3A4VA

Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
311
structure length
311
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 122
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a4vA00
3QJ5A 1A72A 1Y8RB 3ZV4A 4JXKA 4RZIA 1DRWA 3ZWOA 4WCFA 1DFGA 3C1TA 4E30A 2D1YA 4MKXA 4FBGA 2X5JO 1T1SA 4MP6A 4RVFA 3QWAA 1VKOA 4BVAA 1YL5A 1K89A 1RJWA 4FB5A 4CM6A 2QRJA 1ONNA 1U5CA 1WLYA 1ZCJA 4M87A 3ZW8A 4KUGA 4CMIB 3I1JA 3TZKA 3IOYA 4N18A 1R66A 5A04A 4CLRB 4EUEA 1NFRA 2CDCA 2YHIA 1UXGA 3DZBA 4IDDA 4WASA 2JD2A 2O2SA 3ASVA 1GDHA 4ALJA 4CQMA 3RC2A 4Z0TA 4Y67A 1HYHA 1XGKA 3K2EA 2Q3EA 4BNZA 4CR7A 1H6DA 3PI7A 2W2LD 3G79A 4OL9A 3V1YA 4GAEA 1VKNA 2FMUA 4B4VA 5AYVA 1DJQA 3DBLB 1ZKMA 2HO5A 2O3UA 4E2ZA 3ANMA 2WDZA 5FWNA 4ZN6A 1U3VA 3W4IA 1H5QA 2TMDA 3BMCA 3MTJA 4PG5A 5DOZA 3A4VA 4ID9A 4BNFA 4F46A 4MIEA 1ZUD1 3HB4X 3JQBA 4RVUA 4URFA 1LQUA 4IQ8A 2PKQO 5JS6A 4MVJH 5FYDA 4XWYA 3RUDA 1VC2A 4FS3A 4GSLA 3U4CA 4MINA 5GMOA 4Q3CA 4TVBA 1ISGA 1P3DA 5DP2A 1OC2A 2QIOA 3GA0A 5A03A 1EUZA 1C1DB 4N54A 3I52A 3BMNB 3VAZA 4BO9A 1E0DA 2EW2A 4J43A 4M55A 5IZCA 3P2OA 4L4RA 3DC2A 3QW2A 5JDCC 4NQZA 3L4SO 4M1QA 1PGQA 1PR3A 3SXPA 2FR1A 4L9RA 4NK4A 4IXTA 2GZ2A 2DBQA 1Z74A 2RH4A 4CV3A 1QR6A 1YBVA 4IINA 2O3SA 4XYBA 4YRAA 1TVEA 5ICSA 2VN8A 4A03A 5KKAA 1NR1A 1DIGA 1KC3A 1E7WA 3FTNA 3U4IA 4CLOA 4UVDA 4XGKA 5K6AA 4ONEA 1HRDA 1Q0HA 2D8AA 2J5KA 4N7RA 4PCVA 3GZNA 3L6OO 3PZRA 1O94A 1X15A 2NNLD 2EG9A 1EE2A 4Q9NA 3Q6IA 5F1KA 3K9QO 2VRCA 3R3SA 4BGUA 3ZDFA 4XRRA 1U7TA 1ADBA 3PEFA 1E3EA 2PH3A 1YL6A 2PNFA 2Y1FA 3MTGA 3PQFA 1LX6A 4MP3A 2R00A 3GDGA 4WLUA 4UUPA 1VRWA 4WNCA 1T25A 3PWKA 5EQFA 2RCYA 5TJ9A 3OHSX 4AJHA 2XPCA 3VPGA 2HRZA 2XXJA 2X9GA 1G1AA 3FPLA 3ST7A 4E33A 4FFNA 4J4HA 1E6EA 5CPFA 1GPJA 1PGOA 3JQ8A 3GRKA 4O5OA 3WGHA 2ET6A 3WYCA 2BGMA 3E48A 4XYMA 4PG7A 4YA6A 2OGUA 4J2OA 4JGBA 3RUAA 3VDQA 5JAIA 4R5MA 2Q99A 2ZYGA 3FNGA 3PDJA 1YB4A 3GVCA 3ZI0A 3DOJA 3OJFA 3MOIA 1Y8QA 1Z75A 2GZ3A 2QZZA 4I9UA 3WBBA 5AXCA 4CLEA 5CFZA 1ZEJA 1DFHA 1AN9A 2GPTA 3F5QA 3INRA 2AQIA 2HUNA 4GWGA 4J0FA 3DB2A 2IODA 2VTEA 1BXKA 1N2SA 4J9VA 3PQDA 2WYVA 4EJ6A 4IZIA 3EUWA 4M89A 4BNJA 1YS4A 2OOSA 3M1AA 4O59O 4PLGA 5U4QA 1HT0A 5JAMA 2DUWA 1PQPA 3QA9A 1YXMA 3DZKA 1R16A 4I1IA 1DSSG 2RH8A 4YAJA 1ZIDA 2E4AA 3ADOA 5JMPA 5EN4A 1YVEI 4NFHA 4G65A 3V2UA 3GFBA 4NH4A 2O3JA 3FWNA 4NU6A 3I9KA 4NJOA 5JYDA 4RDHA 2P9EA 4J1TA 3MEQA 1NQ5A 1NR7A 4MVJI 3ETGA 4WLVA 4J9UE 2B37A 4KZPA 5B37A 3ULKA 1JWAB 2O7QA 2W90A 4IQGA 3G1UA 2WYUA 1LDEA 2AG8A 4Q39A 4QT0A 4AJLA 4WUVA 1XCBA 1KEWA 4PLTA 2D59A 3IQDB 2WMDA 1LDNA 3H9EO 3VH2A 5KWEA 1C0LA 4RCVA 4NPCA 3NT5A 1BXZA 2G17A 2P91A 1N9GA 1HZJA 1Z7BA 5I7VA 3PIIA 1K0UA 4G2NA 4HFJA 4NZ9A 4FW8A 5ILGA 5JC8A 1Q7BA 3QWFA 2HJRA 1I01A 5KTKA 1H2HA 4BKUA 1M66A 3TJRA 1YQDA 5BNFA 3ZZNA 4PG8A 4GH5A 4H16A 5L53A 1P1KA 1NHGA 5L7TA 4CM7A 1TLTA 3PWSA 1HLDA 1K6JA 2X86A 4OH1A 4XGNA 5I7EA 4FJ2A 4WCFC 2H5LA 4BGEA 1KEVA 1FMCA 1MP0A 2VNSA 4DVJA 3I9NA 1DXYA 1QP8A 1LJ8A 1T2CA 3KEQA 3STHA 4FOOA 4RQUA 3QV1A 3RCBA 3WQRA 2GYYA 1BXGB 1EVIA 4TROA 1MGOA 1XU7A 4CMAA 2FN7A 4B7CA 3VTZA 4IPTA 3WIEA 1LSJA 2GN6A 2WJPA 4BOYA 4J91A 4YPOA 3ONEA 1UAYA 2SCUA 2V6GA 3ROMA 1U3TA 1F8GA 3WXBA 3TRIA 1ORRA 1FK8A 3I9OA 1UP4A 1H93A 1ZMTA 3PYMA 4P8RA 4GMGA 4CMKA 2YW9A 4CM4B 1GPDG 3ANLA 4B7UA 4PLWA 1R0LA 2J5RA 1NFFA 4K9DA 3P5SA 4GBJA 1CRWG 4EGFA 1PJBA 3ZWPA 1ISJA 4BO7A 3JD4A 4AG3A 1R0KA 3U9LA 4R54A 2IEBA 4IS3A 4FGWA 3JQBC 1OOEA 2PGDA 3VKUA 3MJ4A 4IDAA 4BNGA 3RUIA 3RASA 3QWHA 1R0SA 4ZRNA 1EQ2A 2DTXA 3GT0A 3U3XA 5F1OA 2A94A 1V6AA 1V3UA 2EJWA 3U5TA 3TWOA 4R4JA 4FFPA 4PZDA 3P19A 2OORA 4PG6A 3OH8A 2NU8A 2Z95A 5AQ1A 5FI3A 5EPOA 3HSKA 1AUPA 1YDWA 1PJ2A 3H7AA 4Q3NA 3C3XA 4FGSA 1HDZA 3JQ7B 2VOEA 4P22A 4FN4A 4BNNA 5A9RA 3OSUA 5JAQA 1KVRA 3HHPA 4IS2A 3TZHA 1ISHA 1UP7A 2FSSA 4R1TA 4ALLA 3JQEA 5K6AC 2C5AA 2Q4EA 4J1SA 5BSFA 2Y0CA 2J6IA 1GFSA 4D79A 2EP7A 4JBHA 3W6UA 5TSDA 2CDBA 3W8FA 1I33A 5A9TA 3ZHZA 3TNLA 3KZVA 3TPCA 5KVSA 4DRYA 3O38A 1OBFO 1ULSA 4XDZA 4DIOA 3M2TA 4O1MA 3BTVA 5H81A 1LDBA 3GQVA 4U6SA 3H6KA 4HWKA 2ZK7A 1GCUA 1DC6A 1Y1PA 4AICA 2JHGA 2PD3A 3DMTC 5IG2A 5ITWA 2J8ZA 4HFNA 4YQYA 1A71A 3B70A 4Z0HO 1M6WA 5HM8A 3UGKA 1YO6A 3SC4A 3WIDA 1DDOA 4R9RA 2E48A 3O4RA 5EQDA 2I66A 4P4GA 4BGVA 4NBUA 3MWDB 4E6PA 4WCFB 4FFLA 2POQX 1XQ1A 1NASA 3E8XA 1T24A 1PZGA 3ZU2A 3GGGA 1NAHA 1ARZA 1GYPA 3TFOA 5T6BA 3IJPA 2O50A 3TOZA 5K0ZA 4XDYA 1EFLA 2DFDA 3DWFA 4KWIA 4BNLA 5A5EA 4XQGA 1J49A 3ROKA 2G1UA 2Q1UA 1RM0A 4GX0A 1LSOA 2QX7A 1E6UA 3ZWWA 2GN4A 1U4OA 4JJFA 5TX7A 4CQMB 3VKVA 4EEZA 1LXCA 4BS9A 4NBWA 3ZHBA 5JY1A 1PJLA 2RHCA 1VI2A 2BMAA 1E5QA 3H2ZA 4BKRA 2JFHA 3DAPA 5CP8A 2UUPA 1D1SA 4JJIA 1ISMA 2H6EA 3HJAA 2DKNA 2DVMA 3BMCB 4NFSA 5TGDA 4OKNA 5ITVA 5T5QA 4E21A 4FC6A 2VWPA 2B35A 1P44A 1BGVA 4GPD1 1P1FA 2WD8A 3OFSA 2RAFA 2ZTLA 4XJSA 1FXSA 4YWJA 2B0JA 3RC9A 2D5CA 3LQFA 2C29D 4NMHA 1DFIA 1T4BA 5U9CA 5A06A 3T7CA 2DFVA 5CG2A 2ZCUA 4GKBA 4B7XA 4RLSA 5L4NA 2WTBA 3ZV6A 1FDWA 4MDHA 4XKJA 1DB3A 5CAEA 1JKFA 3UHAA 3WGIA 1GD1O 4IUYA 4RVHA 1YBAA 1VSVA 2Y1DA 3WDSA 