3A4VA

Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
311
structure length
311
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
total genus 122
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a4vA00
5CG2A 4MKZA 2O3JA 1XG5A 5HWSA 1LRKA 4OIMA 2PLAA 2QG4A 4TZKA 5G0VA 1HSZA 3ZV6A 2VUTA 3ZNNA 1NXQA 4C7JA 4EDFA 1HYGA 4IXTA 4MKXA 2GPTA 1YDEA 4YWJA 1D1SA 2DT5A 2I5PO 3NJ4A 1MA0A 1GCUA 5EJ2A 3LT4A 3HDQA 3VPFA 1PL7A 4F45A 4BO2A 4CMIB 1ZFNA 3GMDA 1YB1A 3RC7A 5IDXA 4YEDA 1GZ6A 1V3VA 3MTGA 3EUWA 1CF2O 1WP4A 4IIUA 2D5CA 1R0LA 1AGNA 4ZRNA 2G76A 3QWIA 2A4KA 1ZNQO 3Q1LA 3OIGA 4FOSA 1R16A 2IDZA 3GY0A 2BF7A 3WNVA 3GVPA 3GLQA 4GLLA 1PJ3A 2AEJA 3GVIA 5KJCA 2CUKA 1MXHA 3WGTA 1LLCA 1GQQA 1V8BA 3ETEA 3DEYX 4ZQBA 4MP8A 3ITDA 4YT2A 4J2HA 1SZJG 1QMGA 3DBVO 3V5NA 2PH5A 2ZK7A 3TFOA 5EL0A 1DHTA 3CMMA 3HFSA 1I2CA 1SMKA 4WCDA 1PSDA 4GX0A 1YJQA 5T8KC 3ZZNA 4NDNE 3RSHA 5I8ZA 2EF1A 1NVGA 5KJ6A 4DL9A 1X14A 3H7AA 4S1VA 5DN9A 4B3JA 1GCOA 5KVCA 2AHRA 5KVSA 2QRLA 1JVBA 5JLAA 2CDAA 2HK8A 3G3EA 4H15A 1DSSG 1EVZA 2BH9A 2VHYA 2GNAA 2XOXA 3K96A 1D3AA 4E30A 1EK5A 1NBOA 2GUGA 3WB9A 1VJTA 4O0LA 2C2XA 4YT4A 4YRAA 2PFGA 3LYLA 2DPHA 1GD1O 2EP7A 3VC7A 4PG4A 1WWKA 4O5OA 4WNIA 4K1LA 3CZMA 2H63A 4WPGA 4E5PA 3VVCA 2BLLA 4B4VA 3QVWA 5JO0A 3C7DB 3F47A 2OUIA 2BELA 5DBFA 1HKUA 2EEZA 4BMVA 1YBVA 4AICA 3IP3A 3JQAB 4J91A 5L40A 3DZGA 2WWRA 2FHSA 4BNNA 3LT1A 3AK4A 1SC6A 4MIYA 3IDSA 1C1XB 1NWCA 1TB4A 4D3SA 4GMFA 1XQ1A 4YAEA 2ZB3A 2ZKLA 1Y9EA 3I6IA 4LISA 2BMAA 4P22A 3GG2A 3ZWWA 1GZ3A 4R54A 1X15A 5AQ1A 4XRGA 3WYCA 1BSVA 3UGKA 1P74A 3NTOA 4RF3A 3TFQA 3DONA 1FDTA 4P4NA 2HK7A 1R6DA 1WDKA 1QR6A 2QX7A 3C1OA 1K3TA 4OOEA 4PZCA 3S8MA 1LQUA 3BMNA 3OHSX 4ND3A 1R0KA 4MP6A 5DF1A 4BO0A 3H9UA 3FR7A 2XPCA 4D46A 4BL5A 2DVMA 3DZFA 2OBNA 2YFHA 2AQHA 4I5FA 4FQ8A 1G6KA 1C3VA 1DFIA 4A73A 4Q9NA 4GSKA 3ZHYA 3DC2A 4JBGA 3ETDA 3TL3A 3VZPA 3QIVA 1TVEA 4ALMA 3AU8A 3E1KA 4E12A 4ESOA 4MKRA 1CQJA 3ZGYA 3BHJA 2G1UA 1Q1NA 5G4KA 3E48A 1ZXLA 3DZIA 3WGIA 1BW9B 4NJMA 5GZ3A 1O89A 3AUTA 3M1AA 4JBIA 1I10A 3UF0A 1KVRA 4DPMA 2OP1A 2Y93A 5U4QA 2DBRA 3HNPA 4AJPA 2NM0A 2ZYAA 4FJ0A 4WEOA 5TQVA 2YHIA 2Q1WA 4RVSA 4PG8A 4RQUA 4ILKA 1PZEA 4HV4A 1U7TA 2J6IA 4TZTA 1UXKA 4Z0HO 4CV3A 1BDBA 5A5EA 5BSFA 4HUJA 4FBGA 4IJWA 3GF4A 5TJ9A 1IULA 1YL5A 5I9LA 3OQBA 1YS4A 2P5YA 3BMOB 1AXGA 3AY6A 1H2HA 2Q2WA 4W99A 5DNAA 1QXSA 3PWSA 2Q49A 4MIEA 3RD5A 3W8DA 1DIAA 5ES3A 1DOHA 2D59A 1MG5A 5CEEA 3T7EA 3X2EA 2B83A 1EE2A 5EINA 4E6PA 4EJ6A 1SOVA 3H65A 1PWXA 3BMNB 4OMUA 4FSHA 4R3NA 2AW5A 1U8FO 3IP1A 1KC3A 4MJLA 4IQ0A 4CUJA 5A9SB 1HDXA 1XIVA 3MJTA 4E5KA 5L51A 1C14A 1WMBA 1VRWA 3K6JA 3OJEA 1O94A 3N7UA 1V3TA 3W4JA 3JQ7A 4TQGA 3G0OA 2Y0CA 3FRJA 1WZEA 4J1TA 4MDHA 4BS9A 4CODB 3VH4A 2P9CA 4Z0PA 1NFRA 3ADOA 4AJ2A 4RORA 4YJFA 3IUPA 5B37A 3NT5A 3LZ6A 2PGJA 5CDGA 5T8KA 4BGIA 1QLHA 3DFUA 3OH8A 4BB5A 4NMHA 3JD4A 2EW8A 3NV9A 4II2A 1ULSA 2X9VA 4J6FA 1YVEI 4AL4A 2YV1A 4BB6A 2CFCA 2HJSA 1BXGA 4Q3AA 3VZSA 4MVJA 2VWQA 2DUUA 4WLFA 5H82A 2NSDA 1GFSA 2F1KA 3JYNA 3WNQA 2X22A 3DR3A 2C0CA 5IXYA 3GDGA 2X5OA 1X0VA 3GZ4A 4PLVA 2XXJA 5JC8A 1LDMA 4O6VA 3K92A 1I2ZA 2FZWA 4DXHA 2AQIA 3PIIA 4LRSB 3U4CA 4BHTA 1E1MA 3KSUA 3KUXA 1CJCA 4KUHA 4CMAA 4ZICA 4R5MA 4RL6A 3WS7A 4LCEA 4NG5A 4J1QA 3D64A 2GYYA 2C82A 1E3SA 2G5CA 5BR7A 3B1KA 3K8ZA 2PZLA 4BNWA 2EG9A 3NGXA 4U0KA 2C54A 1GR0A 1HF3A 1KY4A 3DBRA 3R3JA 4J4BA 1Z82A 1I33A 1B16A 1HZJA 3P2OA 4MIOA 5IZCA 5AYVA 1OFGA 2EKLA 1ENYA 4Y6SA 3HSKA 1WAMA 1GUZA 1HDCA 4XGKA 4Q3DA 2C5AA 3E6AA 3FI9A 3GEMA 4FC6A 2YQ5A 3NRCA 4M49A 5COAA 1J6UA 4IS3A 4GMGA 4GX2A 2I99A 2NACA 1C0IA 3CINA 4CR8A 1SEVA 4EZBA 1HEUA 4GGOA 3NYWA 4WLVA 1M2WA 1G1AA 1ONPA 2DTXA 3U5TA 5KOIA 4IBOA 1YRLA 2IRWA 5EN4A 1QRRA 4B8ZA 2OGUA 3AY3A 4RVUA 3S55A 5ENVA 5JDCA 1U28A 3K30A 3PPIA 2HKIA 2Y1FA 3M2PA 1BHSA 3D5QA 3E9MA 3FNFA 5EESA 3STHA 3WG9A 2O2YA 1HETA 2AEFA 5J23A 1U2GA 1QV7A 4XIYA 2UUOA 5TGDA 4TRJA 4I9UA 4Z9XA 5JC1A 1LNQA 1SO8A 4RCVA 5TT0A 2EGHA 5L53A 1W0CA 4U0JA 4IIVA 4JJIA 1E1NA 4OSOA 1I3KA 2JJYA 4Q3BA 1TA4A 4E2ZA 4PRLA 1IUKA 3I83A 1U8XX 1PQWA 4XDZA 1QYWA 1B15A 2X5JO 3LSYA 4OO3A 1N1GA 1B7GO 4JP2A 4IMPA 4BQRA 1NAIA 4WOJA 1MC4A 3OSUA 4CLXA 1HWYA 4AJKA 1P1IA 4CV1A 3RWBA 1GEGA 2OFPA 2ZTLA 2P2SA 2J3KA 1DHRA 1DEHA 1UXJA 1A4UA 2VTEA 1I32A 1QSGA 4YR9A 3QJ5A 2HO5A 5JNLA 3MJCA 5G4LA 1MV8A 3V2GA 5TRTA 3JV7A 4XDYA 5BSHA 2FN7A 4ND5A 2HSDA 3Q0EA 4WCFA 2I9PA 4KMSA 2RBEA 4M1QA 5K9ZA 1I5RA 2ZCUA 1LC0A 2AE1A 3QA9A 1EDOA 1XU7A 1P1HA 3L4BA 3D4OA 1TXGA 2NTJA 1W73A 3ZDFA 3AUSA 3INRA 1ISIA 4A7PA 1QYDA 5IZ4A 1HDZA 1Z45A 4MVJH 5A06A 3ASUA 1P1RA 3JQ9C 3KB6A 4R01A 1EBUA 1ZK4A 4R51A 3QY9A 1ZUD1 1E3IA 5KIAA 3JD3A 3ZWAA 4E31A 1XA0A 4BO1A 2FPIA 2EHDA 4CMEA 4YJHA 2O4CA 2GZ1A 5K6AA 1MXFA 1RM3A 3QP9A 4CLDA 4MINA 1DLIA 4IQGA 3H9GA 3H8VA 3JQFC 2HQ1A 4BNIA 3CUKA 1NR1A 1ZH8A 3L4SO 2J3JA 4FDAA 4OGWA 4RDHA 1CYDA 1NNUA 5BNIA 2PKQO 3BTSA 4ALJA 4EJMA 2J5QA 3S2EA 3QWHA 4BO3A 1H93A 4DQXA 4RF4A 4YYZA 4CM5A 2WYUA 1O6ZA 3A14A 1PJ2A 3CZRA 1E7QA 1LRLA 3TNLA 1CETA 2HMUA 5KKCA 3DBLB 1U5CA 4PLFA 5T57A 