3A4VA

Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
311
structure length
311
Chain Sequence
b'MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 122
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a4vA00
4KQWA 1LLUA 2FPPA 4BOYA 1E3EA 2XOXA 1BGVA 5JYDA 2P5YA 5TT0A 4NDNE 4QO8A 1J49A 1HKUA 2D1YA 2PH3A 1QR6A 3DO5A 3W8DA 2EKLA 3I9LA 4IJUA 1KVUA 3CMCO 4Q39A 1GYPA 1L7EA 3GT0A 4FQ8A 4NI5A 5A9TA 2V6GA 5IN4A 3S55A 3WBBA 3ZWCA 1DIAA 3KYCA 1XEAA 4MVJP 1GFSA 4OXNA 1UXIA 4HADA 2YV1A 2HK9A 5JY6A 1NHWA 4YAKA 1NTOA 1H94A 1MG0A 4GQAA 1PTJA 3JD0A 5CHEA 3UVEA 1U3UA 3E48A 4B7CA 3IIEA 4CMKA 1PGNA 5IN5A 1PX0A 4PZDA 3GHHA 4PIVA 3C85A 1HEUA 4GVXA 4A26A 1ULUA 2O3TA 3I9JA 3ONDA 2B35A 4CR7A 5THQA 3VZPA 3JQ9C 4A0SA 2YDYA 3TJRA 3AY6A 4CMEC 4II2A 1N8KA 4QO7A 4QT0A 3E9QA 5AXBA 2Q1SA 4XCVA 4ALIA 3K73O 4H3VA 3F1KA 3KSUA 1ADGA 3CXRA 4JJFA 3W8EA 3E8XA 4WUVA 1GAEO 1OC4A 4E2YA 3NAQA 3OJLA 4W99A 5JPIA 1OOEA 2DVMA 3OICA 4JN6B 3A9WA 4MVJG 1LUAA 2X5OA 9LDTA 1Y9EA 3ONEA 4XYLA 2CD9A 1XSEA 2PZKA 2VHXA 1UZLA 2IE0A 3UHAA 1P1JA 4O1MA 4E31A 1R4NB 4MVJA 2NTNA 3HDJA 2P9CA 1EFKA 2GZ1A 4YAEA 2E6UX 1PSDA 4OH1A 3SX2A 4M49A 1ZIDA 1EFLA 5A05A 4JK3A 2JAPA 4JROA 1HL3A 1YL6A 3FF4A 3G3EA 2NTJA 3K2BA 5KJFA 3P2YA 4ZQHA 1LDBA 3QJ5A 4E5KA 3L6DA 2OOSA 3C7AA 2VRCA 2JCYA 4NH4A 5TSDA 4M89A 2X1HA 2EHDA 2RH4A 2Y05A 4ILKA 2DBRA 3JQ6A 3BAZA 1C1XB 4PRLA 5C37A 3CE6A 3WJ7A 2NWQA 2YY7A 3ETGA 4B4WA 1MXFA 4IZIA 4YJDA 4JGBA 4L4XA 4XQEA 4AJLA 3I9KA 5AOVA 3V2HA 1IY8A 1HXHA 3LT2A 4F45A 4WLVA 2AHRA 3ZWXA 1M6HA 4B8WA 4BNJA 5MGBA 2X0NA 4NBRA 1PS8A 4O59O 1ISGA 3EK2A 2JKVA 3ABIA 2O4CA 8LDHA 2CMDA 2B36A 1TI7A 4ZN6A 3JYQA 4MKZA 4DGSA 4F6CA 3RAJA 2B4QA 1DB3A 3TWOA 1PWZA 3U4IA 4CUZA 1WMBA 5I9NA 2HRZA 2RIRA 4WNCA 1ZBQA 2EG9A 3BHMA 5TC4A 5EN4A 3WGHA 4BKPA 2O2YA 3H9QA 1W6UA 4DMLA 4MVJI 4CL3A 1X1TA 1X7HA 3NX4A 3Q0EA 3RJ9A 1TVEA 4MOWA 2VYND 1EUCA 3GEDA 4U0JA 4FGWA 3OJOA 3ZZNA 1Z74A 5A02A 3DHYA 1F8GA 3FTPA 4YWJA 1AHIA 1P74A 4WGGA 4PFJA 1YQDA 3DBHB 4FFRA 3S8MA 4AJPA 1Q7BA 4B4UA 2OGUA 4GMFA 2PR2A 1Y81A 2UV8A 1ZFNA 3QW2A 3PWKA 5AYVA 3GUCA 2R6JA 4JJGA 3HNPA 4A2CA 5CDUA 1DXYA 4BNLA 4RVGA 4FFPA 4U5QA 4BNGA 4L4RA 5KCZA 4BGEA 1N2SA 3NJ8A 4P38A 2J3IA 1EVJA 3FBTA 3ZWOA 3ZWVA 2A35A 4BGVA 4AJNA 3GF4A 1T2CA 3FNFA 2I9PA 3B1KA 2GUGA 3EUWA 4MINA 4Q3BA 4YQYA 1IOLA 3WWYA 2RH8A 2Q1UA 4EUEA 1HZZA 2J5KA 2PKQO 1YXMA 3DZBA 1M6WA 5IAAA 1H93A 4H16A 1LSSA 2GLXA 1U9JA 3G79A 4RLHA 3PZBA 2NVUA 5DCYA 4LN1A 1ONOA 3RBXA 3KO8A 4MVJE 1MA0A 1U28A 4QECA 2J8ZA 1IHYA 1P1FA 4JP2A 4RF2A 4BO3A 3F5QA 1GYRA 1QYWA 2WDZA 1B15A 4N54A 1GUYA 1EQ2A 3GGPA 2B37A 4FW8A 1ZSVA 3QWHA 1T2DA 4EUFA 1CEQA 1HZJA 2HAEA 3FD8A 2IXBA 2QRKA 1W8DA 3FNEA 3BHJA 4L75A 3UN1A 1E3IA 3F46A 3GGGA 5IXYA 4NR0A 1PJBA 4J7CA 2WEKA 1R6DA 2VZ0A 5U4QA 4YJHA 3IMFA 3V1UA 3DBVO 2ZIZA 1Y8QB 1CRWG 3DEYX 4CV3A 2IZ0A 3GDOA 3JQ8A 1ZSNA 2YFHA 3L0DA 1ZEJA 2H9IA 1KBZA 3JQCA 4CM6A 1EUZA 3IOYA 3VZRA 3F3SA 2CF6A 1DC6A 4D3SA 2AEJA 3FWZA 5HRUA 4YT2A 3UOGA 4JBGA 3C1OA 2P91A 3M1LA 4JIGA 4TSKA 3GG2A 5C3MA 1PQUA 3W1VA 3GVPA 2QQ5A 2OL4A 5CDTA 4WECA 3HB5X 4KQXA 5A5EA 3H9EO 5EJ2A 2O3SA 5G0SA 1ZNQO 3WTCA 2BFPA 4BNWA 4WOKA 1C0KA 2GR9A 5F1PA 2HUNA 4IXTA 4EDFA 4J91A 1H6BA 1GTMA 2C2XA 4NZ9A 1HDGO 2RHCA 2Y0DA 2HJRA 3EHEA 4MJLA 4W4TA 5T57A 4AJIA 1O95A 1R66A 1K6IA 3V1TC 4YDRA 4Z9XA 1KVTA 4GSKA 1ISHA 4ALKA 3QWAA 4XYBA 4NBUA 1VL6A 3EMKA 1GL3A 1QYCA 2YHIB 1K5HA 4BKQA 1LNQA 3INRA 2GN4A 3BA1A 1OI7A 4IIUA 3H5NA 3UICA 2QRJA 1MXHA 4OO3A 4DQUA 5JW6A 1LQUA 3HWRA 3CEAA 3DBLA 1B0AA 4PZCA 3PFWO 3OQ6A 2RBEA 2JD1A 2AG5A 4CJXA 3ST7A 4BNKA 2Q46A 3NJ4A 3UUWA 3A1NA 3W4KA 4AICA 1BDBA 4AJ4A 1DIBA 3KSZO 4CMGA 1HT0A 4IJWA 5EQDA 1V9LA 4ALNA 2P9EA 1E5LA 4HXYA 4CV0A 2E82A 3HG7A 1KEWA 1OMOA 1BDMA 3RASA 3VH1A 5COBA 1K6XA 2YV2A 3JYOA 3VVBA 4OYRA 3U3XA 4L0QA 1I36A 1EVIA 4D3FA 3JD3A 3CINA 4Z3DA 1B26A 1GV1A 2ZK7A 1PZGA 1I10A 4E2WA 1IPEA 3O38A 3BMCA 1J0XO 1NAIA 3O9ZA 4XZ3A 1E3WA 1PL7A 4G5HA 2OFPA 4RVUA 2G82A 2PLAA 5KIAA 1PR3A 3I83A 1EVYA 5DNAA 5A06A 2Y0CA 5T64A 2PV7A 3U49A 1QYXA 1A72A 3JQAA 1CF2O 4IMPA 1GDHA 5TT1A 4EYEA 3RIHA 4PRKA 4QEDA 1HDXA 2VTEA 3IS3A 1D3AA 4CM5A 3BTSA 1VKOA 5F3RA 4FC7A 4YQZA 4FBGA 4BQRA 3IKTA 1Y1PA 5DDIP 5JDCA 4RGBA 3UH1A 2IYPA 2JFHA 3GRKA 1EMDA 1DIRA 3ENKA 5DP1A 2NU6A 4B79A 3VAZA 3ZNPA 2PA3A 1HDOA 2EJVA 3OM9A 3AOEC 4CPDA 1SPXA 3VPFA 1I5RA 3ADOA 1SZJG 1U5AA 3UFXA 1I8TA 3CTMA 2FZEA 1KVRA 4BMVA 4F46A 4E33A 1PJLA 3PHJA 4RQTA 3GGOA 4J4TA 1DOHA 3B6ZA 1J5PA 2AQIA 4R4JA 5FI5A 4BNMA 3TFQA 3NT5A 5JE8A 3DONA 5T8KA 1E5QA 1RM5A 1YOVA 3EC7A 1QP8A 5JC8A 4M54A 3VC7A 4KTVE 4ZVVA 1P31A 1M75A 4OM8A 1ZUD1 4I5DA 2DPGA 3TDKA 4CM4B 1O5IA 1N92A 3Q9NA 2ZQYA 1WXDA 5FF9A 1PQWA 2O7SA 1TB4A 2H1SA 4K6CA 4BNYA 3PIDA 3IUSA 3JQAB 1DIHA 1DAPA 5BR7A 4ALLA 2BFAA 1PR9A 2ZB3A 3LT4A 3FI9A 1O0SA 3HQ4O 3PRJA 2QYTA 1Y8RB 3RU9A 1M66A 4YAGA 2WE7A 3R1IA 3H2ZA 2ZTLA 3NTOA 3RFXA 1MC4A 5TIIA 4LMRA 3DFZA 3K9QO 4FB5A 4JXKA 1I2BA 3AY7A 2PZMA 3ZHZA 4O6VA 3RC7A 3WXBA 1VSVA 1T2EA 3BHIA 3TQHA 4Q3NA 2XPCA 4J1NA 1GQQA 3DBRA 3E03A 1I30A 4ND1A 