3A4VA

Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
311
structure length
311
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
total genus 122
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a4vA00
5TT0A 2NACA 2ZB4A 3OETA 1ZK3A 1CDOA 2JAPA 3RUHA 2HK8A 1GQQA 4ALMA 2HMWA 1D4FA 1T1RA 4GGPA 5JSFA 4LMRA 2X6TA 1WW8A 1C0KA 3BMOA 2BRUA 1WXDA 2DAPA 3GUYA 5KVVA 4AJ1A 3RWBA 2BI8A 5T8KA 3TL2A 3GRPA 5THQA 1R16A 4O63O 2P9CA 3PGJA 2J3KA 1HXHA 2AG8A 2R00A 3Q0EA 1IZ0A 1I3NA 1U3VA 1Z7BA 5FWNA 2W8ZA 5IFLA 5C7LO 1E3WB 4FD3A 3GOHA 5ENDA 2O23A 4OKNA 4MVJM 2QRLA 1SZJG 3WFJA 4IZIA 2NADA 4ND2A 2JFGA 2PTGA 2V7PA 2YZ7A 4OXKA 5BR7A 3VPFA 3B6ZA 4JX8A 2W2LA 1XIVA 2EHDA 4TRJA 3W8DA 1O9BA 1UP7A 5FI3A 3VH1A 2FPIA 3RASA 4J16A 1VSUA 3GLQA 2ZQYA 5JBIA 4W9NA 4PVCA 4IS2A 2PH3A 3AM5A 3JD1A 1P1RA 1YONA 4J1SA 4MVJF 4ZQEA 5KJ1A 5A05A 5AXAA 4WCFC 1B7GO 1LQTA 4C7JA 3RBXA 5KJCA 5DT9A 4HV4A 4KTVE 4GWGA 1E3WA 2H5LA 4B7CA 4O6VA 1XR3A 3L6EA 2X4GA 1QV6A 1UUFA 4EI2A 3AI1A 1JKJA 4YAKA 3BTOA 4BNZA 5DOZA 3ZNPA 2C82A 2ET6A 4TWRA 1PJ4A 3DZGA 4HP8A 3NAQA 1EVIA 1FK8A 1Y5RA 4PLZA 4A73A 5TS3A 3RFVA 1ZZEA 1G0NA 4R5MA 5DBFA 5IZCC 1UZMA 2HCTA 3Q6IA 3WGHA 4EJ6A 4J4HA 2B83A 3RCBA 1F14A 1HYEA 1JW9B 3CZMA 4GI2A 3A06A 1T4BA 3LT1A 4FJ0A 1DLIA 2UVDA 2NTJA 4Z9YA 1LSJA 1DPGA 1I32A 3PLRA 1QYWA 1Y6JA 3KYCB 3WFIA 4DC1A 1I8TA 1EDZA 1T2CA 4J0EA 2NQ8A 1M76A 4FIZA 3EVNA 1BGVA 1EVYA 1ZIDA 3JQ6A 4RDIA 4OXYA 4A10A 3EYWA 1I2ZA 4W7IA 3ZWAA 5I9LA 5IN4A 3PPIA 1JQBA 1MG5A 3UXYA 4N18A 3U4CA 2V6GA 2J3JA 3C7DB 4UUOA 2Y05A 2Q1TA 3ANLA 4XB1A 1R15A 2X9GA 3M1AA 1VC2A 1KIFA 4CM1A 4IBOA 1H9AA 3H8VA 4R68A 3E48A 5TT1A 1U28A 4QTZA 2R6JA 3KYCA 3NEPX 5A9SB 1LX6A 2Y93A 2C59A 5IAAA 1K6XA 4AJ2A 3MCVA 1ZMTA 4OQYA 4EDFA 1NR1A 2QRJA 3NX4A 3ASUA 3KB6A 1QLJA 1PZFA 4WOJA 3BMNA 1PSDA 2OUIA 1WVGA 5FEUA 3RC9A 2HU2A 2PKQP 4BO6A 1LRKA 1I3LA 1WMBA 2ZCUA 1IYZA 3LC2O 2OFPA 1AE1A 3PLNA 3IKTA 1EBUA 1VL0A 2IZ1A 3SJUA 3NT2A 5A9SA 2WD7B 5IXYA 2YDXA 4MIOA 3INGA 1EUDA 3WGOA 3IUSA 4ITUA 1ZNQO 2PK3A 3VTZA 3GVHA 5K6AA 5KWEA 2EF1A 3F1KA 3RI3A 4D3FA 1ENOA 1LSSA 1H6BA 2TMGA 4BB5A 3P19A 2Q46A 4M89A 1E3JA 1A7KA 3C3XA 4KMSA 3ANNA 4Q3EA 5EQFA 3PK0A 3AM3A 2B37A 2C2XA 3PEFA 1P33A 3LF1A 1KERA 1PR3A 2OZPA 1EUCA 1TA4A 1RWBA 3PQEA 4GGOA 1ULSA 4KUGA 3RBVA 4PZDA 3H5AA 1PJCA 3GT0A 2DVMA 3AU9A 1DOHA 1UAYA 1QG6A 3QWIA 1EQUA 2DBZA 1E6EA 1NWHA 2NNLD 1E1MA 4L4XA 4MVJE 4XYBA 4XYEA 5DP2A 5TGDA 1E1NA 1ZKMA 2YYYA 5B37A 2ZTVA 3W8FA 4MOWA 1OBFO 5B4VA 2CSUA 3ZU5A 1WZEA 5T57A 3JSAA 2OBNA 4R16A 4P4LA 4EUHA 3ASVA 3ON5A 2P5UA 3KZVA 1H94A 3E82A 2C5AA 4YYZA 1FXSA 2CDBA 2GERA 2O3SA 2X7HA 4FFMA 4M55A 3PIIA 2PGJA 3I83A 3L6DA 1JWAB 4J6FA 2X1HA 4E2XA 4J7UA 1VJ1A 4J4TA 4RF3A 1LRJA 3H6KA 4IJKA 1IPFA 3OJLA 5C37A 3I9KA 1RM5A 4J90A 4N5NA 4AJPA 1UZLA 2Q1SA 2W2LD 3ROQA 5ER9A 2GZ3A 2O3TA 4OOEA 4U0JA 5CDYA 2Y1FA 1VI2A 5TC4A 3S8MA 1CWUA 3BMQB 2VUUA 2AMFA 5DP1A 2Y1CA 3WWYA 1M6HA 5IF3A 4MINA 2Y67A 4CLOA 2JCXA 4NJMA 5JDIC 4JJIA 4GWKA 1DEHA 4CQMB 2C7GA 2P4HX 4IJVA 4BKRA 4KZPA 4E5KA 4PLGA 3HWRA 4LW8A 2AQIA 1BXZA 5IN5A 3HQ4O 2WYWA 4Z0TA 4R54A 3RVDA 1WLYA 1SBYA 4BQPA 1GFSA 4AJ4A 5G0TA 3PYLA 2CVOA 5L7WA 1WP4A 3BMQA 4RPHA 5U9CA 1OC2A 1ISJA 3DL2A 3VPSA 3E9NA 1I0ZA 1X7HA 2VOJA 3GN1A 6LDHA 1ZXBA 2PGDA 4BUCA 3FNFA 1JVSA 3AY7A 2AQHA 3Q1LA 1EE9A 1V8BA 4WNIA 3WTCA 3GMDA 3QVWA 3EMKA 1U3WA 1JN0A 1P9LA 4PLVA 4DLAA 1N2SA 1W8DA 4QECA 9LDBA 1H2HA 3DMTC 3H9QA 1TEHA 2X23A 2D1YA 4HADA 4RV9A 5MDHA 3JQ7B 2NU6A 1PJSA 1TLTA 2AQ8A 2BH9A 4XA8A 1AUPA 2BD0A 2IXAA 4BO9A 1X0XA 4IS3A 1V9LA 3OQ6A 1LJ8A 1SO8A 4BNGA 3N74A 2OL4A 3Q11A 1BWSA 1ONPA 3ZWVA 1KVSA 1XEAA 3D4OA 1WWKA 3DHYA 1HEUA 2YFHA 3ROKA 4NK4A 2WEKA 3GRKA 3VDQA 4YAJA 4H7PA 4EUFA 1YO6A 2PZLA 3GFBA 3JQ9C 3MJVA 4DMLA 2RH8A 4ALJA 3NTOA 2A9FA 1A9YA 5G4KB 2O48X 5U4QA 2GNAA 4K1LA 2GLXA 1U5AA 1HF3A 4FFOA 3WDSA 4AJJA 1QV7A 4Y6SA 3QY9A 4DPLA 2Y0DA 4ND1A 3C85A 1PS0A 3PJGA 4BNKA 1HLPA 1KS9A 3P7MA 1HDGO 1MX3A 1U3UA 3AOEA 3DR3A 2WSBA 1DIGA 4NIMA 1P1JA 3DBRB 4S1VA 4YR9A 2X0NA 3I9JA 4OIMA 2EG9A 3HSKA 3IJPA 3ZHZA 1LRLA 1LSOA 1GTMA 4ZGWA 1H9BA 4LMPA 2PV7A 1DBVO 3JQBC 5LDGA 4HNGA 1J49A 2ZK7A 1PJ3A 4XIYA 1PEDA 5T64A 5AQ1A 4TKLA 1Y8QA 3D0OA 3RSHA 3JQAB 3U09A 4D3SA 3QVSA 2VQ3A 4CLEA 1ADGA 2HMVA 2DPGA 3ETGA 3B1JA 3DZKA 5TQVA 1VRWA 1A5ZA 2BGLA 4WLUA 5HS4A 5A3VA 1NAHA 2GSDA 1Y5MA 4PZCA 2Y68A 5KVQA 5JXWA 2C20A 2G76A 2VNSA 4JXKA 5A9RA 5JS6A 4PGFA 2WDZA 4NJOA 4XIJA 1ADCA 2GPTA 3V2UA 1R6DA 1PZEA 2SCUA 3HFGA 3QE3A 4I9NA 1B8UA 1FDUA 3EGOA 4R41A 4TVOA 5F5LA 3I9LA 2RCYA 4AJLA 1ZK1A 2NU9A 2C2YA 2YV3A 1G6KA 1YB5A 3JQAA 4IM7A 5EMHA 3BYZA 4DIFA 1NYTA 4PG4A 1HE3A 2YHUA 1QORA 4CMIA 4DREA 2VUSA 1Q7GA 3DZFA 4WCDA 4GMGA 1M67A 2PGLA 1GCOA 2A92A 4NBWA 3AUAA 1E7RA 1NVTA 1ZEJA 4OGWA 4RQUA 4P38A 5HS6A 2I99A 3WICA 1YQGA 2E48A 4B7UA 3PGXA 2YY7A 3L07A 4D45A 1T2EA 1LDBA 4CUZA 2HK7A 3K73O 4RZHA 4UVHA 4EYEA 3B20A 3H65A 3PWZA 4RL6A 3S2IA 4CLRB 3RBZA 4K6FA 4HFRA 4B3JA 1Z6ZA 1GAEO 2O2SA 5BSEA 1R12A 3VZQA 3AY6A 4YRDA 3U5TA 4E31A 4NU5A 3VTFA 4CMCA 3V1TC 3TJRA 3OJ0A 3ZZNA 1X7DA 