1WZIA 5HM8A 5DP1A 3PK0A 2R2GA 4C7KA 2WE8A 4CLRB 3PYLA 4WLNA 4YTEA 3VZQA 1E7YA 1YDWA 2JAPA 3U3XA 3GR6A 4CM9A 4XD2A 3PLNA 4IMRA 4IDFA 1JN0A 2I3GA 2GN9A 4M55A 4BNKA 1JKFA 1XELA 2O50A 4E5NA 4LW8A 3GZNB 3GA0A 2CMDA 3PJFA 4FS3A 1H6CA 1PIWA 2CZCA 4L4XA 3RFXA 4KTVE 3BAZA 3FPLA 1B0AA 2OHXA 3AJRA 4AJ1A 3I9KA 1HSOA 4DLAA 3CSDA 1UP7A 4CL8A 1HXHA 3UOGA 2JFFA 2WMDA 4NK4A 3GAZA 3A28A 4MVJP 5JAQA 1KOLA 1U5AA 1Z7EA 2RIRA 1C0KA 3JQ8A 3GN2A 2I66A 2W2LD 3JQCA 5JBIA 1LU9A 4KWIA 1T1SA 4HP8A 3U49A 3UH1A 2J3HA 1E3LA 3MJEA 1H6DA 5EMHA 1ULUA 1I30A 2ZTVA 4ZQEA 2CDBA 5DBIA 2EJVA 3RCBA 3RUCA 3L6DA 3ZU5A 4BO5A 4EITA 5C7OO 2EKQA 1LDEA 3GNTA 3BMQA 3VKUA 1UDCA 2FOIA 1RM0A 3Q9UA 2RHCA 4OXYA 5A03A 1LX6A 1WXDA 4HWKA 5BNTA 1HE5A 2DPGA 2VZ9A 1YQXA 4BGUA 2VWPA 1E3EA 5A04A 5AXAA 1A9ZA 4IJVA 4TRRA 7ADHA 1PR3A 3NDIA 4GQAA 2HK9A 4XQEA 4XRRA 3L6OO 1A5ZA 1ONOA 3OBBA 4TKMA 1AN9A 1JQBA 3RUAA 3HG7A 9LDBA 1IZ0A 2RH8A 3PYMA 1KIFA 1UZLA 4YACA 2B5VA 2DKNA 5DDIP 5TNXA 3EGOA 2ZYGA 1Z73A 4UUMA 2ZYDA 3MCVA 3WOHA 1ADCA 4CMIA 3WLEA 5EQFA 2Q46A 3JQFA 2FY8A 4DIOA 1ZXBA 4W9NC 2FRDA 2I67A 3K2EA 1ZMOA 4JJFA 1PZFA 1ISHA 1T2DA 1T2EA 3H5NA 1PJSA 1P31A 3QVSA 4R1TA 1FDWA 3U4IA 1ZJZA 3KYBA 4J4HA 3SJ7A 2QRJA 2Q1TA 4HFJA 1SBYA 4NFSA 1MB4A 3WDSA 3ZHXA 4PZEA 1I3MA 3NTQA 3RUEA 3F1KA 1U3VA 1K89A 3B1JA 3OA0A 4R69A 2OL4A 1ZKMA 4GSLA 3T4EA 3ZWYA 4A0SA 5GY7A 5L7TA 1P1FA 3C1AA 1GUYA 1M67A 4KDFA 4XQ9A 3D3EA 3C8MA 3WGOA 4UUNA 2NVUA 4L4SA 2ZB8A 3KM0A 4UREA 1X7HA 2YJZA 4NBUA 4AFNA 4MO2A 4M8SA 4QO8A 4FPXA 3CXRA 4N5LA 1M6WA 2C5EA 4JBHA 1ISMA 3WIEA 1LLQA 5KJEA 4CV2A 2GN8A 3GPDG 3NKLA 1PQPA 2UVDA 4M89A 3COSA 4U6QA 5G0WA 3HN7A 1EQ2A 4IZHA 1HLDA 4FGSA 4DLBA 4RZIA 4CUKA 2VYND 2DTEA 3KLPX 3DB2A 2DTDA 4QT0A 4D41A 1NM5A 5F5NA 2ZQZA 4R9SA 3RUIA 4RLSA 3ETGA 3FF4A 3I4FA 1B14A 2PH3A 2VTDA 4URFA 3VPHA 3WQQA 5THKA 5ILOA 2WYVA 1G0OA 5THQA 2PZJA 7MDHA 1KVSA 3P7MA 4ID9A 4W6ZA 5L45A 3KYCA 1W8DA 2X58A 2QYTA 4EEXA 3ANLA 3ZV5A 2G0TA 3GVCA 3GNSA 1P0CA 3KBOA 3QLJA 3WMWA 1L1FA 3AFNA 2JD0A 3AFMA 5FWNA 2ZB7A 4CMCA 2JFGA 2UYYA 4EBFA 3NEPX 3PHIA 4ZQFA 4D42A 3RBVA 4BO4A 2Y1OA 2H9IA 4J16A 1XU9A 3T4XA 2D4AA 5B4UA 3D1LA 3BHMA 3IC5A 4QUKA 1MFZA 2Z95A 4BO9A 5B12A 3FNGA 5KKAA 1HE4A 4G81A 4DYDA 1VLLA 4FB5A 5JY1A 3C24A 3ZI0A 3K2BA 1ZBQA 4UUPA 3PHGA 4NJOA 3INGA 2W2LA 1U4OA 1H5QA 2BRUA 1LDBA 3DAGA 4O59O 5JYDA 2CSUA 2PR2A 4CMKA 4H7PA 4HXYA 1F17A 3JSAA 4YAIA 4GWGA 1M76A 1OI7A 4CL3A 4J0EA 3HFGA 3I52A 3AM4A 3HJAA 1GAEO 2PD4A 3S1LA 3U4DA 3DO5A 4KDEA 5JPIA 4PLCA 1IY8A 4BNFA 1BWSA 4UVGA 3DBHB 1K6JA 3BHIA 1XSEA 4OH1A 4PG6A 1LA2A 4UUOA 3LC2O 2X1HA 1W4ZA 2HRBA 1K6IA 3PHLA 5AXBA 4IDAA 3A1NA 1VKNA 5A3VA 5A5FA 5ITWA 2DQ4A 4Q3EA 4UEJA 1U3UA 5ITVA 1ZEJA 3DDNA 1Q7CA 3MWDB 4IGEA 1QORA 1D8AA 1V35A 1YH3A 1HE2A 5KJFA 1NFQA 3P19A 4WASA 4LSWA 5F5LA 2GF2A 2Z1NA 4XA8A 2O2SA 1PJ4A 5A1TA 2AA3A 3LLSA 1KVTA 4G5HA 3TOZA 5L4NA 4J2OA 4LK3A 3VVBA 2FMUA 2GCGA 2QQ5A 3OA2A 1KERA 3I23A 1PX0A 1HLPA 4RVDA 1YB4A 3E5RA 1LQTA 3LF1A 3MOIA 2Q2VA 4JROA 1VSVA 3UCFA 2TMGA 3PDJA 1P33A 5JAMA 1KEPA 3DMYA 3D7LA 1Q0LA 2GRAA 4XYLA 4L75A 1Q2XA 2IODA 5IJZA 2O23A 5AXDA 4FFNA 4NZ9A 2WDZA 1MLDA 4W9NA 1E5QA 2PZMA 3PRJA 1P45A 2YQ4A 4IXWA 4YAGA 3ICCA 1PJTA 2VZ8A 4TMFA 1RWBA 2BI8A 4OL9A 5F1PA 2CY0A 4II3A 2O3RA 4DIBA 1T1RA 1LSJA 2R00C 1XWFA 1PJQA 4AJIA 5T6BA 3D3WB 4RGBA 2FSVA 2V65A 5CPBA 1HE3A 3V8BA 3E9QA 2BFAA 2EKPA 3M1LA 4HNGA 4LVCA 4TRNA 5HA5A 3VH1A 4WNCA 1ISJA 3PZRA 3O38A 5FYDA 1GUFA 3ONEA 2Q2QA 1C0LA 1TT5A 4EJ0A 3S2GA 1V0JA 4L9RA 1DO8A 4NBWA 3IKTA 3AOEA 4YB8A 3KEOA 1T2AA 2D2IA 4BKQA 1E5LA 1PL8A 3JQGA 4D45A 4E2XA 3RROA 1Z75A 3W8EA 5HRUA 1GL3A 5FI3A 6ADHA 1YKFA 3QW2A 5I8WA 1B3BA 3HDJA 2HMVA 4RJTA 1M66A 3VHRA 3P2YA 3B6ZA 3SXPA 1QP8A 5HS4A 4JQCA 4GKVA 4WEQA 4PLZA 4HFNA 4DYVA 3WICA 1ZIDA 2VN8A 4BNGA 2VRCD 1P1KA 3KHUA 3RUDA 1CERA 1H2BA 2EP5A 3E03A 4RZHA 2HRZA 3ANMA 3SC4A 3ROPA 3RASA 3RQSA 1ENOA 1H0KA 4Y6PA 3RC1A 1EK6A 1Y8QA 3F5QA 3QQPA 4L76A 4OJNA 2VZ0A 5MDHA 2HAEA 3ZWBA 2VNSA 1R4NB 3R1IA 4IDBA 2HMSA 4ALLA 4AJHA 4E5YA 5MGBA 1NASA 5KTKA 3JD1A 5KNLA 1Z6ZA 3RFVA 1PGOA 3WGQA 5CFZA 3ZWOA 3VPGA 2IXBA 1ZSYA 4OQYA 3JQEA 9LDTA 4DTIA 3EK2A 3GPIA 4A5OA 3H4VA 3BIOA 4TSKA 4BV8A 4FFPA 1OC2A 4FFRA 2D0IA 1IHXA 4A26A 3IAHA 4BQPA 3D3WA 4DIFA 1A7AA 2TMDA 1CEQA 3KRTA 1I0ZA 3WSVA 4DVJA 4PG7A 4BGVA 2Y1EA 3H2SA 1DIGA 4NQZA 2NV6A 4IDDA 3AWDA 1JAXA 1HYHA 2DM6A 4Y67A 4B3IA 4F46A 4XYMA 1ENZA 1LI4A 4QFCA 3TPCA 4CM1A 3HWRA 3IIEA 1PU2A 2X86A 2ZB4A 4M54A 3OECA 5F3RA 1ZMTA 4CR7A 1SPXA 1NHGA 4AJJA 4ZHSA 4HY3A 1SEPA 4DPLA 4DMMA 1NVTA 2VYVD 1T4BA 2ZATA 3OF2A 2VOJA 1XDWA 4AJLA 1NHWA 4KQWA 4RV9A 2C29D 5G0SA 5EQDA 5DOZA 4BNTA 5CDTA 3EYWA 1A9YA 2V7PA 3OQ6A 4Y8VA 3T7CA 2X5KO 2Z1MA 4CM4B 2GZ3A 2NUAA 4WJZA 2V6GA 4J9VA 1S6YA 1VL0A 2E6UX 2HDHA 4JCOA 1R4MB 2SCUA 1BW9A 3MJ4A 3KSZO 5JMWA 1MGOA 5EPOA 3UVEA 1GYPA 3JYPA 1B2LA 1NQ5A 4BKRA 2GR9A 4NI5A 3EC7A 3I6QA 4CUZA 8LDHA 3AOGA 3ZV4A 1FXSA 4E4YA 3WTCA 3GRKA 4FJ2A 3MJVA 1HDOA 1RPNA 2IZ0A 1PL6A 1IHYA 2JD2A 1Y6JA 3Q11A 4IGFA 4RF5A 3RVDA 3AI3A 3L6EA 1S7CA 3PQFA 3GNQA 3ZU2A 