4Y6RA 4DWVA 2QZ9A 3ZU3A 2GCGA 3A14A 3ZW8A 1Y9AA 5EMHA 4J3FA 4XIJA 2UAGA 3VTFA 1PJ2A 1WAMA 3QVOA 5JCJD 2X4GA 2I3AA 2W98A 2X9GA 2TMGA 3Q2IA 2ZATA 3DZIA 4GX0A 3MJCA 3PFFA 3BTVA 1DC3A 3WSWA 2LDBA 2W2KA 4YEDA 2GRAA 3OA0A 4YAIA 4BNUA 3DTYA 4PN3A 4OGWA 1O6ZA 2GD1O 4NU5A 1FJHA 2CNBA 4Z0HO 3D3WA 3WGZA 2VYVA 3RU7A 5BNFA 1QKIA 1PZHA 1UDAA 1Z7BA 1YKFA 3JSAA 5G0UA 4BKOA 3R6DA 5HWSA 3JD4A 1R0LA 4B7XA 4G65A 4W82A 2YHUA 2VN8A 1QYDA 1B3BA 4WKGA 3BMOB 1OC2A 1YH3A 2NNLD 4CQMA 3TZQA 4UUOA 4WASA 2J5QA 3DWFA 1AUPA 5JDIA 3LC7O 1ID1A 4A10A 3DBRB 1KC1A 3SLGA 1P0CA 2PWZA 3RROA 2C29D 1HWYA 4W6ZA 4XQ9A 5B4VA 1W0CA 4DLLA 1ZK3A 4HUJA 4AJJA 5JAIA 2GZ2A 1CQIA 3ETEA 4CUKA 4GWKA 2FOIA 3KYDA 3ADPA 1YDWA 3WB9A 4BO7A 1SB9A 1B8UA 5JMPA 3K2EA 1XWFA 1LBEA 2HO5A 3AI1A 2ZKLA 4RF3A 1ZK1A 1Y5MA 3GUYA 1MFZA 1JTVA 2B4TO 3AM3A 4ZRMA 3WG9A 1ZMOA 4NBWA 1VC2A 1HRDA 5JAQA 5BNTA 3GA0A 2V7PA 3H4VA 3PLNA 4R5MA 3FBGA 2FWMX 3GMDA 3UKOA 3RD5A 1N1GA 4AJKA 3DTTA 1QORA 3PDJA 4JBHA 2VRCD 3S2FA 5DBIA 1B8VA 1F0YA 3RQSA 1E3JA 2J3HA 4DVJA 1U4SA 4PLHA 4ONEA 1FK8A 2BKAA 5KJEA 5EINA 4OSPA 3D5TA 5CEJA 3MJVA 1PGOA 3ROKA 1D4FA 1U7HA 3GAFA 1D1TA 3GPIA 2V6BA 4PLPA 1JN0A 1WVGA 3OIDA 3U4DA 4KWHA 1ARZA 3W4IA 1QRRA 2YV3A 2DAPA 4CLOA 2QG4A 1JLLA 4ID9A 3PYLA 4Q3CA 5KVQA 1VKNA 3N74A 3I5MA 4WE3A 4L9RA 4R5HA 1FMCA 5GZ3A 1IZ0A 1VJTA 2JCVA 3QA9A 4RO0A 4CLDA 1MGOA 3MWDB 4CQLB 4CR8A 1X14A 1JAYA 4JLWA 2O4UX 5TGDA 3WGIA 3HJAA 3LVFO 1EK6A 2EP7A 3KVOA 1V8BA 2FPIA 2FN7A 5C7IO 4JNKA 4BKRA 4MPDA 2Y1FA 5MDHA 1YB4A 4INAA 1V3TA 2WM3A 2Z1NA 3GZ4A 4FD3A 4LSWA 5JO9A 2G76A 4GWGA 1UAGA 1NPYA 3EZLA 2NACA 2D5CA 3C7DB 5ES3A 4RDHA 2FRDA 4J7XA 4PG6A 1R4MB 4XR4A 2B4RO 3ZU4A 5THKA 3S1LA 3ORFA 3JQBA 3ROQA 4FFLA 1YWGO 3W4JA 4LRSB 2D2IA 1KY4A 3RFTA 5B4TA 2DQ4A 2X0RA 3WYEA 4EEXA 3RVDA 4CL8A 2C07A 4L76A 5IF3A 1QMGA 3KM0A 2NU7A 3QVSA 2WYVA 2O3QA 3DMTA 4I08A 4CLOB 3GRPA 4CUJA 4W7IA 4KUHA 1Z82A 2D59A 1Q0QA 3ENNA 5EQFA 2ZYDA 2DBQA 1O94A 1V6AA 4KWIA 4AJEA 3G17A 4DIBA 1GYQA 3LLSA 5B37A 2FP4A 3T7CA 5TNXA 1PEDA 2EF1A 3RUEA 3GN1A 4PZEA 3HDHA 4RQUA 3FTNA 1ADFA 5K9ZA 4HFNA 4OKIA 3GVHA 3OJ0A 4B3IA 5A5FA 5JAMA 1JDJA 2Q99A 3L77A 1ZCJA 3AFNA 5IJZA 4UULA 4UREA 1JWAB 2AEMA 4DREA 4DC0A 1LDEA 4W7HA 4J90A 3GZNB 1BVRA 4GAEA 4WCFC 2VTDA 3EW7A 4YR9A 2GSDA 5F1KA 1R4NA 1JU9A 5JNLA 3NTRA 1DDOA 5A9RA 1NP3A 4MKXA 1E6EA 3C3XA 1XDWA 3UXYA 3ZH2A 2UUPA 4CM3A 5H81A 3PHGA 4ZQGA 1WPQA 2YZ7A 3L07A 3WNVA 3F6YA 3RKRA 2J3JA 1YQXA 1E7YA 3MZ0A 1QV7A 2FR1A 4OXYA 4JBIA 2P2SA 4IY1A 2YW9A 1N1EA 3NDJA 3NEPX 5L95A 3JQ9A 4N5MA 3EY4A 1CYDA 1K6JA 3R0IA 1WZEA 2AQHA 4OOEA 4CMEA 2WTBA 3DFUA 1B16A 2GGSA 3B70A 1DIGA 4HX5A 1YB1A 1C1XA 3HFSA 3TPCA 1ISIA 1EZ4A 4YRAA 3GDGA 1PIWA 2EW2A 5CDGA 1ONPA 2OO5A 1SB8A 1DRUA 2FHSA 1XCBA 2CVZA 2NQ8A 3LT1A 5L7YA 1UP6A 3WGOA 1LA2A 4PVDA 3V1YA 1XQ6A 2ZB8A 3DR3A 4NJOA 1NPTO 1X7DA 3G49A 3ZHBA 1Z73A 4AJOA 1NVTA 4CMJA 4WCFB 3DL2A 3I52A 2W90A 2OP1A 1DC4A 1PJ4A 2PY6A 3IQDB 4UVIA 3VPHA 4PCVA 3E9MA 1ZK0A 3DAFA 1E1LA 4G81A 4CM1A 4CM8B 1AXGA 3JQGB 4BNTA 3VTZA 2FSVA 4FGSA 5G0TA 4DC1A 5L7TA 1J6UA 1LSOA 4DIFA 3FPLA 1G0OA 1TT5B 3FNGA 4XJSA 2AA3A 3DZGA 3ZGYA 4HKTA 2QYSA 2F00A 3LC1O 2BI8A 1GPJA 2OXIA 4ALMA 1F12A 2BHLA 3JV7A 4RJTA 1AN9A 3DBHA 1SBYA 1ORRA 2Q49A 3ITKA 4NFYA 1DLIA 2I67A 1DJQA 3AFMA 5GZ6A 2EJWA 4MP3A 3SJUA 1KEPA 3WYBA 3AW9A 2O3UA 4DPMA 1YDEA 2Y68A 4GLOA 2HSDA 4RV9A 4BNZA 4RVHA 1BXZA 4IINA 5KWEA 1YBAA 3S2GA 5CEFA 1HETA 3INGA 3UCFA 4XJTA 4XYMA 2WMDA 1NQ5A 1ZJZA 3RWBA 1JQBA 1C0PA 4ZICA 4MVJH 3H5RA 3V2UA 3ZV4A 3ZV5A 3WTBA 5C7LO 2A92A 5I7FA 4GKBA 3H6KA 4I5EA 4R1NA 1UDBA 4BHTA 4M86A 2JCXA 3T7EA 1MUUA 2ET6A 5F5NA 3ZWNA 4YRBA 2HRBA 1EVZA 2G1UA 1KVSA 2WD8A 3L4SO 1VSUA 3QWBA 1DFIA 1K3TA 3SLKA 1T4DA 4R3NA 5F21A 1P1KA 4YB8A 5JFOA 3DZHA 2D8AA 4RVFA 3JD2A 4IQ0A 3LU1A 3LF2A 5DOVA 1NASA 5JY1A 3FN4A 3E9NA 1UXHA 3C24A 1U3WA 3CH6A 1H0KA 4BIIA 1DBVO 5L4SA 1Y8QA 4IDFA 5JCXA 4RPGA 3H7AA 5DOZA 1YE3A 2BI7A 3HN2A 3JTMA 3WDSA 1B8PA 2HQ1A 2O48X 4U6SA 5CG2A 4PG5A 5HS4A 2GNAA 4XX0A 4BNVA 4E5YA 5CDSA 1DHTA 2A9FA 4BO2A 3D3EA 2PH5A 2WWRA 5JAZA 4HNHA 2VT2A 1DRVA 2DBZA 2C82A 3WBFA 3PHIA 5KJ6A 1BHSA 2HKIA 4EBFA 3FR8A 3JQ7B 4Z9FA 1I3MA 3W6UA 1WLYA 2VZ9A 4IZHA 1IHXA 1R12A 1BWSA 1XQ1A 4QTZA 4MIOA 1CJCA 2XF8A 2Y67A 4TVOA 4M55A 3T4EA 4BMNA 4PG7A 1H2HA 5A04A 3WMXA 2OORA 4PLWA 3TN7A 4QUKA 3WJAA 4W9NC 3AJRA 2QRLA 2E4AA 2P4HX 4DYDA 3RC1A 1K2WA 5BQFA 5TLSA 1BMDA 5KKAA 2VNSA 1NWHA 1WDKA 3WYCA 4GGPA 2D4AA 1UDCA 1NVMB 2B5VA 5BSFA 3BYZA 4RL6A 3ZWBA 2R00C 2ZJ1A 4L74A 1C0IA 2YHIA 3LSYA 3C7CB 2BH9A 3L9WA 4PG8A 3W6ZA 3K8ZA 4NQZA 3NGLA 3MJSA 2Q2WA 1E7SA 1GCOA 4Q3DA 2D3TA 1T24A 4Y6SA 3K30A 3O4RA 3U4CA 3MJTA 3KEQA 1KEVA 5EESA 4R1TA 2F1KA 1LRLA 4O0LA 5TQVA 4DL9A 1P9LA 2P4QA 3QWIA 4TWRA 3JQFC 9LDBA 1P1IA 2BF7A 1VM6A 3ROMA 4BNNA 3FWNA 1H2BA 3ETDA 4YTEA 2AEFA 1O9BA 4IGFA 5T6BA 2NV6A 4Q3EA 3HUDA 3WR5A 3VZQA 4AJ1A 1C0LA 1U4OA 3AUAA 5L4LA 2VOJA 4BO5A 2IDZA 3P5SA 1LC3A 5IFLA 4AJHA 4GI2A 1HYEA 2VQ3A 4EJ6A 3OEYA 1MLDA 2VYVD 2X6TA 4I1IA 4N5LA 4WNIA 4CV2A 5JXWA 1NQAO 4FFNA 2HCTA 2Y99A 2HMTA 