3A4WA

Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from pyrococcus furiosus complexed with chito-oligosaccharides
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
GPNANPIPEHFFAPYIDMSLSVHKPLVEYAKLTGTKYFTLAFILYSSVYNGPAWAGSIPLEKFVDEVRELREIGGEVIIAFGGAVGPYLCQQASTPEQLAEWYIKVIDTYNATYLDFDIAAGIDADKLADALLIVQRERPWVKFSFTLPSDPGIGLAGGYGIIETMAKKGVRVDRVNPMTMDYYWTPSNAENAIKVAENVFRQLKQIYPEKSDEEIWKMIGLTPMIGVNDDKSVFTLEDAQQLVDWAIQHKIGSLAFWSVDRDHPGPTGEVSPLHRGTNDPDWAFSHVFVKFMEAFGYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus- the role of conserved residues in the active site
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Chitinase
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4wA00
3UG5A 1XCWA 4GXPA 4AZ6A 1CPUA 3GNOA 5FIPA 5A2BA 2YBTA 1YQ2A 5A6KA 2WCSA 5DFAA 4U2YA 4CN6A 5M03A 2BHYA 3WBEA 4BCEA 1OGSA 3NCOA 1HJQA 1IT0A 3L4UA 4U5IA 1B3WA 1MXGA 3ECQA 4MB5A 1BLIA 4LXFA 3CMGA 2PF0A 3O2LA 3U7VA 1QOXA 4U3AA 1CENA 2FGLA 5A2AA 3KE0A 4GZJA 3CHDA 1AQMA 1FH7A 1KR0A 1V02A 4UNIA 4PMQA 5JBFA 5ECUA 3ZJKA 3B9EA 2CKRA 2CHOA 1GPFA 2CBJA 3WSUA 1KXQA 1V6UA 1VFFA 1GOMA 2EXOA 1M01A 1ESWA 2XG9A 3T2PA 1NARA 1GW1A 3WMBA 4WKAA 2OYLA 3BGAA 4KMQA 4U5KA 5BROA 5ABFB 2VR4A 1BYBA 1B3VA 2WVSA 1QW8A 4UQEA 1NWTA 2CESA 7CGTA 2XWEA 2C8NA 4WIWA 5A8NA 3WF4A 1BYAA 1QHPA 3WN6A 3F5JA 3GH4A 4F9DA 4DM1A 5BYWA 2OLHA 2VI0A 1EDTA 4A4AA 3ZOAA 3OGRA 4ZEPA 2J79A 3WBAA 5CGTA 2WVVA 4E2OA 2AMGA 3CHFA 2Y5EA 1UOKA 3A6OA 4DM2A 3PBGA 3SUWA 3A3HA 1UKTA 3L2LA 4KRUA 2VTFA 2VCAA 3VUPA 2VRQA 5IHRA 2OSYA 3FXYA 2CITA 1FH8A 3GTNA 4PMDA 2CBVA 2NW0A 4AISA 1ISWA 1GORA 3AROA 3CPUA 2ZXBA 3DHPA 3BMWA 4MNKA 3WQ6A 4D6GA 1VJZA 2J7EA 1RD6A 3ZJ6A 4H04A 2DH2A 2WKGA 1WZLA 3GNPA 3L4WA 1JZ6A 3VILA 1BGAA 5F7UA 2VC9A 3AHVA 1C7TA 2O92A 2WWCA 4UOJA 3T09A 4QCFA 4BQ3A 4HOZA 8CGTA 3BCFA 2ZUSA 1E15A 4HPGA 5CG0A 1PIFA 4M80A 4D6DA 5HBFA 1B3XA 5HDRA 2Y2WA 4MTVA 2X1IA 2YL8A 4MB4A 4AYSA 1U33A 4UFHA 1CYGA 3VIKA 3BAJA 3WDPP 4JAWA 4QAWA 7TAAA 4OBSA 3FN9A 3RM8A 3WL1A 3VIJA 4IPLA 1J18A 2XIBA 3VD5A 2BVYA 1V3JA 5LYRA 3WNNA 1HXJA 4LPCA 2JIEA 4C7DA 4AIOA 1DP0A 3VIMA 3E1F1 4GZIA 4TXEA 2E3ZA 4WSKA 2NT1A 1VFMA 4MAVA 1H2JA 3N13A 4AZCA 1Q4NX 3M46A 2GDVA 1FP9A 2Y24A 1OD0A 2WMKA 3KWXA 3T08A 1QVBA 5EB8A 2ZX5A 1H5VA 3IAPA 4XUYA 3NDZA 2YL5A 4TX6A 1TCMA 1V0LA 2MANA 1W9PA 2JFEX 3POCA 3JUGA 2WWDA 3U7BA 3PZVA 4NI3A 4WJXA 1JF5A 4HA4A 4UQDA 5A6MA 1RP9A 4W88A 1XV8A 4CD8A 2EPMX 1E43A 2WM0A 2YLLA 4GQQA 2A3CA 2CCRA 1TE1A 4Z2IA 1U30A 1HL9A 1ISXA 3ARXA 4AW7A 1NOFA 2CIPA 3BCDA 3L4TA 2BXYA 1DWAM 2DQXA 1AQHA 4BZYA 4PTMA 1QHZA 4UFIA 4MNJA 3OGVA 4P8XA 3EDJA 1QI4A 4JZ5A 3SUVA 2E8YA 3A47A 3NSNA 4DWSA 3M6DA 1V6WA 4XZWA 3IJ9A 2X09A 2D3LA 3MUY1 5DT5A 5E70A 1AQ0A 1R85A 1QW9A 4E8DA 1W9UA 4CGTA 