2B4TO 3CTMA 1DFGA 2C07A 3F4BA 3RU9A 5B4TA 2RAFA 1EEHA 3DHYA 1Y5RA 1EDZA 2O3UA 2X0JA 3ONFA 4ZN6A 4BKUA 2DLDA 2B69A 2YW9A 3ZCXA 1PZHA 3FBGA 3I9JA 4EEZA 4BIIA 5A02A 3HN2A 1Y81A 3VH3A 4BO6A 1DAPA 4NFYA 3ZWXA 5JCJD 5ICSA 2VUSA 2CD9A 3PGXA 4BMNA 2A9FA 3ENNA 1GU7A 3W4IA 4LSMA 4K26A 2DC1A 1A71A 1FJHA 3WWZA 4YAKA 4XYGA 1PZGA 3MJSA 3LC7O 3DZJA 3PFFA 4I9NA 1JLLA 4GBJA 4JIGA 5A9SA 1R37A 3OJFA 2FPGA 2V6BA 2VUUA 2PK3A 5IAAA 2PY6A 3PQEA 2G17A 3C7CB 2B35A 4CR6A 3AM5A 1ADGA 4NR0A 3I4CA 2JCYA 5AOVA 3UKOA 3PYXA 1JKIA 4RQTA 1SCUA 1SAYA 2XXBA 3G79A 3BTOA 2GSDA 4CM4A 5CEJA 1LEHA 1HDYA 1QYXA 1KS9A 1EVJA 1N92A 2YFQA 1D4FA 2BGLA 1N9GB 2H1SA 1LDNA 4Y6RA 2J5RA 5CDYA 3O4RA 2C7VA 3GAFA 4FD3A 4BNZA 4BNYA 5IZCC 2G82A 5I9NA 1D1TA 3E18A 4B7UA 2BGMA 2B37A 3KYDB 1NVMB 4GKBA 3CH6A 4PCVA 2PKRA 1SNYA 4DC0A 3S2FA 2YDYA 1GYQA 2IXAA 4NBRA 5C37A 2LDXA 3RC2A 2GGSA 3FNHA 3NT2A 1PJBA 2IZZA 5B4VA 4PG5A 2CVQA 1RYDA 3PZBA 5BNFA 3V2HA 3QHAA 1MG0A 4CLRA 4KP7A 4F6LA 4FGWA 4XQCA 3D0OA 1DIRA 4CQLA 1KEVA 3JQAD 3RI3A 3G49A 2O3QA 4YJGA 4E0BA 4ND4A 4WGGA 1YOVA 2FR8A 5C5IA 1PTJA 5DCWA 1GTMA 5JAIA 2B5WA 3H3FA 1Q7BA 3Q9NA 3UW3A 1EMDA 2PGLA 1JKJA 4YDRA 5CDUA 1YQGA 2E48A 3SLKA 5HBRA 4AVYA 1KYQA 4BNHA 1KEUA 2P91A 3WGGA 4D43A 1HT0A 2V6MA 3PIDA 5CDSA 4PLGA 3ZN2A 3RKUA 2X23A 5KWEA 2AMFA 4XCVA 1JVSA 3NGLA 4L4RA 4MPDA 3E8XA 3F46A 4FFMA 1Y7TA 4XZ3A 2GZ2A 1E77A 1LC3A 3BMOA 1GQYA 3JD0A 4R5HA 4UVDA 3SLGA 4BVAA 1ISGA 3K73O 4G2NA 1O5IA 3LK7A 4NJMB 3TJRA 1GV1A 2C2YA 2HUNA 3H5AA 1N9GA 1T26A 5FFFA 5JFOA 4NPCA 5L7YA 3FNEA 1UDBA 3ROQA 4PLTA 5JY6A 1BXKA 4J9UE 4A27A 4Q3CA 1VC2A 3PDUA 2I65A 2X8LA 5JDIA 1FF9A 4TKLA 1M6HA 1UAGA 4L74A 2NU9A 1VSUA 2Q45A 3QWFA 2AQKA 2X9NA 4IJUA 5F1OA 3VPXA 2BFOA 2O7SA 4EUFA 4PLWA 5CHEA 3C3XA 3WIDA 1WDMA 5JO9A 4AJNA 2GASA 2O7QA 3ENKA 5EERA 2CF5A 3ON5A 1KVUA 2EIHA 3AI2A 3GDFA 3GHHA 3ROKA 1ZSNA 1VE9A 3GRPA 1P77A 5BQFA 4CQLB 3L4BC 5DCUA 1F06A 4N5MA 2W4QA 4L73A 4DLLA 2UDPA 2OOSA 3PTZA 3JQDA 3OP4A 1X1EA 4Z6KA 3ANNA 3EAGA 3LLVA 4XKJA 4AJEA 2B4QA 3TZQA 2DUWA 4GVXA 1QYCA 1UJMA 1YBMA 3JQ9A 5G0UA 3ZU4A 3JQBC 1NQOA 4DUPA 4YJDA 1ADBA 4WCFB 3WBBA 5T5QA 3ZWNA 5K6AC 3GGOA 3G1UA 4N18A 5ER9A 2PTGA 3O03A 1BDMA 3Q2IA 2WTBA 3RJ9A 2FR1A 3HHPA 4I1IA 1X0XA 4XGIA 1PGQA 2JL1A 3KEQA 2PKQP 3EVTA 2HLPA 2JHGA 4JLWA 1N7GA 3EY4A 3U9LA 2X0NA 4HKTA 5C7LO 3GFGA 1OAAA 2Y1CA 1OC4A 2Y1GA 5A9RA 1EE9A 1K6XA 1PEDA 2HCTA 3DZKA 3I1JA 3OFSA 4IS2A 4IQ8A 4JK3A 4D79A 1WPQA 5K0ZA 3CMCO 1DJNA 2YY7A 4F6CA 1DAOA 3IS3A 3CKYA 1C1DB 2Q1UA 4XIJA 3GOHA 4OXNA 2IEDA 5TT1A 2ZCVA 1ONNA 1V3UA 4NNJA 1UZMA 3I9NA 1NR7A 3K31A 3RBXA 1YGYA 1R66A 3ZWMA 4JN6B 4BMSA 3F9IA 4W7HA 4J49A 3WGZA 1ZO8A 5L7WA 4OAQA 1E3WB 2NQ8A 3EW7A 4BOYA 4YQZA 2YHUA 1T25A 2IEBA 4NBVA 2QYSA 1I01A 4G65A 3AUUA 1I8TA 4R1NA 4R3WA 1CWUA 3WWYA 2Y68A 4CM8A 3DMTC 2EWMA 2IE0A 3H5RA 2JKVA 3FR8A 3NDJA 3WGYA 4NFHA 3PJGA 5H81A 2O4UX 2GN4A 2E4AA 3WMXA 4B7XA 4GI2A 2UAGA 2JAHA 3NX4A 2WD8A 2DBQA 1BVRA 3ASVA 3WTBA 4DBZA 4E2WA 1ZCJA 1EUDA 5HS6A 2W8ZA 5TLSA 4FJ1A 3SX2A 4PVDA 3TQHA 3GEGA 1P0FA 2WD7A 1HZZA 1OMOA 4XYBA 3IJPA 4YT5A 1NFFA 3R6DA 1C1XA 4HNHA 2P68A 3H9EO 2RH4A 2XF8A 5L95A 2YV3A 3DXFA 2Y0DA 3WR5A 3LF2A 4ND1A 3JQBA 5KVVA 5A9TA 2YUTA 3RU7A 3GUCA 3X2FA 3PEFA 4XB2A 1ZVMA 3QVXA 5KJ1A 3KTDA 5GZ1A 3QE3A 1U3WA 3ZHZA 2VYNA 3GGPA 1ZSVA 3OIFA 1J4AA 3OICA 5IN5A 1U2DA 3CE6A 3EZYA 3JYQA 4TRMA 5TS3A 4WLEA 1H9AA 3TZCA 3KETA 3F5SA 5FI5A 4CLOB 3PJDA 4CMBA 4K9DA 1H6BA 1E7RA 2VCYA 1DC4A 2HJRA 3DFZA 3PXXA 4B8WA 4QSMA 5IDWA 3V1YA 1I2BA 1QG6A 3VPSA 5I7EA 1YXMA 4E21A 5B1YA 1GPJA 1H94A 4MVJE 1EUCA 2C7GA 1F12A 5JE8A 3TF5A 4JXKA 1E3WA 1SB8A 4BKOA 4NH4A 5DZSA 4MVJF 5IFLA 3G1TA 3CIFA 2ZJ0A 3A06A 3ZH2A 2HMWA 1TEHA 2W2KB 1BVUA 4D0SA 1E7MA 4Y9DA 3ULKA 3C85A 3NTRA 3AM3A 2CNBA 3GUYA 3RIHA 4HADA 3JCZA 3M2TA 3U09A 4YAJA 4DPKA 3I9OA 3UAGA 5L4LA 2X4GA 4W4TA 4OXKA 1H6AA 1IZ9A 2QHXA 4I9HA 1WVGA 4BV9A 1XGKA 4J0FA 4AJ4A 3QSGA 3KYCB 4QFDA 3MOGA 4YCAA 3WX0A 2EJWA 1GEEA 2WD7B 3DOCA 4BNMA 3TRIA 1U9JA 2E82A 2C20A 1B8UA 4W82A 1ISFA 4DC1A 1Y5MA 2UV8A 1NQTA 1WMAA 4IDGA 1E6UA 1T2CA 3TL2A 2JHFA 2E49A 1LSSA 3W6ZA 4DMLA 2P4QA 2J8ZA 4GH5A 5ADHA 1VL6A 3B20A 1K2WA 3TZHA 1LXCA 3RKRA 4AG3A 2AG5A 3KLMX 3GN1A 4IUYA 4NU6A 4LCJA 1F0YA 1FDUA 4R4JA 5H83A 4R68A 3H9QA 3PFWO 1NAHA 3DQPA 4D3FA 4PFJA 4CLOA 3JTMA 5JCXA 2Y99A 4LRTB 1PGNA 4P4GA 3SEFA 2XAAA 4IINA 3OM9A 2PGDA 4PGFA 1V9LA 3WQSB 1KVQA 1N7HA 4BNLA 5GZ6A 3GT0A 4IM7A 1VKOA 2I3AA 1VPDA 1IYZA 4OKNA 1NTOA 3WSWA 4DREA 3GK3A 4EYEA 1YO6A 3AW9A 3JQ8B 2YDXA 1FDVA 3CPSA 3BMCA 4U6SA 2X7HA 4OM8A 3OJLA 1NP3A 4B79A 3TSCA 5BSGA 4IZIA 2FR0A 4JP3A 2CVZA 1DIHA 4QX6A 3MEQA 3D5TA 2Z5LA 1E1LA 3OEWA 1PR9A 4WLUA 4WLOA 1E1KA 2PV7A 2CF6A 3DTYA 3SJUA 3UHAA 3V2UA 4CLEA 1X1TA 2Q4BA 4DQUA 5A3JA 3MTJA 3U4HA 3L07A 2P4HX 1VL8A 1NQAO 1BMDA 3E9NA 4OHUA 4CMHA 4I5DA 4CM9D 3ZWPA 3QV1A 1Q7GA 2DAPA 1LDGA 4QO7A 1GDHA 3LT0A 1PJCA 1HDGO 2W98A 4D3DA 1T2FA 3JD2A 4JX8A 4J7UA 5IDQA 5A05A 1ZK0A 1OBFO 1OOEA 2X0IA 1UUFA 2Q50A 2VRBA 4L8VA 5DT9A 3ITKA 4UULA 3FWNA 4BO8A 1FDSA 2A94A 3DBRB 5F21A 3VAZA 