4B3JA 2NU9A 4CLXA 4MP6A 1P3DA 5LDHA 1MV8A 4NIMA 2V6MA 4OOFA 4LK3A 5ILOA 1UP4A 3GH3A 2GN9A 3OQ1A 5A3VA 3SBOA 3ZNQA 3LC2O 5DN9A 5IDYA 2CZCA 4CQMD 4FOOA 1UH5A 3KUXA 3GR6A 3E1KA 1FDWA 1T1SA 4JJIA 3T4XA 3CUKA 1R0SA 1LI4A 3NYWA 4OIMA 1ISFA 4Y8VA 2YQ4A 4E3ZA 2I3GA 2OUIA 3AM5A 3HN7A 4RDIA 3EGOA 2DTEA 2X0IA 5CDYA 1Y5RA 2WYUA 1C14A 4K6FA 3VPGA 2PGJA 4KZPA 3ZWMA 4OMUA 4LCEA 4DA9A 1FDUA 2H6EA 1PWXA 4DQVA 2JJYA 3INTA 4CMAA 1NQTA 4I8XA 1GU7A 5I9MA 4OJNA 2P5UA 2PZLA 4P4NA 2Y1GA 1V0JA 3D1LA 2IYOA 3NV9A 1GZ3A 1DC5A 2B69A 4NMHA 2X0JA 4BO0A 1S6YA 4IJKA 4AVYA 4CM4A 2I6TA 1Y6JA 1U7TA 4DRYA 2YQ5A 3UCEA 1SEPA 4BVAA 5L4NA 5ADHA 1I01A 3RUCA 4XGKA 3C1TA 1J4AA 3GEGA 5G4LA 4IM7A 2NQTA 3L6EA 4YXFA 3NT2A 1I33A 4D42A 4R54A 5IDQA 3SJ7A 1Z75A 1I3NA 4R9SA 3Q9UA 3VVCA 2DLDA 1A5ZA 4NNJA 4YCAA 4ZGWA 1B7GO 1Y8RA 4LRTB 4O5OA 4TQGA 3VKVA 3AOEA 1BXGB 5TJ9A 3X2FA 1HE4A 2VT3A 2YFQA 5LDGA 1DRWA 4U6QA 4UEJA 1NVGA 3HSKA 3DAGA 3AK4A 3PDUA 4IDBA 4TRJA 3RI3A 3I9NA 4PLYA 1ZK4A 5F5LA 1PZFA 3ZN2A 1G0NA 5TJHA 1F8FA 3ZI0A 3HADA 4XR9A 3SC4A 1HE2A 4I5GA 3GNQA 3GPDG 4A7PA 1GV0A 4LMPA 3KEOA 3E5MA 3TL3A 3KTDA 4GSLA 3PWSA 2BMAA 3CZMA 3PEFA 1C1DA 4BB5A 1LEHA 3H9JA 1P44A 1RKXA 1OBFO 2HMSA 3BMNA 3OA2A 3OIGA 5KOIA 3U0BA 1HDCA 3OH8A 3ITDA 3KYBA 5G4KB 2O50A 5HS6A 1GUFA 3RUAA 1GADO 3GQVA 3IDSA 4BO4A 3V2GA 4ND2A 1IZ9A 5AXCA 3PPIA 2NVWA 1UUFA 5L53A 1LXCA 3C8MA 3ANMA 2GDZA 4NBTA 1U2DA 3DZKA 2Y93A 1E6WA 3U4HA 3RUFA 3MJ4A 1YQGA 2OMEA 3I1JA 3HHPA 3QVWA 4J7UA 3AU9A 1LRJA 2QW8A 3DHEA 2VWHA 4FJ1A 5HTOA 5JBIA 2NU8A 3WS7A 4DYVA 1E1MA 2EKQA 4KUEA 5TF4A 2WSBA 4M87A 1T2FA 1HSZA 3BMOA 4BGIA 4F6LA 5U9CA 4XIYA 5ENVA 4GH5A 3AI2A 3EDMA 4E6PA 3U62A 3O26A 4O63O 5CG1A 3U5TA 3B1JA 4S3MA 1HE3A 4BGUA 3OP4A 3GK3A 4B4OA 4AL4A 3P2OA 1WDMA 4FJ0A 2X86A 2Y1OA 2AG8A 1AE1A 3MWEB 4YJFA 2P9GA 3R3SA 3VPXA 1C1DB 5K0ZA 3OJFA 5K6AC 3WGQA 1U8XX 1NM5A 4BO6A 3BMNB 2PGLA 4ZJUA 5CEEA 1JVSA 4EZBA 1FDVA 3FHLA 3I3OA 2J5RA 2NUAA 3PJDA 1IB6A 2WD7B 4IIVA 5U1PA 1R15A 5IZ4A 4BMSA 1DLJA 1T25A 5T5QA 4E32A 5JS6A 2EERA 5C7OO 2EKPA 2BGLA 2C20A 1GR0A 4TKLA 3UGKA 2HK7A 5DZSA 4GPD1 3ZCXA 4E2XA 1H6DA 1RPNA 3QY9A 1RJWA 4HFJA 3MOIA 3BTUA 3WGGA 2VHZA 1E92A 1XELA 1SO8A 4FN4A 4IS3A 4YACA 2B83A 3PYMA 2AQ8A 1OAAA 4J9VA 1XGKA 2C2YA 4XKJA 1NPDA 1G1AA 4PVCA 2CDCA 4K9DA 1SC6A 4H15A 4UVGA 3PIIA 3I9OA 4WOJA 1IULA 5G0VA 4ZA2A 3I9MA 3GHYA 3KOUA 1GD1O 5B1YA 2PKRA 3VZSA 4YJFB 2Q45A 1ML3A 2POQX 1UR5A 2PFGA 4K28A 1LX6A 1B3RA 1IL0A 4J6FA 5H83A 3L4BC 4I5FA 1NFQA 4CQLA 1ADCA 4MVJD 3D4NA 3DAPA 1X0VA 2QHXA 4WPGA 2YUTA 1W73A 5FEUA 1KY5A 3DB2A 2J3KA 4Q3AA 5AXDA 4BV8A 4GGOA 4LGVA 4E0BA 2XXJA 1ZZEA 3CIFA 3KB6A 2X22A 3OSUA 4B8ZA 4FR5A 3G1TA 4GVLA 1SAYA 5CP8A 4NU6A 1UXJA 5ICMA 1BSVA 3GFGA 1R4MA 4IQGA 4OQZA 3N58A 3AUUA 4JP3A 4FPXA 4ND4A 4L73A 3GC6A 2GN6A 4BNIA 2AMFA 3M1AA 1GQ2A 4HV4A 4HFRA 3PHLA 1KS9A 3WFIA 1PJ3A 4IMRA 2Q4EA 3S2IA 3FPCA 4A27A 2X9NA 2CDBA 4UVDA 4K1LA 3WFJA 1E7WA 3JYPA 1YB5A 1GEGA 1TXGA 4ITUA 2FMUA 3F1LA 4CM9A 2Q1WA 2HJSA 4HNGA 4TMFA 5B12A 1TLTA 4OKNA 3ZU5A 4GMGA 5IDXA 4QX6A 4WLUA 1KETA 4JQCA 4Z9YA 4E4YA 4EI2A 3GNTA 1HTBA 1MB4A 5JMWA 4D79A 7ADHA 5L9AA 4GBJA 3PXXA 2CUKA 1UXKA 2W2LA 2O2SA 2ZTVA 4J1SA 5FI3A 3BMQB 4BO8A 5KKCA 1RM0A 4MIYA 4CMIB 4L8VA 1LDGA 3PJFA 3M2TA 1KIFA 1SEVA 2B0JA 2JFFA 4CODB 4QFDA 2DM6A 1PGPA 1A27A 1PJCA 4BQPA 1SMKA 1KERA 3RCBA 3FCOA 2E49A 4CV1A 1DFGA 3ZV3A 5EL0A 4BO9A 3EYWA 3MJEA 3AOGA 4UVHA 1A9ZA 3RC2A 1X0XA 2C0CA 4R1UA 1E6UA 2YJZA 3GZNA 3F5SA 1UXGA 3ZWWA 5HBRA 5A9SB 5KTKA 2PTGA 4LISA 3P7MA 1MC5A 3LDHA 2D5AA 1DFHA 4NBVA 7MDHA 3H5AA 3QP9A 1NWCA 4IJVA 3OF2A 2X9VA 1YJQA 3GOHA 4FJ2A 1RM3A 4R41A 4ZQBA 3IC5A 4XWYA 4ZQEA 3DZFA 2H63A 2IEDA 4ESOA 3TSCA 3NRCA 3B20A 3Q11A 4J0FA 4TKMA 3R3JA 3ZHXA 4EEZA 3MOGA 4FC6A 4BNHA 1I0ZA 2GN8A 3GY0A 2IXAA 2O3RA 3DZJA 5H82A 4RLSA 3VHRA 1BW9B 1OZAA 5F1OA 2BFOA 4D46A 5JO0A 3WLFA 1LDYA 1WNTA 4QFCA 1KYQA 3WQSB 3E18A 1A4IA 3WQQA 5A3JA 5KVVA 4II3A 2IODA 1CIVA 4F3YA 1P1HA 2VOEA 1LTHR 2CDAA 3OFSA 2EWMA 3AUTA 1F17A 1RYEA 1IPFA 1NHGA 3QSGA 4WCFA 4B4VA 5KJCA 3RBVA 2IZZA 5CPBA 5EPOA 6ADHA 3WIEA 1O89A 2NM0A 2A94A 4OQYA 3QRWA 3WLEA 2VZ8A 4KUGA 4CM8A 5JSFA 3JQGA 1Q1NA 4UUPA 2EEZA 4GX5A 4JCOA 4YJGB 1ONNA 3PJGA 3O03A 2NSDA 4PLTA 4DLBA 1CETA 1DO8A 1HDZA 4M1QA 4RZIA 3SXPA 1TT5A 1I24A 1JW9B 4D41A 2Z1MA 2JD2A 4IS2A 5CPFA 5B4UA 5JCJA 2O23A 1LDNA 4BO1A 2DC1A 2GERA 4HP8A 1VL8A 4QQRA 2FSSA 1KVQA 4MVJF 4OHUA 3NT4A 5TS3A 2QIOA 5I7VA 3PHHA 4XQGA 1LLCA 3ZNNA 1QV6A 3MEQA 5EERA 5I7SA 2AE2A 1YO6A 4WLNA 4YT5A 1LRKA 5JYEA 2FPGA 3WSVA 2JHGA 3AWDA 3HZZA 1V3UA 2YDXA 1Z6ZA 4DUPA 5AQ1A 3H9UA 3O8QB 4LVCA 1ISJA 3OETA 1EUDA 2TMDA 3STHA 4YT4A 4ZD6A 2E48A 3DHNA 4KDFA 1GZ6A 1P77A 5FFFA 2CF5A 2VHWA 3K96A 1E0DA 1EE9A 3K6JA 1LJ8A 4MP8A 2DTXA 2DFDA 4NFHA 1Z7EA 2GPTA 3TZKA 4RF4A 2X58A 2RAFA 4DBVO 4UVEA 5A1TA 3QLJA 3ZW9A 1PL8A 1HYHA 4XQCA 4LVUA 4HY3A 3PZRA 5IDWA 2BRUA 1H5QA 2EGHA 4Z0PA 1V3VA 4JX8A 1HSOA 4KMSA 3GFBA 4C7JA 3RBZA 4QXMA 3RKUA 1NQOA 3KYCB 1F14A 5L45A 1VI2A 2I5PO 4E13A 1WW8A 2HMUA 1Q2XA 4BNXA 2Q2VA 1PJTA 3TRIA 2R2GA 4WCDA 