4YAEA 2FZEA 3KLMX 4YQZA 2WYWA 2HMSA 8LDHA 3KV3O 1ENPA 4J2HA 4E13A 4CM5A 4F6CA 1JDJA 3GZ4A 5IF3A 1B2LA 4RV9A 4J49A 4CMJA 2GGSA 4CLOB 2QQ5A 1H9BA 4CM8B 1HSOA 4AJ4A 3AOGA 3GZNB 4UEJA 1DHRA 3W4JA 5ICMA 4BO2A 3HB5X 1MA0A 3JQAD 2IEDA 3T4XA 1C14A 2X4GA 2O23A 1PZHA 3E9NA 4MKRA 4F6LA 4Q3EA 5I7SA 1IB6A 4L76A 1LUAA 4BO1A 1MUUA 4BV9A 3G1TA 4LISA 4CUKA 4ZHSA 3A28A 3VPHA 2C07A 2V6MA 1V8BA 3HE3A 4IJWA 5H83A 3TL2A 5I8ZA 4KUHA 4RLHA 5KOIA 1CF2O 2P5YA 4ND2A 3WWZA 3BXXA 4ZRMA 3ZW9A 2HU2A 4MJLA 4CM9A 1XELA 1WW8A 4UEOA 4U6QA 2JD1A 3JQ8B 1DLJA 4I8XA 4EYEA 3BA1A 3P7MA 5L45A 3EMKA 1OAAA 5DULA 1HE3A 3FF4A 1HLPA 3ON5A 5C7IO 3GRPA 1SOVA 4BB6A 5DOVA 4TVOA 4WGGA 1Y8QB 3NEPX 2IZ1A 1GR0A 1WXDA 2YV2A 1CIVA 3R0IA 2VYVD 1BTOA 1BXGA 4HV4A 4EUFA 1V35A 1F8FA 2JAHA 4HUJA 3LC7O 3HWRA 3N7UA 4A26A 1SBYA 1PZFA 3INTA 1E1KA 3RSHA 1GQ2A 2IZ0A 1XG5A 2WD7A 1VM6A 4ND4A 2PZLA 5HA5A 1EK5A 1QRRA 4YJHA 3OQ6A 5I9NA 2C2XA 2EP5A 3ZCXA 1NAIA 1NFQA 3WGZA 5ILOA 3S2IA 2VUUA 2CY0A 3OMLA 4S3MA 1ISIA 1NBOA 1UZNA 1GCOA 3CPSA 4TKMA 3PHIA 3RVDA 4RO0A 1NTOA 3CZMA 1YKFA 1ZW1A 3DZGA 3FBGA 2FPIA 2C54A 1U7HA 3KYDA 3C1AA 1B8UA 4IZHA 5GZ6A 1WDMA 4JCOA 1W6UA 2FPGA 1JW9B 1T2FA 3PWZA 4B4WA 1GTMA 1E7MA 1NQTA 1LC0A 3NV9A 1ONOA 3Q2IA 3RKUA 3IUSA 1ZH8A 3H9JA 5IDYA 3WICA 4RF2A 4D0RA 3F3SA 4NBRA 1Y7TA 1ZK4A 1N9GB 3R1IA 1SB9A 2Q1TA 4HFRA 4J4TA 3PIDA 4FDAA 5HS4A 2O4CA 1E77A 2YQ5A 3DTTA 5JSFA 2Z1NA 4PGFA 1I3KA 1UXIA 4B3JA 4PRLA 1JAXA 4Y6RA 4LSWA 5A9SA 5JC1A 3GK3A 4XZ3A 4RPKA 1B3BA 2Q1WA 2BF7A 4GKVA 1PL6A 1PS9A 3HFSA 4BNYA 4ZU3A 3JQGB 3ONFA 3WTBA 2WEKA 3QSGA 1EQUA 2VZ8A 3PTZA 4E2WA 4GGPA 1P45A 4UUOA 4R41A 1G0OA 1HDOA 3E9QA 2FOIA 2Y1CA 4BIIA 3FNHA 2X0IA 3MJTA 4RQTA 4FQ8A 1UR5A 3AOEA 5F1PA 1ZZEA 3ZU5A 4KTTE 4WEQA 4J3FA 1Q1NA 4J4BA 4NBTA 1HDXA 1GZ6A 3PHLA 4XB2A 5KVCA 2X7HA 4R01A 3ZGYA 1WP4A 3DFZA 3NUGA 1YRLA 3D5QA 1NPTO 4LMPA 2ZJ1A 3GDOA 3OEWA 1T4DA 3IL2A 2J3HA 1GEGA 3HDHA 4HP8A 5TNXA 4D42A 1JKIA 3DQPA 4W9NA 4S1VA 3KHUA 3F47A 5B4UA 3HG7A 3RQSA 2X1HA 4M49A 5I9LA 4K6CA 2GUGA 1HETA 1QXSA 1V9LA 4L4SA 2GZ1A 4O63O 4A27A 4D41A 2GSDA 5L3ZA 4OGWA 4OIMA 4TKLA 3EYWA 1TT7A 3BHMA 3HDYA 1Z6ZA 3PK0A 2C82A 2J5QA 3GUYA 4KTVE 4A7PA 5C37A 5G0SA 2Y66A 4EZBA 5J23A 1LEHA 1YGYA 3F1LA 1CQJA 3DOCA 3V5NA 3JYLA 1U1IA 2CF5A 5C7OO 1I36A 2NTVA 2HLPA 3JQ9A 3AUUA 3WFJA 1MG5A 1PL8A 4KWHA 4JP2A 1NWCA 4AFNA 5A5FA 3E5MA 4H3VA 1M2WA 2JCVA 5B12A 4XIJA 2IXBA 3FSRA 4FFMA 4KQXA 3TDKA 3TF5A 3GGPA 3AJRA 3P2YA 4MVJE 3W8DA 3INGA 2JL1A 3E03A 2EKLA 4L4XA 4MPDA 1VJ0A 1FF9A 2V6BA 3COSA 2H9IA 1PJTA 3NJ4A 2DU8A 4Y98A 4DYDA 4CL3A 3FI9A 2DLDA 1B0AA 5COQA 3H9UA 3OBBA 4IDCA 5EMHA 1DRVA 1P1JA 3RI3A 3AM3A 1PR9A 1SC6A 2Y67A 3CMCO 4BL5A 1TB4A 3NTQA 1NWHA 3QVTA 4QO8A 1A7AA 3Q1LA 1MXFA 3GVPA 2CVQA 1U3UA 4RPGA 1RM3A 1S7CA 1DO8A 3AK4A 1WPQA 2G82A 1DEHA 2PK3A 1EZ4A 3OM9A 3WFIA 1RKXA 5DDIP 2NVWA 2Q2WA 1U2DA 1EVYA 2Q50A 2GN8A 1X0XA 2I6TA 3LC2O 5DBFA 4XGIA 4EW6A 2B4RO 3OQBA 4OHUA 1IL0A 2EJVA 2B83A 4GWKA 3QLJA 3WR5A 3QIVA 4FD3A 4IIUA 5L7YA 1QV6A 3JQAA 1DHTA 3K2BA 5IAAA 2G0TA 4NU5A 4BV8A 4CM8A 2D0IA 1VE9A 1XDWA 2I5PO 5CG1A 4DMLA 1R4NA 1HDCA 2EKQA 1Z45A 4OAQA 2DBZA 3MJSA 3DTYA 4A73A 3DBRA 2C5EA 3QY9A 4XD2A 3JD3A 2BFOA 1VLLA 4MIOA 3VVCA 4W7IA 1G6KA 2CUKA 8ADHA 1GAEO 4UEKA 1OC4A 3NGXA 4F3YA 3AM5A 2EF1A 3DR3A 2P9CA 4OSPA 4I9HA 1ML3A 2BRUA 3OA0A 3UKOA 1KEPA 5DCUA 2D5AA 3WYBA 2GERA 4IDGA 3JD2A 3CSDA 2FR8A 1IHYA 3WMXA 2Q2VA 4WLOA 5LC1A 4BO5A 2YFHA 2GN9A 4WNIA 3VVBA 1EEHA 2RIRA 5TS3A 4AJ1A 5B4VA 4MVJF 2VYVA 4XYGA 2FY8A 4JN6B 1IZ9A 3WGQA 4CPDA 2GCGA 2IYOA 1SB8A 1ZXBA 3W8EA 1TA4A 2BFPA 3L07A 3ZWYA 5JBIA 2Y99A 1DIHA 5G4KB 1MC4A 2P2SA 3TZQA 3JYPA 3WGYA 1P1RA 2PGJA 2WE7A 4L75A 5CDUA 3QP9A 4ALKA 1D1TA 4CMBA 3CINA 3KOUA 3EVNA 4LRSB 3GMDA 4AJIA 1CERA 2VQ3A 2P4QA 4YT4A 4CMGA 2PGLA 4IJUA 1V3VA 2H1SA 4BO3A 1P1HA 3LU1A 3PQEA 4QSMA 3NAQA 4LW8A 3GEDA 1N1GA 4YAIA 2Y93A 5MDHA 3PLNA 5DN9A 5BSEA 5B4TA 4OSOA 4YAKA 4DPLA 2VZ0A 5ADHA 1UDCA 3GLQA 5HBRA 3MCVA 3B1JA 3D4OA 4BNWA 2B69A 2ZB7A 3VC7A 4D45A 4IDBA 4JROA 3DBVO 1HL3A 1TT5A 1ZK2A 4MKZA 4XX0A 1SPXA 1ENZA 3UH1A 3QQPA 3VOSA 5COAA 3PJGA 5LCXA 5LDGA 1DC4A 3OEYA 2ZB3A 1E7SA 1PJ4A 4QECA 2VWGA 1FJHA 1YQXA 3DFUA 1QYXA 3EDMA 5G0UA 3VHRA 5JDIA 4MIYA 2GLXA 1EBUA 3AM4A 7MDHA 4R51A 3U4DA 1E3WA 2WSBA 3VH3A 3UOGA 3C85A 3ZNNA 2RHRA 1ZFNA 3ASUA 1GZ4A 3LT1A 1VL0A 1UDAA 1ZJZA 3GN2A 1I3NA 5I9MA 1HDRA 2BHLA 4W9NC 4E5YA 1TXGA 4YJFA 3CKYA 3FBTA 4B8WA 3WYEA 5JLAA 1B8VA 1I8TA 1WWKA 3H9GA 4WKGA 2DUUA 3F5SA 3WS7A 1ENOA 2EGHA 3ZNPA 3JQGA 4AJNA 4W99A 4GVXA 2HAEA 4CODB 5C7LO 5AXDA 3S2EA 3E18A 4CL8A 4U0KA 2BD0A 4B8ZA 4RGBA 1JN0A 3DXFA 4R3NA 4TRJA 1SAYA 3N58A 3RKRA 4WPGA 2JCYA 3KUXA 1PJ3A 1DAPA 1W0CA 2NUAA 3HNPA 3JQ9C 3DONA 5AXAA 4EJ0A 3KTDA 3M1LA 1PS0A 2YY7A 4CMEA 5TT0A 2WD7B 1N7GA 3BTUA 4YJHB 1F06A 4PVCA 2IDZA 1HDGO 1ULUA 2AQKA 4KOAA 2HQ1A 3GNSA 1D4FA 3D1LA 3Q9NA 3EGOA 5H82A 1B15A 1LRKA 1NHWA 1YOVB 1P33A 2E37A 2XAAA 3RU7A 2VOJA 4XJTA 4PZCA 1FDUA 3KYDB 1NX6A 4WJZA 2PKQP 3UUWA 4RJTA 4I5FA 1I24A 2I3GA 1I5RA 5EINA 3C7CB 3OF2A 4CQLB 1LLUA 4D3FA 