5TIIA 3CEAA 3BMQB 4HX5A 1I24A 3BXXA 2NTVA 4NHEA 3LT2A 4CQMA 1N2SA 2VQ3A 4GL4A 3UFXA 1C0PA 1LRJA 3WXBA 3RC9A 4EUHA 1Q0QA 1XQ6A 4IY1A 1RM5A 3PJEA 4TVOA 1O8CA 3Q2KA 5DOVA 3FN4A 4P4LA 4DGSA 2UUPA 3PWKA 4QXMA 5DBGA 3ST7A 1L7EA 1JU9A 5IF3A 4PVCA 1QKIA 4KUGA 1DC5A 5CAEA 2H6EA 1M75A 3UICA 3O9ZA 4BNJA 4PLYA 4XJSA 2B36A 3O26A 3PQDA 2PA3A 3LC1O 4KUEA 5ER6A 5G4KB 1KBZA 1ZJYA 2GDZA 4INAA 4K28A 2IYPA 3JYOA 4KOAA 5JMPA 5L3ZA 3GVHA 1Z74A 3MWEB 3V1TC 3LDHA 3HZZA 3L9XA 3GEDA 2R00A 5DP2A 1UXGA 5G2OA 2P9EA 4F3YA 4J90A 1TI7A 2YHIB 3OETA 1U4SA 2Q99A 2Y1DA 4CMGA 4EUEA 1ZZEA 3NUGA 3WBFA 3H3JA 5COQA 3KSDO 2OXIA 1KY5A 1LLUA 3OMLA 2VWHA 4WOKA 3OQ1A 4XR9A 4WE3A 4UEOA 4LMRA 5CEFA 1E3JA 3IJRA 3AOEC 2LDBA 1EQUA 3PLRA 1DLJA 3VDRA 3ZNQA 4A10A 4HFRA 5U1PA 5JXWA 4MVJM 3C1TA 4Z3DA 1GADO 3PVZA 4AJOA 2A92A 2GD1O 1PS9A 5TC4A 4NU5A 1H9BA 4YRDA 4Z0TA 3P5SA 1YB5A 5CPFA 1JAYA 1JA9A 4CMJA 4KZPA 3U62A 1J5PA 2X6TA 2Y05A 4N7RA 2BFPA 2FZEA 1B8VA 4XEHA 2JFHA 3EHEA 4BNVA 4YBZA 4M87A 3BA1A 3Q3CA 3M6IA 3JQGB 4RDIA 3DHEA 3O8QB 3FHLA 4LVUA 2Y66A 4RO0A 4YA6A 3B70A 5C3MA 1T24A 5TSDA 4IDCA 1TT7A 3NT4A 1LSOA 1X7DA 1X13A 4UVIA 1UP6A 3KYDA 1E7SA 2ILTA 4PN3A 2I76A 1AHIA 4ZGWA 1LJ8A 3H2ZA 3HQ4O 2RHRA 2DFVA 6LDHA 3SC6A 3UXYA 1GQ2A 3BYZA 2F00A 1IPEA 1EVYA 1E7WA 2HU2A 1RJWA 2YYYA 4MOWA 4O63O 2H5LA 2Q3EA 4JGBA 4CM7A 4E33A 1DXYA 2DU8A 4RPLA 2VWGA 1AXEA 4RPGA 4RPJA 2OZPA 1CRWG 1PJLA 2GO1A 1KETA 3KO8A 4OYRA 5BSEA 2DFDA 1AE1A 4E5MA 1BXGB 1F8FA 2E37A 3W8FA 1VJ1A 3FPCA 5FEUA 3JQAA 1DPGA 1XCBA 2O48X 5AVOA 4L0QA 2NU6A 2VRCA 4R41A 1DBVO 5ENDA 3BTUA 4KQXA 4BKPA 3VH2A 1GZ4A 3DBHA 1W6UA 3OIDA 3WFJA 4LMPA 2NTNA 4IDEA 4DRYA 1RYEA 3DWFA 3RFTA 4UAGA 1UR5A 4YJHB 3VTZA 1CDOA 2JCVA 4WUVA 1I3LA 4YJFB 4CQMD 4I5EA 5BT9A 2D1YA 1FK8A 3SBOA 2OORA 4RLHA 2AE2A 4BO7A 2NNLD 2NADA 3NDRA 1PGPA 3HADA 1P1JA 3C7AA 4UEKA 2WYWA 1ML3A 1I36A 4I08A 2I6TA 3GZNA 1J0XO 4KTTE 1JTVA 1DIBA 5I7SA 1N8KA 4I8XA 4LN1A 3GH3A 2VHXA 4Z9FA 1FMCA 1YJ8A 2JCXA 4ZJUA 3DAPA 1JDJA 4BNXA 2CVOA 2PWZA 4R1SA 4FCCA 4MP3A 2BHLA 1ZK1A 3KVOA 1J49A 1B8PA 2WE7A 3QWAA 3V1UA 1IPFA 1QV6A 2PNFA 4E13A 3HB5X 4YXFA 4BUCA 5KCZA 4DA9A 1XYGA 2B0JA 1R4MA 4N54A 3GQVA 2Y67A 1KC1A 2X9GA 2O3SA 1EBFA 1Y8RA 1DRWA 3R0IA 1WW8A 4FR5A 4Q39A 3BMCB 3HE3A 1ZK2A 1KEWA 1SB9A 1F14A 3ZWCA 3DOOA 4R1UA 4QECA 5JDCC 2VNAA 2WEKA 5JCJA 1TLTA 1WLYA 3MZ0A 1ID1A 4B4WA 1ZEMA 4GVLA 3ZNPA 1YWGO 4FFOA 2NWQA 3DTTA 3IUSA 4U7WA 1K0UA 3ZHBA 4QEDA 2FWMX 2VHVA 3EDMA 3GDOA 2EGGA 2NLOA 1EFLA 4FN4A 1UXHA 1GY8A 4W7IA 3GG9A 1B3RA 3AI1A 4JJGA 3OJ0A 1ZW1A 3ABIA 4D7AA 4YT8A 4HBGA 3F1LA 1XLTA 1JWAB 1XR3A 4EGFA 3ICPA 1TT5B 4H16A 1ZK3A 1MC5A 3QRWA 1DRVA 4ALNA 4GLOA 1O0SA 3D4NA 4OSPA 3H9JA 1YE3A 4CLHA 5L9AA 2GERA 2BI7A 2IYOA 2NU7A 4LGVA 3ZU3A 2NVBA 3IOYA 4R9RA 3VTFA 3OJOA 2Y0EA 1NPDA 3AUAA 3BZUA 1G0NA 1E0DA 3TOXA 8ADHA 3IMFA 1N5DA 5T64A 4GX1A 3JQ7B 1Q0HA 3W4KA 1UDAA 2J5KA 4ZVVA 2BD0A 2EW2A 1PS0A 1ARZA 4WCFC 1A7KA 2D5AA 4C4OA 1UAYA 2PD3A 1MFPA 2C59A 2QZ9A 1NX6A 1AHHA 2VOEA 1DJQA 1R15A 1Y8RB 1GV0A 2QIOA 1L7DA 3PI7A 4M86A 4PLPA 3ZV3A 4J1NA 2A35A 1Y1PA 3ONDA 1K5HA 1R4NA 4NIMA 4RF2A 5DCYA 2NQTA 5EIOA 3A9WA 5JW6A 3VKVA 4ZRMA 1ENPA 4GWKA 4CJXA 4U5QA 1YL7A 4IJKA 4RVGA 5C7IO 4FOOA 2AXQA 4OQZA 5KVQA 3E82A 4MVJI 4Q3NA 1HTBA 3UCEA 3N58A 1B26A 1P3DA 1IB6A 4XWYA 4B4UA 3QVOA 1E6WA 4YQYA 2VT2A 3UCXA 3R3SA 1EZ4A 2NVWA 1JW9B 2AQ8A 3W6UA 3ZW8A 4FFLA 5ILGA 1VJ0A 4CMEC 4FW8A 3SVTA 3G17A 2NVUB 4YJGB 5IG2A 3HUDA 2IZ1A 3IL2A 3BTVA 4B3HA 2ZJ1A 3HDHA 4MVJG 4NBTA 4RVHA 3JYLA 3Q6IA 4FIZA 1DC3A 1P9LA 4XGNA 4B4OA 3NAQA 2OBYA 5I7FA 2VHZA 3I3OA 5A4DA 3GFBA 3A4VA 2BKAA 4YPOA 1HYEA 4J7CA 1YL6A 2EXXA 3JQ6A 3EVNA 4RPHA 4UVHA 1NYTA 1NWHA 1HL3A 4DBVO 3UUWA 3EZLA 5IDYA 2D3TA 4K6FA 1O95A 2PD6A 2V6FA 3FTNA 3N74A 3QWBA 4CM6A 3LQFA 1NPTO 1R0SA 5JDIC 3GMSA 3DOJA 3NJ8A 4ROSA 5JS6A 3WYBA 1A27A 2J3IA 3QVTA 4KWHA 4YRBA 2ZTMA 3KZVA 1NPYA 5CG1A 4CM3A 1U1IA 1CIVA 3DAFA 3TDKA 5TF4A 5L4SA 1DFHA 4TROA 5IN4A 3WQRA 1IOLA 2YV2A 3GVXA 4A03A 5TJHA 4MVJD 1EUZA 3AY7A 5F1KA 1Y9AA 2PZKA 3I9MA 3ROMA 3O8QA 3D4PA 1EFKA 3TZKA 3F6YA 3IKVA 1U7HA 2DBZA 4XB1A 4CPDA 4Z3KA 5LDHA 1MUUA 4H3VA 3EMKA 5JAZA 5JYEA 4J4TA 2ET6A 3DBLA 2B4RO 5G0TA 1QLJA 3GHYA 3FCOA 3TWOA 3FSRA 1PQUA 4IPTA 3PGJA 1CQIA 4E2YA 1A72A 3RUFA 1DB3A 4B7CA 1UP4A 2VYVA 2QRKA 2W2KA 4XYEA 3S2IA 2OO5A 1Z7BA 1XEAA 1LLDA 4ZQHA 1EVIA 1LBEA 5LCXA 1PS8A 1LSUA 3U0BA 4CV0A 4D0RA 1XKQA 4QQRA 1YBAA 2CDCA 4O1MA 1IL0A 4P8RA 4PZDA 4EI2A 1UXIA 2JD1A 1AUPA 1RKXA 3WLFA 2ZIZA 2P5UA 3OEYA 3RBZA 5JSFA 4XR4A 2AG8A 4GPD1 4DQVA 3IQDB 1T4DA 3I9LA 4WKGA 1PWZA 3F3SA 3PP8A 2QW8A 2EV9A 4ZQGA 1YQDA 2BGKA 4J43A 5TX7A 4BNUA 3UN1A 2VHWA 1BGVA 2POQX 1VM6A 4ITUA 1PGJA 3E5MA 2P9GA 3PHJA 1WNTA 5HTOA 3WJAA 4J1SA 5CP8A 1BRMA 2WSBA 3VDQA 1RM4A 2EERA 3WFIA 2QZZA 3FBTA 1MX3A 4E32A 3I5MA 1YOVB 2VT3A 1N1EA 4N5NA 4GX5A 1GYRA 3RJ5A 5I9MA 4HFMA 1DDOA 1MP0A 1VI2A 3DL2A 4OKIA 4JNKA 2X0RA 3K9QO 5FF9A 1OZAA 3KV3O 4TVBA 4J3FA 3VZRA 1UZNA 1C1DA 1IE3A 2W90A 1LTHR 4Z9YA 3DMTA 5ICMA 4RVFA 1V6AA 4ALKA 1BG6A 3HB4X 4TWRA 4CM8B 3DHNA 4X54A 4XX0A 