3IIEA 1N5DA 4BGIA 4LVCA 3AM4A 4YEDA 3RFTA 3C1TA 1SNYA 2H9IA 4DMMA 1YDEA 3HDYA 3GDFA 4E12A 1MLDA 2G5CA 2PD6A 2FRDA 2G17A 4E5NA 4JIGA 3GDGA 2ZJ0A 1P1FA 3OFSA 1FDSA 4ID9A 4AJIA 2RAFA 3PJEA 4FCCA 1BTOA 1GYQA 1X13A 3IKVA 4W7HA 3AI2A 5F3RA 4EJMA 3CH6A 1ZW1A 2YV2A 4IY1A 4M8SA 3X2FA 3INTA 3LF2A 4HFJA 4FN4A 4JP2A 4KUHA 4JK3A 3BTSA 5EIOA 3BMCB 3JQDA 5EERA 3ZW9A 3IUPA 4Y6PA 2CDAA 2GD1O 4UEKA 1DC5A 2ZB3A 3ZI0A 1YVEI 1VSVA 1SC6A 4A03A 4YAGA 2QHXA 3P2YA 4JBIA 3F5SA 2FN7A 2EV9A 3OM9A 3PWKA 2J5KA 4BGUA 1NWCA 2J3HA 2JFFA 4CMGA 3R0IA 2EWMA 3SLGA 1PL6A 4XDYA 4Z3DA 3TOXA 3ZHXA 4E5PA 3QWBA 3EVTA 3QA9A 1MUUA 3FN4A 2J5RA 4CV1A 1TT5B 1R4NA 5L7YA 2EW8A 1NFFA 5F1KA 1PX0A 4PLTA 1IHXA 3A14A 4R4JA 1NASA 1AXEA 1NHGA 5B12A 5BNIA 2VNAA 5CPFA 5IDXA 3JYQA 3GZNB 3L77A 1GQ2A 4R1NA 2IEBA 3BHMA 1YDWA 3QIVA 1TI7A 5ENVA 3U49A 3IDSA 4KQXA 4E30A 3U4DA 2PWZA 4GBJA 1DIBA 3CXRA 3NDIA 1DXYA 3BZUA 1O0SA 3BTVA 1YQXA 1ADBA 2RHCA 2B4QA 1BSVA 5I9MA 2AEMA 4HKTA 1NQTA 3MZ0A 2Y66A 5GZ1A 3F5QA 3IQDB 2YQ4A 1DIAA 4LGVA 2B5VA 4N7RA 4UUMA 6ADHA 1PQPA 2GZ1A 3GZNA 5AXCA 4RVGA 4YTEA 4YVFA 2FY8A 1W73A 3UKOA 3ST7A 4IDGA 1ONOA 4DQXA 4Z3KA 2P4QA 5TX7A 3GDOA 5DULA 1LEHA 2UV8A 3TZQA 2UUPA 2HMSA 3KRTA 4UVDA 4E13A 4W99A 3L4BC 1E6UA 1P0FA 3U4IA 4IGFA 4LK3A 3R1IA 3TFOA 3IL2A 3GPIA 3WGYA 3G0OA 1GU7A 4ROSA 4TZKA 4E6PA 3PDJA 1PU2A 5TF4A 1QP8A 3TQHA 5BNTA 2OP1A 4G81A 3PYXA 5BSHA 1A27A 1DAPA 2DFDA 1IY8A 2JCYA 3WGIA 1P45A 2W4QA 1WNTA 3HN7A 5JDCC 5I9NA 4BNMA 2B69A 2HSDA 2GF2A 2VTDA 1KEWA 3RAJA 1C1DA 4WOKA 5ICSA 3JQFA 4UAGA 2I66A 1ID1A 2V65A 4PLYA 5T8KC 2B36A 2HDHA 2HKIA 4W82A 4O0LA 1X14A 5H81A 3RKRA 2B4RO 3DOCA 1YJ8A 2R00C 2GN8A 3K96A 4XR9A 1QYVA 4WGGA 4CMKA 2VHWA 4XJSA 1ZH8A 2VYNA 4XYGA 2GASA 1K0UA 1UJMA 3DZIA 4BNUA 1K6JA 2VHVA 3H4VA 5L7TA 5JNLA 1U4SA 3I1JA 3PIDA 3DOJA 2VT3A 2XF8A 1EZ4A 5G2OA 2Q4EA 1GY8A 3U0BA 4EJ0A 4D46A 1LDGA 1D3AA 3L4SO 4CMJA 1U3TA 4DQVA 2DTEA 3N7UA 4DUPA 1BDMA 4J3FA 2FOIA 3ZWCA 4ZJUA 1YH3A 4ND3A 1JVBA 2NVWA 3ZU2A 3E18A 1YS4A 3ORFA 2IYPA 4JROA 2Q49A 1XG5A 3GF4A 3O9ZA 4WECA 5AYVA 4HFMA 2RHRA 1XHLA 4NR0A 3F6YA 3RU9A 1IHYA 2FP4A 2HJRA 1WZIA 1E7YA 3JYLA 1NP3A 1PJQA 5C7OO 4BNJA 2D0IA 1N9GA 1DDOA 1I36A 4JLWA 3DQPA 1QR6A 3O26A 3WIDA 5JC8A 1ISMA 3OEWA 5L4SA 4XKJA 5COBA 3SXPA 3LU1A 1ZJZA 3DAPA 4A26A 1GZ3A 1HYGA 4IZHA 3O8QB 3ZCXA 4GQAA 5DCWA 2HO5A 1PS8A 2HK9A 9LDTA 1N8KA 4BVAA 3SEFA 1ZSNA 3I4FA 4CMAA 3WOHA 2FSSA 1E7QA 4YJGB 4RQTA 1HL3A 2Q2QA 4CUKA 4OKIA 3UCFA 2IEDA 2QQ5A 5G0UA 4UUNA 4M87A 3NTQA 8LDHA 4W6ZA 5J23A 3AUSA 1GUFA 3RIHA 3K30A 1H6DA 1HE2A 3KBOA 1T2DA 2OORA 2VHZA 3STHA 4BNNA 3QVXA 4MVJP 5LDHA 4Z6KA 3SVTA 1IPEA 1BVRA 3H5RA 4QEDA 1R0LA 3GVPA 2DUUA 1C0PA 1DSSG 3CUKA 1ISIA 1X0VA 4EEXA 3RUEA 4CR6A 1NQ5A 3G1TA 3MJSA 5A9TA 1OC4A 4CM6A 1SOWA 2H6EA 4DVJA 3WMXA 3ONEA 4XQCA 3DAFA 3RC7A 1JKIA 4CLXA 5HRUA 4PN3A 5G0SA 5CG1A 3VH4A 3PXXA 2QG4A 2RH4A 3S2FA 4LISA 3PHGA 4Z0HO 3PP8A 5DF1A 4GL4A 4R3NA 2HLPA 2IXBA 4BKPA 1B16A 3D7LA 4CMHA 5I7SA 4GH5A 5L51A 3VOSA 2CY0A 2RBEA 2JFHA 2PY6A 5GMOA 4H3VA 4CM9D 4FW8A 1DFIA 2Z1MA 3GPDG 1LQUA 4CQLB 2DQ4A 2JJYA 4GMFA 5TRTA 3G1UA 1J4AA 1H6CA 2CD9A 4JNKA 3E8XA 4ONEA 5K6AC 4NK5A 4MKZA 3UVEA 5LC1A 3G49A 3F1LA 3GA0A 4FPXA 1H2BA 3RJ9A 2NU8A 3VAZA 2R2GA 2X9VA 4XZ3A 1B8PA 1NHWA 2E82A 5IJZA 1G1AA 1NM5A 1K89A 2NUAA 4CV0A 4UEOA 2W2KB 5TNXA 3R6DA 3WYBA 3ZWNA 2PZMA 3VC7A 1ZK4A 1N7HA 4CM3A 3B70A 5CG2A 3Q9UA 5KIAA 1QRRA 2O7SA 4U7WA 2VRCA 1R66A 1QKIA 3BTUA 1ZSYA 3LT0A 2AEFA 3MEQA 4GVLA 1EMDA 3KSZO 1E3EA 4R9RA 4E2YA 4K9DA 1YL6A 1OI7A 3OECA 1KOLA 4GPD1 4PG6A 2YUTA 2Q3EA 3AU8A 2W2KA 4JP3A 3CKYA 3EZLA 2PA3A 1XA0A 1ADFA 4PLPA 4MKXA 2ZCVA 2ZTUA 1KVTA 3HDJA 2E49A 4KP7A 4DPMA 2Z5LA 4CR8A 4BNFA 1ZXLA 3JYOA 1YKFA 5AVOA 4B8ZA 3HNPA 3C7CB 4Q9NA 4G65A 1A4UA 1HT0A 3UICA 3DTTA 3GUCA 1DJNA 4ZN6A 4IXWA 5KOIA 4N5LA 5K9ZA 2X0RA 4CM5A 1E0DA 1U2GA 4RVDA 1FF9A 5BQFA 3PDUA 1LNQA 5DBGA 5AXBA 4DGSA 4DLLA 1HDOA 2ZYDA 5G0WA 1SOVA 4D44A 3GAZA 3W6UA 4KWHA 3RUIA 3WGGA 2PZKA 3PI7A 3UOGA 3WJAA 4D79A 5JO0A 3MJEA 2UYYA 2YQ5A 2QZZA 4EZBA 2IODA 4IDFA 2BFPA 2WYUA 3I23A 2P5YA 2VT2A 4RF4A 1ENZA 3ITKA 3R3SA 2EW2A 1PTJA 4RO0A 4BO4A 4TRMA 4B3IA 1R0SA 3K9QO 3ZWYA 2J3IA 3F3SA 2C07A 1C1XB 1GADO 1U8XX 3PQDA 3P5SA 3WYCA 1GV0A 1IOLA 4ALKA 4Y67A 1YXMA 1I5RA 5FI5A 3HUDA 3QVTA 1NVMB 2WD7A 3RC1A 1MXHA 4BO2A 3M2PA 1PR9A 4MDHA 4F45A 3VKUA 1C3VA 1X7GA 4LSWA 3VZPA 4MVJH 3EAGA 1JLLA 1HZJA 1C14A 3ZWWA 3KTDA 3QWHA 4IMPA 2X5KO 4PG7A 2YHIB 3V8BA 5F1PA 3UCXA 4INAA 4BS9A 4MPDA 2H63A 1E7WA 4BNTA 4XCVA 4BV9A 5T67A 4TVBA 3ETEA 2BKAA 3WXBA 1KEPA 4J9VA 4FFPA 1A9ZA 2FR8A 3VVCA 1YBAA 2DKNA 2JAHA 3K31A 5ER6A 1B2LA 2VCYA 4MVJA 3U9LA 2PKRA 2VN8A 3PJFA 3SBOA 4OAQA 4EITA 5THKA 4R51A 1M75A 2PH5A 4XYLA 3D5TA 3S2EA 5HM8A 3O4RA 2I65A 3E9QA 2CVQA 3QRWA 1ORRA 4J4BA 4IDEA 5EPOA 1UP4A 3DONA 4KDFA 4MJLA 4QQRA 1HDCA 4YT2A 2VYVA 3QWAA 1GEEA 1MG0A 1DHRA 1DIHA 1P44A 2JD1A 5JFOA 4LCJA 5CP8A 1HETA 3QV1A 1ENPA 3CE6A 4QO8A 4WPGA 1E1KA 4RLHA 1B0AA 3WQSB 5HWSA 3KV3O 3FPLA 3GNQA 3QW2A 1KY4A 3CINA 3WNVA 4ZD6A 2BFAA 2NTVA 2NQTA 3FF4A 