1E0VA 3POHA 3AS1A 1SMDA 3VIIA 4PTVA 1ZU8A 3ARSA 3A4AA 1NWSA 3M7SA 3AOFA 3AXIA 5IFPA 1J9YA 4M56A 3HMCA 2GFTA 5D9NA 2XTKA 1W9XA 4D6HA 1HJSA 2VOTA 3BMVA 1XSIA 1B90A 3ARVA 3OLDA 4ACYA 2Z1KA 4HOWA 1M03A 4CKQA 2WXDM 1CGUA 3VDCA 1TA3B 1DWIM 1R87A 2CETA 3VDHA 2DSZA 2PB1A 4W7UA 2V38A 1E73M 4AZBA 1FA2A 2BS9A 3AYSA 5BXPA 3WQ5A 2EEXA 1QNQA 3L4VA 1UA7A 2W66A 1V3LA 1UKOA 3T2QA 4J3VA 3SUSA 1E72M 2FH6A 2DSWA 4S3JA 1UH2A 1TG7A 3AIRA 4U31A 1O7AA 2J7CA 3ZM8A 2PWDA 4Z2HA 2JEQA 1WZMA 6CGTA 1NM9A 1JAKA 5FD0A 4GIAA 1JNEA 3WDIA 2YLAA 1EOKA 1C8XA 1JZ7A 1JYVA 2V3FA 1JI1A 2JF7A 3CZJA 2EPNA 5A6SA 2CYGA 1LJYA 2WBGA 1JZ8A 4URIA 1GJWA 3ARRA 2BHZA 3ARWA 4ACZB 1A3HA 1H0GA 2DGAA 2YA1A 4TTGA 1G9HA 3ZR6A 2ZX7A 4ML4A 5A8PA 3QOKA 5FCZA 1UD8A 5AYBA 2IXVA 4PN2A 1KFWA 1HL8A 1HT6A 1WP6A 1JYNA 2XJ7A 1NP2A 3MMUA 2V3GA 5CLWA 4PEEA 1M53A 1CXIA 3WEOA 1HKIA 5ABEA 1XD1A 3T0AA 5E09A 1KXHA 2CXGA 2WMFA 2BVDA 1B30A 1HKMA 1E6NA 3VX1A 1EQPA 1CGVA 2QPUA 3QOMA 2YJQA 2BY0A 1JFXA 3LPOA 4CU7A 3W26A 4J28A 1P6WA 2UY5A 4QCEA 2GJXA 1HP4A 1ZS2A 4A3YA 5I78A 4GQRA 5E0CA 1E6PA 4MDOA 4H41A 2D0FA 3I3BA 4W8BA 4Z2JA 2VVNA 4JFWA 1IV8A 3AIBA 2X0HA 3MUIA 5I79A 2G8ZA 5CPQA 3LPFA 1W1TA 4CU8A 4HOXA 4GO9A 4FMVA 5BRPA 1FH9A 2WPGA 3VIHA 3RPMA 4D6CA 5ABFA 4HTYA 4PTWA 2ZWZA 3LPPA 3ZQ9A 3PZQA 4AD5A 1US2A 2CBUA 4FLQA 2CEQA 3ARYA 4LYPA 1H49A 2D0HA 1TMQA 3OLEA 4N0RA 1NH6A 3MMWA 4YPJA 1ZL1A 3F4VA 1UH3A 4FLOA 2PWGA 3ZO9A 3VM5A 1UR0A 1W1VA 2D0GA 3WQ8A 4AIUA 3QHOA 4ATDA 2D24A 2NT0A 5BXRA 3NSMA 1GVIA 3GM8A 2DT0A 4PMRA 1CXKA 3VGDA 1PJ9A 1J0HA 3ALGA 3WH9A 3EDKA 4BQ4A 3OLGA 1IZJA 3PZTA 1KXVA 3I3DA 1GNXA 3BH4A 2A3EA 3D3AA 1XSKA 3AMGA 3DYPA 2DSUA 1ITCA 3SUTA 2GDUA 3EMCA 1TUXA 3AZSA 3WMSA 1HJXA 3WD0A 1GOKA 5DF0A 2EQDA 3CUGA 1J0YA 4P7QA 3CZLA 1HX0A 3L4ZA 1PIGA 4PMUA 1HP5A 2OWCA 3N11A 4HZ6A 1KQYA 1V3HA 4EAMA 1XSJA 2FHCA 1Q6EA 5KEZA 2WMIA 1C3FA 4UZUA 3VGFA 1CNVA 3WDQA 1BAGA 2C0HA 2VL4A 3VNYA 4DWSB 1C92A 2WC7A 1AMYA 5BXSA 1D3CA 3TA9A 1E5NA 1CXEA 1VBRA 2YDQA 4GINA 4JKLA 2OSWA 2X05A 4J3UA 4OIFA 3CUJA 5M3WA 5IFTA 1NWUA 3W38A 1E4NA 2X8RA 5I0DA 4HU0A 1JAEA 2DH3A 1DTUA 3ZMRA 2BY1A 1KBKA 3WFLA 4B9YA 3LPGA 4J27A 3WF0A 2Q8XA 2DDXA 2DIJA 5A6BD 3L4YA 5IHSA 3VMNA 1SMAA 4W5ZA 1VJSA 3CUHA 4H8VA 4AIEA 4JCMA 5JBEA 3MSGA 3T0BA 1JYWA 1GOWA 3SCSA 3PN8A 4TX8A 4WF7A 5FL1A 3AXHA 1LWJA 4W7WA 3D5HA 1UWQA 2A3AA 1H11A 2WHKA 4AY1A 4H8UA 3GXMA 4PYSA 1JL8A 3GBEA 3NUKA 2XIIA 3M07A 1V3MA 2GUYA 2QLYA 1EH9A 1W9BM 1CTNA 1DEDA 3II1A 4YHEA 3WD3A 1UD5A 2XFRA 3HU7A 3W25A 4ZXOA 4X9YA 1OB0A 3RCNA 1UZ4A 1H0IA 2DIEA 1FFRA 2ZICA 3WQVA 1CWYA 4KGLA 4P7OA 1XYFA 4W84A 1EOMA 3S2CA 2ZWYA 1M7XA 1MQPA 1KGWA 4LX4A 1PZ3A 1EA9C 1D2KA 2VURA 1HJVA 3AHTA 3EYPA 1ZBKA 2BY2A 3SCWA 5GNXA 4IISA 4MNMA 2ESCA 4AC1X 1ISZA 2G4FA 2PBOA 