1F8GA 1WDLA 4XJTA 4DWVA 4ND2A 5AXCA 3GC6A 4K6CA 1A4IA 4S3MA 4XQGA 1X7GA 4YVFA 4NK5A 1QYVA 4GAEA 4GGPA 4CQMB 1HRDA 1DRUA 4RPKA 5COBA 3ZNOA 4I5GA 2ZQYA 3L77A 2D8AA 3TZ6A 1ADFA 1E6EA 1HDRA 2O3TA 3INTA 3LU1A 3VOSA 3ZWVA 2NU8A 4ALIA 2BFMA 3PWZA 3KOUA 1SOWA 1O9BA 1U3TA 3RUHA 2Q4EA 5U9CA 1P44A 4QTZA 3B1FA 4UVEA 3LVFO 3ORFA 3DZBA 4ONEA 4PIVA 2FSSA 3GGGA 5LC1A 3RAJA 4PLHA 5LDGA 3ADPA 1XHLA 3FD8A 1BXZA 3H6KA 4BGEA 4D44A 2GN6A 5I7VA 4P38A 2RCYA 1I3NA 1LUAA 4FC7A 4J7XA 4A2CA 2HMTA 1UH5A 2WM3A 2Q1SA 2OP0A 4ZD6A 4R16A 3F4LA 1D7OA 1BTOA 4Y98A 3WYEA 4ZU3A 2YZ7A 3KXDA 3WJ7A 5DULA 1E92A 5T67A 2OMEA 3TN7A 1ORRA 2GLXA 3L0DA 3WGHA 1YONA 2WJPA 1LDYA 3PHHA 4WECA 4PRKA 2DBVO 4ZA2A 3W1VA 1Y8QB 2FPPA 2ZTUA 4WK6A 1DC6A 4U8GA 3ZW9A 3FWZA 2R6JA 1JWBB 3K5PA 4OOFA 3HDYA 3DZHA 4E3ZA 2FP4A 4EW6A 1GPDG 5GMOA 1R12A 3AU9A 3FTPA 3L9WA 5IXSA 2AEMA
chains in the Genus database with same CATH superfamily
2P0YA 3GLGA 2PJDA 5DHAA 3W7AA 3L7MA 2O3JA 1XG5A 3M6WA 3R3VA 2GHRA 1I4EB 4MJ7A 2B1JA 4MKZA 2O07A 2PLAA 3ELYA 3Q98A 1HSZA 4PS1A 5ENZA 2FVXA 1R6TA 4KVZA 3PHBE 3ZV6A 2G25A 1WU7A 4FEYA 4F91B 1NXQA 4L4ZA 1CLEA 1VYVA 3F90A 3P2EA 1JJ7A 4MA5A 4P5PA 2YMPA 1WV0A 3IXMA 4IXTA 1CYEA 1CUJA 4KU4A 1IJFA 4FXPA 3SBDA 1J23A 3CFYA 3KXLA 4KJZA 1GCUA 1XZKA 1Z0SA 5LM3A 1PL7A 2C03A 1GXSA 1OBHA 1VHQA 4BO2A 3KE9A 4D9JA 1C3EA 1O8BA 2AUMA 3QENA 4FINA 5ARCA 2AOTA 1NN5A 3H2YA 1XMVA 5IDXA 4Y9RA 3S44A 4D57A 1T3LA 1V3VA 2B30A 4WADA 2OQ2A 5EZYB 1EWQA 1XF9A 4UNSA 3WL6A 1CJBA 4QASA 4OMCA 1WP4A 1W2WB 2YYAA 3NPAA 1QRAA 3ESCA 2JI7A 2AD5A 4KXFB 4MV9A 1Q77A 1KY3A 1P4JA 2QVBA 3Q1LA 1EGMB 3OIGA 4FOSA 1R16A 2FN9A 2R4TA 4X1KA 3NC4A 1H3FA 5DX8A 3NHAA 3UK7A 4ENTA 2AOWA 2GAAA 4ZI7B 1U8CB 5KU7A 1FBTA 1MXHA 4MW4A 4ZI3A 3C5HA 3K4HA 4FW9A 2QE7A 4A2QA 4OFBA 2Q5LA 2W6MA 1VYTA 3Q6NA 4HYTA 4LXYA 5B6JA 2YZNA 5C1DA 2ZRQA 1XAGA 5FBLB 1IK6A 2Z9DA 1QMGA 2G0AA 4U3JA 3OIYA 2PH5A 2ZK7A 4Z9AA 3TSOA 3V5NA 1U11A 3HFSA 1I2CA 3DVAB 3ZQUA 1JXMA 1KQ3A 5T8KC 2P11A 4LOHA 3UV6A 5EMMA 1RBZA 2RARA 3RSHA 2HDOA 3Q3IA 3SFVA 1I7QB 1BGXT 2EF1A 1NVGA 1L5WA 2QTGA 3ESYA 4TTVA 5KJ6A 3CW8X 5CGQB 1FZTA 4S1VA 1ATIA 1RAFA 5DN9A 3A6PC 4ED9A 3ECAA 3VX3A 4YRLA 1JVBA 1P7WA 4EQZA 4EG1A 2JH3A 2VHYA 2XOXA 1U1FA 2V45A 3S3TA 1EK5A 3UFXB 3OM0A 4GOOD 1Z7YA 3PUZA 1VJTA 4LDPA 4O0LA 3CWZA 1TK9A 1K9VF 4QJ5A 5KTYA 3STYA 3LYLA 5AW9A 1ZWKA 4HAXA 4URHA 2HF8A 4LOAA 1C7JA 4O5OA 4PG4A 3LRPA 4TLBA 3UWOA 4K1LA 3CZMA 1J9GA 4HGOA 4XVRA 3V00A 1XMSA 5FTNA 2H63A 1MNQA 3WNDA 4NZMA 4K9OA 4JH0A 1BX1A 5M04A 1J90A 2XWJI 2BLLA 1E32A 1YZKA 1KOFA 3F49S 3FZNA 3LWBA 4B4VA 1F1JA 3AHIA 4KGDA 4NE9A 4RGYA 3ZLBA 3O8OA 2IUTA 1RPAA 2OAGA 4OHPA 4JFAA 2EEZA 2ZAYA 3G0GA 4Q03A 2D1RA 1YBVA 2XXAA 3FIJA 5D7BA 1O58A 4L3OA 3WHIA 4LMBA 4J91A 4IEEA 4NMLA 4M99A 1VTKA 4RD4A 4BNNA 4DRXB 1B4DA 1XP8A 3AK4A 2WBLC 2Y6UA 3SHQA 2HLHA 3IDSA 2QUKA 4Z1OA 5CTAA 1BN7A 4L1KA 4QOGA 4G0QA 3CPEA 6AT1A 1MU0A 5D2CA 4BMPB 1RQRA 3I5YA 4YAEA 2ZB3A 2ZKLA 3HK2A 2VPWA 1JLKA 2H16A 3I6IA 2QRQA 3LCCA 4P22A 4RW0A 2CBXA 3H1GA 4HN4B 1O6BA 1HK7A 1X15A 4XRGA 5AQ1A 2A33A 4Y1EA 2QJRA 1U6KA 4LUCA 3NTOA 2JGDB 1Z33A 1GIAA 1QMPA 2B61A 4FYPA 4RIGA 3CF2A 3AHGA 4ZODA 1NMXA 4Q7MB 1R6DA 2JI4A 3O9VA 2HL6A 4RXTA 4Q00A 3QU4A 4ECAA 1NTRA 5KNDD 1TKBA 1FTNA 1TAHA 1IXYA 3OE1A 5D8DA 3A6EA 3W3ZB 4U7PB 2H2AA 1A2KC 1P9WA 1TJ5A 1NDQA 2CFIA 2H4XA 1GNVA 2PBLA 1GILA 3ED5A 3MMPA 4HNRA 3IQEA 2OBNA 4WBSA 2AQHA 2QLMA 1GPBA 3NH9A 4A73A 4Q9NA 4GSKA 4U39A 5JD3A 4B31A 1SUWA 5MF6A 4WH0A 2F1OA 3ZCQA 3DC2A 4JBGA 4IJQA 3WLIA 3G82C 2W2QA 2NZXA 4LJ8A 2X8WA 4ARBA 1I6LA 4IKOA 4PYRA 5AW0A 1NONA 2QRZA 4C2TA 4O4JA 3O94A 1EINA 4ESOA 4GZ3A 1CQJA 2PSDA 2Q5OA 2EZ9A 3G0IA 1BX0A 4K0RA 5ICFA 5LUBA 3BHJA 4BJ3A 4ZMBA 2XA9A 3D8BA 3LY8A 5ERYA 1OWMA 4LNAA 4BZXA 2PRSA 1KI9A 1VCHA 3C43A 4KQEA 3TLAA 3CNQS 4MS4B 3WRYC 5J4LA 3TCNA 4NJMA 3FMGA 3D6VA 3A4IA 2FRDC 3VR3A 3EXHB 3M1AA 4DHEA 2XMRA 1KVRA 1LFAA 3PFIA 2OP1A 4KIGA 4PONA 1X77A 4TKUB 5LQDA 2ZIXA 2WA2A 4G5GA 2NM0A 3ZHQA 3OPYB 5BMVF 4P84A 2O2EA 4ZCQA 3GCXA 3JZDA 4PX9A 3BFPA 5DLEA 4ILKA 5L3RA 2JRLA 4UFNA 2E5FA 4DRXA 1U7TA 4JVOA 1K3FA 4MYRA 4IZ6A 4JT4A 1SQSA 3ZDEA 3UC9A 2OQVA 2O7VA 3NAZA 3BCUA 1BNCA 5A5EA 3EXIA 4KC0A 1DX9A 4HD8A 5BSFA 2BEVA 4AZTA 1U7PA 2RGRA 3FGPA 5TJ9A 4GYJA 5D5HA 5DBEX 3G8YA 5HFAA 5EGSA 1S5PA 5JPDA 1QH8B 4ARZA 4MCAA 4I1OA 2HA5A 1SA0A 5LYJB 1MT0A 3BMOB 5AK6A 2GBIA 3AY6A 2F8TA 5JCPA 2BKVA 1NOIA 5DNAA 3PWSA 1PNVA 4UNRA 3OZIA 3BGDA 3IVXA 3K5IA 5ES3A 4IIDA 3MSXA 5KNBA 1KJ8A 4R9UC 3T7EA 4GR5A 1G7CA 2C2KA 2QI9F 5IAKA 5GIOE 3DOUA 3OQNA 5A4MS 4G5RA 1Z0JA 2ZSHA 3OI7A 5TPWB 1EWYA 1PWXA 2YC4C 1SUSA 3BMNB 3IEIA 4JX9A 4O2AF 4UCFA 3SZMA 5IT9A 1O08A 1P5HA 3IP1A 1KC3A 2WAXA 4NV3A 4D99A 5A9SB 1W581 4CDRA 4G25A 4IRXA 4BMDA 1C14A 3K6JA 2IUEA 2WOOA 3F8WA 2XLCA 3N7UA 4W5JA 2GPBA 3VO9A 1H0RA 3JQ7A 4PBSA 4R6WA 2I6GA 3SR3A 5FUMA 3G0OA 3V97A 5AKJA 4O4HF 3EVGA 1UM9B 4KK4A 2IHJA 2P9CA 1RDFA 3N0RA 5ALGA 1SCUB 5FULA 2BEUA 3IHWA 4DEYA 1L8XA 1GAWA 2K4MA 2QAGB 4RORA 3ZCPA 1K4MA 1IH8A 1XTSA 4MI3A 5C4IA 3V8PA 5JJBA 1QE0A 2BTOA 3OQPA 