1MG0A 4JP3A 3GY0A 1LNQA 2VHWA 4C7JA 3I4FA 3EW7A 4E0BA 4U7WA 1MFPA 3AFNA 1XIVA 2WWRA 3C24A 1LTHR 3DHYA 3DZJA 1YQGA 3AWDA 2W2LA 4AJOA 1C1XA 1I0ZA 4GX1A 5IZCC 1FDVA 2HK8A 2NLOA 3W4KA 1QYWA 3B20A 3CEAA 2PA3A 4BNHA 5A9SB 1PS8A 5KJCA 3NYWA 3E6AA 4BHTA 3PGJA 1UDBA 1UZLA 2LDBA 4FFOA 1EE9A 3SBOA 4BNUA 4GVLA 4WE3A 4OOEA 1R4MA 1KY5A 1DLIA 3G49A 1X7GA 2EXXA 2GDZA 2Q1SA 4BQPA 4I9NA 5TT1A 2OP0A 1B7GO 1GEEA 1NM5A 1RYDA 1HSZA 1A5ZA 1U28A 4XR4A 3CTMA 1UUFA 3QVSA 4ND5A 3NT4A 1NYTA 4AJPA 5A3JA 4RVSA 4CUJA 4LRTB 4K6FA 2DBRA 4Y8VA 5G0WA 1LSUA 2J3IA 4IGFA 5DF1A 1UJMA 3GVIA 4L74A 1L1FA 3UCXA 2FZWA 1PIWA 4CM3A 2Y1OA 4U8GA 1MC5A 2EIHA 3FTPA 1IZ0A 2R00C 4NG5A 5L40A 3LT0A 1RM5A 4ZQGA 2VHYA 4L8VA 3GHYA 5JXWA 4FJ1A 1JLLA 3WSWA 2VRBA 3KO8A 2PZMA 1A9ZA 3IC5A 4OXKA 2YFQA 2AA3A 2EV9A 2GR9A 3S2FA 4ZQFA 1X7HA 1Y9EA 3MJEA 2Q45A 3DDNA 5FFFA 3F9IA 3RFVA 4DREA 5A1TA 1E3SA 3A14A 2NACA 4ZJUA 1BDMA 1QMGA 3SLKA 4DXHA 2VTDA 2OL4A 4HFMA 4JBIA 1ENYA 3GEMA 1P31A 3IJRA 4HNHA 3KEOA 4CUZA 2QW8A 1W73A 1KVTA 1P77A 3ROPA 4Z9XA 1B14A 1H94A 1DBVO 5I7FA 1L7EA 2DQ4A 4B79A 1FDSA 3LT2A 4CR8A 4YAGA 2LDXA 2F1KA 4OJNA 4HKTA 3KBOA 3IIEA 5L51A 4YB8A 1JQBA 1JVSA 4BUCA 4E31A 1J6UA 5JCJD 1R37A 4BKOA 1A27A 3FN4A 2HRBA 1NPYA 5C5IA 2OXIA 1KVSA 4PLPA 4KQWA 1R15A 1EFKA 1E1MA 2HCTA 3FPCA 3CE6A 1Q0QA 1LLDA 1UZMA 3DO5A 3R6DA 3PJDA 4LSMA 1QG6A 5BSGA 2EW8A 5CHEA 3D64A 4R5HA 3F4BA 1JU9A 3V1TC 1P74A 3GHHA 4PN3A 1NVMB 5COBA 4B4UA 4FCCA 3AUSA 4OOFA 3BYZA 1BW9A 2IYPA 3I9JA 3GAFA 3ICPA 4R16A 3H3JA 4LK3A 5L4LA 4YVFA 4JJGA 4BMNA 3ZU3A 4IDEA 4EI2A 4TRNA 4TQGA 5G4KA 3FR7A 3DHEA 3ITDA 4NI5A 4NDNE 1OZAA 1HE2A 5EJ2A 1PWZA 4A10A 3NDRA 3L4BA 2C59A 5JDIC 4OXNA 3PHHA 1T2AA 4WOKA 2NWQA 4CMHA 4FC7A 2X5OA 5TLSA 3ICCA 4TMFA 3JCZA 2AXQA 3A06A 4PZEA 1MB4A 2QG4A 4Z3DA 1IPFA 4I5GA 4QFCA 3VPSA 3KSDO 1QKIA 4ILKA 1HE4A 2YQ4A 1Y9AA 2UDPA 3FWZA 3WG9A 1IPEA 4RDIA 3WGOA 1ZSVA 4W6ZA 4J1QA 1AXGA 5EIOA 4II2A 3ZN2A 1X1EA 3H5NA 1HXHA 1UXJA 3JQAB 3GNTA 3IP1A 5IXSA 1WDKA 3AFMA 4JLWA 2HMUA 2ZB4A 1A4UA 3WWYA 3LDHA 1R4NB 3VZPA 1SOWA 4LVCA 3AU8A 4R1SA 2CVOA 3KYCB 5IN5A 1GV0A 5G2OA 3DBRB 3PLRA 2CZCA 3WB9A 4DTIA 3JQDA 5ER6A 1U3WA 2Z5LA 2V7PA 4NFYA 3PHGA 3RD5A 3TSCA 4A2CA 4CV1A 3OJ0A 3VDRA 5KKCA 4CMEC 1AHHA 1O5IA 3AU9A 3C7AA 2QYTA 3UICA 1KVQA 3JV7A 4WLNA 3RBZA 4IM7A 4BKQA 1XQ6A 1SCUA 2AG5A 1N1EA 1PX0A 3ADPA 1WVGA 1KS9A 1Q7GA 1VJTA 1K3TA 4M86A 3PFWO 4E12A 3OIDA 5HS6A 1QYVA 2Y0EA 4UREA 1NXQA 5BSHA 2Z1MA 3WGTA 2PFGA 5DP1A 4DC0A 2XF8A 2CFCA 2GNAA 1BVRA 3JSAA 4GSKA 5JDCA 1K6IA 4DQXA 4RL6A 2I67A 1K6XA 4E5KA 1GY8A 1CQIA 2O48X 3OETA 3CXRA 1KOLA 5CDSA 1MLDA 3PZBA 2NU6A 5CDYA 4PLZA 2B5WA 2X5KO 4OO3A 5K9ZA 3C1OA 4YTEA 3SVTA 2HMVA 4XYEA 5GZ3A 3JTMA 1QYDA 4OKIA 4N5MA 4XB1A 4BNIA 1F12A 2VWHA 4II3A 3F4LA 3I6IA 3OJOA 3GG9A 1XSEA 3I3OA 3M6IA 3U4HA 1YOVA 1I30A 5TIIA 2O3RA 3ROQA 4YYZA 2PH5A 4RF5A 3GN1A 3AI1A 1TT5B 3NRCA 2QRKA 5CDGA 2B36A 3DMYA 4KUEA 3Q3CA 5B1YA 3V8BA 4K28A 1HYGA 1DIBA 4CQLA 3IMFA 1CEQA 1PL7A 4P4LA 3D7LA 1YH3A 2UV8A 3V1UA 4J1NA 4E5MA 4EITA 4DL9A 1X14A 2XXBA 5BNTA 3HDQA 4FJ0A 1BSVA 4GQAA 3PYXA 3L9WA 1E3WB 3K30A 3RFTA 4BNVA 1Y6JA 3F1KA 3PGXA 5ES3A 2ZJ0A 3SEFA 4O0LA 2OZPA 4I08A 4TZKA 3GF4A 5IZ4A 1B16A 2Q4BA 3QVOA 3PXXA 2ZYDA 3GG2A 3QRWA 4WCDA 5JW6A 4BNXA 4U5QA 3H65A 4YJFB 3H9QA 3D4PA 5F5NA 3JYQA 2YHUA 3MOGA 5BT9A 4R1NA 1LU9A 4GMFA 3LF2A 4ZVVA 2D3TA 2ZIZA 3WJAA 4R9SA 2AEFA 1QLHA 3RUEA 4IQ0A 4Q3BA 1NQAO 2C7GA 2FSVA 3PP8A 4ITUA 4NBVA 3DAGA 3LF1A 1LC3A 1LRJA 3K6JA 1I2BA 1L7DA 1HYEA 1U2GA 1ZBQA 3TL3A 1IYZA 3C7DB 3G3EA 3IUPA 1E3IA 1ADCA 1IOLA 3OQ1A 4WOJA 4Y9DA 5KJEA 4EDFA 2NQTA 3ZNQA 5KJ6A 4N5LA 1ID1A 1DIRA 1KVUA 2TMGA 1ZK1A 1IULA 2PZJA 1M75A 2X9VA 5JPIA 1GUYA 4WLEA 3I5MA 4DLAA 4EBFA 1HF3A 4D43A 1JVBA 2A35A 2ZKLA 4LVUA 4Z9FA 4ALNA 1OMOA 3GEGA 1GQYA 3CIFA 3K31A 1IUKA 3L6DA 3U0BA 3WNVA 3QWBA 3KETA 4NNJA 1YJ8A 1VL8A 3K5PA 2B4QA 3LLSA 4J90A 5IDQA 1XU9A 4ROSA 3RU9A 1EMDA 5KJ1A 5CEFA 3ZWXA 5U1PA 1ZK3A 1QORA 3KVOA 3E9MA 5C3MA 2OUIA 4H15A 5AOVA 5JCJA 2I99A 3T4EA 3VPXA 1SEPA 3JQCA 2FPPA 3RC1A 1N92A 2VYND 3CH6A 3L4BC 2EKPA 3H4VA 4D3SA 1IE3A 4O6VA 4D0SA 5I8WA 1U8FO 4HNGA 1U5AA 1EVZA 1A7KA 3FCOA 3SLGA 5HWSA 1C1XB 1DC3A 2GF2A 3FNEA 4YACA 1ZK0A 1LA2A 3Q11A 3LSYA 4GL4A 4BNMA 1H6CA 3UXYA 2EERA 4GLOA 3WQQA 2Y0DA 1BMDA 4D7AA 2BFMA 1DRUA 1J4AA 4GX2A 4XYLA 1R4MB 2P9GA 4B3IA 1Z82A 3LLVA 1WZEA 3PVZA 2X58A 3ANNA 2HMTA 2W2KB 4XQCA 1AE1A 2OHXA 3GPDG 5JNLA 4XA8A 3PYLA 3E1KA 4YRDA 4CJXA 1X0VA 3TN7A 4TRRA 3H5RA 3K73O 3TZ6A 4DQUA 5G0VA 2VHVA 5G0TA 3F6YA 1WMBA 4PLYA 1U4SA 2DC1A 5A02A 5FI5A 1E1LA 2PZKA 1O8CA 1T1RA 3E82A 4RORA 1EDZA 1WAMA 3B1KA 2YUTA 3BZUA 3K8ZA 4E2XA 4R3WA 1LDYA 1GUFA 2I9PA 2OBYA 4RPLA 3IKTA 4JQCA 5CDTA 1QLJA 5JE8A 2HKIA 4L73A 1U9JA 3FHLA 5TF4A 5GZ1A 3ZWAA 2PTGA 2RBEA 2DM6A 3U49A 2AE1A 2HK7A 2BGKA 3BMQB 3EHEA 4PIVA 3MZ0A 4YT5A 5T8KA 2VT3A 4RPHA 1O89A 4AJEA 3RUCA 5BR7A 3U62A 2DPGA 2EWMA 3JQFA 2PD4A 5KIAA 5MGBA 1EUDA 5TJHA 3AI3A 1B8PA 1P1IA 4W82A 4K26A 2CSUA 1Z73A 2IE0A 4DPKA 3DZHA 1I3LA 2CNBA 2NVUA 3KYCA 3MJVA 1PWXA 1ZSNA 5F3RA 4XEHA 