5I6SA 3VPLA 5FL0A 2WYSA 1V3IA 3ARQA 1UUQA 4QP0A 1LL4A 3AXXA 3AS3A 1HN1A 1QI2A 2J75A 3IAQA 2J25A 1H4PA 3W0KA 5LA1A 3CZKA 1EO7A 1QI0A 1R7OA 3K8KA 3CBWA 1W3HA 1CLXA 4JL1A 4DWSC 1BVNP 3TOPA 1X6NA 3MV11 2EPLX 1JZ3A 4W89A 3SCUA 2WCAA 5A6BA 4V27A 3GDBA 4GPNA 1E71M 1W91A 3WY1A 4X0NA 2VQUA 5C71A 1J0ZA 1E3XA 1MYRA 4CD4A 1W9DM 3OBAA 5M5DA 3EDDA 2W61A 3WQWA 2J74A 5A8MA 3GH5A 2XYLA 2G3MA 4B3KA 4C7FA 3MKKA 4U33A 1MW1A 1UG6A 2G3JA 1K9FA 2WK2A 4W85A 3WD2A 1HKKA 1WPCA 1B9ZA 1HNYA 3PHAA 3MU7A 2ZOXA 1J0JA 4JFTA 2UY4A 2ZXDA 4GI6A 2VMFA 2ZUWA 4BQ5A 4FK9A 1PPIA 5AYIA 3AIQA 5EFFA 2WW5A 4WSJA 1H3GA 3W82A 1UYQA 1WCGA 3DYOA 5I24A 4W8AA 1WDRA 1QNSA 2GJPA 5KZ6A 3BLKA 5A3HA 3AIEA 1OBAA 1WDPA 2JF6A 3GXFA 4PMOA 1KGUA 1OM0A 1ZJBA 2JIWA 1BQCA 1MQQA 4NRSA 3FY1A 5BWFA 4HP5A 4D6FA 3OLIA 3ZJ8A 5JIPA 2J62A 4K68A 3AISA 4FLSA 1BTCA 4RE4A 1QI3A 1J0KA 4HZ8A 2ZXAA 3W4RA 2WZIA 1E6QM 1Q6CA 2DT3A 1G5AA 3VKKA 1CXFA 1JZ2A 3FAWA 3VGBA 3VGHA 2WC4A 4Q7NA 3PZOA 2D23A 3SCQA 3UG4A 1J11A 3AYRA 1TZ7A 3A4XA 2Y8VA 2VX6A 3ARUA 1HIZA 4WKFA 1JDAA 2ZUMA 3DYMA 2JE8A 1WAWA 1W2VA 3WEZA 5DT7A 1JNDA 3TTQA 3ZR5A 1XHGA 3CGTA 5A6LA 1ZBCA 1BPLB 1CDGA 1H09A 2D3NA 3AS2A 2YBUA 2ZUUA 5CXPA 5JUVA 1KBBA 1QNPA 4WKHA 4W7VA 4CCEA 3BAKA 2EPOA 1J10A 3MANA 4EE9A 2XVKA 3KL0A 4OJYA 4UFMA 1VIWA 3N15A 4PRWA 4TVDA 3VDAA 3VOCA 3VD9A 1XCXA 3VD3A 3WUFA 3ZSSA 1PAMA 1WZAA 4ZE5A 2OWXA 1B0IA 1R86A 2QF8A 5FOOA 3AMLA 1Q6FA 5E0FA 1LL6A 3RMEA 1MVYA 4LYRA 5D8ZA 5GPRA 3ARPA 1ZBVA 2VUYA 4CD7A 4W93A 2E8ZA 2A3HA 1OSEA 6A3HA 1HJWA 4X0VA 1MW3A 1CIUA 1JIBA 4JFSA 5LA0A 4JHZA 2UWFA 3G6LA 4PMVA 3VD7A 3VIGA 1BVZA 1VFUA 1F4AA 2WMIB 5LA2A 1W9VA 2VZOA 3BSGA 1VEOA 1PX8A 4UR9A 3PZ9A 1BFNA 1ZBWA 2WNWA 3WELA 4PMXA 4KRTA 1E6ZA 3ZT7A 3UESA 3N18A 4N42A 4IPNB 4HMDA 1UQZA 4NZCA 3BLPX 1D7FA 3OZOA 2PI6A 3W37A 5C70A 1JF6A 3UERA 3QGVA 3K46A 4GI9A 1G01A 2WB5A 2PBGA 4P8VA 3MO4A 2WAGA 1IZKA 1MFUA 4UQBA 3VIOA 1SYTA 3VINA 3ALFA 1C8QA 4JIEA 3PZGA 2G41A 2BHUA 2WHLA 1BF2A 3WNPA 4Z2KA 3AMCA 2QPSA 4ATLA 1PZ2A 1UZ1A 1WDSA 1ZJAA 2ZX9A 4UQ9A 1K9EA 4FF5A 2VNCA 4UFKA 2WBKA 1OGBA 8A3HA 1C8YA 2VRKA 3AIVA 2YIHA 4AZGA 3PZIA 2W91A 1GQJA 1V08A 3RO8A 2PWHA 5M17A 4AD1A 1KGXA 5GNYA 4MNLA 2PWEA 1L8NA 1EIBA 3O9NA 3RILA 4F8XA 4W87A 4C7GA 4CVWA 5CGMA 1FFQA 4MADA 1QHOA 1US3A 4PCSA 4OOUA 4RE3A 1CZ1A 3WF3A 2O9TA 1Q6DA 4V2XA 3W28A 4HPHA 1VBUA 4HZ7A 3K4AA 3MUAA 1C7SA 1V0NA 5AC4A 2J78A 1UH4A 2J7DA 1KWGA 2XSBA 3TTYA 4PUDA 1LLOA 4AZHA 3PTKA 1Q6GA 1TFVA 2XPKA 3SUUA 3TTOA 3CZ8A 1W3JA 2NSXA 1EQCA 4YHGA 5E6YA 4M29A 1EDQA 4M24A 2G3NA 3VD4A 1HVQA 3AICA 4WK9A 4F66A 1I1XA 1E70M 3FNDA 1M04A 2J7HA 1JZ4A 2VT0A 4R27A 4MJ4A 1BGGA 1VB9A 1DHKA 1UKQA 2YA2A 1SFSA 2Z1SA 3CZGA 1U2YA 1CGTA 1NOUA 2VX4A 3OG2A 1EGZA 3WKZA 4JCLA 5CZKA 1JD7A 4QFUA 2A3BA 