1XCBA 4EEKA 2PA0A 2RI1A 4KQGA 4DDMA 2DR0A 4KSBA 1LFAA 1DKMA 1DDOA 2Z4RA 3N2IA 3GYBA 1Z4MA 4RY2A 4OTZA 4QUGA 4Q4AA 2VDKB 1RWQA 3BGDA 4RZSA 1S7CA 3I8OA 4M7OA 3EVGA 4ZCQA 3VPDA 1KEPA 4N41A 5BMVA 2XUDA 5JI3E 1U9IC 1GCGA 2PH1A 5A5EA 1PBTA 4IHJF 1AUQA 2DBRA 1RPTA 1Q5PA 2C3PA 2Z8XA 4KN5A 1X1AA 1XEXA 4QELA 2C9MA 4DLXA 2I2FA 3LLCA 4BV8A 1C3XA 1R00A 4Q7LA 1P7VA 1A8HA 1ZK3A 2J3LA 2VRWA 3KP1A 3CJTA 4YN3A 5BT9A 3STTA 2ZW9A 2N75A 4HTAA 3WWCA 2GXUA 5C5DA 3LBHA 2QV7A 2V5VA 2PSEA 3JWEA 4JJKA 1UBFA 4FX5A 5HDQA 5C8YA 4B4UA 3THSA 3IAAA 1AO0A 1R16A 5HF8A 2EGUA 5KTMA 4DDUA 3KJGA 1KEKA 4P7JA 1SURA 3CE6A 4J4HA 4Y7DA 1RT9A 1AKQA 2NV6A 1X38A 4PQGA 5LYJF 4D4GA 4BFLA 5KDOA 3OPYB 4NE9A 2PBLA 4MJ3A 3VX4A 4CF4A 2AK3A 3D43A 3EWAA 3LI2A 3DQZA 1H6CA 4N0MA 3BT7A 1WCIB 1YRBA 1KYZA 2NPFA 1E5DA 1SU8A 2EGHA 1RAFA 3PC4A 3RK0A 1KRHA 4L73A 3BSWA 1M6VA 1GQRA 1B0PA 2NTEA 4L4RA 2J3MA 1ZS9A 2D5BA 2YVKA 3CU5A 3RWOA 3UANA 4HQRA 3VU0A 4DPMA 3T7KA 4A0SA 3NDBB 2W48A 3IOBA 1XN1A 1QP7A 4YNBA 4ARBA 2FN8A 5GONA 1OASA 2WUEA 2FAXA 3BHIA 4BRUA 5HIAA 2ENUA 3LKZA 4JU9A 1OZ0A 3BE5A 3IVMA 4A9AA 4H9GA 2V4MA 4W99A 4CLXA 2G06A 4EG0A 5JSUA 3NHRA 1SXGA 1ZVJA 2VOEA 2VXOA 1KSGA 1HYEA 1ZUHA 3Q98A 2FSFA 1ZONA 2JFFA 1AS0A 2P69A 3RBAA 2D1QA 4CM8A 4BV9A 1Z4IA 3OQMA 1T0IA 3C6ZA 5FLXA 3NDIA 4FIDA 4CKBA 1U0GA 1CF4A 3JZDA 3VXKA 3K2BA 4FKZA 1L7MA 1ULUA 3OURA 1DPGA 1ECPA 3ELYA 4BZQA 5GTDA 4KR2A 1EFDN 5JMWA 3FPBA 3WL4A 5IAJA 5HK9A 2P1RA 1RD4A 4HZUB 4C0AC 4LC9A 2JHPA 3AFOA 3K8ZA 4AUEA 1TZ2A 3MC1