4DBVO 4QEDA 4D3DA 3QWIA 5JY6A 3UVEA 3DZIA 3MJCA 1KIFA 5JYEA 2JHFA 3EK2A 1HEUA 1HDYA 4Z3KA 3RBVA 2Q2QA 1DIAA 4EEXA 2CF6A 2Q46A 4HADA 2HK9A 3JD1A 3DHNA 3GH3A 2BGLA 3U09A 3O8QA 4A0SA 1FDTA 1JWBB 1PGJA 3EZLA 3X2FA 1E92A 4DLBA 4HBGA 4MO2A 1HWYA 1X13A 3ZV3A 1B26A 1CETA 3ABIA 4JNKA 1I3MA 1BW9B 4RZHA 5CEEA 3DBHA 2BFAA 3L77A 1GU7A 4CLDA 5DCYA 1Z7EA 1N5DA 2H63A 3JQ6A 1TI7A 4DIBA 4BQRA 1SNYA 1I10A 4DPMA 2Y1EA 3VTFA 4ESOA 1Y5RA 4ZQBA 4GLLA 3QHAA 4UVEA 3DMTA 1RM4A 2D4AA 1J5PA 3CZRA 3OA2A 2ZCVA 3BHIA 1VJ1A 4UUNA 2UVDA 2C0CA 4Q3AA 4IGEA 1M67A 5THKA 1JA9A 1E7YA 2X0NA 4IIVA 3X2EA 3HUDA 3NT2A 4QTZA 3WOHA 2A4KA 4I5EA 3PDUA 4HX5A 4AL4A 5IDWA 3HQ4O 4DLLA 2Y68A 4FIZA 4OXYA 2VT2A 1BHSA 4EUHA 1YL7A 1OI7A 2NU9A 1VPDA 4R1UA 5T67A 1EVJA 7ADHA 5L95A 1Y81A 3ZWVA 1EUCA 3GFGA 5EL0A 2E49A 4FFRA 4YXFA 3H5AA 3O9ZA 4DBZA 3LC1O 2DAPA 5CPBA 4KDFA 3KSZO 2D2IA 3FR8A 3PHJA 1BG6A 2GD1O 2VUTA 3FD8A 4NIMA 1HTBA 1PQWA 3ZWNA 1YONA 4YT2A 1LI4A 1SMKA 3RFXA 3AOEC 3S55A 2Q49A 2ZTVA 5A05A 1P0FA 3W6ZA 1NPDA 1BVUA 1GV1A 3H2SA 1RPNA 5L4SA 5T64A 2QHXA 3UCFA 1IHXA 2WE8A 1CDOA 4DMMA 4B4OA 9LDBA 4JK3A 1PU2A 1D8AA 1LLCA 3SC6A 2CMDA 1DAOA 1DPGA 2R2GA 1LDMA 1H6AA 1T26A 2X6TA 4YJDA 6ADHA 3H3FA 1E3JA 3RIHA 1YB5A 1RYEA 4I5DA 3V2GA 1KERA 2BLLA 1TEHA 1N8KA 3FRJA 1LRLA 4ZQEA 4CM1A 4YBZA 3LZ6A 2YJZA 1A4IA 1XLTA 3BIOA 1NQOA 4KMSA 4X54A 3I9MA 3ZWBA 2JFFA 3UW3A 4BB5A 2YZ7A 1QYCA 2AEJA 1MXHA 1KETA 2FHSA 2UUOA 4OYRA 4GGOA 1GYRA 4F45A 1V0JA 3F46A 4XCVA 3KB6A 3ZWMA 3UF0A 4NR0A 3JYNA 1HKUA 1Q0LA 1I2ZA 5LDHA 5KVVA 2OO5A 5FF9A 4XQ9A 5JAZA 4NJMA 4J6FA 4CM9D 5AXBA 2WM3A 3S8MA 2PD6A 2B5VA 2C7VA 2Y05A 4CV0A 1XKQA 2A92A 3NTOA 1QV7A 3UN1A 3RC7A 3RROA 3WQSB 1ONPA 3NJ8A 2FWMX 2VCYA 4TRMA 1SO8A 2PY6A 5JCXA 2AE2A 3BMOA 4R69A 2VYNA 3AW9A 4P38A 3OJLA 2EHDA 1QSGA 2OP1A 3H8VA 2PR2A 2NV6A 1ADFA 2CD9A 3D5TA 1GADO 3NGLA 5THQA 5BQFA 3D3WA 5HRUA 1G0NA 4XQEA 1BDBA 4MVJG 4E5PA 6LDHA 3EVTA 5FEUA 1UXHA 4RPJA 1WZIA 1Y8RA 4OM8A 4BO6A 1CJCA 2JAPA 1NP3A 2NTNA 1T2DA 2J3JA 4FPXA 1HE5A 3AY6A 3ETDA 3ZNOA 2AEMA 2DTDA 5L9AA 3O26A 3JYOA 3TOXA 4HXYA 1DOHA 1UH5A 4CLXA 1PQUA 3NX4A 1H2BA 5KVQA 2V6FA 3PRJA 2OFPA 2JD0A 4WLFA 2B4TO 2GRAA 1NNUA 3DZFA 5KJFA 3SJ7A 1UP6A 4CMIA 4M8SA 4WK6A 5DT9A 4QO7A 3WX0A 4CLRA 4FOSA 3GGOA 5T8KC 3QVXA 4FR5A 2W2KA 4UVGA 2P4HX 3GVHA 3JQFC 3G0OA 2PKRA 3GOHA 3L9XA 4IJVA 4NHEA 4QXMA 5DCWA 2O7SA 4AJKA 1JTVA 3IAHA 5IJZA 4NK5A 4OQZA 3NDJA 1JAYA 4PFJA 4U0JA 4LN1A 2HDHA 3DEYX 3DL2A 4ZD6A 3ZH2A 4PLCA 1T2EA 1GUZA 1R6DA 3LT4A 4BMVA 2AMFA 3DBLA 3HDJA 4IMRA 3S2GA 4GI2A 4QQRA 3BAZA 3GMSA 2QYSA 4AJ2A 1CYDA 1E5LA 4LCJA 1J0XO 4PVDA 3R3JA 4MVJD 3D0OA 1ZNQO 3VZRA 3N74A 3A1NA 1I2CA 1AXEA 4IXWA 4ALIA 4IJKA 2PLAA 4UULA 1B3RA 1K5HA 2CVZA 1VL6A 3V2HA 3WGGA 1C3VA 2UYYA 3ZU4A 3SX2A 1JKJA 2W4QA 2O3QA 3BMQA 3QVWA 1NVTA 3DOOA 3VZSA 1LLQA 2E6UX 5JO9A 2AW5A 1C1DA 3D3EA 3BMNA 2W98A 1UAGA 4TZTA 2A9FA 2E82A 4YJGB 3RUHA 3T7EA 1E3LA 2YV1A 2EGGA 3Q9UA 2JFGA 2VHZA 4BNTA 1S6YA 5IN4A 1GZ3A 3OECA 1PJCA 2FP4A 2O2YA 1A9YA 3NKLA 1LBEA 1P9LA 5EERA 3AUTA 4N5NA 4XRGA 4A5OA 2QZ9A 4LCEA 4DYVA 4Z6KA 2HSDA 1PZEA 1X7DA 1ADGA 1H6BA 3IDSA 1O6ZA 3WBFA 5ENVA 3GVXA 1F14A 3HFGA 4DA9A 1O95A 3GDFA 1ZO8A 1RWBA 3CUKA 4Y6SA 3GC6A 2XOXA 2BI8A 5IFLA 3TQHA 2GO1A 3GUCA 3CMMA 5KCZA 4YRBA 2VWQA 3ITKA 2P68A 3B1FA 1YB1A 3I9LA 4L0QA 4CLHA 4E5NA 3AY7A 2YHIB 1BRMA 2I76A 2OMEA 1ISFA 1KC1A 1SZJG 1W8DA 4ZICA 1O9BA 4MOWA 3WMWA 4ZGWA 2G5CA 3I6QA 2DTEA 2IRWA 3ETEA 1ZJYA 1H0KA 3SJUA 1ZEMA 2X0JA 3KYBA 2Y1GA 4H7PA 1BWSA 1PSDA 1EDOA 1LQTA 4P4NA 2FRDA 2ZQYA 1PGNA 3ONDA 4JX8A 4Z9YA 4C4OA 4CQMD 4W4TA 1YJQA 3G17A 2OBNA 3K92A 1P0CA 4Y6PA 4BMSA 2PV7A 1Q2XA 1GYQA 2JJYA 2VZ9A 4CMCA 1AHIA 4J16A 4BO8A 4E3ZA 5JO0A 4PG4A 1M6HA 4MVJP 5T57A 2X22A 5F21A 3RJ5A 4TSKA 3WLEA 4BO0A 1PEDA 3BHJA 4DGSA 1WDLA 1C0PA 3KLPX 4BO4A 4RVGA 1E6WA 1XEAA 4J7CA 4K1LA 4IDFA 4G81A 4INAA 3M2PA 1DC5A 1H9AA 3I83A 2X9NA 2NVUB 4AJJA 1EBFA 3VH4A 3FNFA 2YDXA 2ZYAA 4BKPA 4OMUA 1KEUA 3ENKA 1MX3A 1WNTA 4D44A 4QX6A 3ZHYA 1KBZA 3PJFA 3ENNA 4DIFA 4B3HA 3VPFA 1E7QA 1SEVA 2NU7A 3GPIA 3O8QB 2G76A 2NTJA 4UVIA 4DUPA 3PPIA 5DBGA 5ENDA 1YWGO 4PLHA 4J7UA 1M76A 5JMWA 1Q7CA 3RAJA 4J0EA 3DBHB 4LMRA 3WNQA 5CEJA 4BNKA 2DPHA 5IXYA 3BTOA 4PLVA 3OICA 4G5HA 1E7RA 1PTJA 4XR9A 4YT8A 3Q0EA 4FSHA 2PWZA 1WMAA 3OIFA 4DWVA 5TQVA 5G4LA 2VRCD 4M54A 5KNLA 1YE3A 3RUFA 2DT5A 4JBGA 2V65A 1DJNA 3LVFO 4WEOA 4IY1A 3GNQA 1UXKA 2R6JA 4OQYA 4AVYA 4ALMA 4DC1A 2JCXA 4CV2A 4RF3A 3WTCA 4UUMA 4RF4A 2JKVA 3WLFA 1ZMOA 2BELA 3TFQA 3ZV5A 3KRTA 3D4NA 4YEDA 2IXAA 4LGVA 5DNAA 4MVJM 2X23A 2NSDA 4UVHA 3EZYA 1XYGA 1Y5MA 2I65A 2YYYA 3I4CA 1GQQA 3ZHXA 3NDIA 3KM0A 3VH1A 4D46A 5A4DA 3HN2A 4WECA 1F17A 2BI7A 4Z0PA 4QFDA 3UFXA 1GL3A 2DBVO 1OFGA 5A3VA 2ZQZA 3HADA 1ZXLA 5BNIA 2AHRA 3RBXA 3BTSA 1N7HA 3TZCA 1E1NA 3C8MA 3W1VA 2GASA 2HMWA 4YCAA 3RJ9A 1LSSA 1XWFA 2YV3A 3GAZA 3KSUA 3OP4A 2AQHA 5DZSA 2EEZA 1O0SA 3UCEA 3QE3A 2AQ8A 2W8ZA 2ZTMA 3B6ZA 4ZA2A 2UAGA 4CM4A 4ND3A 1KY4A 3WJ7A 2O4UX 2BKAA 3EAGA 5AVOA 4JIGA 1D3AA 5L7WA 4CR6A 3OIGA 4Q3DA 4R68A 4YR9A 5DBIA 4C7KA 