5CSUA 3QR3A 3K4DA 2VZVA 4L4OA 3T2OA 3EMQA 1F4HA 5CSYA 3WENA 4Z2LA 3CHCA 4UFJA 1XYZA 2WHMA 2YOCA 4MB1A 4XB3A 1SR0A 2QMJA 4JFUA 1GCYA 4D72A 3T0DA 3UR8A 2E9MA 4W5UA 1WO2A 1MWOA 2X0YA 2EO7A 1E0WA 3RIKA 3WF1A 3SCOA 4CN1A 2WHJA 3W29A 2WLZA 4DWSD 2ZUVA 4TVUA 2BXZA 4HA3A 5AY7A 4TUFA 1UWRA 2CBIA 3UCQA 3WUBA 5TD4A 3ZSTA 4H2CA 3W6MA 2VQTA 1MFVA 1E6RA 4KGJA 4OZOA 2FHFA 2J77A 2W63A 3AI0A 4DUVA 2GVYA 1ZB5A 1BG4A 1WNOA 4D6EA 4AZIA 2DT1A 4P7LA 4BA0A 1CGXA 2BVTA 3WNLA 1FHDA 5D8WA 1HVXA 4CUCA 3THCA 4AEEA 2FHBA 3IJ8A 4M8UA 2DEPA 4YN5A 4D6IA 4J3SA 3CLWA 4H8HA 5GQBA 1GHSA 1TA3A 4GO8A 1ISVA 2EBNA 1JXJA 4WLCA 3VGEA 3B8SA 2BV9A 2VJXA 4A3HA 2XVGA 1B3ZA 2WCGA 5D9OA 2CPUA 1J12A 2ZE0A 4UQCA 4AZ7A 5DEZA 2J7BA 4M1RA 3N04A 3MUZ1 4CU6A 4J7RA 4BS0A 3PZUA 3ARTA 1PBGA 1V3KA 1XC6A 1FOBA 1VENA 3ZJ7A 3F5LA 2O9PA 3KZSA 4ZENA 3APGA 1RP8A 3CO4A 2GSJA 3WH6A 1LG2A 3BAIA 3K1DA 5BXTA 2YL6A 3GBDA 3AMDA 1QBBA 3EDFA 3IANA 2J47A 3WD1A 4TTUA 4CD5A 5HPOA 3VVGA 1UHVA 3U5YA 1XH1A 4NF7A 4P8UA 3L2MA 1GOQA 3WL0A 4W86A 1KCLA 3CZEA 1FHLA 2Y8KA 1OGGA 2ZUNA 3K8LA 1QNOA 1BG9A 3TTSA 3SURA 3VM7A 2WMGA 2XGIA 2WSKA 3VMOA 2XGBA 3WFZA 3WNMA 5GNZA 4B3LA 5A8QA 4IM4A 2W67A 1QI5A 2D2OA 1DWHM 1LF1A 1E4MM 4BQ2A 4RE2A 4QLJA 3SCRA 1GJUA 2WLYA 3PTQA 3KL3A 5CPTA 2V5DA 3O6AA 2AOSA 2WSPA 2DSKA 4GI8A 3KL5A 3MV01 4CD6A 3WH7A 4DUXA 1E1FA 3BAWA 1GUVA 1W2PA 2W5FA 4P8WA 5A8OA 4DUWA 1CGYA 1JDDA 4QLKA 2OWWA 1Z32X 2X2YA 2TAAA 2D1ZA 4LQ1A 3U5UA 3WNKA 3S6TA 4HMCA 2XM1A 1OT2A 3KEHA 2GK1A 3RM4A 4MDPA 2XUCA 1TVNA 3AQUA 1E5JA 5ABGA 2FGZA 3WMCA 4GKLA 2VVSA 3B9DA 2VRJA 3VIPA 5A2CA 3AJ7A 3BXWA 5CLTA 1E6SM 2WKLA 1R8LA 3AIWA 2XHYA 4PUEA 2XM2A 4UOZA 3CUIA 5D9MA 4AD3A 1N82A 5BCAA 3DECA 4J3TA 2QV4A 4ACZA 2XWDA 1QNRA 2UY2A 1CECA 5AC5A 1W32A 2VZSA 5CQ1A 3WD4A 2BFGA 3PTMA 2FH8A 2OYKA 5JBDA 1ODZA 2WC3A 1E1EA 4TOQA 1VAHA 3PZMA 4UQAA 2C7FA 4Z2GA 4OOZA 2O9OA 1JG9A 5CPSA 4TVCA 4UFLA 4OUEA 4U2ZA 2CERA 4F9JA 2YL9A 1G0CA 2XVPA 1PX4A 4AZ5A 1AVAA 1JYXA 3W81A 2V3EA 3N1AA 3U57A 5C8BB 4PBGA 5DO8A 3WQ4A 1C93A 1X1NA 4OBRA 4W8LA 2WZEA 1BYCA 1W3KA 2ZIDA 4B9ZA 4HA1A 2WVUA 1JXKA 3VU2A 3GH7A 4M81A 1JDCA 3UEQA 3RM9A 2J7FA 2UY3A 1ECEA 1RH9A 4R5EA 2OSXA 1GVYA 3OIHA 3EBVA 2G3IA 5D9PA 2J8GA 2XVNA 1UWTA 3VMPA 1UR2A 3GZAA 4FLRA 3B9AA 2EPKX 3F5KA 1S46A 4KH2A 1JGIA 2B31A 5ABHA 3AFBA 3AZTA 4GZEA 1XH0A 2GJRA 3UETA 2BNJA 4L4PA 1OWQA 2F8QA 4P7NA 5HOSA 2E9LA 1G1YA 1VF8A 3AMKA 2Y4SA 3OB8A 1H41A 2V3DA 1GQKA 1UWSA 3SCVA 3MS8A 2J4GA 3FHQA 1MXDA 3WH8A 3GXIA 1K9DA 4E8CA 3L4XA 2HVMA 5I5RA 1GQLA 1PEZA 2WMJA 4HU8A 3K8MA 1TVPA 1GHRA 2XVLA 1B2YA 3FW6A 1W1YA 1MW0A 3N12A 1NWRA 4LGXA 1O6IA 3CMJA 1HF6A 4NRRA 4RL3A 3I3EA 3DHUA 2JALA 3GXDA 1UR1A 3VTRA 3RJXA 1E56A 4F79A 3J7HA 1NQ6A 1R7AA 1UKSA 2XFFA 1UR4A 1UD4A 1KXTA 1OIMA 