1YBVA 2X0JA 1XU7A 2VZ0A 3KSUA 5BNFA 4A0SA 1D1TA 3ZN2A 3LQFA 4PG8A 5JE8A 4WLVA 1SB8A 1Y1PA 5BT9A 4NMHA 1O6ZA 4I9HA 2EIHA 3H3JA 2FMUA 1PZHA 3AUUA 4N54A 2PR2A 3MOIA 3Q3CA 3K2BA 4AJKA 1A71A 3PFWO 1GUYA 4R5HA 1GYRA 1ENYA 2CF6A 4BO1A 1NXQA 1W6UA 2NM0A 1EK5A 3AUTA 4LCEA 2BELA 4TRRA 4CQMA 1SCUA 3CMCO 4R1UA 2OO5A 4IQ0A 1QXSA 3IJRA 2A35A 3CTMA 3DOOA 1QYDA 4RGBA 3VHRA 2NWQA 4BNWA 2HQ1A 2GGSA 2VRCD 4GVXA 4PZEA 3TRIA 2NSDA 4XQEA 3GG2A 2JHGA 3WQRA 3ONFA 1B15A 1ZUD1 2ZTMA 1HSOA 4UVEA 3ZHBA 4YAIA 3GGPA 1YBMA 4QUKA 4GX5A 4YWJA 1TVEA 2CDCA 1DC4A 1OZAA 3AY3A 4RZIA 1U4OA 2Q4BA 2OOSA 4IINA 4ZQHA 3L9XA 5KJEA 3W8EA 3WBFA 2HRZA 4XB2A 4RVSA 1V0JA 5I7FA 3GMSA 2ILTA 3EW7A 3KHUA 1GUZA 5EN4A 2VZ9A 4P4GA 1X1EA 2ZKLA 4MVJI 1RKXA 1NFQA 3CSDA 3HDHA 3JQ7A 4Y98A 1GL3A 1MP0A 1PWZA 5DZSA 1B8VA 3KVOA 4PFJA 4QT0A 4QFDA 4BGVA 4ZICA 3GEMA 4MP3A 3FNHA 1AXGA 2AE1A 4XDZA 4OHUA 1I2CA 3NYWA 4LVUA 1HE5A 4MO2A 4E3ZA 1VJ0A 3M6IA 1J5PA 2C29D 4DIOA 1N1EA 1P77A 4PLCA 3ZWXA 1I01A 2DTXA 3JYPA 4UEJA 5G4KA 4PVDA 4ALIA 4O1MA 3OQ1A 1WDMA 2V6MA 2ZIZA 4JCOA 2EEZA 4BKUA 1EE2A 3WG9A 4WK6A 1PGNA 1V6AA 3WJ7A 2X86A 4HUJA 4UVGA 2OXIA 3TF5A 3T7CA 2JHFA 2I67A 3TFQA 1U1IA 5GY7A 3NJ4A 1PWXA 3ROPA 3DBRA 4DBVO 1PL7A 1A7AA 1LU9A 1RPNA 2XXBA 2PFGA 1LDMA 2AA3A 4IJWA 3RUFA 3UW3A 3EY4A 3OMLA 4KWIA 2EGHA 5EINA 4OJNA 4ZRNA 1NVGA 1MXFA 3WR5A 3GAFA 4RORA 4F3YA 3IAHA 1LA2A 2Z95A 3PFFA 4K28A 2WMDA 2Y1EA 2NVUB 3KO8A 3KYDB 3FNEA 1E7MA 4CM7A 1VKNA 2X9NA 4NZ9A 4QFCA 4U6QA 4G5HA 1KBZA 3E1KA 1XDWA 2XOXA 3NDJA 2FR1A 3PHHA 1T1SA 5C5IA 4MIEA 5CHEA 5DCUA 4CL8A 4YCAA 5ILOA 2WTBA 2GR9A 3OEYA 3ZU4A 2E4AA 4NU6A 4E5MA 5CDSA 5KVSA 4XRRA 4HBGA 1IULA 1Q7CA 1YJQA 2QX7A 2NVUA 4AL4A 3GZ4A 4RVUA 5JC1A 3I4CA 1DC3A 1RM0A 3BAZA 3JQ8B 3OF2A 1CJCA 3CIFA 4J91A 2BFOA 1GZ4A 5B4UA 3G3EA 4RF5A 1YWGO 5AOVA 3A1NA 4XRGA 1NPYA 4NBUA 3MWDB 1BW9B 3ENNA 4BQRA 4L9RA 1JTVA 4J43A 4W4TA 3T4XA 3BXXA 3QP9A 4OQZA 2FR0A 3ZNOA 4FGSA 5DN9A 1GZ6A 3JD4A 3IC5A 3MTGA 4C4OA 3EDMA 2NLOA 2PKQO 3JV7A 4IDAA 4Z9XA 3K5PA 4CLRA 4YJFB 1V3TA 1R0KA 1TXGA 4HX5A 4MIYA 4I1IA 1FDTA 4OXNA 3VH2A 5IG2A 1R4MB 1LLDA 3H2SA 4CODB 3V1YA 2WJPA 3GGGA 2O7QA 3C7AA 2NU7A 3DBLB 3OJEA 2I3AA 4ALLA 3GVXA 4EBFA 4FGWA 4GX2A 3HG7A 3LK7A 2DU8A 3FR8A 3DBHB 1Z45A 1B3BA 3OSUA 3COSA 5CEFA 4CQMD 1V3UA 1JWBB 2IRWA 4L4RA 2EXXA 4P8RA 2FWMX 3H7AA 3O03A 4M49A 4YJFA 3OHSX 4WLFA 4CM4B 4XEHA 5JAMA 4AJEA 2X22A 2IZ0A 4FB5A 1FDWA 3PQFA 1DRWA 1G0OA 1LLQA 3AW9A 4XQ9A 5JYEA 1ZVMA 2O4CA 4IQ8A 1KVQA 3C24A 1M2WA 4Y6RA 3V1UA 2D8AA 3FHLA 3K92A 1TB4A 4RPLA 5L9AA 3EK2A 3DBHA 3GEGA 1DLJA 1E3IA 4R69A 3BMCA 1YRLA 4OMUA 2QYSA 4J2OA 1LSUA 2NTNA 4J1NA 1LDNA 1H6AA 3KETA 5CDGA 4CM4A 3IP1A 3AWDA 3GY0A 3I9MA 4YB8A 1O5IA 1CETA 3HB4X 5F21A 3D4NA 5JCJA 2HMUA 4A2CA 3I9NA 3H9UA 2PLAA 2G1UA 1ZJYA 1XGKA 3HE3A 3OIGA 3A9WA 1Q0QA 1Q1NA 1P0CA 1TT5A 4RVHA 2X58A 2EJWA 3TZHA 5JY6A 2FZEA 1HE4A 2V6BA 1WMAA 4EEZA 4OOFA 3L0DA 2G82A 3U4HA 1JAYA 3VZSA 3CPSA 5A3JA 3PHJA 2XXJA 5A4DA 1DJQA 3RUDA 1E6WA 3UFXA 4H16A 5G0VA 4QO7A 2D5CA 4R1TA 2ZATA 4GX0A 3GN2A 4YACA 4OM8A 2FHSA 4K26A 4NHEA 4D0SA 3NKLA 5HBRA 2G0TA 3GH3A 3TZ6A 4URFA 3ICCA 4NBTA 3IOYA 7ADHA 1EK6A 1WDLA 3WSWA 3UAGA 4FR5A 4L8VA 3VZRA 4XX0A 1T24A 4L74A 2C5EA 2DT5A 2JL1A 1LLUA 3VH3A 5A5FA 1BVUA 4AFNA 5KVCA 1CEQA 3PYMA 1DO8A 4BB6A 1XLTA 4NH4A 2VZ8A 2CMDA 1SB9A 3JQAD 4O59O 5GZ6A 4Q3DA 1UAGA 2YV1A 4KUEA 2A94A 4E2WA 5HTOA 1SAYA 2Y0CA 1XQ6A 4BOYA 3WBBA 4F46A 2JCVA 2F1KA 3HDQA 4Q3AA 1T2FA 1PQUA 4GSLA 5ITWA 2PNFA 3JQGB 1E5LA 3LZ6A 1S6YA 1S7CA 3EHEA 4IPTA 3QWFA 4W9NC 4JGBA 1CYDA 2UAGA 1M66A 5L4LA 3LC1O 1ZK0A 1PGOA 1VPDA 4AVYA 2B4TO 3HN2A 3FPCA 3FRJA 2I5PO 3SX2A 3GQVA 4TKMA 1J6UA 4Q3NA 4B79A 4CJXA 1CQIA 1ML3A 1YQDA 1ZSVA 3LT4A 3ZHYA 5CEEA 3TSCA 3JQGA 3OJOA 1NPTO 1E92A 4BL5A 2JD2A 3KLMX 4M86A 4BMNA 1BG6A 1W0CA 4CM8B 3NUGA 1XCBA 1Q0LA 4WEOA 3ZNNA 2DBQA 2EGGA 2AHRA 5JMPA 2BI7A 3INRA 2GN9A 1DC6A 1WDKA 2D4AA 1SEPA 3ENKA 4CMEA 5COQA 4CLHA 1ZFNA 3DZJA 2ZJ1A 1LC3A 5H83A 3QHAA 4R3WA 3L9WA 5KKAA 1X1TA 1QLHA 4A5OA 2DFVA 3LT2A 5F1OA 4GAEA 3MTJA 4YRBA 1CF2O 1DRUA 1LDEA 4PG5A 7MDHA 3PZBA 2GDZA 3PVZA 2J5QA 2C54A 1CRWG 1FJHA 1NPDA 1YB1A 2ZB7A 3IP3A 1IZ9A 3WIEA 4Q3BA 1YOVB 5JY1A 1RYDA 2WWRA 4CM8A 2YFQA 3ANMA 3BMOB 2CUKA 3DC2A 4DRYA 5B1YA 1ISFA 3L4BA 3WX0A 3D5QA 3KXDA 2EKPA 1UZNA 4BO8A 2X5OA 4F6CA 4WASA 1LI4A 3HJAA 3GFGA 3VPHA 3GR6A 5JDCA 1IL0A 3O8QA 4FJ1A 5BSGA 1XQ1A 3ICPA 4JBGA 1Z75A 4U5QA 3A28A 5T6BA 1YOVA 4YRAA 1OMOA 4AJNA 4Z9FA 2X8LA 3GHYA 4YJGA 2AXQA 3GNSA 3TL3A 2CF5A 5JCJD 2YJZA 2X0IA 4G2NA 3RKUA 2ZTLA 1D8AA 5JMWA 2J8ZA 1UXKA 3B1KA 4XYMA 3E03A 3KYBA 4MKRA 1W4ZA 3UUWA 2BFMA 1QSGA 3AOGA 1YL7A 4Q3CA 1ZO8A 1KVUA 1RM3A 5CFZA 1O8CA 1HDXA 1GD1O 4OO3A 4BNXA 4J0FA 2PZJA 2VUTA 4HNHA 2CZCA 4PIVA 4RPKA 4ZA2A 4CMBA 4Q39A 3VKVA 3DHEA 4A27A 3NTRA 8ADHA 1LTHR 4YBZA 5KCZA 3VPGA 3UGKA 1XSEA 3TZKA 1PQWA 4IXTA 4I5EA 3V5NA 1GEGA 3S2GA 3SJ7A 3D64A 1D1SA 2Y99A 4OSOA 1H0KA 1BXKA 2J6IA 2AEJA 3JD3A 3HZZA 3OIFA 4BIIA 3KEQA 3OA0A 4LSMA 4XWYA 4D41A 4DYDA 4ZHSA 1GV1A 1OAAA 3K6JA 3KLPX 2ZB8A 2P91A 2BF7A 3SC4A 