1YU9A 5T8KA 3V4OA 1U2RA 3JD4A 4J0CA 4MARA 4NZOA 3E9EA 2X9VA 4PYKA 2QQ0A 5FBKA 2YV1A 4BB6A 1E62A 1PFGA 1GUBA 1UPAA 1J0AA 3FKSD 2VDMB 4KLRA 4BRZA 3FPJA 3HKEB 4Q3AA 3PNYA 1VLHA 4ETNA 2HCFA 4OFZA 1WQ4A 3OEED 4OU5A 4UPVA 5HE8A 3T7AA 1WXWA 3DR3A 3T3EA 4IFIA 1BCSA 3HY6A 4Q93A 5LP6F 3GDGA 2PCLA 3KJEA 5EIWA 1FFSA 2O6LA 1VLQA 1Q0RA 3ZEIA 5JC8A 4X1YB 1BU8A 2AQIA 2P27A 3GCGA 3LD9A 3IOMA 3PIIA 1E1MA 3N2IA 1RWXA 1ABFA 1O87A 3WS7A 2IUUA 4LCEA 4NG5A 4WBNF 1MIOA 2EQBA 2BGNA 2C4KA 4YHHB 2C82A 2PPLA 3B5IA 3KT8A 1BS9A 1JG4A 1K4KA 5HQ3B 2FZLA 4FE7A 3OTWA 1R1DA 3UM9A 3P27A 1GR0A 1KY4A 1WV1A 3DBRA 4J4BA 3ONWA 4MQUA 1IBSA 4PSVA 2V5VA 3G9TA 3QLVA 5IZCA 3JWGA 4BNDA 1BJTA 3PKZA 2K6GA 3NANA 4UHJA 5FOSA 1ENYA 2JFVA 2DPMA 1IZ7A 3HSKA 3RTAA 5DHFA 2XKAA 1X7YA 3D3QA 4X5OA 3I62A 4RTLA 4O2BB 1NULA 2HSEA 3NRCA 2WIKA 5LQAA 3FZYA 2L0XA 1OXTA 3KHKA 4NS4A 3HCBA 2NACA 4MYUA 4UPDA 2WNHA 3DE3X 4WQMA 3S5JA 721PA 3JRNA 1PSZA 4CR8A 3IE1A 5IVHA 1SEVA 3NOOA 1WBDA 1UAAA 1HEUA 4GGOA 1NIJA 3NUQA 3CLSD 3AVOA 5CA0B 1KDVA 1NY5A 4IBOA 4O4IB 4D2IA 2IRWA 1V47A 2ZUBA 5EN4A 4EZEA 1CNMA 4CCSA 3I4LA 4QNRA 2AR0A 3PR3A 4YMUA 5ENVA 2PS3A 3VKFA 4CIXA 4M7WA 2UZ0A 3M2PA 2XUJA 4R0MA 3RIXA 1FXWF 2WKRA 3FNFA 3NHRA 3WG9A 1YFZA 2O2YA 2Q0HA 4IO1A 3OC6A 4QYMA 1R8JA 5AWFC 5HFNA 3ZY3A 3P52A 2L19A 2ZR9A 5J23A 1I9CA 1QV7A 4M1TA 1P1CA 4XIYA 4YP9A 1WXEA 3AP3A 4RVNA 5GQSA 5TGDA 1LBTA 4Z9XA 5JC1A 3H17A 3KU4A 3R41A 3Q7EA 4L5CA 1ZD3A 3MUNA 3QEMB 5TE9A 2FWAA 2CLHB 3KV1A 3ZW9A 4WRRA 5GAJA 1O94C 3NONA 3UMMA 1X74A 3GZJA 3KLNA 4EGJA 2QMYA 4FE3A 2IUFA 4S2UA 1TA4A 3VSAA 2WQZA 1W0JA 1AJEA 1CY1A 2YS7A 5EYPA 3TNJA 1B15A 4YAFA 3LSYA 4K1XA 3Q5DA 1BWQA 1IU9A 1XNRB 3D4LA 3L5OA 3K6SB 3ES9A 1AUVA 3CRNA 1N1GA 4WXHA 4US0R 1CUFA 4BQRA 1NAIA 3OSUA 3TXXA 2Y92A 1JNXX 1JLMA 3E58A 4ZOQI 2CB0A 4CV1A 4EH1A 2ZI6A 1P17A 2IVFA 4BLVA 2OFPA 1YCGA 2ID9A 2XUIA 3OZUA 1MAVA 4A6PA 1BC5A 3BL5A 3ZIAA 1DEHA 4MGZR 1I1HA 1K4YA 4KQGA 2P2DA 1UXJA 4HPJB 1A4UA 3O84A 4TS3A 3W6PA 1KJYA 2VTEA 4PQYA 1ADJA 3KVYA 3B36A 3OZ7A 4QGBA 5PNTA 4BV2A 3OQHA 2O2XA 1M0TA 2PMWB 2ZR8A 1A98A 1L8QA 4JL6A 2C8KA 4CF4A 3HJFA 4MYTA 3AERA 5TRTA 1KXJA 3JV7A 2Z5GA 5HW0A 1LPAB 1MJGM 5EUCA 3IVCA 3UEOA 1LNZA 4WCFA 3QVGB 2PUBA 2HJWA 2H59A 5KOJB 3QPUA 3NMUF 3CX8A 3O2SB 4BZWA 4M1QA 3KOXA 5K9ZA 2ZCUA 3IVMA 4RXUA 4EY4A 1FRNA 5JT1A 3AF6A 2IGTA 5ALWA 1P1HA 1X7WA 3W0LB 2P4EA 3NHMA 5I7OA 4DUGD 1X1BA 4CYMA 5J5CA 2JBHA 3B2EA 1QYDA 3HR4A 5IC6A 13PKA 2B9VA 4P4SB 4MVJH 1KORA 1OLXB 1KO4A 1RS0A 3LBFA 4DA4A 3HY4A 1NGSA 4Q7LA 2FLKA 1P1RA 3F67A 3JQ9C 5DBOA 1W29A 3ZX5A 4C7VA 4D9NA 4E03A 4P3KA 5HMLA 2ZBVA 3TR0A 1ZA1A 1VMKA 2OC4A 3VDNB 4X1IA 1GLVA 3QY9A 4B6GA 5KIAA 1JYFA 4FNMA 4AXBA 3LQRA 4JP5A 1XA0A 4BO1A 2ATXA 3CN7A 4BP9A 4CMEA 4ZAXA 1PEYA 4COKA 1MXFA 1ORDA 3QP9A 1CFZA 4WXYB 3L43A 1DLIA 3QOYA 4OGKA 5LWQA 1QX3A 1R6AA 2HQ1A 3NHJA 3PD7A 3CUKA 1AQ6A 4C6HA 1RLUA 1Q0TA 3GRRA 2AYYA 4V1CA 1NNUA 1HPLA 3OOWA 2XQVA 1RAEA 2JFQA 2PKQO 4ALJA 3ZZTA 1A9PA 5E6UB 5KREA 1C29B 1M5UA 2RGNA 2J5QA 2WU0A 5JBNA 4I4TA 3DMNA 4ZMRA 2EFDB 4DQXA 1KBOA 5AVRA 4DLUA 5BT8A 1PCXA 3GT3A 5CD1A 3HO1A 2EX1A 3TNLA 1CETA 4E5SA 1EX6A 2GFHA 2NO4A 3DBLB 4RPIA 5KKCA 4CEJA 1OT5A 1RQ7A 2M1XA 5EY5B 4DIMA 1XNJA 3O4IA 5C8YB 1WZIA 2PR7A 3HZHA 1W1IA 3LXUX 5HM8A 2H18A 4Z3OA 1AUXA 2JK0A 3U80A 1EG7A 5DP1A 3PK0A 3AQ4A 2DF8A 4K2AA 4BQEA 5IHPA 4BFUA 2WE8A 3Q8KA 2XMZA 4D4JA 5JZ9A 4LJ9A 1ZI8A 1YDWA 4CM9A 2ORVA 3IE2A 5FTKA 3PLNA 1Z6AA 2ZJ7A 3GEHA 1UKBA 1G8YA 4MRPA 1YKSA 5FL3A 3K6RA 5AUQA 3FUXA 3ADCA 2XKBA 4TTAA 2ZYRA 5J47A 4ZMSA 3P96A 1COWD 2H1LA 4IXNA 3GA0A 4U9HS 4QSHA 1QH1A 4ISBA 2OY0A 1WUJS 1NXPA 2HA6A 4J29A 2P8SA 4XUEA 4BJ5A 1YS1X 2X1VA 3BAZA 1TZMA 3FPLA 1PKEA 1W5FA 3UXMA 5C8ZA 4J76A 2YIDA 1VB5A 1HSOA 2Q4OA 1OTHA 3SGLA 1UP7A 4P4SA 1HXHA 4R1QA 1T9CA 1XMIA 2JFFA 1OLXA 3G9ZA 5DN6A 3A28A 4MVJP 4YUVA 1U5AA 2ZIEA 1L1EA 1PL0A 2ZRLA 2QUIA 3EBPA 3H84A 2V7WA 2W2LD 5BR4A 1RTTA 3EH2A 5BOSA 4H7HA 5DWQA 4NE7A 3U19A 4HMQA 4PPNA 1Z37A 1Y42X 3CNHA 4HP8A 3TIFA 2J3HA 3DMPA 2DFNA 5EMHA 1ULUA 2QU8A 4CN8A 1WETA 2CDBA 4BQSA 3FXAA 2H4WA 1TO2E 4BO5A 5KYYB 4HOYA 2J6CA 4K46A 3GLRA 3I73A 3QFHA 4EITA 1WPGA 3DR5A 3T1NA 2QTZA 4MQ6A 2W2XA 3RQIA 1GT91 3PFCA 3BMQA 1N1DA 2ZP1A 3EDRA 3KZ1E 2FOIA 1FPMA 4ZDJA 5A03A 2CNWD 4TTJA 4ZREA 1QRDA 1JR3A 2DPGA 3ZE9A 5DH9A 2VWPA 1E2LA 5A04A 1ZD1A 4DGQA 4J16C 1PR3A 3DBOB 1GKYA 1VL5A 3NDIA 4O02B 4TKMA 4DB2A 4AWXA 1AN9A 3MS4A 4LJRA 1IZ0A 5C52B 4ZYUA 2IYNA 2ZE5A 5NULA 4EW3A 4UHEA 3U39A 3FG9A 2N1MA 4LZPA 5DDIP 1C9JA 1XAIA 2G36A 2ZYGA 1EFPA 1FFXB 1Z73A 1OKKD 4RJKA 4N0QA 2ZYDA 2E5WA 3CRMA 4QZVA 5REQA 2OG2A 1ADCA 4MH0R 3RVBA 5EQFA 1CE8A 2GT1A 1HQCA 2JZOA 2Q46A 3JQFA 5CLHA 3RRFA 2D62A 3THYA 1UPTA 1YGPA 4YJ3A 3IB6A 5DNCA 2A1UA 2FRDA 2QUBA 1ZMOA 1FS6A 5D87A 4LNUB 1WW3A 4Q16A 1OXVA 4DUZB 2PUTA 3QVSA 3ETHA 2W11A 2XYGA 1YQ9A 3U4IA 4AMVA 1DV2A 2NX2A 4J3JA 3WDSA 4EQ6B 2DWPA 4F38A 1ES9A 1Q91A 2F43B 3HDVA 5AUPB 4XPIB 2C97A 3RUEA 1OWNA 3L04A 4GUAA 4QC2A 4ZTUB 3DFMA 1GITA 1K89A 2O0LA 3OA0A 5LXTF 1T1JA 1JA0A 1A9SA 2OL4A 4W5RA 1N36B 