2CHNA 2V5CA 1JI2A 4MB3A 4XV0A 1WB0A 5A94A 5FKYA 4S3KA 2VZUA 1OD8A 2FDMA 2EJ1A 2OYMA 1I75A 3TP4A 1UD6A 5A6AA 3EDEA 2E4TA 1V0MA 3BC9A 4JFVA 3NJ3A 4JL2A 4CCDA 1XRVA 1KR1A 4UCFA 1E3ZA 1B3YA 2GJXB 2YDSA 4AD0A 1UR9A 5HNNA 1GQIA 1C91A 1XGZA 1VEMA 4AXNA 3AIUA 4HMEA 3HJEA 3VIFA 2YDRA 2DPEA 2IXUA 1OIFA 1WKYA 2D20A 4UZSA 1ITXA 7A3HA 2ZXQA 1EHAA 1CGWA 1YHTA 2CKSA 4CVUA 3VGGA 1DWJM 6TAAA 3ARZA 2PWFA 1UWIA 3SEPA 1NP0A 4AD2A 4KWUA 5EFDA 3NYDA 1XH2A 3WDRA 1CBGA 1GOIA 3THDA 1GONA 3NIYA 3WUEA 3WDJA 3AHYA 4D1JA 4AWEA 3UG3A 4MPKA 2VR5A 2ZUTA 1KCKA 3NSXA 1JZ5A 2RGLA 3FHAA 1V6YA 1K9TA 2ZX6A 3OGSA 2W62A 2PC8A 1DWFM 1UD3A 4Q22A 3N9KA 3PZNA 4PSPA 1CEOA 4NSBA 5EBAA 1Y7VA 1EO5A 3WH5A 1PX3A 3FAXA 5E9AA 1WZKA 3WUGA 1B1YA 4Y7EA 1WE5A 4MJ2A 1E6XM 3ZT5A 3WF2A 1G94A 3SCTA 3MMDA 3EMZA 1EXPA 3CUFA 5I2UA 2YA0A 1JFHA 1L0PA 1HJUA 4V28A 4J3WA 1H1NA 2CNCA 2W4XA 5DMYA 3ZIZA 1V0KA 1QPKA 1W3LA 4AZCB 9CGTA 4EANA 3VDBA 4JHOA 3W53A 3SIMA 4AEFA 3AHZA 1ISYA 5I77A 1WDQA 2WZHA 2O9RA 2VO5A 2HISA 3G6MA 4AD4A 4CN4A 3TONA 4D71A 5A6JA 4JKKA 5A95A 1UA3A 3CHEA 1CLVA 1VEPA 1X6LA 1A47A 2YKKA 1KQZA 2E9BA 3SCNA 2VCCA 1W1PA 3AZRA 1HKJA 2WVTA 1UWUA 1OCQA 4D1IA 3QHNA 1EDGA 1MQRA 1J01A 1V03A 3W6LA 4EK7A 3AHXA 3SCPA 1KWKA 3MSDA 4PMYA 1LG1A 3VX0A 4XX6A 5A69A 2E0PA 1NOWA 3VNZA 1J0IA 3BAYA 3CTTA 4CCCA 2W92A 3VO0A 1E4IA 1LWHA 3HN3A 2QMKA 5D4YA 1UKPA 5CJ5A 2VCBA 4JKMA 1DWGM 5HPCA 3WEMA 4BF7A 1E4LA 1TR1A 2XSAA 1MW2A 1QBAA 1BHGA 1V6XA 1FP8A 2XFYA 4OKDA 1E9LA 3QHMA 4D6JA 5I3DA 2RGMA 1B31A 2E40A 1CXHA 3GNRA 1ODUA 1UR8A 4LYQA 4UOQA 1GOOA 3WNOA 4P7RA 2VX7A 2BY3A 4EKJA 2WMHA 2JEPA 1KB3A 1LQ0A 5EMYA 4ZXLA 2J7GA 3DC0A 1LL7A 3LMYA 4ZE4A 1JD9A 4PTXA 3OZPA 2GK1B 2D22A 1RPKA 1V6VA 3BSHA 3WDHA 4B16A 3ZT6A 3AS0A 5I23A 4M82A 1CXLA 1UD2A 2DSVA 2DT2A 3WIJA 4PMZA 3IK2A 2ZX8A 5A1AA 4AMCA 4ZFMA 1EHNA 2WANA 1C90A 5HXMA 3CH9A 2WVVB 4B15A 5E6ZA 4XZBA 1XD0A 2VZTA 4U3CA 1GZJA 4PMNA 4UTFA 4ATWA 4QLLA 3UR7A 3GYCA 1OT1A 4E4PA 1UQYA 2IUZA 1I1WA 4J3XA 1E40A 3A4WA 5JIWA 2J8FA 2QHAA 4MAZA 3IJ7A 1E55A 1OINA 2AAAA 4PSRA 2F2HA 4IUGA 1VRXA 3RJYA 3W24A 5IXEA 1BSIA 4H7VA 3NDYA 5IDIA 1K6AA 3BAXA 1BYDA 4QDMA 3OA5A 2VX5A 1V02E 1VFOA 3CIVA 2F61A 4PCTA 1E0XA 3N17A 5BRQA 3W27A 3RDKA
chains in the Genus database with same CATH superfamily
3UG5A 1QWGA 2P5NA 1CPUA 4JIPA 5FIPA 1YQ2A 5A6KA 4U2YA 4CN6A 4I8YA 1OGSA 1HJQA 4ROQA 1IT0A 5FJPA 4U5IA 3ECQA 1IGSA 1BLIA 3CMGA 3REQB 1QOXA 4U3AA 2I5GA 3EX4A 4WY0A 1CENA 2PURA 3AAMA 4GZJA 2EPHA 1KLYA 1FH7A 1KR0A 2CZDA 1V02A 4UNIA 3T6CA 1QK0A 3WFAA 4L5ZA 1LWIA 4RLIA 1B4KA 1SZFA 3UVIA 1GPFA 3CV7A 2CBJA 1UUOA 3XISA 4LV9A 1M01A 1OC5A 2XG9A 1KM6A 2PDUA 1NARA 3DFHA 3LLXA 4KMQA 4U5KA 1RCOB 5LNSA 1OCNA 2WVSA 2CESA 3NTYA 1WA3A 2QJMA 4KETA 4A05A 3P8JA 1ZNNA 5FJJA 