3GR6A 2VHXA 1VSUA 1XR3A 4XIYA 1MV8A 1IY8A 2J3KA 1KYQA 3AY3A 3ORFA 1YBMA 3E5RA 1PJSA 3ZWCA 2C20A 1I32A 1U8XX 3UAGA 1C0IA 5GY7A 3A9WA 3EC7A 4E4YA 5HTOA 2NADA 2VUSA 2ZATA 3MWEB 2X8LA 4MP8A 1MFZA 4W7HA 4DQVA 3I23A 1C0KA 2IZZA 3PFFA 3S1LA 1HZZA 2O3TA 5TRTA 1ZVMA 5IDXA 3DAFA 5JFOA 2FR0A 1NVGA 1V3TA 3IS3A 2X0RA 3JD0A 3L0DA 1EK6A 4ND1A 3EY4A 4MVJA 4QUKA 2CDAA 3K96A 3AUAA 1ZSYA 4YDRA 5EESA 4J7XA 4HY3A 4UAGA 4RVDA 3JQ7A 5ER9A 1PGPA 3L6EA 3IP3A 2NVBA 4NJMB 3HN7A 3OJEA 2NQ8A 4IBOA 2NM0A 1LDGA 4PLFA 2VNAA 1YDEA 2BH9A 4TWRA 3KXDA 4ZQHA 4E32A 4KP7A 3RWBA 2P5UA 3Q2KA 4EJMA 4E2YA 1K2WA 3VZQA 1W4ZA 3PJEA 5F5LA 5TC4A 1XA0A 2ILTA 1XHLA 1PJQA 3BMOB 2ZB8A 3O03A 4YJGA 1X1TA 2HJSA 2YDYA 4PRKA 4KDEA 1CWUA 2ZTUA 3AI2A 2C2YA 3LK7A 3LYLA 2I3AA 3HZZA 3NTRA 1D7OA 4IMPA 4BGIA 3D3WB 2QRLA 4GX5A 1AGNA 9LDTA 1F0YA 1R12A 2F00A 3IKVA 3WSVA
chains in the Genus database with same CATH superfamily
1OZ0A 1S1MA 3COPA 3IA7A 3QFHA 4L07A 3I73A 1OQAA 3N05A 2QL5A 4JXKA 3IA2A 3K4QA 4F93B 5IUJC 2AKEA 1KI4A 1M5UA 1XAHA 4RZIA 3U31A 3VO2A 3ZR4B 4ACAA 1H4SA 1DRWA 1K7EB 2BCEA 2WIJA 3DD5A 5ARCA 3ZWOA 1DFGA 1EHIA 3A9SA 3MGGA 3AEKA 3QBTA 4E5UA 3I09A 4XWTA 4KLZA 2OB1A 4MP6A 2MYPA 4KZKA 1P1CA 4XPIB 1ESNA 4Q37A 1ONNA 1U5CA 1WLYA 2HA5A 5K0NA 2DCUA 1Z5UA 2CBZA 2OBFA 4M46A 5KNBD 1OB2A 4EPWA 5HHTA 3I1JA 3BAFA 4PAMA 3IOYA 1UFOA 4FB4A 5EHZA 5DE3A 1YRHA 3B3FA 4LRQA 3C3BA 3PC8A 1FVXA 4PCUA 1KAQA 2VT6A 4C5AA 3H5TA 1GRCA 2G5TA 3DZBA 3OE4A 4HH3C 1PYDA 4FDTA 5CJPA 1QRUA 3B5JA 1C9MA 4UMDA 4AMBA 3TBFA 2JD2A 3LKDA 1RP7A 2EZ9A 3JTEA 5DRYA 2O2SA 3ASVA 2VAMA 3ASZA 4ALJA 4NYIQ 1UM8A 3VYUB 1X3LA 4P0QB 4CQMA 2RGRA 1XGKA 3NRJA 1O0BA 3Q3IA 2W2LD 3LHIA 3IULA 3GLFB 3T4PA 1LPNA 3ESCA 5DX0A 1YE5A 1HT1E 1TD9A 3DO6A 4ARUA 1ZKMA 2HO5A 4E2ZA 3JPWA 1CR4A 4AX8A 5FWNA 3ZXIA 4ZVSA 3UJ8A 4C0AC 3B1VA 3W4IA 4KDCA 3MTJA 4BNFA 1W5EA 3FI0A 1QPGA 4MIEA 3RARA 1UKBA 4JSRA 5C5DA 2QJTA 1ZUD1 4PYRA 5CH8A 5CBPA 3HB4X 1ZW6A 2R8YA 5GM2A 4IQ8A 1EWRA 2UU9B 1JKJB 2XDQA 2JDID 4FS3A 4GSLA 3U4CA 1S9DA 2GLUA 5GMOA 4EPXA 2ZRIA 3H8WA 2JAWA 4NE2A 4Q0MA 3I52A 4Q66C 3R0JA 5IZCA 2EW2A 4M8IA 4J43A 5E3HA 3HKDA 5DEIA 2VTBA 1ZGAA 4J75A 3SYKA 3IP5A 3ICWA 3TQFA 2I91A 1AK1A 1DKOA 1EE1A 3UMBA 2J4DA 4EI8A 3TAHA 5JPDA 4NCIA 4IXTA 2GZ2A 5LFAA 4L3VA 2PMWB 1NJ2A 5LD2C 1CNEA 2B8TA 2DBQA 2CUZA 2FP3A 5EXSA 2NT3A 1QR6A 4ZT4A 4CU5A 4D4JA 4BLSA 4HAVA 4YRAA 2J9YB 2X2OA 4J0KA 5ICSA 1ZWKA 3EXEA 1GAXA 3EVGA 4XD7A 1IATA 2HNKA 1CHNA 1JQJC 2BDUA 4LJ4A 3EXAA 1XXLA 1WB9A 1Q0HA 2D8AA 4BLUA 1VE1A 1L4FA 2UUAB 3RAPR 1K66A 1ZG3A 4W8HA 1ZAKA 2BZGA 3T7AA 1JHUA 1EE2A 3H75A 2HCFA 3H42B 5EAIA 2CNLA 3Q6IA 2YMQA 4AS3A 1LTKA 4WFIA 2NO1A 3IV9A 2ZWPA 3ENVA 3K9QO 1SBCA 3R3SA 3PEFA 3O3OB 3IELA 3L02A 4KKXB 4JELA 1UEXC 1YL6A 2Y1FA 3MTGA 3PQFA 5DHRA 4MP3A 3VKHA 3GDGA 1KJYA 2GN0A 5LZ7A 4UUPA 1AB5A 3S27A 2G4CA 3KZ1E 5F76A 4TYMA 2R8ZA 2XNCA 2WSSA 3UWMA 1VIYA 3PWKA 4WNCA 3CVUA 1KJIA 2RCYA 2XXJA 4TV8F 2H1LA 4O0MA 1PEAA 1G1AA 1SQ0A 1SZCA 2HI0A 3ST7A 3VOBA 4CR6A 5CH5A 4FFNA 4IXNA 1KRXA 4J4HA 5CPFA 1TK3A 3CB2A 1GPJA 2MT9A 2DUJA 2VJYA 1T2VA 3CRRA 3DOEA 3GMTA 3MT8A 4MV9A 2XB6A 5D1NA 5J9FA 3W6PA 3WYCA 1S3SA 3L1UA 5KYUB 4J2OA 2XOEA 4OF4A 4N12A 3FNGA 2ZYGA 4ZZ1A 2QTVB 4W5QA 2NAFA 3VDXA 3ZI0A 2AN1A 1NGSA 2NZ8A 1FYVA 1WB4A 1X38A 3K9BA 1QPZA 1Y8QA 2GZ3A 4FVTA 2C5SA 1K2VN 2H08A 1YJBA 2QZZA 3OIUA 4I9UA 1T1JA 1U0TA 4RK1A 3EXIA 3Q8MA 2HQRA 2XBUA 5B3KA 1X7XB 4GWGA 4YQEA 1R6TA 2IU3A 2H1VA 3GJ3A 1N2SA 4Z1MD 1FRNA 1Z2CA 1A5TA 1ZMXA 2FLVA 4BNJA 2G9UA 3C3AA 3A9TA 1ZUNA 4C1NA 5DHAA 3M1AA 4X84A 2D54A 5U4QA 3SXJA 1WG8A 3L7BA 4FX5A 2AFRA 2VS1A 2HHCA 2R4UA 1YXMA 3DZKA 1R16A 3QMVA 1DSSG 2A0FA 2HZ7A 2RH8A 4DV0B 2KBEA 1K8RA 4EARA 1W87A 2RH5A 5B30A 1RYBA 5F98A 1TFRA 3U6BA 3RSQA 5JVDA 4S35A 2XQVA 5DM0A 3D8UA 3FWNA 2AOXA 2CNWD 1IMOA 5K45A 3TDNA 1P29A 2P9EA 3U37A 4HVAA 4L1KA 3TGWA 4MVJI 3RS9A 3L8EA 3DR5A 1RIIA 2B37A 1ZJJA 2IPAB 2Q5IA 3FCAA 1RQGA 1JJIA 1TGVA 3OZCA 5FBWB 3RYHA 2O7QA 5TMBA 3JSXA 1WEKA 4MICA 4ZO9A 1JH9A 3ZHCA 1ZOOA 1E2FA 2WYUA 1LDEA 2AG8A 4OJTA 4EYQA 2F9LA 2ISSD 1ZA2A 3LUGA 4XUEA 2E4VA 2C8LA 1WQ3A 3KVRA 5FB3A 1IVNA 2RGGA 2C5HA 5KTRA 1V5FA 2JS7A 4PLTA 3IQDB 1VPEA 2COKA 5DHFA 3TTWA 1RKQA 3A3KA 3AR8A 4RCVA 3U9SA 4BE4A 5HRCA 5KWEA 4ZEWA 4B3CA 4DA7A 1BXZA 4YN3A 4BZQA 2G17A 1RPJA 1U7DA 4NAHA 4MYDA 3OZEA 3PIIA 4V0QA 5I7VA 5IABA 2B98A 4JVOA 5TMDA 3AUFA 4KMRA 3KKMA 4HFJA 5LOVB 5ILGA 4IIJF 2O0KA 1B43A 1HM5A 3AEUA 1Q7BA 3IQGX 1JZQA 1UOPA 4R1PA 1PI3A 2H06A 3TSWA 4M0LA 3H2YA 4KMMA 4BKUA 4E1BA 5AESA 1YQDA 5BNFA 1Z4JA 2OPBA 2G6BA 1UQUA 1FZTA 4DHWA 2W6PA 5DPMA 2D0PB 1OYVA 5HJ2A 2XA1A 1Q1ZA 3IBYA 3C6MA 3PFNA 4OHZA 4UOEA 2OESA 5JS7A 2QLBA 2WNHA 1PFWA 3IV7A 4Q3OA 1HLDA 2FEWB 3IDAA 3OCYA 4LHEA 3BH7A 4OH1A 4HT3B 1WDWB 1X9IA 3EN0A 2VPIA 4KPUA 1ES9A 3HI4A 4D81A 5CXUA 1FFAA 1KEVA 2PSSA 1MP0A 4E08A 3AUKA 4QRHA 1UBMS 3KEQA 2GXUA 3STHA 4FOOA 5ETJA 5A9RA 3QV1A 5JPCA 2GYYA 3D81A 3VDMA 1BXGB 4C3VA 2WP8J 4QZVA 1SULA 4R1QA 4TROA 1P18A 3BWXA 2V7XA 2QPAA 4BAZA 1N2OA 3GUZA 2FQXA 5M7EA 4U3JA 1XYYA 1J24A 2Z0MA 