1T0IA 1ZKMA 4ZWNA 3SD7A 1RHJA 1DARA 3DHVA 3T4EA 4A0SA 4KSYA 4AS3A 1P1FA 1HMYA 1GUYA 3C1AA 1WVMA 3FJYA 3S70A 3VYSB 4D98A 5EHQA 1V5IA 1UADA 3CO5A 3D3KA 3K0KA 4Q9AA 3KCQA 2NVUA 2J0VA 1P0IA 2ZB8A 4EF5A 1B74A 3FF1A 4NBUA 4CTMA 3VOTA 5C31A 4WINA 3VNVA 2Z43A 4LYDA 5A6SB 3R74A 3UG7A 4QO8A 1D4ZA 3GFQA 3W6OA 3I1YA 3A4MA 4LOLA 1AH2A 1ISMA 3I5UA 1HR0B 1SXHA 1N2IA 1KSFX 1J7KA 3COVA 5KJEA 3GPDG 3NKLA 4Y0VA 5DBHX 4RHEA 2UVDA 4ARVA 2VQSA 2XUFA 4GOND 3COSA 3IP8A 2WAMA 1L5KA 4IZHA 2G72A 1HLDA 4IICA 5C8XA 4WL0A 4RZIA 4A1OA 3GLIB 2QSZA 1UKEA 1YC2A 2PLWA 1KJIA 2VYND 3ACDA 2I0FA 3JW8A 5AR1A 4II7A 4D41A 3LUPA 3BF7A 4BMYA 3RUIA 4RLSA 3TQQA 3ETGA 4F5EA 3E0XA 4DLPA 1PTKA 2OCDA 2COEA 4URFA 4OP2A 4AXXA 4C20A 4GQIA 5FPKA 1E5XA 1CY2A 1NKTA 1AK9A 2PZJA 3MWYW 3PCTA 4YROA 4US1R 3H1EA 4FHCA 3ET4A 4N47A 2ZBGA 1FP1D 1U02A 3IILA 4G0MA 4M9UA 3ZV5A 4O29A 5CB8A 1VG9B 3KKZA 5TMDA 2C57A 3WMWA 3N75A 4EB0A 3L1UA 1FTGA 1Z6GA 3U3MA 2ENUA 1JG7A 3AFMA 5LR6A 4N9WA 4L16A 1PT5A 1JXOA 1ULAA 3NEPX 3R8XA 4X92A 3REOA 3W8NA 4YRIA 1FP4A 1JDBB 4KMMA 5KNBH 5K8LA 1XU9A 2V9ZA 1XT6A 2D4AA 4Y3UA 3ZDAA 1RYNA 3D1LA 3B60A 1JQAA 1MFZA 2DT8A 3IDOA 5EE9A 2Z95A 4F6RB 5D3ZA 4BUJA 3AILA 4JL5A 1OXXK 5B12A 4G81A 2BMWA 3TKLA 1VA5A 2GWHA 1L4YA 1QUEA 3C24A 3RFFA 3LP6A 2ZVJA 5JEEA 4I81A 2QJFA 1P8JA 1O03A 2H5EA 3TW8B 1VJ5A 2C4NA 1ACJA 3ER6A 4O59O 1JHQA 2OV8A 2YJGA 3GYGA 3PSHA 5AD1A 2AR7A 2FWIA 1U7WA 3W5IA 2C5HA 4HXYA 1F17A 3CJRA 4G5FA 1Y4DE 1M76A 1TQ2A 4IQ4A 4KPEC 2PVCA 4IHKA 4PNEA 3HJAA 1WXQA 5KOYA 1N2XA 4EGCB 3DO5A 2PPVA 5JPIA 4ZEXA 2QQGA 4ABYA 3DBHB 1U3GA 1K6JA 4B48A 5EIEA 2WVHA 3OLYA 4FGJA 4UW9A 3ZVKA 4GGMX 5EMLA 5DHRA 4XWTA 1OTYA 3LC2O 5I47A 1C7EA 2R1UA 4IIJB 4EATA 3AKCA 4URWR 1NBIA 1TIBA 3G13A 2ZI4A 2JAXA 4P32A 5AXBA 1CLUA 2G77B 2K5UA 2PGNA 2WF9A 3AZPA 3R40A 5ITWA 2DQ4A 1LS1A 2E5LB 1SHTX 1Y5LA 3MIIA 4UMVA 2BGUA 1FNCA 4LHWA 3A9SA 3I32A 4OGFA 4JT2A 1XCOA 4AIIA 2ZJZA 3SIWA 1D8AA 1V35A 1QZZA 3VMMA 5JNTA 2H08A 5JYCA 3K1ZA 1NFQA 3Q41A 4WASA 1PUJA 2Z1NA 1V4BA 3T0GA 3O7MA 4N12A 4EGQA 2O2SA 4B0PA 5A1TA 1P2VA 1KVTA 2WJHA 3C6ZA 3LLSA 4GZLA 4PINA 4TTTS 3FSGA 3MJFA 5E6UA 4HZUB 2ZBEA 2IE8A 4LK3A 4WXMA 4UKDA 2GCGA 2UZIR 3OA2A 1C8VB 1SU8A 1AO3A 4G01B 3FH0A 2J9XB 1BKSB 4WKOA 1DUSA 1X8KA 2FTKE 4B2PA 1HLPA 5C8DA 5JHGB 2VJKA 2VJPA 3EISA 4HL6A 2FX5A 1W30A 4YRJA 5CYPA 5F78A 1V1JA 1YRQA 3TXYA 4BYMA 1XCMA 1X70A 2JVJA 2C1EA 1Z2DA 2C4TA 3FLEA 3EA5A 3HEBA 2GJ8A 5EHXA 5JAMA 3E7DA 3GWGA 3HBLA 3DMYA 2E1RA 3D7LA 2XTAA 3KXIA 1JXQA 4YAWA 5CITA 4ARZB 5LIRA 3KKPA 4HNAA 5GJCA 2N46A 2VA9A 2WDZA 1MLDA 3ZI7A 1JUDA 4W9NA 1OFIA 2PZMA 4EB6B 4U3JB 2WFLA 2PGAA 4IXWA 4KLCA 4WGFA 2BI8A 4OL9A 4MQLA 2FHPA 2LPMA 2JLBA 5CFNA 3NRBA 4QELA 2YV4A 4IH9A 5CX1A 2I71A 5AKZA 4E7OA 2FYTA 1W47A 2WKSA 1P9RA 1XRPA 4JT8A 1UMDA 2W6OA 4L8YA 4UFOA 5T6BA 3L6CA 3TLXA 5EE1A 5KSYA 4RGBA 4GG1A 4X00A 1EM8B 1NN3A 2FSVA 2QTRA 4O2AB 4X6YA 5DM0A 1UPCA 1QRUA 2OHGA 3CWQA 5EJ6A 4I1VA 3W34A 1J21A 4QQKA 4RTKA 2EKPA 4JC4A 1MAUA 1QO9A 3VYRB 1LH0A 3GLHA 3W3AA 2W6NA 4LVCA 4TRNA 3N59A 4DIEA 3PZRA 4Q7EA 1GUFA 1J8DA 5GJWC 2W37A 3IR5A 2E0IA 4EJ0A 4L9RA 2I3BA 2W22A 1VKZA 4Q19A 4JASB 5H02A 4ZYWA 4DZRA 4D45A 2A86A 3B78A 4G84A 1Y3AA 1FL9A 5AHOA 3WGUA 1GL3A 5FI3A 5HRUA 2IS1A 3KTOA 4DDTA 1NJ6A 2K7ZA 4RJTA 2J5BA 2WTEA 1PT8A 3L0SA 1TD1A 2HW8A 2YY5A 3LZDA 2DCUA 3ABOB 5A5GA 2OBLA 3EARA 5HS4A 4JQCA 4BLSA 2NUAB 4IGIA 1DTWA 3QNWA 2FUG6 2V98A 4HFNA 4PLZA 2O8EA 1CS0A 1IB0A 1ZIDA 2VN8A 4NPHA 5F7ZA 5B1HA 4DA6A 4DLYA 1FLAA 4OP3A 4LF6B 2H65A 1ORHA 1H2BA 3RUDA 1CTQA 4RZHA 1L8OA 1UJBA 5CBPA 1AKMA 2HRZA 3FAKA 4DCPA 4OVKA 1P5FA 5KTPA 3RASA 1GA4A 3WYGA 3EA4A 3QNMA 4Y6PA 1OI2A 3ZK9A 2QXUA 1O3YA 2P1DA 4I2NA 4MS1A 4DCSA 2YN4A 1QRTA 4WK4B 5HE9A 1Q0SA 3CX7A 3O31A 4JUDX 4O4JB 2IHNA 3QEJA 4HDSB 4Z4QA 1JKMA 1CNEA 1NW3A 4Z4FA 3BDIA 4ALLA 1U5BB 2GXAA 1Z5GA 2P9ZA 5FFMA 4HUTA 3MLEA 4RKFA 1NASA 5AVKA 4EYOA 1M1XB 2XUZA 3FLMA 2OCXA 3JD1A 5CVUA 4BP8A 1ZU5A 4BMZA 2WT9A 1UK6A 1Z6ZA 4CKCB 1QANA 2V7TA 1QHEA 5JSZA 2AN1A 3B13B 2IS4A 4UQOA 2BISA 3VPGA 1ZSYA 4OQYA 3JQEA 1FBNA 2H06A 2V0NA 1WBBA 2EBHX 4BV8A 5KZMB 2D4HA 1OC2A 3H13A 4DLVA 3UPDA 1RAIA 2D0OB 3D3WA 3I09A 3OQIA 3OLZA 2YBEA 3H2SA 3NKFA 1FDIA 1AGXA 4R2LA 3LTNC 3ROGA 5ALKA 3EZFA 4P7JA 3ICEA 4IDDA 4TYNA 1JAXA 2DM6A 4Y67A 4B3IA 3BH0A 3TIIA 4F46A 4L57A 3BXHA 2IPMA 2GK7A 4HCJA 5ALRA 3VKWA 2OILA 4NOLA 5F3RA 1R8SA 3OHPA 4G0ZA 4QPDA 2OCBA 1SPXA 4KXQA 3Q9LA 5EWLB 3AM1A 3FDZA 1S1MA 2I7TA 4HY3A 4B32A 1SEPA 1JFRA 1CW2B 3WFZA 4ZOBA 1RTKA 3OF2A 1X7XA 1IXRC 1GU0A 4AJLA 1NHWA 3T7TA 4RV9A 4R0NA 2C29D 3DLTA 5EWMB 2WFMA 1F60A 1DKOA 1SVOA 2NAFA 2RFLA 5DOZA 3EYWA 1NBME 1KARA 2OGWA 2V7PA 2W6JD 2NT3A 3GJSA 3MWFA 4G4GA 4PTLA 4Y8VA 4OA5A 5FB3A 3T7CA 3UGTA 4CM4B 1IY2A 3DO6A 2V6GA 4WJZA 3ZLUA 1BMTA 4B83A 1RAGA 2O8VA 3SYMA 4C22A 5CCBA 1V8FA 2YH2A 4O8CA 3B1WA 3NETA 4NOMA 4C0QC 4QDZA 1NQUA 3KSZO 1H1TA 2QR5A 1R4ZA 1PEAA 4HO1X 3EXHA 1B2LA 4QGAA 2F3SA 1OVGA 5FLEX 4CTOA 2WB2A 3FWHA 5AHRA 2LD4A 2VNHA 4CEIA 1FSZA 2HU8A 3K09A 1AKVA 3UKJA 2PBRA 4D1YA 5FUQA 4ZAYA 1S8FA 3B3JA 