2AQKA 4B3HA 1YJ8A 3MCVA 4RVDA 2WYWA 1VE9A 4J49A 5DCUA 3ZU2A 3RUHA 5A03A 5ICSA 1R16A 1YBMA 2VRBA 4EUHA 3AUSA 1ZXBA 3GEMA 3PQEA 3JYLA 4LSMA 3HFGA 3CMMA 3JQ7A 3NDRA 3D5QA 1E1NA 1YONA 2HU2A 1EBFA 5G2OA 1Q7CA 5DULA 4ND5A 1NYTA 3PQDA 1E7QA 5FYDA 3VPSA 3KETA 4PLVA 1A9YA 3JQAD 2CVQA 1NAHA 4CM7A 1NBOA 4UUMA 4URFA 4CLHA 4IDEA 1XU7A 1DHRA 4RPLA 4D0RA 2C5EA 3GLQA 2JD0A 3PI7A 3H8VA 6LDHA 1UJMA 3PVZA 1EK5A 1NFRA 4HBGA 1I3LA 3RJ5A 1XR3A 3AY3A 1X15A 1LSJA 3Q1LA 2BD0A 3QWFA 1LQTA 3CPSA 4LW8A 3TZ6A 4WLFA 3DMYA 1WWKA 1X13A 2JFGA 3TNLA 3QQPA 2Q1TA 1PJQA 2GZ3A 3D64A 4NJMA 4YYZA 4YA6A 4L4SA 3OECA 3PYXA 2PD4A 1E1KA 1XU9A 1PS0A 1U5CA 3CZRA 2Y0EA 2ZQZA 3RSHA 1RWBA 4IXWA 4I9UA 2UDPA 1OFGA 4NG5A 3WGTA 3H3JA 4IDCA 2VWGA 1QSGA 4DBZA 1HF3A 3Q3CA 3I23A 3E5RA 3P19A 4RF5A 4FDAA 1P1RA 3QHAA 3KRTA 3K31A 1BXKA 3ZHYA 1T26A 4NK5A 1A4UA 1A7AA 2FY8A 4BKUA 1EDZA 3ANLA 3KHUA 3V8BA 3DXFA 1CQJA 5BNIA 1AGNA 1BRMA 4BNFA 4MVJM 2I99A 4AFNA 3VDQA 3DC2A 1ZJYA 1AHHA 4FCCA 4W9NA 1EEHA 1UZMA 3RUDA 4ZRNA 2ZCVA 4K26A 5EIOA 2C7GA 1DEHA 4EJMA 1EDOA 4KP7A 1BTOA 1XG5A 3HDQA 1IE3A 1LLDA 1GPDG 5KVSA 2H5LA 3QVTA 1ZSYA 4WEQA 1YL7A 2R00A 3E6AA 4P4GA 4E21A 5DP2A 4DXHA 4NJMB 4BL5A 1X7GA 4EW6A 5A4DA 1PZEA 3OQBA 4J43A 2X5KO 1T2AA 3COSA 4FFMA 4FFOA 4G2NA 3Q6IA 4TROA 1AXEA 3PQFA 8ADHA 5DBGA 3VH4A 4A73A 2UVDA 3QV1A 3JQFA 4D0SA 1EE2A 4FOSA 4C7KA 4BV9A 3PLRA 4N7RA 1JVBA 2VCYA 3NGXA 4XD2A 2PKQP 2JAHA 3GVCA 2VUUA 4XB2A 3WGYA 1U3VA 1FDTA 3WOHA 2EP5A 1RM4A 1G6KA 3PWZA 3K92A 2BGKA 1ENYA 2LDXA 1N9GA 2X8LA 1SNYA 1ZKMA 2Q2QA 2EIHA 4GLLA 3SVTA 4P22A 3MTJA 3LLVA 3DOCA 2IEBA 3VH2A 1JKFA 1NXQA 4UEOA 4NK4A 1GZ4A 1RYDA 1WDLA 2ZB4A 1K89A 4Z0TA 3ZWAA 4S1VA 3FSRA 3WICA 2Q4BA 1ZMTA 3HB4X 4R3WA 2X23A 3D4PA 5GMOA 4ROSA 3GAZA 1JA9A 3TOZA 1ENOA 1P33A 2HLPA 5TRTA 1QLJA 1JKIA 3F9IA 4YBZA 5J23A 4WLOA 1Y7TA 2AW5A 4PLFA 2FR8A 1Q0LA 1SOWA 3PK0A 4TZKA 2NVUB 3GNSA 3PTZA 3UF0A 1P0FA 5GZ1A 4MO2A 4N5NA 4E30A 2DFVA 1N7HA 2FZWA 2NADA 4TRNA 4E5NA 3A06A 3H65A 3LF1A 2BELA 3L9XA 2CFCA 4EITA 4PGFA 4E12A 4KOAA 3C1AA 1D1SA 3G0OA 4ZU3A 3LT0A 1BXGA 1KC3A 1M76A 1N5DA 4EJ0A 1PJSA 2RCYA 2VUTA 2Z95A 3CSDA 4NHEA 1SOVA 3GMSA 4D45A 4YJHB 3BIOA 2A4KA 3JCZA 4FSHA 5I8ZA 3WX0A 4RVSA 2PGDA 3A28A 1LLQA 3ZWYA 1ZVMA 3HE3A 4HWKA 1N9GB 1T4BA 5G0WA 3EVNA 3JQ8B 1XHLA 2BLLA 4B7UA 3LQFA 4RZHA 5IXSA 2I66A 4OSOA 2Z5LA 1M67A 3IKVA 4GX2A 1CWUA 2DKNA 3ONFA 1ISMA 4ND3A 2C59A 1V35A 5CFZA 5JC1A 2ZCUA 3RFVA 1E3LA 4DPKA 4YPOA 3NTQA 2GO1A 4OL9A 4XDYA 3BZUA 4BS9A 3JQDA 5G4KA 1S7CA 5DBFA 3JD1A 4Y98A 3WQRA 4RPJA 1R0KA 1A7KA 4E5MA 2UYYA 4R16A 5I8WA 2PD3A 4P4LA 1K0UA 4ZHSA 4R9RA 4Y6PA 1E7RA 3N7UA 3I6QA 3VH3A 1LDMA 5T67A 4PLCA 3FR7A 1QYVA 2G5CA 2ZYGA 1KOLA 5BSGA 2RHRA 1XIVA 1TT7A 1WZIA 4BUCA 3PP8A 5FWNA 4J16A 5ITVA 3JYNA 4CM9D 1VJ0A 2VWQA 4IDGA 1PL6A 5IZCA 3G1UA 3W8FA 3NUGA 1D8AA 5IZCC 3I4CA 2FR0A 5LC1A 1Q7GA 2OHXA 4YRDA 5GY7A 1CDOA 3HDYA 2W2LD 4DPLA 4AG3A 3F47A 1I3KA 1XLTA 3QE3A 4IDDA 3VDRA 3KXDA 4KTTE 1ADBA 2EXXA 4UAGA 1MG5A 1EBUA 3KSDO 2O7QA 4KDEA 1WP4A 1U8FO 1FXSA 2SCUA 3B1FA 1FF9A 3V5NA 1QXSA 2VYNA 4CLEA 1T1RA 3DBLB 4P8RA 4CLRA 4IGEA 1JAXA 2IRWA 1GCUA 2Y66A 3LK7A 5JDCC 1ZEMA 3DQPA 4J1TA 5ENDA 4YT8A 1E7MA 2C54A 1PQPA 2GF2A 2W4QA 3F4LA 1ZXLA 5HA5A 3D7LA 1FDSA 4R69A 2VHVA 3ROPA 4C4OA 2WD7A 4BB6A 3RUIA 4TZTA 4ALJA 5KNLA 3PGXA 1HLDA 2D0IA 2DPHA 2G0TA 4OAQA 1ENPA 3RC9A 2Y1EA 5ILGA 2XAAA 5L3ZA 3H2SA 3JQEA 3NDIA 1ZW1A 1X1EA 4OXKA 5T8KC 3WWZA 2XXBA 1HE5A 4XRGA 1IUKA 2B5WA 3BMCB 1JWBB 1E3WB 1YBVA 5ITWA 3ASVA 1BVUA 3AU8A 4LCJA 3BTOA 5KVCA 3ICPA 4XYEA 2DT5A 1I2ZA 1PGJA 3DDNA 4M8SA 2Q50A 2NTVA 4GKVA 4XRRA 4I9HA 1Q0HA 2DUUA 3UAGA 3EVTA 3TFOA 2JL1A 3AM4A 4U7WA 1GQYA 3KLMX 4J1QA 1LSUA 2WJPA 2EV9A 4IQ8A 4AJ2A 1HDRA 4D3DA 1R37A 4TRRA 1YRLA 1GY8A 2VNAA 4WK6A 4CLRB 1SCUA 5K6AA 2IZ1A 4Y67A 2DU8A 1ZO8A 3I6IA 4E2ZA 1L1FA 2OZPA 1GUZA 2CVOA 3BXXA 3SC6A 1DAOA 3D4OA 3U9LA 4E5PA 3K5PA 4FIZA 3TF5A 1GEEA 2W8ZA 1B14A 1YOVB 3UW3A 3PJEA 5TX7A 2JHFA 3ZV6A 1H9AA 3KLPX 5ER9A 5KJ1A 2VHYA 4X54A 2BGMA 4N18A 3NKLA 3ICCA 2AE1A 1YGYA 2CSUA 4DMMA 4MKRA 4A5OA 1WMAA 1U1IA 1UZNA 4U8GA 1HYGA 3ON5A 4XGNA 5ER6A 4D44A 1E3SA 2I76A 2G17A 4RPHA 4NPCA 1DSSG 4J2OA 1C3VA 1ZH8A 5LCXA 4J4BA 4YVFA 5BSHA 5I7EA 3TZCA 4PLGA 4Z3KA 1LU9A 1U2GA 1M2WA 3PGJA 5HM8A 1LC0A 5BT9A 2J6IA 4DQXA 4PLZA 2ZYAA 4R51A 4DTIA 3ASUA 2P68A 3IJPA 5C5IA 1E77A 1I32A 2ZTUA 3ZDFA 3L4BA 1VL0A 3OBBA 3WIDA 3H3FA 1BG6A 3BMQA 4D43A 1PU2A 3OEWA 4CMIA 5IG2A 3KBOA 5CAEA 1O8CA 2VUSA 2GYYA 3KV3O 2I65A 3VKUA 2PZJA 4DIOA 5L51A 2Y1DA 3IUPA 4GX1A 3ZNOA 1MX3A 4DLAA 1DJNA 3DOOA 3GVXA 1DPGA 3I4FA 4XB1A 5JDIC 4RPKA 1NR1A 1NNUA 2E37A 4I9NA 2ZTMA 1QG6A 3LYLA 4R68A 3L6OO 3QVXA 2Q3EA 3H9GA 3KZVA 4XYGA 4PG4A 5A9SA 1YL5A 2WE8A 3CKYA 1XKQA 2EGGA 1H6AA 3GVIA 2OP0A 3E82A 2DUWA 2X5JO 2GASA 2W2KB 1ULSA 2QX7A 2YYYA 4YAJA 2DTDA 3SEFA 4H7PA 3EAGA 2OBNA 4EGFA 1MFPA 2ZB7A 4WLEA 3D3WB 5COAA 3UCXA 4U0KA 4CMCA 3GN2A 4CMBA 2VWPA 3LZ6A 5L7WA 4IDAA 1XA0A 3QIVA 4Q9NA 1NR7A 5AVOA 4UEKA 3IP1A 2HK8A 4IPTA 2CY0A 1L7DA 1PGQA 5L40A 2EW8A 1Z45A 1BW9A 4TRMA 4CR6A 