3C1OA 2DBRA 4RF2A 2D59A 2E37A 2EERA 4CQLA 4P4NA 3NDRA 1U9JA 1V3VA 2D2IA 2NVBA 3PHLA 4GKVA 4K6CA 4P22A 4IDCA 1F0YA 2GUGA 3AFMA 4J1TA 2Q50A 3QLJA 1ZEMA 2IE0A 1U2DA 5B4TA 1Y8RB 1VLLA 2O50A 5L53A 2BLLA 1JU9A 5L45A 1MGOA 4B4UA 2VWGA 2P68A 2Y1OA 2W90A 1E1LA 3ADOA 1UXGA 3GGOA 4ESOA 3I52A 1O95A 4XD2A 1VL8A 3SLKA 2Q99A 2VRBA 1GDHA 3OJFA 4WKGA 2VYND 3V2GA 1NQOA 4J7XA 3GC6A 4QSMA 2HUNA 4WEQA 2P9EA 4FC7A 1I30A 3R3JA 1OOEA 1OFGA 4WCFB 1B26A 3BMNB 3P2OA 1Y8RA 3F46A 4L76A 5GZ3A 1YB4A 2AG5A 3C8MA 1BMDA 2Y1DA 3DTYA 2O3QA 4JN6B 1YE3A 4GSKA 4BGEA 4RPGA 2HRBA 3D3EA 4PLFA 1EVJA 4FFLA 4YQZA 3LSYA 4M54A 4BKOA 1VE9A 1F17A 3TNLA 5L4NA 5JAIA 1XKQA 3I6QA 1Z7EA 4HY3A 1O89A 4UVIA 1MC4A 1F12A 1LLCA 2IDZA 3WTBA 4B4VA 4HXYA 2Y0EA 3WMWA 3KUXA 1PL8A 1MFPA 3H3FA 1GCUA 4M1QA 4WCFA 3PRJA 2NV6A 2BGMA 3IS3A 1M6WA 3ZV4A 1YGYA 1L1FA 5HA5A 3KOUA 3WYEA 2PD3A 4XGIA 1QYXA 2VHYA 3BIOA 5I7EA 4BO0A 2CFCA 4LRSB 3TDKA 3H9GA 5JAZA 4J9UE 2FPPA 3MJ4A 3I9OA 1PS9A 4PCVA 1EUZA 4I08A 5DOVA 5A02A 4R01A 3TOZA 4DBZA 2RIRA 4D7AA 4DL9A 1CQJA 3SC6A 2C7VA 5JAQA 4BV8A 5IZCA 5JCXA 1C1XA 3K2EA 4KOAA 1B3RA 2P9GA 4NFSA 3ZWBA 1DRVA 4NFHA 2Z1NA 3Q2KA 3JD2A 5COAA 3RC2A 1GR0A 2Y1GA 4BO7A 3QSGA 1UXJA 1LUAA 5MGBA 2GCGA 5CDTA 2JKVA 3E6AA 3RQSA 2QW8A 4MP8A 1Z82A 3F47A 4WJZA 3RD5A 1EFKA 1MB4A 2ZYGA 4N5MA 4YXFA 5KTKA 1RM4A 1E7SA 4ZQFA 1K5HA 2YHIA 1CIVA 3RUAA 2HAEA 1XYGA 2TMDA 3DXFA 4IUYA 1FMCA 1Y7TA 4L0QA 1ZCJA 2OBYA 3E5RA 3H5NA 4GLLA 4BO5A 2EP5A 1MV8A 4AICA 4D0RA 3PWSA 3N58A 3OBBA 4JJGA 5DBIA 4ILKA 3W6ZA 4CLOB 4E2ZA 1DAOA 3KSDO 4NJMB 3AK4A 3AOEC 3ULKA 4I8XA 4CUJA 4GLOA 1Y9AA 1I24A 3ZU3A 2IYOA 1NAIA 5K0ZA 4L75A 4TROA 4X54A 3X2EA 3FNGA 3OA2A 4CV2A 4NBRA 1DFHA 2BHLA 4Y8VA 3O38A 2O2YA 3JYNA 2QRKA 5I7VA 1HRDA 1XWFA 4YDRA 1K2WA 4JJFA 4HFNA 4PRKA 5ADHA 3KM0A 1F06A 1GPDG 2VOEA 5ICMA 3IMFA 3W4IA 1BXGB 1UR5A 4U0KA 4RDHA 3S1LA 3U62A 3LLVA 4TQGA 3OP4A 1ARZA 5A03A 2F00A 1VKOA 4R1SA 1HZZA 2IZZA 1J0XO 3NGLA 4B7XA 2WE7A 3MJTA 5F5NA 1K6IA 3D1LA 4DLBA 2P2SA 5TIIA 3T4EA 4F6LA 1L7EA 3NRCA 2HMTA 2VWHA 1UP6A 4YT4A 4OL9A 3E9MA 3DAGA 3D4PA 4FS3A 1HTBA 1DFGA 2GN4A 3C1AA 1BXGA 5KNLA 1T25A 2O3UA 1P1HA 1R37A 4YA6A 3PTZA 2Q2WA 1AN9A 3VPXA 3LLSA 4J49A 1NQAO 1A72A 3DO5A 3CMMA 1LXCA 4UUPA 1NFRA 2WM3A 5FFFA 5FYDA 4DXHA 5U1PA 1UDBA 1HDRA 3BHIA 4NDNE 2EKQA 3WWZA 4DA9A 5TSDA 4TZTA 5A06A 3ZWPA 4BO3A 4B4OA 1UDAA 3JQCA 2Q1UA 3UH1A 1PIWA 2BMAA 3EUWA 3GNTA 4MP6A 4BNLA 3BA1A 1B14A 4RPJA 1E5QA 1C0IA 1GQYA 4TRNA 3TWOA 1DB3A 1KC1A 3BHJA 4FC6A 5A5EA 4KDEA 4ND4A 5KJFA 4IGEA 5IDYA 3DHNA 4Y9DA 2W98A 1Y8QB 3G17A 1QMGA 2YDYA 2POQX 3ZV3A 3V2HA 2GRAA 2FSVA 3RJ5A 2WD8A 3UHAA 1SPXA 3FTPA 5JDIA 3QVOA 3F4LA 1EEHA 1VM6A 2OMEA 4BNIA 2B35A 4LRTB 1Z73A 1PGQA 3WGTA 3NT4A 3JQEA 4ALNA 1EQ2A 1PJ2A 3QJ5A 4QXMA 4A7PA 4E33A 3EZYA 2VWPA 2DBVO 3OQBA 4IQGA 4U8GA 2DUWA 5G4LA 1IE3A 4GX1A 2LDBA 5ILGA 4PRLA 1V35A 2EKLA 4PLWA 4ZVVA 4U6SA 3FCOA 4II3A 4AJHA 1L7DA 3ABIA 1ZMOA 3FWZA 3GG9A 3ZH2A 4DQUA 5T5QA 2I76A 2C0CA 1BHSA 1I3MA 1NBOA 4IJUA 4EUEA 4B3HA 4CMIB 1LC0A 3WGQA 3CEAA 1EFLA 5L3ZA 1F8GA 3FR7A 3G79A 3RU7A 2XAAA 3DMTA 3RFXA 1KC3A 3MOGA 4MVJD 3RUCA 4EGFA 3DB2A 5DCYA 1NNUA 4E4YA 4D3DA 1JKFA 1X15A 3ZDFA 1PZGA 3KYDA 3UN1A 4XR4A 3PZRA 4BMSA 2QZ9A 3F4BA 3ZV6A 1AGNA 2VYVD 2CVZA 3AI3A 3DMYA 4ZQGA 3DWFA 3WLEA 4B8WA 3WS7A 1UH5A 2FPGA 4J2HA 3FWNA 5C3MA 5JYDA 1KYQA 2Q2VA 3JQ9A 2O3JA 5JPIA 5BSFA 2BGKA 3H9EO 1D7OA 1P3DA 3WSVA 5IDQA 4DWVA 1MC5A 1U7TA 3HADA 3WLFA 5ES3A 1LDYA 1PGJA 3UCEA 1Q7BA 4BKQA 1H5QA 3WB9A 4HWKA 1T4DA 2CNBA 4WNCA 3CZRA 1JA9A 3JQ8A 4YQYA 4DYVA 4EW6A 1VL6A 4UREA 3MJCA 3LYLA 4PLHA 1O94A 4FDAA 4L73A 1P1KA 4OH1A 3LC7O 4R9SA 1BW9A 4I5DA 4TSKA 1YL5A 3VVBA 1Q0HA 4E0BA 1KETA 4LN1A 5IDWA 1DIRA 3ROMA 4C7KA 4RJTA 1U5CA 4WE3A 3JQBA 1BDBA 1IUKA 4E5YA 5L40A 3HHPA 3RROA 1Z74A 4E32A 1UXHA 2AE2A 3QQPA 1AHIA 4BNVA 1MA0A 3ADPA 4FBGA 4YT8A 4L4SA 1N1GA 4D42A 1KEUA 1UDCA 1R4MA 4JQCA 4NPCA 2B0JA 1CERA 4FSHA 2PD4A 3UF0A 1E3LA 3DBLA 4ZU3A 1PJBA 3DFZA 3W4KA 4FQ8A 2VWQA 3NV9A 3JQFC 2QIOA 4XGNA 2OHXA 1DHTA 1GYPA 1BRMA 5CEJA 1PGPA 3Q9NA 1R4NB 1MFZA 1SEVA 4TMFA 5JO9A 3ITDA 4DIBA 5H82A 3DZHA 2I6TA 1EDOA 1HYHA 4I5FA 4CPDA 2X5JO 3KEOA 4UULA 4DTIA 2XPCA 2Q45A 3FBTA 4IIVA 2GZ2A 3JD0A 2DTDA 1LBEA 4DC0A 3U3XA 5TLSA 3WNQA 3L6OO 5EL0A 3FSRA 2I9PA 3EC7A 5KJ6A 1A4IA 3FTNA 2O4UX 1NTOA 3OIDA 4ZRMA 3VDRA 2O3RA 1H93A 3S55A 1EVZA 3DZBA 1GPJA 2GO1A 1HWYA 4II2A 5DDIP 4FOOA 3W4JA 1PJLA 3FBGA 1TT7A 1JDJA 1XELA 3WGZA 3H9JA 1KEVA 5A1TA 5I8ZA 4CL3A 1E77A 3ZWOA 3ZGYA 2QYTA 1U7HA 1N92A 5TJHA 1Y81A 2H1SA 1FDVA 3HB5X 1K3TA 3JTMA 4XJTA 3I6IA 3FD8A 3K8ZA 1NX6A 4CR7A 1NR7A 4KTTE 4FOSA 2D5AA 4CM9A 2GN6A 1C0LA 1RJWA 4JBHA 5TJ9A 1E3SA 4NG5A 4CMEC 2WYVA 3TZCA 3GVCA 4I9UA 1ISGA 3D3WB 3LVFO 1KY5A 2B5WA 1UXIA 5KKCA 2OGUA 4FJ2A 2WE8A 4Z0PA 3FI9A 2V6FA 3T7EA 3ONDA 4FFNA 4ZQBA 1WAMA 1JAXA 1C1DB 1HDYA 3MWEB 3OICA 1ULUA 4XQGA 4WLEA 1F8FA 4BNYA 4XGKA 1I10A 5JLAA 1I2BA 3GHHA 4E21A 2GYYA 3A4VA 3TPCA 3PJDA 4OYRA 5ITVA 4I5GA 2LDXA 3E5MA 4IIUA 4YPOA 4YJHB 3D3WA 4RCVA 4AG3A 3NT5A 4B4WA 3ZWMA 1HKUA 1HDZA 2AQKA 