3L79A 3G5AA 4IPTA 4QRIA 1I4TD 2ENWA 1SBHA 1V5GA 4XVUA 5JUWA 1FXWA 4J91A 2FJPA 3RAEC 2GKSA 1UAYA 3HZRA 1CY6A 1U3TA 2BSXA 1F8GA 2VJBA 2ZS9A 3KOWA 3DMPA 4IV5A 1A50B 1T34A 1TA9A 1UBSB 5JQGA 3QVGA 4CDMA 3AVYA 4UM7A 4MV3A 1L5WA 1ZMTA 3PYMA 4C0KA 3KZCA 2UVPB 4OQQA 1EUYA 1D9ZA 1GPDG 1OHHD 1QC5B 2IKQA 2XAUA 2XTAA 1G21A 3ANLA 3IP8A 4B7UA 4ZK6A 1S8AA 2A88A 1R0LA 2NO7A 2OCYC 1Q1GA 2J5RA 2DP4E 1NFFA 2PZBA 1V7ZA 2WMNB 3RRNA 3BE6A 4ER0A 3HWX1 1GNSA 3OE1A 3U7JA 3NIDB 4UZEA 1E5TA 3OZDA 3N76A 4HLNA 3ZWPA 2O8BB 2R1ZA 3P45A 3JD4A 4EMUA 1R0KA 4I9FA 1R0BA 1IY0A 3NH6A 4R54A 4XPIA 3PA6A 3BFPA 1ECLA 1ODCA 3ENQA 3VKUA 4B85A 3T12A 2ZUBA 2FETA 4H0NA 2H0QA 3MJ4A 5GGXA 4IDAA 3HS3A 2O0HA 1HPLA 2J48A 4JEUA 3RUIA 3I01A 1LH0A 4ZYYA 2YYZA 9MHTA 3QWHA 5DRTA 1AVTA 3GT0A 3LLUA 4GPIB 1P39A 1HDEA 2WIFA 4UMVA 4EG7A 1E5VA 5I45A 1I5EA 4F91B 1UC4B 2EJWA 2ZE6A 3C4JA 5EQJB 2A0WA 2G9ZA 4R4JA 4FFPA 3V6MA 5AVVA 4UMFA 3ELBA 1J23A 5AM4A 3NBYC 3OH8A 2C04A 3ZCRA 1M10A 2FOXA 4BWGA 1NA5A 1SHTX 5LLSA 1NURA 1YR1A 1GITA 1ZM7A 5CW2A 3FHCB 1YDWA 5EPOA 2RH9B 3WKBA 5B5SA 3GLFA 1ULAA 2OXFA 1QX4A 2A9QA 2WJ4A 3AF6A 4FGSA 1IONA 1NLFA 3GROA 4ZV9A 3JQ7B 2VOEA 4P22A 1T8UA 3CKLA 5JBQA 5JRZA 1QIMA 4FT2A 3SZMA 2YMLA 4MVXA 1FP7A 2X13A 2Y4NA 1H2ZA 3WGMA 2Q4OA 1DC7A 3JQEA 3RFCA 4DM3A 1D0IA 4RHUA 4V0LA 3N7AA 3STUA 2DERA 5C52B 3CS3A 5THXA 1TQ2A 4PN7A 1O94C 3HBFA 5BSFA 1U7WA 4MARA 2PRKA 2Y0CA 3N2EA 3KYJB 1P5ZB 2IEZA 1O8BA 4D79A 2EP7A 4F2GA 4JKOA 5TSDA 3EOAI 1PFVA 3TNLA 4EZIA 3D2BA 1PVOA 2AR9A 1NYLA 5KVSA 2TS1A 3CWQA 4CDNA 3I0NA 5IMBA 1X8JA 3GD5A 1CVLA 4L72A 3IUNA 3L6UA 1GFWA 1ULSA 3NO4A 4R81A 3M2TA 4XDZA 3JALA 1UKYA 4RBNA 5AT1A 3GQVA 4MNTA 3ELYA 4GE3A 1K8QA 4LNUA 1B0UA 1JXAA 1R18A 1W2HA 2R8OA 3DMTC 4I1OA 521PA 4EHBA 5HIIA 5ITWA 1SCDA 1UPXA 3B9BA 1F5SA 4YQYA 3HXQA 3ZQKA 1N5JA 1JRLA 1KA9H 1U98A 3OAAD 3R3ZA 4F9GA 5K4HA 5HM8A 3TI7A 2G77B 1N6LA 3HB1A 3SC4A 3DDCA 3UGKA 1DDOA 4Q3LA 1SIUA 1OCEA 2FZLA 1T8RA 2W6ID 4YFVA 5EQDA 5EKSA 5K8IA 1QRSA 2QG6A 4NBUA 4E6PA 1J8DA 2J5BA 2PJDA 5AVUA 3TE7A 3AEYA 1XQ1A 4PV7A 4ZVOA 4PGHA 4DA6A 4RZ2A 3V7UA 2QVZX 2CXSA 1ATZA 1NKSA 3MS4A 3DYIA 4MWOA 1T24A 3NNNA 1SVUA 1VGVA 3E7DA 1NAHA 3OZIA 1GXSB 1JG4A 4YDHB 2RK4A 4XDYA 4N49A 2IYNA 1A98A 3BRWD 5H70A 2HRCA 3THOA 3AINA 4C01A 4YPFA 2HR1A 2P5SA 4PFSA 4R0NA 1RZRD 4NYMR 2Q1UA 1RM0A 1JHMA 4DLUA 1ILWA 3WLPA 1WF3A 1B93A 1NRJB 3A3YA 4NXMB 2WPDA 1WKVA 3IEUA 3BCUA 3MLEA 1E6UA 3ZWWA 4JJFA 1TU3A 2EF0A 4Z2AA 3VKVA 3TW8B 3LJKA 4EEZA 2JJ1D 4KK4A 2ODBA 3RRXA 2RHCA 2Z8ZA 1GA1A 4US2R 3AEXA 2V7GA 5KYUA 3K6RA 1XQXA 2XWJI 2JFHA 4M1MA 4E03A 4KRGA 2W71A 3ELDA 4LGMA 5H3HA 1D1SA 2QTVA 3ZXXA 4A6PA 1OIXA 1ISMA 1W47A 2H6EA 3EJ6A 5A4FS 1QH0A 3WLHA 2DVMA 3BMCB 5HZKA 3TQIA 4KYVA 1JI0A 3Q9SA 4R84A 3QSYA 4OKNA 3QE2A 1JG6A 3UYLA 5BYAA 2VWPA 2JKYA 2E7ZA 3IXMA 5ENZA 5G02A 5BWBA 3NHRA 3QXHA 1P1FA 2WD8A 3OFSA 2JAQA 2GFHA 2CB9A 2ZTLA 4YWJA 2B0JA 3FPFA 1Q0UA 2D5CA 3LQFA 3MMNA 4X7BA 4E14A 1E61A 1MB9A 2DPLA 2IHYA 4V0RA 1Z8DA 3QNUA 4W63A 4O4IA 1WVIA 4WZAE 5GWXA 1OH5A 4B7XA 5BV8A 2H2AA 2W4IA 5L4NA 2WTBA 2ZUUA 1FDWA 4MDHA 4MQFA 1Z7WA 3FHOA 4AG6A 2BM9A 3HO8A 4KIJA 4Q7JB 2J46A 2PS0A 5EJ7A 1GD1O 3PD7A 4INJA 4BDSA 4YQZA 4MJXA 1L7AA 1QFMA 1WRBA 2PL9A 2GA8A 4CM5A 1ZM9A 3GZ4A 6CHYA 3FYUB 4FCVA 3G0IA 3ESXA 4KX5A 4HMQA 4RV9A 3UYKA 4DA8A 4HPXB 5HMMA 4B48A 5HNKA 2GGSA 3B7GA 2WWIA 1FTWA 3HNOA 3GLGB 1Z2EA 2AK3A 3KT3A 3AOGA 3GZNB 3RC3A 3UTCA 4P54A 5ICMA 4MGEA 1MO6A 2C9MA 1KI2A 2G4VA 3ANTA 4IIEA 3KJEA 2IEDA 5IPFA 3IMEA 1QDUA 1E60A 2O23A 2Z3VA 2ZJ4A 4P93A 3N5CA 2QSZA 2YMMA 1A8QA 4O4LB 3EZNA 3K9NA 1LUAA 4BO1A 1U2QA 2VFAA 5LOVA 4BV9A 3G1TA 1G3MA 1TKAA 2C07A 4IJWA 3TL2A 5H83A 1B6GA 1VGRA 4RZQA 3J7TA 5I8ZA 4RMJA 2IKSA 3NBAA 4RHCA 4Y3UA 1DI0A 4PQGA 5CVCA 3IMGA 3U44B 1G63A 1H65A 4QU0A 4MJLA 4CM9A 5B3JA 2B9VA 2QM0A 3ZDZB 1WW8A 5M04A 1H2AS 3QXGA 2SKCA 4KE6A 3EF3A 2VVTA 4U6QA 2A57A 4EPRA 2H9AA 1DLJA 3JQ8B 2A3RA 2JLXA 3BA1A 4X92A 3ECCA 3JATB 3WC4A 2H7VA 2BFWA 3BKXA 3EMKA 5DULA 1J8VA 3FF4A 1NMSA 1O2DA 2P62A 1JG2A 3GRPA 2MDTA 3M6FA 1SG9A 3IB3A 1NI3A 3LQRA 4YAWA 3NWPA 3NEPX 3N75A 2IZ1A 2GDJA 2VYVD 3R7WB 1BXGA 1UBKS 2GBCA 2PQ2A 4G1BA 4MA0A 4B2PA 3IVXA 3FRIA 5DM70 1WSBA 3RIMA 1BDHA 4W5JA 2X0FA 3N7UA 2D2EA 2BEUA 4K7JA 3N2IA 1E2QA 1M1NA 1RJEA 3INTA 3K0CC 2IZ0A 4IIFA 4ZO7A 2WD7A 1N7IA 5DYIA 2E4XA 2R0QC 4HXFB 4ND4A 3K0AB 3QV2A 3EXHC 2B92A 3LIPA 5EP2A 1IBCA 4BATA 2C2XA 1KYYA 1GGMA 3O2NA 3O74A 3VTKA 4KGVA 2KW5A 5J59A 1NFQA 1NNEA 2B6HA 2G88A 4G0NA 4J0IA 1KH1A 3GP3A 2CXXA 1WCIB 3NOXA 3T7SA 1K7YA 3GCZA 5FRDA 4ER6A 5KNDA 1ISIA 1NBOA 5DGHA 3CPSA 1QC5A 4TKMA 1U11A 5CDFE 2QN1A 1ORIA 2FZGA 2QORA 4RE6A 2XADA 3DZGA 5LJIA 2NG1A 2CXRA 1BMFD 1GSHA 1Z0AA 2A2ZA 3PNPA 1ICIA 4KR9A 1U63A 2P9QA 3C1AA 1B8UA 1MEOA 1W6UA 3EZ6A 3BH6A 3A9CA 3RT9A 1T2FA 4IFBA 4GP9A 3PWZA 3UUFA 3QUTA 1KSFX 1EZZA 2DFPA 3V42A 1Z0JA 3RHFA 5AKJA 1NBHA 5HJEA 2HX1A 1AQNA 1JG1A 1EVKA 3CZ4A 4INPA 1DBQA 1WV0A 3MWFA 5L3QA 1U9ZA 4AXBA 1TKCA 4ABYA 3F3SA 4NBRA 1JV2B 3BBLA 2ZBFA 4GUAA 3DDOA 2OCDA 4NS1A 4Y9TA 4J4TA 9ABPA 1J1IA 3MLBA 