4ADSA 2OXNA 3LLFA 3WN6A 2BGNE 3QW3A 1UMLA 2A5HA 3U2OA 1LRQA 1RBLA 4F9DA 2VI0A 2ZDSA 4KT2A 2PC4A 4IQEA 5CSRA 1I0DA 1SJBA 4C6IA 2Y5EA 1GTHA 1O60A 3O15A 4MWAD 5D37A 2BODX 3R5EA 4KRUA 2VCAA 3H4GA 5IHRA 4GGBA 4GYPA 3FXYA 4PMDA 1FWDC 2X1RA 4AISA 1ISWA 2RAGA 4EAYA 3GK0A 3DHPA 2QJIA 2PGFA 4EIVA 2J7EA 1RD6A 2FFCA 4GVHA 1ML1A 2Y7DA 3LRMA 4EF9A 1WZLA 1K8XA 2A4AA 5EY5A 1A5SA 2PWUA 3VI2A 4C6MA 3IACA 2I9EA 2WWCA 4QCFA 4XK2A 4WDUA 3TDFA 1E15A 3T40A 3O6CA 3TC3A 2GJLA 4D6DA 3EWBX 1B3XA 1XLEA 1SO5A 1RPXA 2X1IA 4GD0A 2O55A 4HPNA 4O52A 1U33A 3NQFA 4QQ3A 3WDPP 3BVJA 4JAWA 2XIBA 3F7JA 3VD5A 2X7VA 4N4PA 3M64A 3NQDA 4WJ8A 2P1FA 2XN2A 4J2PA 4WSKA 4B5UA 1I2OA 1H2JA 3N13A 3F4WA 2YCJA 1FP9A 2A7PA 3I7SA 2WMKA 3KWXA 4H3DA 1QVBA 1H5VA 3IAPA 4XUYA 3NDZA 3O6DA 4LVGA 3V3WA 5KINA 2YL5A 3TJXA 1SW0A 2JFEX 2YDAA 3GU9A 3GX9A 1Q6QA 3TW7A 3JUGA 4GY1A 3IWPA 2WWDA 3CAQA 3E02A 4A8IA 4HA4A 3SAZA 1XQKA 4XQ6A 1XFCA 4CD8A 4GQQA 2WQDA 3GC4A 1TE1A 1EWEA 3TW6A 1M7OA 4FI4A 2CIPA 1SM9A 3AYTA 4C6OA 2BXYA 3RXZA 3LM3A 1DWAM 2DQXA 4PTMA 3FSUA 3H70A 3OGVA 5I07A 4JZ5A 3XIMA 3G5EA 4XZWA 3IJ9A 2X09A 1U1JA 4MWAC 1R85A 3QEZA 4E8DA 1W9UA 3IGUA 3AS1A 1SMDA 2R91A 3LBCA 5C9XA 4PTVA 1ZU8A 3ARSA 2CZFA 2WZTA 3A4AA 3FJ4A 3W1UA 5IFPA 5CGQA 1A5UA 3C5QA 5D9NA 1AQFA 3H7RA 3MZNA 2XTKA 4MOZA 3LCHA 1XSIA 5KZDA 1FRBA 3W2KA 4ACYA 4EWJA 3QY8A 3NQBA 2Z1KA 4LJ3A 4XVEA 3AXMA 1M03A 5AYXA 4FNUA 3NQVA 1CGUA 1ZJIA 3MHUA 4UR7A 4XZLX 1R87A 1H61A 3TQPA 3EKLA 5EMKA 2XH4A 3A13A 2DZSA 2OOFA 4XAZA 3QY7A 4XKYA 3JW7A 2EGZA 3DGRA 4R33A 5BXPA 2OZ8A 2EEXA 1R2SA 1TV3A 2FVMA 2I5IA 1V3LA 1UKOA 2DSWA 4S3AA 4H9MA 2CZVA 1TG7A 4U31A 2X1UA 2G95A 3ZM8A 1W6TA 3A22A 5FD0A 3GKAA 4IGHA 1FCVA 1AW2A 3LRKA 1JYVA 5HINA 5F4SA 3N2XA 4N6EA 3VOFA 2CYGA 5E1QA 2C16A 1DBTA 3LEPA 3KM8A 4GABA 3ARWA 1A80A 1OFEA 2HRWA 3F2BA 4ML4A 3CS2A 5FCZA 3JRKA 3P80A 1UD8A 1NQKA 3UWUA 2YCLA 4GNJA 4JR5A 5CZ0A 2XJ7A 5HK4A 1NDWA 1IE7C 2Y0FA 3PSWA 3T0AA 4LUJA 5I09A 2WMFA 1X7IA 2DW7A 1G4EA 1I2PA 1XP3A 3G0XA 3NQ6A 2VELA 8RUCA 1CGVA 4S3EA 1JFXA 2E09A 2YXOA 3PPHA 1ZS2A 4IMCA 2Z2AA 5GJNA 3CQ0A 3I3BA 4W8BA 3AIBA 4DXVA 3I6TA 4CQCA 4ZCWA 3MYPA 3WLTA 3L12A 4ENLA 4CU8A 1TO3A 2DU2A 1FH9A 2WPGA 3VIHA 3KHJA 1K4GA 3FJLA 1I4NA 3MB9A 1W1IE 3LY0A 4N2YA 3STFA 1K77A 3KP0A 1EP3A 1US2A 2CEQA 3ARYA 2UV8G 3VE9A 1TWSA 2D0HA 3IEBA 5K3VA 4N0RA 1NH6A 2P76A 3Q67A 1R3TA 4NI8A 3F4VA 4Q7BA 3T4CA 3WQPA 5K7JA 4DPQA 2QJJA 3BE7A 2P88A 4IH3A 4P61A 3QHOA 3ITVA 2D24A 3MWCA 1GVIA 4PMRA 3VGDA 4O18A 3AYVA 3RITA 4LVFA 4BQ4A 1F6KA 2QJHA 3VOJA 4AY8A 1KBLA 1EF3A 1GNXA 3BH4A 2A3EA 3D3AA 3AMGA 1BXBA 1AFSA 2H3BA 2VFEA 4IXHA 3GS6A 4NZ4A 1A50A 4U28A 3WD0A 5DF0A 2EQDA 4IP7A 4KFOA 1AH0A 4IFOA 4CQDA 3KBSA 3CM4A 4G5DA 3TX9A 4PB5A 1R5YA 3L4ZA 1TZZA 2OWCA 7REQA 5AZ0A 