1Y9EA 2Q1WA 1ZK2A 1P1IA 2D3TA 2EP7A 3DDNA 3AFNA 5FF9A 3ZV5A 5DNAA 5CAEA 4WLOA 1HSZA 4H15A 4GKBA 1VJTA 4RVFA 3ZW8A 3ETDA 4MVJG 4NI5A 1Q2XA 2DC1A 1T2AA 4NBVA 4J7CA 1I33A 1T26A 4NNJA 1RYEA 4S3MA 3GK3A 4J1QA 2DM6A 4BMVA 1AHHA 4YJHA 4CLDA 5IXSA 5C7IO 1WPQA 5JW6A 3JCZA 5EESA 5AXDA 4WUVA 3GVIA 4AJOA 1ONNA 2HJSA 4NQZA 1ISHA 5EJ2A 3F9IA 3B1FA 4CV3A 2EJVA 3NJ8A 2AW5A 2ZYAA 3WQQA 1U8FO 1XU9A 4YAEA 3TN7A 3I3OA 5IZ4A 3H2ZA 4BNHA 2I3GA 1EBFA 2ZQZA 4IDBA 3GEDA 4ND5A 3HFSA 3PHIA 2UDPA 1PJTA 5L95A 2OP0A 4YT5A 4WLNA 4O5OA 4NFYA 5EQDA 2FZWA 4KQWA 4BHTA 5CDUA 1I3KA 1N9GB 2DPHA 3W1VA 3ZNQA 2E6UX 5LCXA 2UUOA 4OSPA 4YJDA 5I8WA 1P74A 3LDHA 1QYCA 3AJRA 3DEYX 4DPKA 3I5MA 1IB6A 2A4KA 1P31A 4QX6A 1N7GA 2VHXA 4FFRA 1HLDA 2VTEA 2YW9A 3DFUA 1KVRA 3NGXA 3Q2IA 4IDDA 4IMRA 4D43A 2JD0A 5CPBA 1SMKA 3OH8A 5A04A 3M2TA 2DLDA 4RLSA 3M1LA 1ZBQA 3DBVO
chains in the Genus database with same CATH superfamily
4M83A 4F1KA 3H0EA 2OCPA 3KEMA 1TD1A 2G8LA 2ZRFA 2NACA 3ZKAA 4KN8A 4PX9A 1TPYA 1ZH2A 3EIQA 2FUCA 1HFEL 2RB4A 2ZAGA 3GQBB 4JDUA 2HK8A 2J9ZB 4UZEA 4Y2VA 3RUHA 5LU9A 2C7PA 2HMWA 1TCAA 1T1RA 2GSWA 4XVHA 4YQEA 2NXCA 1WB9A 1XMXA 3C39A 4QZVA 5EPUA 1C0KA 1P6QA 1TYEB 2BRUA 1WXDA 1QVZA 2IH4A 2BHNA 4JBXA 3QU9A 1FOEB 4HTFA 2ZYIA 1LK7A 1L5VA 1DG9A 2BI8A 2LCIA 1VLQA 2PGOA 3DO6A 1R16A 3BWYA 4KO3S 4O63O 3HUUA 4WMLA 5THQA 3V1NA 5EJGA 1CV2A 1FUIA 2C61A 3VRHA 2R00A 1SIBE 1HT3A 3W78A 2ONJA 5SY9A 1SR8A 1YBFA 2FWIA 3R5TA 3DDCA 3G5LA 4NMXB 4Y7CA 4ANFA 4CIBA 3F67A 3GOHA 4K6GA 1OYYA 4OKNA 1FXWF 2TMYA 3VHXB 1H23A 4UBIA 3WFJA 4IZIA 3GZTB 2FN9A 2YYSA 2V7PA 4ND2A 4LF9B 4FDUA 2Q4DA 3B6ZA 3W8DA 1XIVA 5LXTB 1O9BA 1UP7A 3BH6A 2C5BA 2FPIA 3RASA 2C4MA 2PKEA 1FMJA 1VSUA 2XCUA 4J16A 4TTRA 3RTBA 1EKXA 2GYUA 4IS2A 1IFXA 1DQSA 3AM5A 3KR1A 3TKYA 2Q4TA 4LE1A 4Q18A 4Y0NA 2QTRA 5BVHA 4TN5A 1BWQA 1YONA 1Z15A 1Z4OA 3EFHA 1GXSA 2WJ6A 4MVJF 4QU5A 3WS7A 1RMYA 3QPUA 4WCFC 1LQTA 3G8YA 2IHUA 4C7JA 4X7MA 3FTEA 4HLDA 2FGJA 1EFRD 1TYDE 4B7CA 2PGNA 5KYKA 4O6VA 2UYHA 1XR3A 3E53A 1N5KA 2H4WA 3L6EA 2X4GA 5C5DA 2W8BA 5GVSA 3AI1A 2OY0A 5JNVA 3BTOA 1TVKA 3AEXA 4FBLA 1OFVA 1W0JD 4TWRA 1PJ4A 1R0YA 3K0CC 1RI3A 1WA5A 1EVIA 1Z6AA 2WMOB 1W35A 4N7JA 4RMIA 1F3OA 2E18A 2HPZA 3E8SA 2NZ2A 3EGCA 1P2VA 4PLZA 4A73A 4F1WA 3W2IA 3FSJX 3LHFA 4Y0VA 3OWHA 3LHSA 2ACKA 1MJ5A 1JH8A 3GGJA 5DNCA 5AH0A 3C45A 2GBLA 1QHNA 4GPBA 2A5JA 1RWKA 4FS8A 1UZMA 1V7QA 4EHKA 4HAOA 4UU0A 3LY7A 1LV8A 4Y1RB 1IDOA 4MVXA 4TKZA 4F3CA 1FFGA 4DM3A 2XTNA 1CNEA 2JBAB 4E88A 1E3DA 5F2OA 3HZRA 4HGZA 4GI2A 3WLAA 4F8JA 2V4MA 1QZZA 2ZM6B 3DR5A 2FR8C 2DY0A 3FPFA 4FJ0A 4D6YA 1DLIA 2G8NA 3JAKA 4YHBA 1E4EB 1DRKA 1LSJA 4P0QB 2F6RA 3CX8A 4L57A 2OUKA 3THYA 2MJLA 3CLUD 3CW9A 3DOUA 2OFFA 4KJXA 1I8TA 1CUHA 3FPGA 1J2EA 2R79A 3RVJA 4DY4A 1SA0B 2REOA 4FIZA 3OOWA 4B3FX 3EVNA 4ZVQA 1BGVA 1WHTA 4HNAB 1WY5A 3N07A 4OXYA 4CIYA 4FW9A 5IN4A 4Z0NA 2A9JA 3EIXA 1NW5A 1KO5A 3RM3A 3UXYA 4KVFA 4N18A 2WJVA 2D5IA 2A0YA 4WFQA 3VOBA 4YRPA 4HDNB 4UUOA 2Y05A 3LW7A 4JNCA 3GMIA 1D0SA 1WL8A 3M1AA 4LWZA 3TLEA 1GPH1 1KIFA 4EHIA 2WF8A 1LF0A 1Q3KA 2NGRA 4F2WA 5DHUA 2OV8A 1B0PA 2JATA 4I1VA 4I8IA 4YUYA 3E48A 2XBLA 4LC1A 4EGCB 1D2MA 2IXGA 2JLQA 2HSEA 2R6JA 3FHJA 3KYCA 4PIPA 4PR0A 2WKRA 2GEJA 3OM1A 4DIKA 3CUWA 4CTMA 4QSHA 3K35A 3MCVA 1CFJA 4ZI3A 4HNTA 2YH2A 3EQ7A 3WLRA 3TCNA 5TPZD 3SC3A 3LL7A 4NECA 1UKVY 4I9FA 3DB1A 4OQYA 5JSZA 4TWBA 1N5OX 3QPDA 3NVKI 2Q3FA 1FPQA 4UXIA 3QLVC 1P6UA 1QLJA 2HNBA 3LYAA 1E1CB 4TTVA 5C2JB 5KBYA 1KE2A 1L6RA 2HB6A 3BMNA 1O4VA 4B33A 2WJAA 4HB4A 2PKQP 2F64A 3OX2A 1Z26A 2G67A 2MSCB 3CO5A 1IYZA 2QW1A 1PDWA 2OFPA 5E3IA 4LYFA 2J5BA 4NCKA 4M1MA 1EUCB 1XTVA 3NT2A 5E6RB 4YASA 4BMOB 1BOOA 4TLEA 1XN1A 2GM3A 1QVAA 1EB9A 1JDSA 3EGXB 2IBMA 1ZNQO 2HGSA 5FTWA 5EWMA 3HWWA 4CDGA 2COUA 3LDFA 2OO5C 2OHFA 3F1KA 3BN3A 5AVJA 2CWDA 4PRZA 1H6BA 5MN5A 1Z6TA 1E3JA 1Z4NA 5F2EA 4ZEXA 3ABZA 1E2KA 1VE1A 1RKVA 2OGWA 2P30A 3PK0A 1N6RA 4G5XA 3AM3A 1JR3D 4IH9A 2VUHB 5M7EA 3DBOB 4GHWA 2WJ3A 4KFUA 1F2UB 4EY8A 3KKQA 1K4YA 3E61A 3FRHA 4KR6A 3RBVA 4GGOA 1H69A 2YCBA 4QXAA 2Y2UA 4PZDA 4NE7A 4OU5A 4BEVA 5IKMA 3H5AA 1TFUA 1I3OA 3G8AA 2IVFA 5KSOA 2PZAA 1WOMA 3HU1A 4M88A 5EXSA 5IDVA 1QG6A 1HH4A 2BZ0A 3TW6A 2DBZA 1E6EA 3KTAB 4XYBA 4L4XA 4XYEA 5AVQA 1E1NA 1S0UA 4MOWA 4HGYA 5B4VA 3DF9A 4FZRA 1SUAA 4N5IX 1SXJC 1WZEA 2CCGA 1XMJA 3JSAA 2DWUA 4P4LA 3G7SA 4KHZA 1ABFA 4GNRA 2C9CA 1GRRA 1ZICA 3KZVA 3ZYCA 1QPZA 4IIJB 1KDRA 1FXSA 2AFRA 2CDBA 4M55A 3U13A 4CKCB 3PIIA 4DHWA 3PNKA 6Q21A 3A7DA 5F3WB 1IVNA 1V25A 1VL5A 3HPQA 3V1LA 1QRTA 1LWNA 1RWPA 1NJ5A 1WQ4A 3PNVA 4J6FA 5ALIA 1IWPB 4J7UA 3AKZA 4MW9A 1VJ1A 4N6OA 5AIBA 5EJMA 3G13A 3H6KA 4KGZA 5JXJA 2DY1A 2VHCA 3RH0A 4Q1CA 3I9KA 4TYYA 3R7WB 1QQ6A 2P9QA 4MVYA 2P11A 3I1IA 1OXUA 2BGTA 4JL6A 4OOEA 4U0JA 3ROQA 4HC4A 5CDYA 1GO2A 3NDPA 1T4CA 1VI2A 3IUJA 4LNAA 4Q9HA 3O8CA 3NC0C 5TC4A 1DAKA 2MINB 3BMQB 4LZPA 4ROTA 5A71A 3UO8B 5DP1A 1KSHA 1YIAA 2Y1CA 2WIJA 2BZSA 3WWYA 1XZNA 1IXZA 4M38A 4JI6B 2JJMA 3V2IA 5IF3A 1LPBB 2EKDA 2EBHX 3LXXA 1CBUA 3X1XA 4CLOA 4C0XA 4MWGA 4PAGA 1CUAA 1KMQA 