3G8BA 5FJIA 2ZUTA 1UXIA 2G5GX 4A91A 3MIIA 1XQYA 3DLAA 4XZ3A 4IKPA 2XUFA 2QJRA 3EOBI 3MTBA 4I1SA 2IZ7A 3HY4A 2VBCA 2HF9A 2WTEA 2C2BA 3AESA 3FVTA 4GKVA 1Q1AA 3T5GA 1PS9A 4I19A 5ALRA 2X15A 4UOQA 2PBZA 3SF0A 5IAKA 3ZLTA 2ZJFA 4BNYA 1Z2AA 5H4HA 1JEJA 2BFCB 1L5LA 3WTBA 4C4XA 3DLPX 4Q1EA 2JGFA 3PKIA 3LFHA 3SHFA 5JASA 2AD5A 2VZ8A 2H4HA 2XYQA 2ICAA 4GGPA 4KVAA 4HQKA 5CVJA 1C50A 1OREA 4YI3A 1NNI1 3DQQA 2E3JA 2X0IA 3MJTA 3VVMA 4FQ8A 4BX3A 1US8B 2RKBA 3AOEA 5F1PA 3ZU5A 4KTTE 4N6GA 1P2UA 2Z4SA 3PC2A 4GGMX 1W29A 3F5DA 3L7JA 5E8RA 4RH0A 1HDXA 2ZBPA 4PSAA 4XB2A 5ISMA 2C00A 2AEEA 3DFZA 4F2PA 1JHDA 1IRIA 2CVPA 1FP2A 3ACBA 1T4DA 2PJZA 3GDOA 1R4AA 3G2IA 3HDHA 3OC6A 4KN5A 5E95A 1K8XB 2X4LA 5DM2A 4D42A 2BR3A 1WP9A 3DQPA 5KQLA 1AQIA 1N4DA 2SCUB 3DEZA 3KHUA 4ISCA 4S1VA 4G8CA 5JMOA 4XARA 1UBUS 1NMEA 2C31A 4HAIA 3PNOA 2MINA 4M49A 5F1YA 3TCXB 3UK1A 5ADWA 1QXSA 4A27A 1JFTA 3CW2A 4D41A 2DJIA 2G80A 2N46A 2BKXA 3NB0A 4CKBA 4OIMA 2XUDA 3EYWA 2GCOB 3PK0A 2ZYWX 3GUYA 4KTVE 5G0SA 4CN9A 1JIVA 2X9LA 4PO3X 3DE0X 4WBSA 1DTWB 5D00A 4IYRA 1C4OA 1LEHA 3D0QA 5EUMA 4PBTA 2SKEA 3A6KA 1CQJA 3DOCA 4MROA 3RV4A 1ZM2A 1G4HA 4ILEA 4LJKA 4XPZA 3KEMA 5C7OO 3PENA 1VI5A 2IXEA 2O2IA 4JUAA 4DLTA 1E1DA 4AYWA 3JQ9A 2ZVDA 1UIRA 1M8GA 2VTKA 5KNDH 1ABBA 2YCBA 5B1HA 1TM4E 3JASA 4JITA 1XWIA 3ISTA 1E8NA 4HRAA 3OU7A 1UJNA 5J4HA 3N2LA 4EB3A 1NWCA 1U8TA 2PJRA 3HO1A 3OD1A 5LYJA 1DG9A 4H3VA 2GF0A 2JCVA 4LX8A 1P60A 5B12A 4XIJA 1NUAA 1D2GA 5DGDA 5EUCA 1M74A 3L7IA 2OG2A 4JCCA 2NXNA 3MTIA 4KQXA 5BV7A 3T1YB 1GPH1 3TDKA 3GGPA 3C5WP 4MVJE 3U7HB 2ETVA 2JL1A 1PNQA 2EKLA 5HKKA 1AIPA 3TW8A 2NU8B 1V5EA 2EFCB 3TKAA 1FF9A 3F8SA 5TQ2A 2YZKA 4NG4A 4WKBA 1PJTA 2CBXA 4A92A 1UOEA 4Z7JA 5K8CA 4GDFA 1GJRA 4AKHA 2DU8A 5G53C 4ZAYA 1YKSA 3X1JA 3ZJTA 4Y98A 2P4EA 1IZ8A 3R5TA 4CL3A 4X65B 1MNAA 1NX9A 3FI9A 4KR0A 1NUPA 1L7OA 3H9UA 3MYYA 4CBVA 4AQYB 1WKBA 3FOZA 3S7TA 1P1JA 1M8KA 3ZXYA 4BRZA 4WBNB 2CHUA 5ALQA 2YZNA 2WAXA 2ZRBA 1Z8NA 3RHTA 3VNVA 3FJOA 1JYFA 4OK3A 2R3SA 3A58B 1JLHA 3SEQA 3QVTA 2RB5A 3PTAA 3SK0A 5KNCD 1A7AA 3KPWA 2VP4A 3Q1LA 4B2LA 1AMUA 2CVQA 1U3UA 1Z4IA 2QB5A 5CFLA 3LUJA 2R8RA 3A3OA 4QBIA 3E4DA 2BKUA 4RIHA 1XE3A 4IF6A 5IT5A 4KR6A 3O3MB 2X5XA 2C4TA 1PFGA 3GBPA 3HLTA 1SN7A 1DEHA 3LGSA 2BMEA 1V2GA 2NP6A 4K6GA 2C2KA 4XJXA 5EEGA 2P3SA 2HF7A 1T3TA 2CLIB 2Q2WA 1U2DA 4HAUA 1QF6A 1X0XA 3LC2O 1JUDA 3NBZC 4FR2A 4N48A 4P5EA 4QQNA 4RKQA 2B4RO 3OQBA 4MWEA 3U7QB 2GX6A 5MN6A 1JT2A 1PP4A 3NHJA 1YOBA 1XPUA 3T5MA 4DEYA 4FD3A 2VK2A 1FVOA 5DNWA 2Q27A 3HRIA 1RSZA 2C78A 4KODA 1E3QA 1W6RA 2G0TA 3ET5A 1I5OA 4G0PA 4BV8A 3TFWA 1VE9A 1ODLA 2P0EA 1Y6QA 1IG3A 5GONB 4LDRA 1TZJA 4FYKA 1HDCA 3PSHA 2B2CA 1T8WA 4KQHA 4K6OA 3IP9A 4BTVA 1ECPA 2MSNA 3AETA 4IFIA 1S2LA 3OLZA 1HURA 2A1UB 2JBAB 3F6SA 3QY9A 3MBIA 5LJLA 3JD3A 2VP0A 2R97A 2C03A 2EJBA 4M9CA 2WM8A 4W7IA 5CT6A 3K1JA 2XF2A 3U5ZB 1GAEO 1SXJC 2JA1A 3VHXA 2ONCA 1OC4A 4G0MA 5CYGA 2ZI4A 1T0BA 4NEHB 2ZI9A 4TS1A 1CCWA 5AJVB 4OSPA 3NKVA 1W5FA 4I9HA 2SNIE 2VYCA 3U6KA 1M8FA 2NUPB 3D3KA 5GADl 2J4CA 4FUQA 1KEPA 5FR1A 4G4GA 3QLEA 4KIFA 3SSOA 2XCIA 4TTAA 4QJ5A 3W2EA 2C42A 1J8YF 1VXOA 3SR0A 4NCBA 2WWGA 4CN8A 5LC1A 4BO5A 4MKGA 4AJ1A 3O95A 4MVJF 4GZ6A 3DVAA 2ATCA 2FY8A 3FUXA 5DXFA 2ROQA 4CPDA 1UQRA 3DVQX 2XRYA 2CXOA 1A3CA 2PA0A 2BFPA 2QZJA 3L07A 2DJ5A 4QGBA 3AR4A 2OHOA 2Q3MA 2Y99A 1DIHA 3O3CA 2Q0XA 4ZMSA 2P2SA 4K1XA 4NP6A 1O96B 2F1HA 1Z06A 5EE1A 3WGYA 2HYDA 4MUEA 4OGGA 1CDZA 1HTWA 3F0TA 2BDTA 2G83A 3DPUA 3QP9A 2FN8A 3CINA 4BFCA 4QULA 2XE4A 3DHWC 3B2NA 3GMDA 2DULA 5E3IA 3WLLA 4UAUA 1ZAYA 1SA0B 4BN0A 5HXAA 1DEXA 2JLWA 1TM1E 1ECFA 5SZHB 3RS4A 3ZGNA 4YT4A 5A7FA 2H2IA 1FY2A 2RJ3A 4PO9A 3K0AA 4BO3A 1VKHA 4RJIA 4MLDA 4QSMA 1LWNA 2FWNA 3NAQA 4Y2GA 5IHPA 3GEDA 1HZZC 4WXHA 1JR2A 3VA7A 3KJGA 2Y93A 4QJIA 5DISB 5AFSA 4OGFA 1S8FA 1J2TA 1Y1QA 2A5YB 5DN9A 4ZI7F 5BSEA 3TW4A 5ADHA 3GLQA 3O4IA 3R23A 3MCVA 5KOJB 1KDYA 4QNNA 2OQ2A 4HAXA 4HYQA 5ALDA 1KSHA 1RPAA 1U80A 2VIIA 3PDCA 2F6RA 3DMNA 1YU9A 3G5UA 1P9RA 4IDBA 2XUIA 3DBVO 3HCNA 4MS4B 5AMXA 4EB0A 1X7WA 1XU4A 4MKZA 4MB2A 4B3GA 1EP2B 4WQMA 1A69A 4L9WA 1F6WA 2P27A 3LAWA 4J0QA 4LRXA 4MJ3A 4HX9A 3WGKA 4EMTA 1OAOC 1TYBE 3KL2A 4QPJC 3UKDA 1DC4A 2FUG1 4JYPA 3OEYA 1E1CA 3OO0A 5ALIA 4QG7A 2QENA 1CY2A 4RTJA 1TW2A 2VWGA 5FPPA 3DFUA 5TB5A 1QYXA 3LX4A 1JEOA 4RQBA 5CB4B 1JR4A 3AKZA 1EBUA 1VI6A 2O0LA 3BORA 1DXQA 1NF3A 3ABSB 3E7PA 4RKWA 5FFMA 5HIJA 2DKOA 7MDHA 5HM6A 2ZZMA 1RTKA 1FU8A 1TD1A 3IXQA 2EJTA 4K8OA 3TNJA 2P79A 3U4GA 3UOGA 4ZJPA 1PAUA 1A96A 1Z37A 2CFSA 1GZ4A 3A32A 3BDVA 3QTBA 4OEHA 4OGKA 1XMVA 4YMSA 2I78A 3MSCA 5IBQA 4BDTA 2YS6A 4XW2A 2FGKA 3BXPA 4C78A 1GT6A 2CT8A 4EJSB 1HDRA 2ZXFA 5IW8A 3FOFC 2P4SA 3RB8A 2CZQA 2PZAA 1TXGA 4TS3A 3ZDCA 3CKYA 3L0ZA 2XWQA 4PC3A 2ZBRA 5B2ZA 4B8WA 4BVFA 5IH7A 3Q9LA 4WKGA 1A5BB 5IHXA 4IOJA 2P6NA 1SKYE 4D25A 1ENOA 2EGHA 1GHTA 1CNFA 2WY2D 3ZNPA 4YCMA 1PLLA 2HAEA 2JIMA 4HD8A 3L40A 1MIOB 2BD0A 2CK3A 4URXR 4B8ZA 1DO2A 3DGFC 3DXFA 1ORHA 2HF2A 3T0IA 5FDFA 1WS6A 5FA8A 4F5EA 4S2UA 2QMYA 1WIWA 3N58A 4UUAA 5AVYA 5EIEA 1CNMA 