4WJZA 4J2HA 3WNQA 1HDYA 4CQMB 4FS3A 1P45A 4J4HA 5DF1A 3IP3A 1VJ1A 5DT9A 5AXAA 3TL2A 1U3TA 4J9UE 4XA8A 3GG9A 3ULKA 2ZJ0A 2C5AA 4RORA 2C7VA 1TA4A 2O3JA 2X7HA 4NFSA 1PS9A 3OHSX 4TVBA 3DOJA 3ANNA 3KYDB 2Y1CA 3IAHA 4GL4A 3U09A 3IL2A 2UUOA 1QLHA 2HMWA 4UUNA 4IBOA 5DCWA 4IUYA 4Y9DA 4YJGA 1NFFA 4CMHA 1UAYA 3GDFA 1IYZA 1ZK2A 3D0OA 3TZHA 5JLAA 1B2LA 3WMWA 2OBYA 1I2CA 2V65A 3VOSA 3S2EA 3Q2KA 1H9BA 4Z6KA 1CERA 1D7OA 3TOXA 1W4ZA 2DBVO 4WEOA 4A03A 3MTGA 1N7GA 1JKJA 2PK3A 2NVBA 1VLLA 1NX6A 4MIEA 1MP0A 3JQBC 2PD6A 2NLOA 4RCVA 2ILTA 1ENZA 1XYGA 3F4BA 2AXQA 1HLPA 2HMVA 4J0EA 5COQA 4D7AA 2QZZA 1F06A 3AI3A 4XDZA 3X2EA 2PNFA 4ZQFA 5BSEA 1EQUA 4QSMA 5I9LA 2V6FA 3OJEA 2BFMA 3OMLA 3O8QA 4R01A 4XEHA 3FRJA 3DMTC 3OIFA 1H6CA 1YS4A 3A4VA 4XGIA 3FNHA 3IJRA 3M2PA 3EZYA 1YVEI 2HDHA 1KEUA 3M6IA 4HFMA 4MDHA 1VPDA 3ZWPA 1VRWA 1UP7A 4R1SA 1TEHA 1A71A
chains in the Genus database with same CATH superfamily
3AEYA 4OGFA 1HA3A 1HDEA 4ZFNA 5REQA 2RH9B 4NDAA 2J0UA 1HKUA 1E4OA 2PH3A 1QR6A 3W8DA 5EGSA 2W2QA 1KVUA 1N6KA 1AKWA 5JASA 2G36A 4CEIA 4AY4A 4A5SA 1GYPA 1C7QA 4NI5A 2HNKA 3AH8A 3M82A 1GAWA 2FX2A 3ER6A 4OK5A 3M9WA 4PEVA 3E0XA 2B7CA 3FDZA 4F2GA 1J9GA 3RVPA 3KPVA 3VVLA 2WI8A 3DAYA 3VXKA 2REQB 4KG7A 4DJFC 1C29B 4GS5A 4ND8A 1XTTA 3VBEA 1MOSA 3WBBA 1DIAA 3PNKA 1XEAA 4MVJP 3DXXA 3NIWA 2BTQB 4AD8A 4ENWA 1UXIA 4B40A 4MH0R 2AS0A 4ZIRA 2P9QA 1RLTA 2REXB 3OBIA 1TTHA 4WACA 2N46A 5JY6A 3K0FB 1KJ8A 1SH7A 2Z2XA 4WCVA 4DIEA 4GQAA 1YZVA 4JZKA 5E9JA 3UVEA 1U3UA 3DFIA 1C30B 3S1AB 5DLQC 1V8OA 2GF9A 3OO1A 2A0UA 3P8ZA 4FNMA 5FLYA 1S9DA 5FP0A 5FJIA 4B7CA 4CMKA 3GHHA 4PIVA 4TV9A 2HJGA 1ULUA 2O3TA 2WINI 3IBTA 5IK2A 3ELDA 3ONDA 4MQBA 4G0UA 5EHQA 4FCTA 1JIUA 3NBMA 4MZXA 4NAUA 5JCOC 5LZ9A 2IDJA 2PDAA 4II2A 2QTRA 4L8LA 4QT0A 3E9QA 2Q1SA 4C0BA 1CNFA 2VC2B 3F1KA 3KSUA 4JJZA 1GPBA 4RK6A 3ZX5A 4B0PA 1PLKA 2XCOA 3KE8A 5HQTA 2HYDA 2B98A 4WUVA 2X6QA 5J63A 2OO5C 2A1IA 5JPIA 4E2YA 1XVUA 2B7BA 3N5CA 1UBUS 3F0TA 2EBFX 3VDXA 1J2YA 4P5DA 4HK4A 2I6SA 2R751 4IIJA 4XIFA 3OTHA 4JN6B 3A9WA 3VJMA 1M8FA 3U44B 3B1WA 3V80A 1LUAA 1LCIA 1L3IA 9LDTA 5IJ0B 4F91B 4XYLA 3OOHA 2CD9A 1XSEA 1ZD1A 3P5BA 1NMYA 3WBKA 3OCYA 1IM8A 5AHOA 3SKVA 2P90A 1EPUA 2PGAA 2R86A 2ZIWB 2O2ZA 4MB6A 3CX6A 4M7PA 2P9CA 3R7NA 2WZQA 2WLSA 3RYHB 1C7FA 3OX4A 1L6IA 1EFLA 1F1BA 2FSVC 5CX1A 1TM2A 1WB4A 3KKEA 4OJTA 1Z6PA 3CSSA 3D0QA 4KRYA 3LWZA 1LDBA 2JIBA 3QJ5A 3G2LA 4E5KA 1GKIA 3L6DA 4TS3A 3HYNA 1QP0A 4Y1EA 3WL3A 3Q98A 1K3FA 2PGIA 3GXOA 5T4HA 4M89A 5BW6B 1UDRA 3RIGA 1BO6A 3WKAA 3QSYA 4A36A 1NQUA 4HWSA 2BHRA 4ILKA 3E2MA 4RE6A 2QUKA 3GAMA 3TEMA 3WIOA 1GGNA 1DDIA 2QGNA 1ILEA 2N0SA 1E6LA 1OU4A 3GEPA 3JQ6A 3GZTB 4KKVA 3LKBA 1L0BA 4PRLA 3VKWA 3ECAA 3QUTA 4ECAA 2QJTA 4L85A 4GZ6A 1L5QA 1X38A 3HFJA 3IGFA 4MS3A 4TMYA 4F7DA 5DPMA 1MXFA 3PRHA 3V1NA 1T43A 3KJGA 4DLXA 2A3RA 4XUCA 4YJDA 2ZYIA 1KK2A 3TLGB 3QTTA 4LECA 4WLVA 2AHRA 5CW1A 4RFSB 3TIVA 3GGCA 3LECA 2X0NA 3R6TA 4QTTB 1MTZA 3KZKA 4NYIR 3EK2A 2JKVA 4FGJA 4D6YA 4EMUA 5GIPE 1G21A 3JYQA 4MKZA 5DM60 4M1KA 3RAJA 3U4IA 3ANXA 3IV7A 1MAWA 1QZXA 1RLMA 5CFMA 1EE1A 2G5TA 4BMCA 2EG9A 3GZJA 1MENA 2C5SA 4HRAA 1MR3F 3JU3A 5J2TF 1QP4A 4ZMSA 1YTUA 1Y9JA 2Z3VA 1QYRA 1X1TA 5IBRA 4CL3A 2ZP1A 1K3UB 1JGTA 3GRAA 4GFDA 4LYJA 1V25A 2UZ0A 5JSHA 1TVEA 2VYND 1L7NA 3LXMA 3IVMA 5CB0A 4DIMA 5IJ9A 4LEIA 4QHSA 3FWHA 4TOIA 3JASB 4MKGA 1AKTA 1U90A 2D7JA 3DHYA 2HA3A 1AUVA 1AHIA 3E1GA 4YWJA 4R2LA 3S6JA 5C1OA 2JAUA 2QN7A 3R9KA 2XJ9A 3S8MA 3WO0A 2P2DA 4MQEB 1Q7BA 3TQTA 2IBSA 2OGUA 5AP9A 2JEZA 4X3PA 1MTOA 4JA2A 5BWMA 5ALZA 3ND5A 2QP3A 3SOZA 2YICA 1JI0A 4UFNA 5AM3A 3C16C 3VDMA 3E22A 1OH6A 2ARKA 2P9JA 3PWKA 3I45A 3H0KA 3M4JA 3R44A 3GUCA 5AYVA 3E9EA 1DJLA 2Q41A 4DYHA 3HO6A 3P9YA 3TNJA 2PYIA 2ZRIA 4U5QA 5EHGA 4TWIA 3ZQJA 1WZNA 4EL5A 2RK3A 3ZWVA 1DGQA 2VPYA 3W0LB 1RQRA 5EWLB 3GF4A 1BQEA 3MWFA 3SC2B 1VJDA 2I9PA 2OVFA 2IOQA 5A3SA 4KITB 1T1EA 2GESA 2PTHA 4K05A 5IW8A 5I5GA 1A2BA 1HZZA 3ZQKA 2V59A 2EHJA 3ENWA 4IQ4A 4JC8A 4PC2A 4QQFA 1KMIY 2VZEA 1M6WA 1M1NB 1H93A 1T3TA 3WGVA 1E6CA 1NUUA 2FB9A 3DCYA 4M83A 1U6JA 2XWPA 1X1RA 4EKEA 4MV8A 1DKQA 1V37A 1YA4A 1FVHA 3G79A 2AKYA 4YNBA 5BUCA 3AM1A 3QEAZ 2FPLA 1LI5A 4LN1A 2B6HA 1NVUQ 4MVJE 2IYVA 1N6PA 5J1SB 4JP2A 3VU3A 5LP6B 4W5QA 4N9QA 3AQIA 5BW5A 2WDZA 1XQYA 3HR4A 5JD5A 1E2JA 1TJ3A 4FW8A 3QWHA 5B6JA 3K9HA 2B3TA 2Z3WA 2HAEA 3RF7A 3WK6A 3TAHA 2IHJA 3BCHA 2QRKA 4L75A 5CK5A 5CH8A 3UN1A 5TY0A 3F46A 3GGGA 4HPXB 5IXYA 3AVXA 1CB0A 2F3PA 3MN1A 4J7CA 1KSFX 1TJPB 2FWNA 2XW6A 1D1QA 4QU0A 5F9FA 3U13A 2VZ0A 1UJCA 4N6OA 4YJHA 2SKDA 4OQDA 1W1IA 4I1VA 4AS3A 3OURA 4QYIB 1Y8QB 2NXCA 1AK1A 1WCV1 1J8FA 2JHPA 1G20B 2UYGA 3RS5A 1CP3A 1Q1ZA 1RAAA 2PSFA 2GM5A 3G8YA 3NIGB 2OZLB 4G8DA 4YI3A 2IFTA 1ZEJA 2H9IA 1KBZA 2NPOA 1L4BA 3IOYA 3V9AA 8AT1A 1GZUA 3V4RA 2X40A 1TZCA 3E8MA 3F71A 3I3SR 2AEJA 5HRUA 1N0VC 3UOGA 1H0RA 3VPBA 3C1OA 3GBVA 2ODEA 3M1LA 5C3MA 4Q02A 1K5PA 1VBFA 2WPDA 2ZXUA 3W1VA 4EHDA 1NF2A 4U4AA 1J09A 4C2AA 3DGFC 4X64B 2ZCJA 1Z0KA 2DWQA 3PEUA 3MAGA 4MGHA 1ZOIA 2C97A 4NZYA 2ZRFA 4KQXA 1RYNA 3FMFA 4NQRA 