3EDYA 4GZMA 5IF9A 4JJIA 4GWKA 1P1CA 2YMMA 3ODGA 3ZC3A 4CQMB 1N32B 4QOFA 3H7IA 2GHIA 1SCUB 2H2HA 3SEQA 4WBNA 3MN1A 2IYZA 3DQZA 3LI2A 1RQ2A 2YC4C 3DM5A 1T8SA 3QYFA 5KQLA 3T7IA 4BQFA 4IUBS 4R54A 2P2LA 3RVDA 4LNHA 2GPSA 2LR0A 4EGJA 5CGZA 1GFSA 5FFNA 2MHCA 5G0TA 4J3JA 3SS7X 5KSZA 5L7WA 4RPHA 4G8DA 1OC2A 1ISJA 4N82A 3DL2A 4TOIA 1P2DA 4W5HA 1T5DX 2RKBA 2WYHA 3UWOA 2P4UA 4PZ0A 3WAGA 1JEYB 4DY6A 2NMVA 1T8WA 3GRCA 3H1AA 4GSYA 5D5HA 3QITA 2VP9A 1M0SA 2OYSA 3B82A 1V8DA 1BQ3A 1X74A 5T4HA 5DYYA 1QG2A 4CG0A 4EFLA 1Z5PA 4DLAA 3MNFA 2WJGA 1DWUA 5EIHA 9LDBA 1MA3A 1P4JA 2DKFA 4XFJA 2OPHA 4AKGA 2D1YA 3HJTA 4HADA 5JFTA 4EX7A 1QOPB 4IGIA 4O25A 1RAIA 2LIVA 2NU6A 5CJ2A 4D0LB 5MDHA 1PJSA 5E9AA 1XK6A 1O95D 3UJ8A 1NN3A 2W4IA 1AUPA 4HB0A 4XA8A 4YCCA 1P4RA 5EHZA 4QPPA 5C8YF 1JPVA 1AKWA 1PD0A 1JHZA 1V9LA 3OZEA 4IS3A 3ILHA 4UU7A 1A9QA 5FTNA 1LJ8A 3TI9A 3VR0A 5D87A 1W4BA 1QU2A 2O9JA 3EGDA 1PR6A 3ROKA 3DHYA 1HEUA 2A6PA 1YRWA 4NK4A 2FK8A 1O97D 3BAFA 3SR4A 1AC5A 3HYCA 4GE0A 5DNDA 5LIPA 4EUFA 2F43A 5L3VA 4AIIA 2BGGA 3NKFA 2VK4A 3X1YA 2IBSA 4EENA 5G4KB 3WV4A 4K87A 1LX7A 4XUCA 4O4LA 4ZREA 2OFOA 3HY4A 4MUKA 4GZ5A 1X42A 1HF3A 1V4NA 2BMDA 3MTAA 3PFHA 4RFLA 3CHYA 2V7BA 4EG1A 5F12A 4Q3OA 2AFIA 2G9NA 1V1MA 2Y0DA 4JGIA 1EA7A 5LL6P 3BIWA 1O94C 1M2VB 1YSCA 2W6OA 4HDSA 1KS9A 1JHXA 2MSKA 2ZJ5A 3HVHA 3A6DA 3KVRA 4NONA 1QGZA 4ENUA 1DIGA 2HA4A 4NIMA 3NHYA 5F23A 5JQWA 3GFOA 1BVYF 2Z8YA 3IJPA 2ZVJA 3BXFA 3EOZA 1IMJA 3LUGA 1LSOA 1GTMA 1T8PA 1IUNA 3IPRA 3I8OA 3OCWA 1FXUA 1T1JA 2BKVA 2ZSAA 4OKSA 1VLHA 3MJRA 2ZBGA 4CEHA 4MV8A 1G55A 3FWHA 4QGAA 4RLQA 1PFKA 5T64A 1NVFA 3UW1A 3U37A 1RPTA 3A1EA 4CI9A 1Y8QA 1EFPB 2KYRA 4QHYA 2EZ4A 5EZQA 3RSHA 4EEKA 1REQA 3KQQA 3OU6A 3NV7A 4D3SA 1KBQA 4OJTA 4WJLA 4CLEA 4MB6A 3ETGA 2Q9UA 2WFMA 3E2MA 5TQVA 4F1JA 1NW8A 1JNYA 7YASA 4MZXA 1EJ2A 2ASVA 1XTPA 2Z3ZA 3IUQA 1NF2A 1U1EA 5TQ0B 4WLUA 1YT5A 5I4KA 2I1LA 1ONSA 2HM7A 3C6MA 4PZCA 3RANA 3H5WA 2VNSA 1SBQA 4LHSA 1UBOS 2G1JA 3CT4A 3P0JA 4NJOA 4XIJA 3A1WA 2GPTA 3ZOZA 4DDVA 1J5XA 1PZEA 4I9NA 3UJCA 1H4VB 1P61B 4Q47A 4AJLA 5KNBH 1ZCAA 1YB5A 5EMHA 1I2MA 2MYUA 2F8MA 3OU7A 3LX6A 4EK9A 2Q21A 1QPGA 4BC0A 1FUKA 1QORA 5AI9A 4P92A 4QUEA 4DREA 2W58A 2FH5B 3ENWA 2ZUDA 1B8OA 4WCDA 4WZBE 4C08A 4GMGA 3AUAA 4FDLA 2PX4A 1ECJA 1ZRHA 2W2OA 2YWHA 4KE6A 1EINA 3TQRA 2IK8A 3GIDA 1KQNA 3TR0A 1ZEJA 4UAVA 4OGWA 4RQUA 5BMOA 1IQ0A 4Q1FA 2XOKD 4B7UA 1RLOA 3PGXA 3L07A 2G25A 1DCMA 2FJ0A 3DMHA 3IALA 2ID9A 3O3OB 4GPEA 4JI0B 4UVHA 1EG2A 5HQ3B 2HEGA 1DCFA 1L4GA 1YR6A 2DF8A 4ND6A 3RBZA 3QEBZ 5DKFA 1Z6ZA 1GAEO 3DQQA 3TGLA 1TKCA 5BW4A 1PR5A 1X8JA 2O2SA 5BSEA 1U99A 1R12A 3M1IA 5BV0A 5IASA 5EMNA 7AT1A 1A4XA 2WZQA 4YRDA 3TVYA 3U5TA 2FNAA 3LCUA 4E31A 2OGZA 2Y2VA 4NU5A 4CMCA 1ZUNB 4RZ2A 1UT6A 3OJ0A 1ETHA 4YMWA 1YAHA 1TMYA 5AK5A 4EQ6A 3TSYA 5CCEA 3ABQB 3SWWA 1SIOA 4L02A 3UMCA 3R6WA 5KNCD 1SNYA 2J6CA 4BVJA 3NHPA 3ASZA 1N77A 3K9BA 2G5CA 2PD6A 3KHTA 2FRDA 2P9ZA 3QXJA 1U8AA 4PEVA 1DXQA 1PEYA 1V7CA 2ZE7A 1P1FA 2H1VA 2J3MA 4P5DA 5AWFC 5H3HA 3SBEA 1T3LA 1GYQA 1GPKA 3SN6A 2VTVA 4EFMA 1X13A 5J2UB 3IKVA 3IQGX 1M34A 4JB2A 1VKHA 3CH6A 4NAUA 1RYZA 2WHXA 3TMAA 3CNLA 1OKKD 2IP4A 2VP4A 3DPSA 1IN6A 3X2FA 3ZUPA 3E7XA 4HFJA 5FWYA 4FN4A 1BEZA 3EF0A 4J0HA 3EBOA 2GDJA 2OV6A 2HDOA 4DR6B 1Y9JA 1KDVA 1BKDR 3OQPA 2PJRA 3AETB 5EERA 3ZW9A 1EIWA 4HQOA 5FR2A 1Q0UA 1YIOA 4AWBA 3G7UA 5LMZA 3FX2A 3ZIAD 2QRUA 4A03A 2QHXA 4JBIA 4UUQA 1NF8A 2EV9A 4QLOA 2F1IA 2OV1A 3GLTA 1NWCA 3CWCA 2VPZA 3WBKA 1Q12A 3K0SA 2DJIA 4TMVA 2QYOA 1ZL0A 2FSFA 5LNK1 2BM1A 4GQIA 4RLFA 1A76A 2CLMB 1Q7RA 2PNJA 3W5CA 1Y6GA 4XDYA 4Z3DA 5IK2D 3ZHXA 4MA5A 4D9FA 1FSZA 3LQ1A 3VA7A 3EASA 3B3FA 2J5RA 3VKWA 2IS2A 2BM9A 1IONA 3FPEA 1JQJC 3L01A 3OPYA 4CV1A 3CN7A 3C70A 2EW8A 2AOUA 4IRUB 1PX0A 1L4HA 3OZXA 3PGVA 4PYIA 1VECA 2B94A 2XCRB 2XGMA 1I7SB 4G89A 3KXPA 2AKEA 2GZAA 3U1VA 3IXQA 3X43A 3DZ8A 5C1DA 2HFJA 1YC5A 3HKEB 4DNXA 5A4AA 2XCTB 5AVYA 2PKWA 2VNAA 3OQJA 3AEKB 3IPYA 3PQ7A 4GPAA 1USIA 1Y3CE 2A5DA 2H7YA 1EU1A 4R1NA 1QQAA 1O5OA 2PMDA 4E30A 4YGYA 1U5BA 1KYVA 4B1FA 3I12A 1CLUA 5K01A 3RYFB 4LDAA 3UJBA 3DLPX 3L5KA 2BTOA 3BZUA 4G36A 5LMCA 3H5IA 2I4OA 5CA1A 5HKAA 1ADBA 1ATIA 1GLNA 5BPHA 4FOPA 5DNEA 1AMOA 5I9MA 4HKTA 1NQTA 3IQDB 2RFLA 3F6BX 3DL0A 4LGVA 4LDJA 1JLSA 4Q0MA 2GZ1A 5AXCA 3OU2A 1V11B 4XX0B 1RWNA 3ADBA 2FY8A 2R66A 2OXFA 4IDGA 4OB8A 4XPZA 5FUVA 4DDUA 1NQXA 1M73E 2OAP1 3WAKA 1PN3A 1X1CA 4KQ1A 4Z3KA 2HF9A 2PLNA 3SXJA 1N4AA 1EX7A 2QVXX 1ESCA 2HIGA 1JYSA 4P53A 3IB6A 1ODLA 2JNWA 1LEHA 3OWOA 2I8CA 4UZSA 2UV8A 3TZQA 2UUPA 5BWNA 2QTWB 2VJCA 3BM5A 4M53A 4E13A 3GNLA 2GEBA 4QXQA 4W99A 1L4BA 4LK3A 4DIMA 1QK4A 2H85A 5JBQA 5KQGA 3NMUF 4F7DA 2NUPA 2POCA 2XNDD 1PK9A 2A1UB 3C3WA 4OHWA 5AK0A 3TKLA 1PG0A 5BNTA 4OI0A 5BSHA 2HIMA 1XVTA 1WNTA 2YBEA 3IYLW 5JDCC 2R1VA 4I1SA 2B69A 3PF8A 2HSDA 5I9NA 2VTDA 1FRZA 4X64B 3O90A 1KI2A 1W4RA 3QTLA 1XU4A 3FMIA 2G7ZA 4B6JA 4GP6A 5FBWB 2I3BA 4A6EA 1WCIB 3CEJA 5T8KC 4QJ3A 1SWVA 2D1TA 2VK1A 4R2MA 4W82A 3IAXA 4O0LA 1Q77A 4H18A 3QX7A 3G5UA 1ZHOA 3DOCA 3K96A 3CS3A 4M9ZA 4GYWA 3KQOA 