2JCYA 1GDDA 3LNTA 2Q8NA 1H2WA 1PE0A 3DE4X 1PJ3A 4TT3D 4EG3A 4GOND 1W0CA 2OILA 3CH4B 3HNPA 2C4NA 4AN1A 3DONA 4EA7A 3WK9A 4MWBA 1NVAA 5AXAA 5HFNA 3TEJA 2H3EA 4IEIA 3M8KA 4TKVA 4OHFA 4JLSA 2VQ6A 1UINA 5I9IA 4KXVA 3SKXA 1CZLA 2RONA 1N7GA 2WICA 1U3FA 2XGMA 4LECA 3T3IA 3WIOA 4YJHB 3KR0A 4RJJA 3TOSA 1J5XA 1KR2A 2ANBA 1CHDA 2AQKA 3GNSA 4K3UA 3QF7A 1TJ5A 1FSPA 2X1MA 3Q9NA 4DW8A 3WHIA 4EUNA 5ESXA 2GCOA 1NHWA 1MC1A 2O8FA 1T5BA 6AT1A 2ZVPX 3R4VA 4FP9A 3RVSA 4XJTA 5A0TA 1DTWA 4PZCA 1QZZA 2CXTA 2IQ5A 4ARAA 5KNBA 1KGSA 4DANA 3OIVA 2RKOA 3TNFA 1YVPA 4WJZA 3UPDA 4RJTA 4I5FA 1I24A 1A5SB 4CG1A 4Q9LA 2FPGB 1L4YA 4A2WA 1NSTA 2NO4A 4D3FA 4OKSA 3MQFA 3GY0A 4B3TB 1ISPA 4C7JA 4PYMA 1TMYA 3I4FA 3DWIA 3Q6MA 5AP9A 3T5CA 2HSGA 2APJA 3IVMA 4ZAFA 1V1RB 2WPNA 1KKUA 1L7BA 4U7WA 2QMOA 2I22A 2D62A 3MJRA 3SEAA 4CEHB 1C4KA 1TUIA 1VCMA 1XIVA 2CDNA 2XT6A 3OFND 1IEXA 3WP1B 1TX4B 3DHYA 4FU0A 4LTMA 3K2IA 3P9YA 2W2LA 1C1XA 4RTSA 3R7LA 5CIQA 4AO7A 4PHFA 1QYWA 1SIWA 3RODA 3VNRA 5F3WB 4JASB 3LQ2A 4BNHA 5A9SB 5KCMA 1VG1A 5BYBA 1CZKA 4V1CI 3NYWA 2ZAIA 3S5UA 3IT0A 1ETUA 4GXTA 2CGEA 5IVIA 3QKRA 4OOEA 5ALYA 5DTMA 5BUQA 3RRZA 2WFLA 1LS6A 1WXFA 2G63A 2EXXA 4YLYA 1TLFA 3ZPXA 5ECWA 3AJ9A 2JDIA 4WBNA 1HSZA 1REQA 1RYDA 1NM5A 4XR4A 4QBFA 1U28A 2RGYA 4EUEA 3CTMA 1M7GA 3OZVA 4YUZA 2R6FA 3QVSA 4OMFG 4L57A 1YAHA 3ZY4A 3OVMA 1QF7A 3KPVA 3ZY2A 3CR8A 3OKFA 1PD0A 2PX0A 1CQZA 1Z26A 3BFKA 4Y8VA 5DWQA 2WJZB 3A6JA 2R65A 3RK0A 4UAJA 3N2NA 4L74A 4EFNA 3NIWA 1SCJA 4NV0A 4C6TA 2R1UA 4Y2PA 4RL4A 1ZJ6A 2CVHA 4HNQA 1Z6AA 3UJAA 1EIWA 3FTPA 1F20A 1J8QA 4IFTA 4MPJA 4RLFA 4W1RA 2WJVA 4BWYA 5FUVA 2VBGA 4ZQGA 5TR9A 4ER3A 1P8JA 2BEKA 3DL0A 4L8VA 2ZT5A 3CT4A 1ORVA 3H5VA 5IXJA 4FJ1A 4D0GA 2I62A 5G3ZA 1NF9A 1CB7A 2O7VA 4QOGA 4ZEXA 5JNVA 3AF3A 3IC5A 3R7BA 3SQNA 2YFQA 2ZYRA 4KJXA 4KQGA 4RAOA 2GR9A 3LOUA 4G24A 1X7HA 1Y9EA 3MJEA 3DDNA 1JDUA 4K6HA 4BBJA 1E20A 2E6KA 1H8EA 1E3SA 1HG1A 2WJAA 1BHO1 2OUKA 3GWZA 3OF5A 2VHJA 4KVZA 1XMJA 1QMGA 3T41A 4DCGA 3PQ5A 3SF8B 4DXHA 4NZYA 1GKIA 1AQUA 1QOQB 4D4MA 5HQ3B 1NN5A 3IJRA 5GONA 3KEOA 1C3EA 3OHMA 2Z4RA 4ZAWA 5GM1A 4KFRA 2XT9A 1S02A 5KHLB 1T10A 1B14A 3BH0A 3HP1A 4RSMA 1H94A 2A1UA 1DBVO 1GWNA 1NJSA 1Q16A 3WZLA 3H6HA 5I7FA 5DNVA 1GA6A 1C8BA 1V1MB 2F1KA 2GPBA 3OFKA 4JQSA 4NARA 2NV2B 4OJNA 4U5XA 1W7AA 1JQBA 3VNAA 2X77A 4EMBA 3VKWA 3BULA 1R37A 3LOPA 3E3OA 3FN4A 3M1IA 3P9ZA 5C5IA 3KQNA 5JEEA 2ST1A 1L0BA 2KE5A 2HJHA 5KNBH 5ED4A 4BB0A 3R6DA 1A9TA 4HEA6 5AVTA 1DEAA 1QG6A 3BSYA 2B25A 3CV3A 3D5EA 2XA2A 5BYKA 1FFGA 1F0PA 2C4HA 3FPHA 3DF7A 1BWPA 2OYRA 1KYTA 3V1TC 3SYLA 3I8OA 3MWJA 3Q2OA 4R1OA 1QLWA 3RW9A 1NYQA 3IR7A 1Z12A 2FH5B 1UPUA 3AUSA 3P9NA 1XZBA 4YCJA 4KPFC 4B4UA 1U3CA 4CEJB 1BW9A 1PN3A 3I9JA 3GAFA 4J1TC 1Q5PA 3AG6A 3ICPA 5ABPA 1CUEA 1MN6A 4Q34A 2Z9CA 2ZSFA 2CW5A 2UYGA 3H3JA 2CMHA 2ZSUA 4LK3A 1GNRA 2V5VA 3DWGA 3ANXA 3K1YA 4YVFA 4B87A 4JR0A 1LJUA 4YNBA 1KZ9A 1T6BY 1VLVA 4Z1MA 5BQ5A 4ZDKA 5FWXB 1WETA 3VMMA 3AVUA 4C07A 3BZWA 3SX0A 1XZLA 1E69A 2H7CA 4KU4A 3R9WA 1EA7A 1XTBA 2XZTA 3Q12A 2UZ4A 4QE3A 2WKPA 1G59A 4A10A 4FEEA 1V8OA 1JDSA 5JDIC 5CR9A 4Y2HA 4OXNA 5A7GA 2H4FA 2JJ2D 4R9NA 4M37A 4WOKA 3MGKA 5AW5A 4CMHA 4FC7A 2X5OA 5EIWA 4YRSA 3Q41A 3SKYA 3PQ2A 4UHFA 4TMFA 3TX6A 1J2YA 3QUCA 4TMVA 4WXPA 3H97A 4CDGA 2AXQA 4QYWA 1FOEB 4PZEA 3JWIA 1MB4A 3L46A 2I54A 2C2MA 4G2TA 3C98A 4URHA 3E3AA 4EFMA 2IHVA 4X41A 4PX2A 4JUFA 4LC1A 3KSDO 4ILKA 4MCHA 1F9EA 4TWJA 4WL0A 4BFYA 2YQ4A 1L5NA 1SHUX 2DR0A 1ZLXA 2YVLA 1P73A 4RDIA 3IJ5A 4MS4A 1HQKA 4J1QA 2F2TA 3DNFA 4BP9A 5F23A 1ZU4A 1RCUA 1GNLA 2ZZKA 3REOA 3JAKB 1Y5NA 1UXJA 1YQWA 3G8AA 1Z5ZA 4G8JA 3GNTA 4YCDA 3TIGA 3CLUC 2QAGA 5EXXA 4YV2A 5IP5A 2GEDA 2YJ3A 4I4TB 4JLWA 5HILA 4ENRA 4B3FX 2BTEA 3C3MA 3IHTA 1R4NB 3AJDA 4JWTA 2QPLA 3VZPA 3GP8A 3MWKA 4U6NA 1IN4A 2FFHA 4R1SA 3F6BX 3ETLA 4BQSA 2CVOA 1M2NA 4IIHA 1YASA 3L8DA 4BRSA 3TEFA 3WLNA 3PLRA 4RTMA 1JAHA 1UJ6A 3LSTA 2FPUA 4AX4A 3U5TA 5CLGA 1PQYA 3DEHA 2YW2A 3PHGA 4HLQB 5LB4A 2PRYA 5J43A 2YNMC 4DLPA 4EJSA 3PUHA 4CMEC 5WRFA 4DJTA 1T1EA 4ZYWA 1O5IA 2ID4A 4GLFA 1F6DA 3LUPA 4AWAA 3IE1A 3O2JA 2PM8A 1MHPA 3WI7A 4Q9HA 4OFWA 4RADA 1XQ6A 1SCUA 1M1ZA 2AG5A 1DG3A 1PX0A 1UC8A 2VH5R 3ADPA 4L0MA 5GGYA 1Q7GA 4QBKA 1VJTA 3SDBA 4EHNA 1CRPA 1PV2A 2A7XA 4E12A 1WHTB 1GN8A 1NW3A 3B51X 1IEWA 2FPRA 3KU4A 3OIDA 1RLTA 5K0FA 2Y0EA 3HCBA 2ZRAA 1O94D 3GMIA 5KMGB 4IOLA 1TA0A 4NOLA 3H2GA 5H7XA 3QFSA 3TM4A 4QBTA 3A1VA 3ZDQA 3HVRA 5JDCA 3AR7A 4RA6A 3USCS 5F9FA 1XWWA 2D8MA 2ZM5A 4O25A 1CIPA 3AR6A 3RTCA 1UPTA 1BOFA 4I50F 2P40A 5KYYB 4HWTA 3CXRA 1KOLA 1W8IA 2C61A 4DWWA 3SZGA 4HDKB 4GQIA 3QW4B 1GZ7A 1XD9A 2B82A 3I30X 3OZWA 1SHLA 4LDQA 5K9ZA 4B40A 4DC9A 3NFYA 3ORHA 1GZVA 2YRFA 3FHJA 5KU7A 2XZDA 3OPNA 1OHHA 1TIBA 4XH9B 1T4GA 1RXIA 1AGXA 1WPGA 2VPPA 1TAHA 4TM8A 4DCCA 3SIWA 4C7BA 1CJUC 1H1LA 2Z56A 4FFBA 2FE1A 1V39A 3W5CA 1WY7A 2F17A 3F4LA 3CRQA 4EAAA 2XMGA 1QDLB 1XSEA 4F92B 3VJKA 1NMYA 4BMYA 3CISA 4GM1A 4E6EA 5M2QA 2O3RA 3NBKA 4CCSA 4YYZA 5EI5A 1DE0A 2O1XA 2XHEA 2XNDA 3TMAA 5CDGA 5SICE 4RHYA 4GFDA 2YV4A 1ZUHA 1SKBA 3Q3CA