1V3HA 3AUOA 1UCWA 4F3HA 1Q6EA 2F38A 2WMIA 1C3FA 4UZUA 5D2XA 3R8GA 3V5OA 3GXTA 1POKA 1F3WA 4L65A 2DUZA 3CHVA 4C6NA 3S1VA 3TLQA 3TWBA 3NO1A 1O68A 2PAJA 4LS1A 2VFDA 5BXSA 5REQB 2DVTA 1TV8A 1L2UA 3N2TA 4RDYA 2X05A 4LBSA 2ICSA 5IFTA 2FDSA 2X8RA 5I0DA 4DB7A 3L65A 4J27A 3WCZA 2DDXA 2VFGA 2DIJA 4FHAA 3PPCA 2HNEA 5IHSA 1R30A 4UR8A 1BXCA 4ZMGA 5C9WA 1M7PA 4YTRA 3W2JA 3HF3A 3CV6A 3KOWA 1TWIA 1X8FA 4QXIA 3SCSA 2P53A 1LT8A 2VEPA 4O11A 2V5KA 3PJTA 3GKFA 3GXMA 4PYSA 1JL8A 1F73A 3M07A 1YLVA 3ZLFA 3BTNA 3II1A 3MUXA 2VD9A 1TWZA 5F2IA 4NHVA 2NSOA 2TYSA 4Z1BA 2ZICA 1AG1O 3ZWSA 1TE6A 2QJNA 1CWYA 4KGLA 1EUAA 4W84A 1OABA 1EOMA 4MKVA 4GCXA 1MQPA 4I6VA 3AHTA 3GNDA 2PTWA 4NJIA 5GNXA 4MNMA 2ESCA 4AC1X 1ISZA 4ILSA 3W1TA 1EJRC 4DO5A 2PBOA 2QIIA 5I6SA 1R3WA 4F2UA 4GQBA 3HM7A 4PUKA 3W7MA 1UUQA 3N9RA 3AXXA 1V93A 1HN1A 3OZMA 1NF0A 3EX3A 4LUSA 2J75A 3H6OA 1ZJHA 1H4PA 3CZKA 2QR6A 1EO7A 2ZRVA 4QAIA 1GJPA 1B5TA 2YFOA 1MXSA 2V69A 1X6NA 2GOUA 4GXWA 1MDLA 1XLLA 1VJIA 3SCUA 4LY4A 3WK0A 3GDBA 1E71M 3WY1A 4M0XA 3F1QA 1E3XA 1TV5A 3EB2A 1MYRA 3HQOA 4LANA 1W9DM 3KRBA 2WSRA 2H6RA 3WQWA 4E2BA 3DFYA 4AHOA 1GYLA 7TIMA 4U33A 1MW1A 2G3JA 2O0TA 1K9FA 2WK2A 3LV6A 3OO2A 1LBMA 2DUAA 1KKOA 1J5SA 1B9ZA 2Z6JA 3M0KA 3MU7A 4JS3A 3C2VA 1J0JA 4JFTA 1Z9AA 2R1KA 3SRKA 4FOUA 3WLJA 2BX7A 4BQ5A 4FK9A 2FZMA 4GUIA 1JPKA 4LEFA 3UGVA 2JGQA 4MUPA 4JTCA 4IMAA 4HVXA 1MZHA 2WW5A 3A3WA 1UYQA 3WG6A 1WCGA 5I24A 1PHQA 4H1ZA 4MFEA 2CWNA 3AIEA 1OBAA 2PDFA 2JF6A 1YDOA 4G1NA 3RPDA 1YTKA 1ZRQA 1BQCA 2HJPA 5DMNA 1DXEA 2ISVA 2VWTA 1FKWA 4DZAA 3V35A 3DC8A 3OP2A 3AISA 1BTCA 3W4RA 2ZXAA 1E0UA 2WZIA 1REQB 3ABZA 3URAA 4O1DA 2HK1A 1RBOB 1W8SA 2OELA 3VKKA 1CXFA 3VGBA 2IW0A 4ICNA 5L6UA 3RU8X 3UG4A 4H6KA 3PJWA 1OJXA 1ITQA 2QCDB 1ME9A 2CW6A 5DXYA 3BG9A 2EJAA 1DJHA 1F8MA 2Y7FA 3R89A 2JE8A 2ZZ2A 5I00A 5DT7A 4N7QA 1ZBCA 2ZFAA 1BPLB 3AS2A 1OFDA 1IR2A 3HJZA 4WKHA 4FSAA 4CCEA 3GDKA 2PLKA 1K4HA 3H7VA 1OHLA 4DJEA 3VDAA 1VIWA 5HQLA 1OCJA 3EX1A 3ZSSA 3VD3A 1PAMA 2OWXA 5HUPA 5FOOA 4IL0A 3RMEA 4HPJA 5GPRA 4KIRA 2OGJA 4JTEA 3MVTA 2BASA 5JXQA 2VUYA 6A3HA 2A3HA 1LTDA 4FR1A 1JIBA 1XLBA 2J66A 1P7TA 5LA0A 4JHZA 3HFYA 2IMRA 3VD7A 3ERPA 4YWSA 2BP1A 3G2GA 3LM7A 1JRCA 1BVZA 1B9BA 1XIBA 4B2DA 1F8IA 4YVXA 4E6MA 3U2EA 1KTBA 2VR2A 5EGRA 3EZ4A 1GVFA 4UR9A 4AIBA 1ZBWA 2E28A 4YL2A 4KRTA 3TYEA 3LXCA 3C56A 5BOOA 4GY7A 1H7RA 1D7FA 1XISA 1Q6RA 3UERA 2ZCGA 3QGVA 2NWRA 3H22A 2WB5A 3H2CA 4P8VA 4K3ZA 1MFUA 4LVDA 4UQBA 4ZB0A 1SYTA 3C2RA 1C8QA 3NL6A 3KVLA 4WDWA 2CU0A 2BHUA 3H21A 1BF2A 3AMCA 2GVJA 2QPSA 4GE8A 1K9EA 4O1FA 4WX2A 1FQ0A 1XF0A 1GVSA 1C8YA 3AIVA 3T05A 4AZGA 3UGRA 4DAFA 3PPFA 4RNJA 3N6JA 3TMLA 3RN6A 1EIBA 3O9NA 3O07A 3RILA 4ZODA 4WXYA 4C7GA 4MADA 4FS9A 2FVLA 4IUOA 4MZ1A 1XCFA 4WCJA 3T8LA 4AC7C 