3AVPA 1DKMA 2VHWA 2XVZA 2VYNA 4FHEA 4WD3A 4XYGA 2YN4A 3EXFB 3HM2A 1G59A 2O19A 1QCYA 1P8JA 1QC5B 3A6HA 4X1YB 1PK7A 2BFFB 2PT7A 3GWGA 4KH1A 4OUDB 4BU0A 2B82A 4ZCPA 5JNLA 3I1JA 3S2SA 1B0ZA 1TO6A 4F5ZA 5IXJA 1EZ4A 1M1YB 1DRJA 1ZIYA 1H2ZA 2WFAA 4HWTA 4PHCA 3VO8A 3W5BA 4RUKA 5A5GA 4KO1S 4NDAA 4PZZA 5BN3A 4WI1A 3G2KA 6GPBA 4ZALA 1QWSA 3MM4A 3HBJA 5FHRA 3ZE7A 4C6RA 4MQFB 4ZPXA 3X1KA 5B55A 1LKZA 4D46A 1LDGA 2B2CA 1AH2A 1UMDB 5JXGA 2DTEA 1G4UR 2CNWA 4OTZA 1BDMA 4J3FA 1E32A 2CLHB 1QTNA 1D7AA 2HHCA 1Z8NA 3DYIA 4U7GA 3ZWCA 4RTQA 3R6TA 2G08A 2PQ6A 2QMHA 4URUR 2IZOA 5HFNA 4EF6A 3K8YA 1LNSA 3JRNA 4TX1A 1UBMS 1XG5A 5DBHX 3MTIA 1F0NA 4N7MA 2BGRA 3DP7A 4WADA 1XHLA 4J0DA 4N5HX 4NR0A 4ZYZA 2JEOA 1R8YA 4CKWA 2XUGA 4EAQA 1F2TA 4EY3A 4H6XA 3TJZA 2IUYA 1M8GA 3CJTA 4BMPB 3T5GA 3IQFA 3EBPA 5BRNA 5AUPB 2GZMA 4LJRA 1ZM4A 4US2R 1U8ZA 3DQPA 3O26A 4YMHA 4RZSA 1U2DC 1ISMA 3ESAA 4UU1A 3WB2A 5L4SA 3DAPA 4A26A 2IUFA 1GZ3A 3K72B 3KAJA 3MG9A 4HDRB 3RYCB 1FDIA 1QOZA 2ZT8A 1V9CA 2ZYWX 4DLSA 1GNSA 4GR4A 1HYQA 3D2AA 4YRTA 4BN5A 1SFRA 2VPIA 4RTJA 3ABOB 2HCRA 2VG8A 5JG7A 4CUKA 5J2TA 1GPMA 5EHXA 5LZ9A 1NLFA 1HGXA 3T9BA 2IEDA 1JXAA 4L9SA 3BVPA 3KJZA 4ZGBA 1MOQA 2VQFB 1OH5A 1TX4B 4KAJA 5M29A 5K8CA 1GUFA 1ABBA 1H2YA 1T2DA 2OOKA 2RHDA 1C3OB 1NQVA 4HSEA 5LSAA 3T5PA 1MC1A 1QVVA 3JTEA 2A30A 2IOFK 2CLIB 2EFHB 1BVRA 4QEDA 3SVTA 3GQBA 4E15A 3GVPA 3N0WA 3TG2A 2WAOA 2G1PA 1OX4A 1X0VA 3NRJA 4ND7A 4CR6A 3ZVMA 4OHYA 3WQHA 4BWFB 5AJXA 3HGMA 1SOWA 4HN9A 2F9LA 1CUWA 4IIGA 3WMXA 4WZAE 3RC7A 1O58A 3WL3A 5K0EA 5GIPE 5KTOA 1NYRA 2RH4A 5C32A 4LISA 3SFTA 2GPAA 4Z0HO 4YV7A 3PP8A 2QI9F 1FQJA 1YUBA 1BFDA 4I6JA 4WQMA 3D7LA 4DGQA 5EXEA 2BSAA 2O8DB 1Y8AA 1EDBA 3CX7A 3GLFE 3EQ9A 3PUXA 1IEWA 2OQVA 1D6JA 1L5SA 3LPDA 1XPRA 3PXBA 2AN1A 1GGFA 3H2YA 4R2WA 4DLZA 2YS7A 4L3WA 4GMFA 1QIDA 4KZKA 1Y7LA 1KFJB 4HEHA 4DANA 2OHOA 3TD6A 1ESEA 2ORYA 2OXEA 2CD9A 2VPYA 3P32A 4OPMA 3E8XA 2OC9A 3BREA 4ZC8A 4ONEA 1E9CA 4LDZA 4P1ZA 2QLNA 1VIVA 4F11A 4FWTA 2V3VA 3A3OA 3KJHA 3UVEA 2C5LA 4KVAA 2JI9A 1K7FB 3C3AA 3NHJA 5EZ6B 1CJMA 1CUBA 1J8DA 1OW3B 3VAZA 5KREA 3R8XA 1RZRD 1W44A 1B8PA 3BWDD 1NHWA 2E82A 4IW3B 1G1AA 4WN9B 3RNLA 4FYXA 3ZD9A 4ESHA 2QTZA 1C9MA 1KYZA 2NUAA 3GLIB 1KNQA 1XK7A 3CRQA 4JKIA 1W6RA 3ORRA 5D84A 1JBKA 1YI8A 3EEFA 2J48A 2ID7A 2Q62A 4O4HB 1L7QA 1SUDA 5G1OA 4W63A 5CG2A 1ZOIA 2IYEA 1WG8A 3R7SA 2HJHA 2QI9C 1E2IA 1SKYE 3H1GA 4PZAA 1SD5A 1FBTA 1OZ0A 4MUJA 2BTEA 1EMDA 3KSZO 4MRMB 4RJLA 2VPWA 1MABA 3OPNA 1E3EA 1GN9A 3KPWA 5AJUA 1N5RA 2WSSD 2YMQA 3QMMA 4K9DA 1OI7A 4IR7A 1PT6A 5E4JA 4F3TA 2YOGA 3F71A 2IU0A 2QR3A 2YUTA 5BOSB 4BRSA 5KOYA 1LWOA 3A4TA 3PIRA 2MDTA 3QXCA 4LHVA 4EYGA 1XRMA 2JBAA 1X1QA 1XJ0A 4JP3A 5DM1A 1XA0A 4KP7A 2WBLC 3HDJA 4DPMA 4CR8A 1E4EA 2QQEA 5DLEA 3QHQA 4BNFA 3JYOA 1YKFA 5AVOA 3U3MA 3HNPA 1D0VA 1J8QA 1JLHA 2WFZA 3C7CB 5DMXA 1PVDA 3V4OA 1Q1ZA 2ON6A 4J94A 2QMEA 4CKYA 4DDHA 5JRJA 1AUVA 2RH9B 3TIIA 5JEDA 1DJNA 4HNAA 3G9ZA 2X0RA 4CM5A 4PNHA 2CXUA 1EGAA 2HH9A 1A8UA 1U2GA 5JCZA 2XYRA 3OFND 2QLMA 2V7EA 5BQFA 4HDNA 3LM8A 4PYOA 4RK5A 3NQ41 2JFOA 2NV2B 5K05A 5FP0A 1T5TA 3W6OA 3NBKA 3H1PA 2P75A 1SOVA 4GW3A 3TLZA 4E7OA 3OOSA 1CJBA 1BA3A 2AF3C 2I6GA 3PI7A 3UOGA 4URHA 4MWOA 3JATA 4Y7DA 1E6LA 2UYYA 2H52A 2OQ2A 4CHGA 1XXHE 4MPTA 4EZBA 5JD5A 4PAOA 3VVLA 3L2OB 3I23A 4FU0A 4RKQA 2GYWA 3ABRB 4RF4A 3RRNA 4QODA 1T6BY 4B7ZA 2OHGA 4RO0A 4WA7A 1E1CA 4IWNA 4P6VF 2YS6A 3ZWYA 5ALNA 2XTAA 2FFAA 2CJXA 1QLWA 3WB1A 2P1DA 3RFUA 5J4YA 4B5KA 1XDZA 4AZ0A 1I5RA 2P9HA 1DX4A 3VPAA 1T3TA 5E6RA 4O3MA 3G0HA 1NVMB 2HV9A 4ZJZA 1MXHA 1Z4PX 2CUNA 3AMVA 3MWFA 3ZHOA 1QFJA 5I3ZA 5JISA 2VEDA 4F45A 4MDHA 1ZGCA 5ELLA 3GBPA 5K6TA 4M8IA 1O03A 3DZDA 1JDZA 5FH9A 1E8DA 1RYBA 4L16A 2WSYB 5GAJA 2IYYA 3KTDA 3QWHA 4JLOA 2X5KO 3NEJA 3NHFA 4PG7A 4HLUC 3AH8A 1Z5NA 3OESA 1UEJA 3OUTA 4LNUB 3WJ2A 1OXBB 4BVFA 4CQNA 1ULAA 2ZVDA 1VG9B 4LHWA 4FGLA 4XJVA 4JEUA 4AO6A 1KH3A 3W9SA 5AO9A 3C4VA 1VKZA 1F2UA 5K8TA 1A9ZA 3AIIA 1J99A 4UTVA 3SSOA 4AURA 1GSHA 1UXOA 1QO0A 3H99A 1ULHA 1F2VA 4TVKA 4DNPA 5JMOA 2XGGA 2VCYA 3LQKA 1OR8A 4OXRA 1SC4A 2IF0A 3BXZA 4G0PA 5EHGA 3U9LA 4DCCA 5AVRA 2I2FA 1KYTA 4JAVC 3RAPR 2WU8A 4HN4B 3IT3A 4KFTA 2PH5A 3QM1A 3KTAA 1DXOA 2JARA 2C84A 2CVQA 4OQ4A 2R8RA 1S2NA 2XDYA 3BGVA 1T5SA 3HVIA 1U0JA 3MHPA 2VH1A 4J4BA 4R2KA 2AXNA 5EPOA 5K0NA 4YT2A 3IDFA 3FPSA 1GEEA 1MG0A 1DHRA 1DIHA 4XPIB 4HB2A 3G2IA 4IDHA 5K09A 5CP8A 5AI4A 2GOYA 1HETA 3P9ZA 1PCXA 3QV1A 4HAZA 1Y48E 4QBTA 4CKCA 4QO8A 4RKWA 1VOTA 3UBMA 1E1KA 2AD1A 3IEKA 4RLHA 2FSVC 2R6CA 2WTAA 3FPLA 2PZ8A 3QW2A 4JUFA 4MWBA 1KI1A 3VR4A 2RD2A 1U0GA 3GO4A 2X0JA 3PF9A 1C80A 1YJCA 3GZJA 2WHEA 3IELA 4QEZA 3LJKA 3SIWA 4GM0A 4YRMA 3NASA 3A6JA 3CRRA 2OCLA 1YQ9A 3CUYA 1M2FA 3LQFA 4GECA 2HY7A 4K9MA 2GPBA 3GD5A 4GVPA 4NMHA 5FPQA 5FBZA 3UMYA 3EFEA 4G5FA 1EESA 3H3JA 1KMNA 1PZHA 2FMUA 2MINA 3QE4A 3AUUA 3UA3A 4DXAA 2ATCA 4NQRA 1PV2A 3RHTA 1XF9A 1EM8A 1GUYA 1QFZA 3I2JA 1GYRA 2CF6A 4UFOA 1Q1GA 1MR3F 1CPYA 4EF5A 4PN7A 2XUFA 1EK5A 3GT7A 3GGSA 5IVKA 4FYJA 1Q6YA 2BELA 4QBKA 4CQMA 3DTVD 3FH0A 1SCUA 