2ZRJA 5EJ2A 4HGQA 4AP5A 2GOYA 2W6JD 2A88A 2O3SA 5G0SA 2G72A 3OP1A 2Q7OE 4BE4A 3WTCA 2ZREA 2UZ1A 2ZPAA 4OQMA 1W36C 2ECOA 2BMFA 2B78A 4URWR 4QJ4A 4B35A 5KYGA 5J2TA 2HUNA 1KO4A 2LTAA 4IXTA 5AKZA 2Y2UA 4Z4CA 1JDTA 4J91A 1AVTA 3DNMA 4Q5IA 3K05A 1VXRA 4LF6B 1UKBA 4TS9A 4WOBA 4MR9A 1E6KA 1R66A 2MYTA 1U0SY 2OWEA 3NHJA 4HXFB 5JH7B 1C1HA 2ZRBA 3IAS6 2VA8A 1ISHA 1CEXA 4I3GA 1VL6A 3BQNB 3JRWA 5HKKA 2RGNA 3HLKA 3INRA 1GZDA 3CCBA 3OAAA 4UM9D 4IIUA 1S02A 3H5NA 4GNRA 3RV4A 6Q21A 1O3YA 4OO3A 2ZZMA 4Y2JA 1W5SA 5B2FA 3MINB 2JFVA 3MFQA 4HDOB 3R3UA 4PWZA 1R6AA 4WZAE 2JD1A 3G2PA 1XC7A 3WL8A 3T1TA 4D1YA 4G37A 1OU0A 2Q46A 3UUWA 4AICA 4CT4B 2JAXA 3UK6A 1BDBA 1OUMA 1N6NA 1RKUA 3DEAA 5CU7A 1WCIA 2CB0A 4N1AA 4RZSA 2P9EA 1E5LA 1LF5A 4HXYA 4ALNA 1WQ4A 2M6LA 1BDMA 1V48A 4JXXA 2B1JA 3RASA 1L5VA 4PZUA 1DBWA 2R5FA 4OMDA 3KALA 3VVBA 3N2YA 3W7BA 3QPBA 4OYRA 4AXBA 2N75A 4Q4AA 4D3FA 4RJIA 4FGUA 1DARA 4LZOA 4C6TB 4DNQA 1KWGA 3R6LA 4ABYA 1H4QA 4Z53A 4E2WA 3HP4A 4RJJA 521PA 4ENQA 1AHPA 2VH2A 4LQLA 1IPEA 1DUSA 1NLUA 4XZ3A 1XALA 4UBJA 5CR9A 3TUIC 1QJ4A 3HUUA 2OFPA 1NW4A 4LI3X 1ZLYA 4M22A 4ZXFA 1QX4A 2G82A 4TMVA 2PLAA 1RHUA 2NU9B 3PDIB 2A0FA 5DNAA 4HAXA 5T64A 2YNMC 1JJBA 4IMPA 5TT1A 3U80A 5K4AA 4EYEA 1QGZA 4C7BA 1ODJA 3KX2A 4ITVA 1QH9A 3IX7A 4IIXA 4PRYA 4QEDA 3BXEA 4KQJA 2RSLA 4PYQA 4B6PA 2X4IA 2IXDA 4I4TF 4ZP1A 5EMJA 3A11A 2H18A 4P0TA 3WGMA 4FC7A 5HBGA 1LW6E 1I7LA 4AKEA 2AW3A 2QN8A 5JDCA 4LC1A 1RWXA 4RGBA 5E9AA 3WWCA 2IYPA 3E23A 3GRKA 3IMKA 4FKBA 1RZRD 3SX4A 3D4LA 1ZD8A 3TOVA 1YBFA 3VGPA 4EW1A 1HDOA 2Q5JA 4K9PA 3OM9A 1QFXA 4QDJA 3HEMA 3KDSE 4F72A 1U5AA 4MRSA 3CTMA 3VI4B 4EMSA 4E33A 3HL0A 1BN7A 1PJLA 5CT4A 3ES9A 2P6NA 1PNOA 3B6ZA 5TPWB 1J5PA 2V4UA 1D7AA 2V7GA 2J0QA 2BFCA 3NT5A 3TFQA 2DHEA 4K6OA 1KI2A 3EOAI 5JC8A 4M54A 5KSPA 3VC7A 4O4IB 3FNQA 1DJOA 1P31A 4FX5A 1M75A 1YVRA 3QEOA 4OM8A 2EL7A 4WADA 1R8YA 2I78A 2Q6KA 2GHIA 4I5DA 2JG3A 2FQQA 3QXCA 3ORSA 4C04A 1J70A 4H3SA 1O5OA 3MMSA 2ZQYA 1WXDA 2WV9A 3V48A 1W7AA 2RCNA 3BDAA 3KFLA 3GJ8A 3RHSA 4X71A 3PQ5A 1MW8X 5EE1A 3IUSA 1CUAA 4IIHA 2AYYA 4NCNA 3I9V1 2F48A 3F5FA 3EVDA 1ZHHA 2XOEA 1PR9A 4I66A 4LDQA 4OFWA 1AU9A 5DEOA 4EY5A 1PFGA 2VP6A 1E5VA 2D0DA 2XOKD 2PUFA 2O8EB 1V9SA 1VL5A 2ONKA 3QG5A 4JUFA 2IZ7A 4KN9S 2GZHA 1U2DC 3HQ4O 4A6XA 4E51A 2GPJA 3E35A 2QYTA 5HCIA 2HZBA 5K0NA 2Q9AA 4FWTA 5HZGA 3S29A 3THSA 3IIIA 1UINA 1K8RA 4G4SO 3V4ZA 2ZSEA 3DOIA 4BAGA 3H1FA 4PANA 2H1OA 1E3MA 3H1PA 2QDXA 2MSNA 1JDNA 3EVFA 2F3TA 2XNJA 2G07A 3EH1A 3WDKA 3H2ZA 1QTNA 4H7FA 3RFXA 3GJRA 3P9NA 1ND5A 2Y9MB 2QRMA 3FWPA 2WAXA 3AIKA 4HVLA 1HE8B 1Z38A 2FX5A 2X2FA 4PAWA 5TEVA 1T2EA 2FEPA 1OZHA 4MNTA 4Q3NA 1JZTA 1G38A 1V8FA 4QTXA 3DBRA 1CULC 3SSNA 4LJRA 1CPYA 1QIMA 5IKEA 1F0KA 2OK8A 1XYYA 3ZW8A 1Y9AA 5K0JA 4NP6A 4B76A 1IDN1 4BQFA 2YCLA 1WCWA 2PT6A 2A1TS 1QH0A 4WESB 2YBEA 2UAGA 3IIMA 1PJ2A 2L42A 3IHTA 4UATA 3MOSA 4XIJA 3HRKA 3TQRA 3VTFA 3AF6A 1D6NA 3L7YA 2W98A 2X9GA 5NLLA 4AYXA 4GX0A 5PNTA 2E6KA 4GI5A 4OLFA 1JR4A 4LSGA 2LDBA 3KPYA 3QLVC 3SGLA 4BNUA 3DTYA 1GDDA 2R68A 1H2XA 4PN3A 5EUQB 3QZUA 3HJTA 3N59A 4MYHA 2Q4OA 3Q2OA 5JV5A 4Z0HO 2CLCX 4RTSA 1YJCA 2OCYC 1JQAA 1KQPA 5AIAA 2BSAA 2OLEA 4PTZA 1UDAA 2ZBVA 1ULTA 2PUAA 1YKFA 1P73A 1DWOA 2X0DA 4A2WA 5F98A 3THWA 4B7XA 5BVHA 2WNHA 4QUJA 4I1SA 2V74B 1Z08A 2VN8A 2ECQA 2HF9A 3W77A 3D6MA 4WKGA 2J9ZB 2JGKA 2XZOA 4MYUA 5ICGA 4Z99A 1HFWA 2ZETA 3OF3A 1SKMA 4BBJA 3TZQA 1DUIA 1CV2A 2A1UA 2J5QA 1AUPA 2VH5R 3A2NA 3H42B 4IZ6A 4L7QA 4WA8A 3LC7O 5GONF 1S1MA 1TO6A 4CYMA 1EINA 3OKFA 4CKEA 1P0CA 2PWZA 5ERYA 4X5OA 2C3YA 3OFNA 4V0QA 1Z5ZA 2G4CA 3AB7A 3VHLB 1G3IA 1Z26A 4H7KA 2JB9A 4HUJA 4CT0A 3GCGA 3ETEA 1Q14A 4D9JA 3KYDA 1ZGBA 3J7AC 4X7PA 1SZPA 5J5VA 3WB9A 3R24A 5IM5A 2OM6A 2D5IA 4KQ9A 1RKQA 2B2NA 1WMFA 1SR8A 2VQEB 4MQMA 5FUXA 4HOYA 4X1KA 2OV4A 3S8EA 4WXRA 1G59A 1CRLA 1O57A 4ZVPA 5HW0A 1J5XA 1T4GA 2JEYA 3C2QA 1EK2A 1XEWY 3AM3A 4OATA 1GL7A 5KI6A 3WG9A 3D8NA 4ZANA 3MHTA 3FFXA 4YP6A 3DT6A 3H4VA 3PLNA 2FWMX 2C7PA 4FFVA 3RD5A 4AJKA 5K4GA 2XGMA 3QI2A 4YP7A 3PDJA 1WXIA 5K8JB 3S2FA 2F1JA 1JYSA 3R5XA 1F0YA 1W29A 4HYTA 2YN4A 5BSRA 4YFYA 3CW8X 4C1BA 1EM8B 1ETHA 2OV1A 4PIPA 3VA7A 1ZRNA 2ZUUA 2XX3A 2WUDA 1RBZA 5KJEA 5EINA 1PZNA 1Z83A 4I1RA 3NWPA 1LPPA 1AB6A 3UV6A 5I7AA 4BQIA 3DUWA 3WHKA 2HD4A 4LRYA 4BFUA 1J1ZA 2XITA 3JVVA 3NOXA 2ACEA 2D00A 2W83A 4QBTA 3H2HA 3AQ4A 2V6BA 3U4DA 1A5BB 2VBGA 4X8LA 5D00A 1GSOA 1KQNA 3QX9A 4UDNA 1N6HA 2YV3A 3FHCB 1G5PA 3OZRA 4UNSA 4CKXA 1SQGA 1HV8A 1AZTA 3PYLA 2NG1A 1T15A 1VDZA 2R79A 3EA4A 3HVIA 3V4VB 4G0VA 1VKNA 2Y3IA 1Q84A 1R9GA 3N6RA 1FMCA 1FRFS 4ZZ2A 4ZK6A 1D1PA 1XRRA 3KZXA 5GZ3A 2ZUWA 2MSKA 3CO0S 2ZITA 3NH9A 4M8IA 3UMBA 3CBGA 3L6CA 2GUWA 1MGOA 4IVPA 3MWDB 3UM9A 1MT0A 2D8MA 4MR7B 1Q44A 1JHXA 1XZNA 1O2DA 3AHFA 1AZLA 4JLWA 1ECCA 5FOSA 2M6KA 2IX9A 3HBMA 4U3JB 2V1UA 1WD5A 2CSXA 1B0ZA 1H2YA 3KVOA 1V8BA 2FPIA 1K9VF 1YB4A 3DOHA 4JLBA 1M8KA 2A78A 3EZFA 3GZ4A 4LSWA 5JO9A 3G2QA 4GWGA 3OLQA 1P29A 1UAGA 1Z4NA 2NACA 3DVQX 5DBEX 2YWEA 1K68A 4HT3B 4DW8A 2CMKA 4FTWA 4OB7A 2XLBA 2J9FB 3L8DA 2B4RO 1WW3A 