2ARKA 4ER0A 3VBEA 3S99A 1IHYA 3DD1A 1GKIA 1RYMA 1S02A 2HBRA 2BEKA 1W35A 2EU8A 3BBPA 4IGFA 4TSFA 4BLQA 4B7AA 4Y9UA 2YC2C 2GTPA 2I91A 3IQWA 4MPJA 4ZT6A 2B4TO 3M6VA 1DFGA 2R97A 4RAOA 1UBJS 3VR2D 1MEOA 3FY4A 2Z8XA 1EEHA 2B3TA 2XY4A 1XE3A 3DHYA 4FKZA 3KJNA 2RK6A 1QO0A 2CMHA 5KYUB 3GLTA 5LYJA 2X0JA 2AKEA 4BKUA 4GYWA 8ABPA 3LA8A 4B43A 2CJPA 3SJAA 1BWRA 4BIIA 5CRIA 3BGSA 5HK9A 2BE7A 2PQMA 5DNUA 1RT9A 4XM1A 4XLLA 5BWLA 1MDFA 3W4IA 4OQFA 2M6KA 2FPOA 2OCIA 3K0FB 4QICA 5AO9A 4DY4A 3IBTA 4CIDA 4LOIA 4KQCA 3TMKA 1P9NA 2GN0A 4YAKA 1ZA2A 1GO2A 2W8BA 3NTXA 3U7FB 4L0MA 1PZGA 4MCHA 1AY0A 3A1WA 4HAVA 4OFXA 4Q66C 2QLFA 4GBJA 2CNKA 4DWOA 4E11A 4FE4A 4UM7A 4QPPA 5EWLA 1JS1X 1VDMA 1JHVA 4JHLA 1WOMA 2ECPA 1S8OA 4Q15A 2XA2A 3BKXA 1X7YB 2YYZA 2XWBF 3DZ8A 3G2QA 3PQEA 3C7CB 1XDBA 3KB8A 4X1IB 4M1MA 4B71A 1ADGA 1L4KA 2ZRBA 1H85A 3B8HA 3I4CA 4DLTA 3PYXA 4FB4A 1NF9A 2I4RA 1TDJA 1TMYA 1IN4A 1AM4D 2A9RA 3OT4A 1E1CA 2BW0A 3KQSA 3O1IC 3DB1A 3LWNA 3N6RA 1KNXA 1QYXA 2YWDA 4G5OA 4GQBA 3BWCA 1T6NA 2YW2A 2BFDA 4G5QA 4BVHA 5KWVA 2DQZA 2FWBA 3PVSA 2YFQA 1GZ5A 1HQKA 5AJYA 3BMXA 4URVR 4Y6RA 2J5RA 1IUPA 2QR3A 4UTNA 1YUNA 2OM6A 2VDRB 3GAFA 2G82A 2B78A 3MAGA 1DUIA 2H8GA 3CEJA 4B7UA 5CM9C 2BGMA 2YTZA 2B37A 3KYDB 1X9IA 4Q18A 3VPAA 3CH6A 2NUBA 1X7ZA 1BCSB 5FO1A 3DE6X 3OU7A 4UNIA 3DGFC 1KO1A 4HQRA 1FEZA 1XHEA 4D4LA 1KBQA 3EFEA 5J4VA 3RSGA 2YDYA 1N6PA 5CUQA 2IXAA 3S68A 2HMAA 4EY8A 1DXHA 4HRYA 1KJZA 5E1BA 1N2HA 1B6SA 3RC2A 2OWDA 3K9LA 4YLEA 2OGZA 3R44A 1AQYA 2F8MA 4YX9A 3HVIA 5I45A 1ZITA 4ZJPA 1U65A 1V1MA 2ETVA 2OB2A 2DY0A 4LVNA 1Z3CA 2V58A 3WKEA 5BQ3A 5B1DA 4IHAA 1NP6A 4F6LA 5A5DA 2O8FA 5SYMA 1PJAA 1L4GA 2OESA 1KEVA 2IKQA 2OYSA 3JQAD 4XJVA 2BKEA 4I6GA 3UB2A 3GQBB 4YJGA 3BZBA 3FMFA 5E1DA 3AKZA 1XAHA 4E0BA 4F9TA 4WERA 2EWVA 3MAAC 5B30A 4W5TA 2HX1A 5EE3A 3DAHA 3SEZA 1R6BX 1VECA 3N2ZB 2VDWA 4DAEA 1ODFA 4AROA 3N8IA 1X9GA 4I4IA 1JKJA 2ZITA 1ZNYA 1A7UA 2ZG6A 4JEUA 4N9QA 4EYSA 2RC6A 1IUOA 3BD8A 4BNHA 1GPNA 2TS1A 4EY6A 3K72B 2D0PB 1NOKA 3I53A 3PIDA 5CDSA 4QATA 3RKUA 3S81A 4MUXA 4IRUB 3AI7A 2YZGA 5A7HA 2Q6OA 3URKA 4AY6A 1NR5A 4Q3OA 5ELLA 4C08A 5IX8A 3IIKA 3BFJA 3G2OA 4PPYA 3N8HA 2P3LA 4FFMA 4TTQA 4QNMA 1W0JD 3BMOA 1VE7A 3MSCA 2GM3A 1GQYA 4UVDA 5HG0A 3SLGA 3X2SA 4BVAA 3F5DA 1SBQA 3S8YA 5EE5B 1O5IA 1DP4A 3K0CA 3LK7A 4FLMA 2C2YA 4DDVA 1WEKA 2A0KA 2HUNA 1YZVA 2YUIA 3GGSA 2C2ZA 3M82A 1S2MA 4MW9A 1XEXA 2QN7A 1T26A 3BGVA 3SDBA 5JFOA 4PRZA 2ZUUA 4ZHQF 1UDBA 3DPIA 2QORA 4GSYA 2UYOA 1BXKA 3F6BX 1JX6A 3ZY6A 2XEXA 2HEGA 1X7ZB 3R0XA 3EGCA 1JQLB 1M6HA 3PR1A 4MUFA 4OI4A 1KPIA 1T0HB 2VLBA 1VSUA 2O8EB 5F1OA 2J33A 2EYUA 1MRNA 2X9NA 5FAKA 3R7LA 4PLWA 5CHEA 3LDUA 2P8JA 3DFKA 3WIDA 3DZCA 4G8DA 4M38A 5JXJA 2P75A 4Y2TA 1LF5A 4OG2A 4S35A 3VU3A 2ONCA 2WK1A 2BFBA 1Z16A 1K98A 1V9SA 2EIHA 3AL0C 3GHHA 3EXHC 1FRVA 2BEWB 3FETA 2XNDD 5BQFA 4UE6A 2WP8J 1VG8A 1GDTA 1F06A 4N5MA 2W4QA 2R62A 3EVAA 4KMRA 3WWEA 2OOSA 3WSTA 1E3MA 4K5QA 1TCAA 2ZIUB 4Z6KA 2LCFA 1EGQA 1QHNA 2WR8A 3LLVA 4M53A 1PT6A 2IIPA 5DWDA 2C7RA 3DKPA 3LUGA 2A5FA 3T4PA 3IIMA 1MAWA 1UJMA 1Z4JA 4UM5A 4ASUD 1GG5A 3DDWA 3ZU4A 3H5LA 1CV2A 2DKFA 1NQOA 5IYZB 3KVNA 2FJUA 4GBMA 4IVNA 4L6CA 4M0KA 3NIGB 3LY7A 4R7TA 1D4AA 1J1ZA 1OH5A 2B6NA 1NRIA 3NIBA 3W05A 4B40A 4EG8A 2QTWB 4KR7A 5EMNA 1L5GB 3GGOA 1I4DD 3V6MA 2V9PA 5AVQA 1LS6A 3WNBA 3IP9A 3JZFA 3IVAA 1O5OA 3OTIA 5DGDA 4AUKA 3TX2A 1E99A 2WTBA 2IYRA 3ICVA 2K2WA 1ONSA 2Z2KA 1JEQB 4JI1B 5K0SA 1DADA 1KEZA 1RD4A 1I0LA 2VTVA 3IKLA 3L0ZA 4XGIA 4UOEA 1PGQA 3IBYA 4L7VA 2FKAA 4NBLA 3C3BA 1KYYA 4DNFA 1AGYA 1CC1S 2AG0A 1YA4A 1O95D 4CMIA 4CIAA 3U9LA 4UTPA 4PCAA 3GFGA 5KX5A 4IO0A 1XQYA 3ZD7A 2AL7A 4N1AA 2BSAA 2WT4A 5A9RA 3DZKA 3UJPA 4FXOA 2GM5A 2CFOA 4I50B 5T4HA 3LX5A 3E3MA 4MPTA 3ETLA 1N0IA 3SM3A 1O5TA 4IIBA 5TEWA 3ENZA 3MFQA 3AEZA 2VTBB 5LA6B 2H8KA 1MOQA 4A6EA 4BB9A 4N03A 2PMKA 4RM3A 4OXNA 3RC3A 2IEDA 1ONNA 3VR3D 3EWSA 4X95A 1OAOA 2ACEA 2ORED 1BMQA 5JBQA 1ULZA 1JIKA 5DB4A 3ELBA 1JPVA 1G5PA 4HQ6A 1GDDA 3K6KA 3TEMA 1A9QA 3HCOA 2UZAA 3O8LA 3ZWMA 1JHUA 1JEOA 4BN5A 5CB4F 1CZKA 2X7JA 5IN5A 3EW7A 4ZVTA 4YQZA 1T25A 1Z0AA 5KVAA 4NBVA 2R1ZA 3BWEA 3MTBA 4JLJA 2QYSA 4OGGA 1SGWA 4PSCA 3QPBA 2ONJA 4DDUA 3F6PA 1I8TA 4KBFA 4XWYA 5T41A 4RZ2A 2BTQB 2ZBDA 3C4JA 2ZETA 4CM8A 2IE0A 2WZBA 3FR8A 3H5RA 3NDJA 4DILA 2IV3A 2G04A 3KELA 2ADMA 5H81A 2O4UX 4PAMA 5KYVA 4BXOB 2VPYA 2A4MA 4GI2A 4PC2A 2UAGA 3T4UA 1LPNA 4AO7A 4C1NA 4EPXA 2CYBA 5KNCA 1H23A 2WD8A 1NYQA 1GVHA 1BVRA 3IHKA 3SE7A 1FFBA 3WTBA 5JASA 1NXOA 1ZCJA 4NMXB 1E4OA 1UJ6A 1VFNA 2QJTA 4JMPA 5TLSA 3OE7A 1XTVA 2C77A 1DAHA 1L7XA 1Z4LA 2X3FA 3EDOA 1P0FA 3GEGA 4EPVA 2WD7A 5H3LA 4FCVA 1QU3A 3C74A 5ITSA 2J0EA 2I2DA 4IIYA 5GGYA 3T12A 1V4NA 2V7UA 4HNHA 3O3MB 3W5BA 2P68A 3H9EO 4BZQA 4B3BA 3F73A 5CGZA 3UA3A 2XF8A 5J1TB 4JZKA 1BFDA 1T5IA 1VGRA 1VG1A 3AHDA 3LF2A 4GE3A 2PSSA 1OA0A 2AB0A 2V55B 3X2FA 1GGJA 2B1QA 3B53X 4EJSB 5E7JA 1WB5A 4LJKA 4R8SA 2C2OA 4I55B 5GZ1A 4QLBA 1NUQA 4EL0A 1YAHA 3RYIA 1U3WA 3FCCA 1SC1A 3IJEB 3GGPA 3BCSA 1U0HC 2XE6A 3N0VA 3ZDRA 3WOVA 3EZYA 3A04A 5BMOA 4BE7B