1E0JA 1SHUX 4PW0A 4XLTA 4YFYA 3IJRA 1YGPA 2WV9A 1QYDA 4RGBA 1RWQA 2NWQA 2GGSA 2VRCD 5AW2A 2PSEA 3GRZA 4Z4CA 2X3YA 4JD5A 5CA0F 2G6BA 3LPAA 4EX6A 3MRXA 4PAWA 2JHGA 2J9XB 3C4JA 3PD1A 4V1CI 4IDNA 1ID8A 1HSOA 1ZJJA 2V7QD 4C7XA 4MQBA 1Z4MA 1SXJE 3AFIA 3DEZA 4EI9A 1Z0DA 4GX5A 1RCTE 2BHRA 3ZDRA 1TVEA 1JEYA 2ECQA 4WT7A 2YR0A 3SI7A 3DL7A 2XRZA 2BAGA 1DC4A 1J0BA 1R9NA 5LP6F 3W04A 1S2MA 5U4XA 3PE4A 4YCJA 2HWXA 4AMUA 3T5CA 3AVTA 4AZTA 2EJBA 3EW7A 3HA5A 3GFQA 1GUZA 1XTQA 3VSCA 4MULA 1OH7A 1O6FA 3BPSA 1IEVA 1J7JA 4NBNA 4MVJI 2JIZA 3CA8A 4Y98A 1KDYA 1L5WA 1MP0A 1PWZA 4PCAA 4AUKA 5I7UA 3KVOA 4I4NA 3TIFA 1ZR2A 4NVRA 5FIUA 5HE8A 3GEMA 5KSYA 4MP3A 1E3MA 2O2HA 2C2ZA 1AXGA 4GOXA 5CYOA 1C7EA 2ZSKA 1JR4A 3H5VA 1W36B 2NZWA 3TR5A 4RPIA 2C8LA 1JKXA 1QIEA 1UBEA 3O7MA 1I7NA 4K5QA 3UHJA 4E3ZA 3EPRA 3M6IA 1OTXA 5B6JA 5FOWA 4GF5A 2EYQA 4INJA 4ENWA 5DN6D 4DIOA 3A0RB 3C3YA 3BD8A 1RBZA 3K9GA 3GJ7A 1FLDA 4EG3A 4UEJA 4I50F 1JSRA 4M9RA 5G4KA 5ISMA 1WX1A 4PVDA 2SKEA 1A7JA 3FSGA 4EVQA 1R5JA 1YB7A 4N3CA 2X8JB 2GEDA 2R2AA 2V6MA 5CCDA 5K0BA 2QN9A 4DR2B 3D2BA 5K4HA 2FDXA 3IQHX 1EE2A 3KU4A 4ZOLB 4PNEA 1YZFA 4P7FA 3TF5A 1OAKA 4QDXA 1YA6A 1F5NA 2XYQA 4BE7B 1M2VA 2QMYA 3FCUB 3A9SA 3M6VA 2OECA 2I67A 3K70B 1AQJA 3TFQA 1OTYA 1Y1LA 5GY7A 5IS2A 1QVRA 4M6WA 3I6BA 3N0RA 1LU9A 2CSXA 2PFGA 1U3DA 3W79A 2AA3A 3GPBA 4G85A 1G9TA 1B6GA 3OLWA 4IG4A 2EGHA 1J06A 3C4QA 3IBFA 1P4SA 2J9RA 4L5YA 4OJNA 1Z6YA 1RKBA 5EINA 3ECAA 1NVGA 3SXUB 2BSQA 1MXFA 1Z6PA 3GAFA 4RORA 2RGUA 5DYGA 2R47A 3BWCA 4JL5A 1QAMA 3E84A 1DIOB 1CZKA 1TL7C 2B6NA 2WMDA 3IFSA 2YHSA 3KYDB 1E7MA 2J7PD 4GOOD 2X9NA 3FVVA 4QFCA 2OM6A 4DG9A 3BCUA 2FR1A 3HVKA 1XVAA 3O83A 3QLUA 1UWLA 2CHEA 2H54A 4HAXA 1JEOA 4O2BA 4D9GA 3VTAA 1JL3A 3ECCA 2PPVA 5LQJA 1RWXA 3REQA 5B3LA 2VYQA 1QKKA 1VGVA 2GR9A 1KZ1A 5IBQA 4BEWA 5CB4B 3U6BA 1NXVA 5CDSA 4I1RA 4YMLA 1L5MA 5KNBA 1L8AA 3NZEA 4G4SP 1PVVA 1VCNA 4FZ5A 5F52A 3DMDA 4RV4A 1IULA 1Q7CA 1KZ6A 2NVUA 1ECGA 1T0IA 1C9KA 3KQHA 5KX5B 3KEFA 3QKSB 3GELA 4GEGA 3B8EA 1RM0A 3BAZA 1IC6A 3A9VA 3OF2A 4HDKB 2PBLA 1CJCA 1W2HA 2DQYA 3OC6A 3HZOA 3CY6A 1FEZA 4CT5A 5B4UA 5LYJF 5FLXA 4KX5A 2ECKA 1NU6A 1NVAA 5AOVA 3ESDA 3FCEA 4BDTA 4HMQA 3V80A 1A3CA 1HLFA 4XRGA 3SCZA 3BWXA 2VAWA 1BW9B 1SK9A 4HG2A 1VQ1A 1NRJB 1JTVA 1A5AB 4J43A 4MUXA 4Q7JB 1GNVA 2C2HA 3T4XA 3TO5A 4IIYA 1QCCA 2FR0A 4KRGA 4OQZA 1PW5A 2EKZA 2N0SA 3OT1B 1MH1A 3U26A 5JJBA 3TIVA 2RH5A 5TPWA 4LI3X 2QLBA 3DNPA 5I01A 2UVQA 4KGXA 2JLZA 3T3NA 1ZD1A 4WXEA 2PKQO 2ZE8A 4JV5B 4DC9A 2EP8A 3K5PA 4XWTA 1TQ2A 3WC4A 1RLIA 1PE0A 2ZSIA 2FWRA 2V6IA 4I1IA 4JOCA 4OXNA 3SE7A 5I51A 5IG2A 1R4MB 5D6OA 1NULA 3N87A 1CW2B 4G07A 3WFZA 2WJPA 3CVOA 2O7QA 2Z30A 3DBLB 2AC4A 1ZUNA 4PYKA 5K7SA 3GVXA 2Q28A 3C6QA 3AO0B 5T4EA 1JT2A 1RXYA 3Q6NA 1HEYA 3PRHA 1AF4A 1WBJB 5T6MA 4R7ZA 4RNDB 3FR8A 2PH1A 5CEFA 4EG4A 1Z0ZA 2ZSJA 3JWJA 1V3UA 3MRTA 1JWBB 6CHYA 3WLJA 4BIMA 5D3QA 4RMJA 3B1WA 5FUBA 3OHSX 2A1IA 2QJOA 1YRAA 4FMBB 3BQNB 4JC0A 1OCEA 5JAHA 1N2OA 4QE3A 3M6XA 1FDWA 3PQFA 4UDNA 5J2UA 2ZPAA 1RYNA 4QAJA 2OBFA 3HO6A 3VV2A 4BJHB 1XVLA 5TE9A 3TOCA 3N2GB 2YHAA 1H3FA 4IQ8A 5J59A 3C24A 2XYGA 1KZYC 4YJ3F 2D8AA 2VYCA 3FHLA 3OSZA 4N3NA 1JEEA 3DBHA 3EK2A 1OFIA 1E3IA 1J7KA 1LK0A 1LK5A 3CZCA 4A9AA 2VAMA 1UKZA 3L46A 5JJKA 2Q0SA 2JRLA 2QYSA 3QYPA 4J2OA 4EB6B 1CC1S 4J1NA 3VYUB 1Y9ZA 3WI7A 1G2IA 3B85A 3KETA 1P18A 1LPPA 2JGAA 4QFBA 2FLWA 3GY0A 4TV9B 4YB8A 3STVA 3CB2A 2BYTA 1M5UA 4K8OA 2ODEA 3Q41A 3WMGA 4ZV4A 2AYXA 4CN8A 5DXJA 2QVYX 3I9NA 3P94A 5IRCD 4BTEA 2Q0HA 3H9UA 1RPZA 2PLAA 4EO4A 3VYSB 1U9IA 1XGKA 3CUEF 3I58A 1JNXX 4BWVA 1Q0QA 1R10A 1XFDA 4QPDA 1P0CA 4LJ4A 3W3ZB 2EJWA 3NHMA 1E94E 2YICA 4LX8A 1N75A 2PJUA 5H5JA 3TZHA 4ES6A 3UC5A 5LM3A 3G9QA 2IX3A 4OOFA 3RREA 5FWXB 1BCSA 1YFJA 3SQXA 4Q1DA 1F20A 4N6GA 1JAYA 3HKEA 3VZSA 4M1OA 1JPNA 4G67A 1JDBC 3T12A 3WGKA 3AEKA 4J2TA 1YV9A 2XRMA 3QVVA 5JSHA 3OTGA 1DX9A 1ML4A 3ZD6A 1CZNA 3H1FA 5CX4A 4AUNA 1EFRA 4IVQA 1VCIA 2X77A 4HXGA 1J23A 4K2HA 4BFLA 1AKNA 4B6GA 5IARA 3GN2A 1PJ8A 3V4LA 5CIQA 1F1JA 1ZVJA 3GEIA 5AUQA 3RYFA 3PEYA 4OM8A 1BZYA 4CKXA 1DPFA 4NHEA 2ORWA 1W0JA 3AL2A 4L9AA 3V97A 2CXHA 5HBRA 5DXFA 1TUGA 5BR8B 3OZGA 4XFKA 2G83A 4WTOA 4IL5A 3R6GA 1KJZA 1HA3A 2X4IA 3D7SA 4PC2A 4URFA 4X7RA 7ADHA 4CEIB 1W29A 4KPUB 4FR5A 3UG7A 4M1KA 1V11A 4XX0A 1CUEA 2DKOA 3H2IA 4Z9AA 1KSFX 1XO1A 3DUFB 5KU1A 3PGKA 2B8NA 2A5FA 4GL2A 2JL1A 1LLUA 2P2DA 4M1YA 1IXSB 2BJWA 3NTXA 4NBKA 4BB6A 2LNDA 3KPVA 3ESYA 3ANXA 2CMDA 1SB9A 1Z0JA 3TB6A 5GZ6A 2DPYA 2J3EA 3AUKA 2YV1A 2VHEA 1A9RA 3EVEA 1JIIA 2CL5A 2Q27A 5HKKA 1YZVA 221PA 3HR7A 4N8DA 2E4ZA 3R74A 1FP4B 2GD6A 2ZITA 1TJPB 3KU1A 1K8ZB 1SAYA 1P9RA 1SG0A 5IU6A 4TV8B 3QNMA 5H8WA 4RDCA 4UOQA 2JCVA 2Z4TA 1YHZA 2PQ2A 3CZ9A 2IV2X 3HDQA 3UK7A 4WH0A 4DA6A 2CJWA 4D9IA 2J67A 4EECA 4O4IF 4WJKB 5C34B 4D9KA 5ITWA 1G20E 1PFUA 4QOGA 1G2QA 2GB4A 2J3QA 4OSEA 2H48A 1ORDA 3ESZA 3KKKA 5TEVA 2MMGA 2WHRA 2QL5A 2VZEA 1WCIA 4QYIA 2ZJBA 2G9UA 4ARAA 4MCHA 4DV5B 3CRNA 1K92A 4DB2A 3DKKA 1QX4A 5L4LA 3KKMA 5M5BA 4HS9A 2WNIA 1ZD4A 1ZK0A 4AMBA 4WA8A 3DE4X 4NCXA 4