1AM4D 2FRDC 2V7XA 5JNSA 3JQBA 4RY0A 1YWGO 3EX7C 5CW2A 4LRSB 4ZAXA 2PZEA 4WDRA 2WU8A 4N39A 1BNCA 1ZCBA 3K4HA 2DQ4A 5B4TA 5U4XA 4E11A 1JT9A 3ZW7A 1GGHA 1TU3A 2XHZA 3RVDA 4CL8A 5BW4A 2M1XA 3LCJA 1WMSA 2OQIA 3HJFA 3CLHA 1QK4A 1QMGA 1YNSA 2BEUA 3QBEA 3L1IA 4J0JA 4AMYA 5A62A 1FMFA 1VLQA 1N5LA 3DMTA 3QVSA 2D0OB 4C4ZA 1JLLB 1N3LA 2J6HA 3VU9B 2C8JA 2QTFA 2ZWOA 4IDQA 1O1YA 3UV7A 3HY4A 5AESA 2HPAA 1P7YA 1Q0QA 3AUYA 3AUJB 1TZMA 3HJNA 1WHTB 1V6AA 3G89A 4L0DA 1HUQA 1R0WA 5K3FB 3CVWA 1E9DA 3G17A 4RSHA 4P3NA 5B37A 4NOLA 1KEEA 1H66A 1R7RA 3CNBA 4M88A 4DWWA 2EF1A 4PZEA 4ES6A 1YIOA 3AL0C 1TYEB 5EVCA 3H0EA 1JG7A 3O95A 1OLSB 2MSEB 4QSHA 2BFDA 3NHAA 3S5UA 1WL8A 2Q99A 1RMQA 2OLJA 3QKSB 4WBNF 4C4SA 1UIRA 3OKCA 3AFNA 5IJZA 1JWAB 3ESRA 3GJTA 2PGNA 1LDEA 2HT6A 4W7HA 5SZIA 3NNDA 3D3QA 4J90A 5IWCA 2PH1A 1YI0A 1Y98A 4LZWA 2NXWA 1BVRA 4CTOA 2VTDA 1BGXT 3FXAA 3OT1A 2LIVA 3ZLTA 5KSWB 1TGYA 1TVMA 3CJTA 3TLZA 2IYQA 3IVAA 1KF0A 4A0QA 3P1JA 1SVOA 2Y71A 5EE0A 1HE1C 1WSWA 1W85A 4MKXA 1PKEA 3PC8C 4B73A 5KEIA 1XDWA 3P2MA 3NOQA 2UUPA 2OEPA 3UC9A 3WRVA 3ZJTA 5LOVB 4QQNA 1HR0B 3EBLA 4HLNA 3D0KA 1E7YA 3M33A 2FR1A 3MZ0A 3QXSA 4I4IA 5IP5A 4JBIA 5AI9A 2P2SA 4TKZA 2LZ0A 1YUMA 4KQEA 2BLNA 3CC8A 3UT5B 4P31A 5JCOA 3EY4A 4OOEA 1U6KA 1VIYA 3GJ7A 1KPIA 3P9XA 4KMRA 3QFHA 3V33A 3EEOA 4HX5A 3TPCA 1C1XA 4AF8A 5JCZA 1C3LA 2ZM6B 3GDGA 2DMRA 1PIWA 3H04A 1GNRA 1HURA 5BYJA 2QVXX 4JYMA 5G53C 4MSUA 1H4TA 1BE0A 1LNZA 1P8JA 1MAAA 2OO5A 3I6YA 2H4XA 3KKNA 1DV2A 4Q9LA 3WZMA 5ES4B 1DRUA 4WKNA 2CW5A 3WGOA 2PLFA 3GFVA 3V1YA 4EABA 3FSJX 3ZUPA 3DR3A 2PUTA 2HOQA 4L6AA 3ZHBA 2RGWA 4CMJA 5CLLA 1IOVA 3EG5A 1KY2A 3I52A 2C61A 4WCFB 2W90A 3IQDB 1SQSA 5FL7D 2PY6A 3PFGA 3IDFA 7YASA 2CBGA 2GCPA 1YFKA 4Z9BA 5LVAA 4MHTA 2O1SA 2PUEA 1KYZA 3OLCX 2B8TA 1QHEA 2HY7A 5BN3A 4HWGA 3TE6A 3ZVRA 2EP8A 4CM1A 5AW8A 3IKLA 3NG1A 4WAUA 5HKKD 1NVVQ 1E9AA 2FSVA 2ZB2A 1CQWA 1YD7A 4HH1A 1U0HC 5J40A 3VTZA 3WC4A 2XAUA 1WMEA 4CCSA 4CKYA 4DC1A 3A3PA 3NANA 1LSOA 4LC9A 4KC0A 3ZDCA 1JE0A 1T5IA 1G0OA 1ZITA 2K6GA 2XQFA 3FNGA 4MUXA 5JSYA 2AA3A 1TUBA 2WP8J 5DFAA 3RU2A 4URXR 5AJWA 2RI0A 3IBSA 4MCJA 3LC1O 5ALTA 3ZQ6A 4RJTA 4M8NE 1D2NA 3DBHA 1SBYA 5FBZA 1E3DA 1TMKA 2Q4TA 3EEBA 2I67A 1QANA 2O2EA 2P3QA 4ASUA 2EJWA 5IM4F 3CUSA 1N9ZA 2V45A 2P1DA 2W2NA 5K3EA 1F60A 3AW9A 3W6OA 3I5YA 1GM5A 1Y8AA 2H0RA 3PUWA 1ES9A 1T9KA 5CRIA 4EKIA 3JALA 4DV6B 3O8NA 2HQBA 5KTNA 5CEFA 2PVSA 4QXPA 3UCFA 5DYTA 2R47A 4U2KA 1BZYA 4UFOA 1N3BA 4XJTA 5HUHA 1NQ5A 3VKHA 2GS9A 4GMDA 2PG3A 5DHPA 2PVPA 1RKVA 5D84A 3V3KA 5B3JA 1SK9A 3PPXA 4MVJH 3WLQA 4ZICA 2GJ8A 2H54A 5E2BA 3V2UA 2HDNB 3ZV4A 4LV5B 2QTHA 1LTKA 4KGXA 4O4LA 5C7LO 5LQCA 3H6KA 3K9BA 3HCCA 1TX4B 3I42A 4JSTA 1OT3A 4NTZA 2OESA 3CG4A 3Q5DA 2ZBRA 1DG1G 1II8B 5DNVA 5C2JB 5HKBA 5ESRA 2JK0A 2HRBA 2QX9A 1Z68A 2QVLA 3EY9A 2WD8A 2WNIA 2X6RA 3L4SO 2NIPA 3QWBA 5JHHB 4HDSB 3SLKA 2GARA 1CR6A 1JQDA 2ESRA 3S40A 5AK0A 4IVRA 4RYDA 3R8CA 2VTBA 3R0XA 5DOVA 4EG8A 1G18A 4YO7A 2PFKA 1XZHA 5IFKA 1V8DA 1GRQA 3JS5A 3T52A 1JAZA 1EXDA 1IONA 1H0KA 3ICWA 3ZLBA 2OFWA 1DBVO 2CFSA 4BLWA 5JCXA 5L4SA 5JANA 1Z0UA 4QDXA 5DHTA 1YE3A 3QI7A 4DS3A 4EYKA 1B8PA 1N8SA 2NT3A 5CG2A 4PG5A 5HS4A 4P2GA 4EAQA 3UPTA 3MRVA 5BOVA 3DM5A 2D06A 4WZAA 2QPAA 4BO2A 4GOLD 3P9ZA 2V9ZA 1G9SA 2WWRA 2ZROA 2AUMA 2IDKA 2VT2A 1Z0ZA 1Z07A 2H5EA 5EJAA 1M2OA 1XZDA 2K5UA 5FRDA 3R7SA 4F3CA 5L3QA 5F9HA 4BAZA 1KARA 3QPCA 4KVAA 1WABA 1BHSA 2W2PA 3TIIA 4EBFA 2QRHA 2II6A 4YUXA 2XT6A 2FUNB 3HNOA 1U8TA 2HA0A 3JQ7B 1U8AA 2AH5A 4FFBB 3CGWA 4JU9A 4AUMA 4C0XA 1R12A 2QKYA 5TV2A 1U2ZA 2YIJA 4JQSA 3KUUA 2K2WA 2GBCA 1CJCA 3M34A 1FTQA 4QPDA 3AXTA 3V6MA 4LJ8A 5I9SA 1ECLA 4BMNA 1M34B 3I53A 4IJ6A 4WHMA 5ICFA 4PLWA 1VCNA 4MHOA 2X8AA 1DT3A 3TR6A 1G291 1M0TA 2E4AA 1IJEA 1N75A 2OORC 3LBFA 4H4EA 5DW0A 2SICE 4PO9A 4UNPA 4CG2A 3ZI7A 1JQLB 4FMDF 2XVYA 4DV3B 4JEHA 1EFCA 3AEXA 3AWIA 4NPHA 1WDKA 2QIPA 3WYCA 3AESB 1V47A 2OG2A 1SCBA 4MYRA 1AA6A 2IBTA 5BSFA 4ARCA 1NVMB 2HTEA 2Z8ZA 3BYZA 3LL4A 2H06A 2JJ1A 1FSSA 2R00C 3C97A 2GBLC 3LSYA 3RS4A 1JZQA 3AETB 3RFCA 3ZVMA 1G5QA 4B6EA 2TYSB 4W1RA 2Q2WA 2BSXA 3THOA 5KBYA 3O4RA 1KEVA 5EESA 1R10A 3VHQA 1Q1BA 1SKYB 3C15C 2YN0A 4DL9A 3TRJA 2P4QA 5TXGA 3RU3A 3UK0A 3AR6A 9LDBA 3GL9A 3SQLA 5D01A 2IYWA 1VM6A 1L7RA 4Q34A 3FYUB 4LVOA 1HG0A 1IBRA 3U0VA 2W0MA 2BGTA 2UVPB 4PONA 1U3DA 1ZP6A 2AEFA 4PAMA 3CTPA 3FCSB 3IVGA 1ODIA 1N1MA 3AFGA 5IXJA 4IGFA 3NPAA 5T6BA 1I7DA 3GPCA 2JPDA 3VU1A 4Q3EA 4TWAA 4CIAA 1GQSA 1A9RA 1SWVA 5L4LA 4CF5A 3CLUC 2VOJA 5CFPA 3P5SA 4BVLA 5IFLA 1JPUA 4C29A 4DV5B 5K99A 2RGDA 1HYEA 4GXQA 3M89A 4EJ6A 3U7FB 4RWEA 3NBKA 4WZZA 3R09A 1MLDA 2X6TA 4B6GA 2PUDA 2WNSA 4GOND 4F4UA 2XCIA 1KS2A 1GCGA 1QIDA 3G0GA 2H1LA 4KO8A 4B3JA 1U02A 5LXTA 5DNYB 5EUBA 2FW7A 1H5UA 2E9SA 2XE8A 1Z88A 4MP6A 5BSWA 1P3DA 2XJ4A 2YMLA 1OWPA 1MV8A 1MH9A 4OOFA 2O8DB 3HCWA 3TXYA 4QTUB 1Z8NA 4D4MA 3H6GA 4NYJQ 2CKDA 5ADWA 5DK6A 3PVSA 1TQ2A 3ZNQA 1KI9A 2WJJA 4PNPA 5DN9A 2FR8C 1W5BA 3ER8A 3CF6R 1UH5A 1OLXA 3KUXA 1A8SA 3WBJA 1A96A 1CFZA 4H18A 4MR8B 1I1OA 1CKEA 1LI4A 1ABEA 2MJLA 3NYWA 4PCAA 1XHEA 2GFHA 4KXNA 4NHOA 3OFND 1L7MA 4E3ZA 2ROQA 4TKUB 4RTKA 1JIIA 3WA7A 5AVKA 2DHQA 3FB4A 3SE0A 3HN7A 3M6MD 5IKPA 3J80A 4WUTA 3KQNA 4UCQA 4RDIA 3FPJA 1G7TA 4Q03A 2JFYA 2PMFA 2GVDC 4RXUA 5CDYA 1Y5RA 1ECFA 2Z30A 4O4HA 5DGHA 4AS2A 4XW2A 3UENA 3M4NA 3A1EA 1DOZA 4GYJA 2VJNA 4MRNA 4OMUA 4K3UA 3WP1B 4DA9A 2H6EA 5LA6A 3MJDA 5H59A 4I8XA 4Q24A 5I9MA 4OJNA 2KS6A 1G6HA 1RWPA 2PZLA 1B93A 5ALGA 1ZA1A 1TA0A 2Y1GA 1XE3A 2IYOA 1G6OA 3EXHB 2VBFA 3GLFE 4NMHA 5IDVA 4BO0A 4IJKA 3U16A 4AVYA 1H69A 1ISRA 4R0NA 5L6MB 3WA6A 4EYGA 4P7GA 5ILQA 1P0IA 2W6IA 2YNMA 4GC5A 1J0AA 4HUQA 2JEOA 3VC2A 2Z1DA 3QVKA 3DE0X 5ALMA 1W19A 4PAGA 2M6SA 5ADHA 3J7TA 4YX9A 2PMWB 4XGKA 4ACBA 2F43A 1U0LA 2HM7A 1ULAA 3DM9B 3ZE1B 3ZCVA 4COKA 4YJ2A 5G4LA 3NGMA 3K4QA 3NT2A 1I33A 3A70A 3V97A 2BZ1A 3F6RA 3SJ7A 2JLUA 1Z75A 4I55F 1I3NA 3R7WB 2NZYA 4KDCA 3JY6A 2DLDA 1X9IA 2JAOA 4LRTB 1NQWA 3JR7A 4TQGA 1WUJS 4KPUA 3WK4A 2PKYX 3SHFA 5ALFA 2JBWA 3HJHA 4QJIA 5BSTA 1ZN7A 3KK0A 3ZDAA 1BXGB 1HE4A 3ZQUA 2J0VA 1EUQA 4E94A 2V1XA 4U6QA 5AOBA 3FLAA 4IDBA 3E05A 5DM2A 2JIZA 1YE5A 2C31A 3QVMA 1KYWA 2P6UA 4D9IA 2I80A 5IJAA 1UBEA 3N3AC 2B2CA 1JEYA 1OTHA 1CD5A 3ZI0A 2RGAA 2VK2A 3O94A 3RVLA 1MV5A 4GT1A 3BE8A 4I5GA 3GNQA 4RMJA 1TIPA 2O0MA 4OU5A 3QELB 4A7PA 3KEOA 4C2BA 2Z6UA 1G8MA 4RDXA 1E0KA 3BMXA 3PEFA 4L8FA 1JQ5A 2FOLA 4BB5A 5A5GA 4EATA 4EPTA 4WX2B 4X8MA 2VDQB 1GL6A 2Q5HA 3URMA 2LWIA 1SCAA 1HDCA 1V8ZA 3OH8A 4J1TC 5HS6A 2IP4A 2O50A 2MSWA 1GUFA 3S0JA 3ZKWA 2W2OA 4F71A 3OTQA 4KR0A 1DC7A 1OFTA 1ZUNB 3NOOA 3U7EB 1TU0A 2QQGA 3D6HA 4ND2A 3V2GA 2XTJA 4JC0A 4C01A 5J3JA 3W7AA 4J0GA 1QZUA 2CNKA 2NVWA 3Q5EA 1LXCA 1RVDA 4Q1BA 3C8MA 3H9BA 3VAYA 2YV5A 3W5IA 2NO9A 1C9KA 1U2DA 1L3CA 2A0WA 3HS3A 1E6WA 1K92A 1FQKA 3RUFA 1QHFA 2HHCA 1YQGA 2OMEA 4OQXA 1N77A 2F8SA 3FCUB 4ZCTA 3W2EA 5BWNA 4ML3A 2BGIA 2VWHA 2WJVA 4TTPA 3H1AA 4GQIA 2VJMA 4G5GA 1MCZA 1AZSC 4C21A 3S3TA 1E1MA 2EKQA 2QXTA 2ZVDA 2SHKA 4LF9B 1WE2A 3TMYA 1SPBS 1AUOA 2WSBA 4M7WA 5BQPA 4ZDKA 5IU6A 3BMOA 1XU4A 5U9CA 4F6LA 3DL0A 4G0QA 4B2PA 1DADA 4GH5A 3U62A 4EA8A 3BH7A 4ZYWA 4RQAA 4BATA 1W88B 5IUNC 1OXKB 3B1JA 1H85A 4HNVA 4BGUA 3OP4A 2PXXA 1W0KD 4B4OA 3AYXB 2YVUA 4HSEA 1WDMA 3H2YA 2ZUFA 3M6FA 4Y0NA 5CGQB 1US8B 4Z8XA 3WLSA 1YC2A 2AFRA 4H7HA 3NMUF 3Q8LA 2GPYA 3PQ8A 4BO6A 3BMNB 4NCAA 3JAKA 1JHOA 1ZJWA 3SHWA 4B74A 3CRVA 2WHYA 4DIKA 2GWRA 4OHKA 2ORVA 2DR3A 3N8HA 5HF5A 5CA1B 3I3OA 3H9CA 3X0DA 3T6KA 2IYXA 2CEKA 1P2VA 4HGPA 4Z1OA 4CGZA 3CX8A 3LUKA 3QLVA 4RZ2A 3VR3D 2I1VB 4BMSA 3GU3A 3AZQA 1G42A 4OUDB 5I47A 1PYGA 2V58A 4MUMA 1T25A 1TEXA 1BAPA 2EKPA 2YXPX 3B6MA 4REQA 3KTAB 4ZT2A 4TKLA 4D92A 4P81A 4BEVA 5E0OA 1KKUA 1CY0A 4OTZA 2ZS8A 5DZSA 5K8IA 3CF0A 4GR9A 3HCEA 2FWPA 5DH9A 3UGQA 3K9FC 2ZI6A 1M5RA 1TFUA 2XQIA 4LV6A 3K94A 4GZ3A 1GN9A 2OQVA 1DXHA 1R8SA 2QRVA 1E92A 1XELA 2VHZA 3OWOA 5KKNB 3BDVA 4AYTA 4QUAA 1G9XA 2B83A 2DR0A 5G40A 4J9VA 1XGKA 2C2YA 4F21A 5HJ2A 1G7CA 4FD2A 3GPBA 4R8KA 4B7ZA 4L8YA 1BU8A 5C51B 1SC6A 1VI5A 2IYRA 4UVGA 1A9XA 3V1MA 1H2WA 1QGOA 4HDKB 4MWZA 4YV1A 2QE7D 5HCUA 4PGAA 4L22A 1JJVA 5H16A 4D4LA 4FKMA 1EIWA 3KQLA 3I9MA 1AKRA 2IYAA 4JQOA 5L3RA 3GHYA 2B6NA 3KOUA 5B1YA 4H7JA 3BPSA 3RT7A 5KTPA 4H6PA 2JIMA 1ORWA 1ML3A 2R6ZA 2YJ3A 4MJXA 3T0IA 4YRIA 1VDMA 1VE5A 1OY1A 1WV1A 3UJ7A 1B3RA 5JQGB 4BUJA 3L4BC 3UIEA 4HNUA 1GNSA 3KQVA 1A8UA 4MVJD 1KO7A 2CXXA 2I4RA 1YR8A 4HG2A 2IXGA 1TTQB 3JWHA 4CIYA 1KY5A 5AXDA 1I1QB 3VR4H 4P34A 3ABQB 4IDOA 2FGKA 1EU1A 1C4WA 1CJKC 1I4OA 3C6BA 5I51A 3MT0A 4FYMA 4YAOA 5JUWA 1QBGA 1SAYA 4QYXA 4DR3B 1UXJA 1UZUA 3L3BA 2Y6VA 5JCPA 1AK9A 1IEVA 4NS4A 3OPXA 3UBTA 4DRXB 3N58A 3DULA 1JFSA 4JP3A 4LXXA 2FSHA 3DUFA 4PFKA 4BNIA 2AMFA 4F8EA 1E9BA 2ONJA 1OTXA 4HV4A 2WKPA 1J8VA 2BGUA 4WK2B 1G8SA 1JT2A 3I0NA 4QPPA 2QJWA 4MUIA 2IBMA 2JBAB 1JX6A 1L7XA 5TF0A 1F4VA 4ARSA 3LCUA 4O2AF 3E70C 3FPCA 2X9NA 3WFJA 1R5NA 4WD3A 4C2UA 2J3QA 3MVEA 3PKZA 5GQSA 4G1CA 2JIQA 4BLOA 4LZPA 5KWSA 4LOLA 4FEAA 3JYPA 1QONA 3NHFA 5ABPA 3L05A 4V1CI 3F1LA 3D54D 3IXQA 3QMPA 2I6FA 1XWIA 4RGYA 1RBQA 4G8JA 5IDXA 4OKNA 4ZYZA 5HR5A 2HC9A 2XXAA 1KETA 4PX3A 3KUCA 2HWYA 4S0ZA 4EDHA 1MB4A 4HNTA 5L9AA 4QDOA 4GBJA 3PXXA 1RQPA 2CUKA 2W2LA 4L6CA 5CA0A 1DEKA 2C4TA 4FBMA 3ZE2B 1DDGA 4O29A 3ZGNA 2ZYSA 4AURA 1U7PA 4MIYA 2Q2OA 3T5AA 3IB6A 4JD5A 3EIWA 2FW6A 3E3AA 1GXSB 3ZGVA 2RHOA 4G4JA 5B36A 4FLEA 2WFAA 2I1LA 1A7JA 2XEXA 2Z83A 4IIDA 4UM9B 3C87A 1CUUA 1E2FA 2DQSA 1IN6A 3UMGA 3MQFA 2I6UA 4CV1A 2QLBA 4TYQA 3JWIA 4B2LA 1R2QA 2C5LA 4NYMR 3EUAA 4IJQA 1EJ2A 2AZMA 3MJEA 3HA5A 3GLIA 2XRZA 1A9ZA 1AHNA 2BE7A 3C41J 2C0CA 3DLTA 5ALVA 3GZNA 2YJZA 4Z3KA 1Q1AA 4DJEC 2W6OA 4IR7A 1UXGA 4OLBA 2GKOA 4L3VA 1XZ8A 2FNAA 1QE5A 3ADKA 4PS0A 5GV8A 3UB2A 3MLEA 5G1NA 3LDHA 4KFSA 1M7GA 3EPHA 1DFHA 4NBVA 3TBFA 7MDHA 4CU5A 1WTAA 1NWCA 4IRXA 2D2XA 2EX4A 2XE7A 4R41A 4ZQBA 3M3DA 5BMOA 4AS1A 5TMPA 3IC5A 2Q5CA 4XWWA 5K4HA 2H63A 4S0XA 2REBA 3EF3A 4NATA 4M6WA 1X7YA 3Q11A 3OT4A 3KQTA 4G25A 2B82A 2Y77A 3CW2A 3RVBA 1BS9A 4NPAA 2GI4A 2HRDA 3QG1A 4ZZ3A 5TGZA 4BNHA 5LZ4A 4BV2A 3AVVA 4WW0A 3B1YA 1K8YB 1T8WA 1OHHA 1E9E