1H1YA 1YEYA 3B3DA 3E5PA 1Q6DA 3DKJA 4V2XA 2I1OA 1PE1A 3K4AA 1Q2SA 3MUAA 1WKFA 3EWWA 1BSLA 1JCLA 3TTYA 4FF7A 3UXDA 3V75A 1XBVA 2NSXA 2G3NA 1I1XA 3W7IA 1GGOA 4R7JA 3W7CA 1KNWA 2VT0A 3S9IA 2CZ5A 1VB9A 2YB1A 1UKQA 4BR1A 3CZGA 4QG8A 1PWLA 3WKZA 4XAYA 1JD7A 2A3BA 3BMXA 5HNRA 1XS2A 3EMQA 4H83A 4Z2LA 2HCVA 3B4UA 3LLDA 3W76A 2WHMA 4LRSA 4B4HA 5B7YA 3KTSA 2QMJA 1YX1A 4D72A 4B5XA 4W9TA 1WO2A 4A3QA 2X0YA 3NM1A 4QSFA 4EVZA 5AHNA 3SCOA 3HTWA 4A22A 2ACQA 1T40A 3BJTA 1XC4A 1V6TA 1KFBA 3W6MA 1MFVA 4LTSA 4OZOA 1OG0A 4HIBA 4DUVA 1BG4A 3M43A 1UB3A 3AUJA 3T55A 1UP0A 1V4YA 2AL2B 4O17A 2BVTA 3WNLA 1WYIA 3PNUA 4JTDA 4R9XA 5DELA 2VEMA 5GQBA 1GHSA 4GO8A 3LSBA 5F2GA 2O4MA 4WLCA 2BV9A 2VJXA 4LCSA 4QBXA 4PCNA 1RCQA 1P5BA 3B0PA 1J12A 2ZE0A 3KVKA 4M7SA 4RZ4A 3PWGA 3V36A 2P3ZA 2I16A 4AZ7A 5DEZA 2J7BA 5DMLA 1AZ1A 3RU6A 4CU6A 1SQ7A 1HL2A 3BLLA 3NQMA 3PZUA 3IK4A 4QG9A 4JTLA 4OGZA 1PBGA 1YBQA 3ANYA 5D30A 1EYWA 1OADA 1S1PA 2YW3A 3GY1A 1TMLA 3APGA 3UFYA 4B92A 4IIFA 1NAL1 2YL6A 3GBDA 1QBBA 1Y5WA 1JCTA 1XRTA 2J47A 5C5YA 2XH7A 2OU4A 3E0IA 3LK6A 4H9TA 5IBXC 3EA2A 1XINA 4HSNA 1UHVA 2PF8A 1JJKA 4GC3A 4NF7A 2E1DA 5FJOA 3STGA 2PDJA 2E67A 3DX5A 5KZMA 3WL0A 4W86A 2XN1A 3OG3A 3CZEA 1OGGA 3B06A 3G1RA 3N25A 3GU1A 2ZA1A 3LMZA 5T8GA 1XLCA 2XGBA 2AKZA 3VNKA 1F3XA 1R9XA 3M0YA 4DNHA 4IM4A 3R7MA 3W7JA 1IHIA 5FACA 4BQ2A 5MHBA 1SJAA 3GG8A 3KL3A 5CPTA 3I10A 1AODA 3AJXA 3O6AA 3GW0A 2AOSA 3KL5A 2QKFA 1E1FA 1W2PA 2W5FA 4AVOA 2V81A 2J24A 2ISDA 3SY1A 2NLIA 4J5NA 2BOGX 1QPNA 1FWBC 4IIBA 2GK1A 3W7EA 4MDPA 4I7VA 4DAIA 3P6LA 1E5JA 3G1SA 3MTWA 4UBPC 4LBRA 2V82A 4GKLA 2VVSA 4LC6A 1XUUA 4NAEA 5CLTA 1RY8A 1NDYA 5C6MA 4UOZA 2XM2A 3CUIA 5D9MA 1K3UA 5MKGA 4ACZA 2YXXA 2UY2A 3C2FA 2VZSA 1FVPA 5JBDA 4IMEA 3S5YA 3OJGA 4O13A 2C1HA 1VFTA 1E1EA 4TU1A 1P0EA 3CL7A 4JGDA 3VC6A 2O9OA 4RDZA 4UTUA 4U2ZA 2CERA 2F6KA 2HE5A 1BD0A 1T99A 3C3NA 2BWGA 1AVAA 4NILA 3W81A 2RFGA 4XBKA 4PBGA 3WQ4A 1O5RA 2AKMA 4W8LA 2WZEA 2ZA3A 3GTHA 2ZIDA 5FSEC 4HA1A 1J5TA 1K8ZA 3GH7A 4M81A 3RLUA 1JDCA 1JQXA 2J7FA 4HCDA 2QIWA 2C18A 2BB0A 4R5EA 2Z1VA 3R10A 1RHCA 3OIHA 1ZTVA 2G3IA 2FPTA 3PG8A 1P0BA 3BUVA 5CAKA 2EPKX 1S46A 1JDFA 1JGIA 2B31A 5ABHA 4WR3A 3N19B 3MZ2A 2GJRA 3A23A 5G2HA 3DFNA 1OWQA 2YB4A 3BCJA 5HOSA 2Y4SA 4IX0A 3MS8A 1KV5A 4GOAA 1DPMA 1JQVA 1YXCA 3QMSA 4RZ5A 4MZ8A 1ICSA 5SWUA 2VM8A 1RD5A 3R13A 2A1YA 3UG8A 4HU8A 3K8MA 2FZNA 3SN0A 4AHQA 1MW0A 3MT1A 4ZO9A 1HF6A 3CEUA 3UZYA 2ZYFA 3TNOA 2VFHA 1E56A 1UZHA 3HGRA 1NQ6A 1R7AA 1RSCA 1UD4A 1FWCC 2NX3A 1EJWC 1WB0A 5ECVA 3CJPA 4S3KA 3TP4A 4R53A 1UD6A 5A6AA 3TYUA 1XBYA 2ALDA 3BC9A 2GUBA 3QLDA 3HFTA 4Q7IA 4CCDA 2HS8A 4XSMA 4O8RA 4HGXA 4IJRA 4UCFA 5B80A 1E3ZA 2YDSA 4S2CA 1C9DA 4LFYA 1VEMA 1ECQA 1YNQA 3HJEA 4Q6XA 2YDRA 2DPEA 1WKYA 3W70A 2PP1A 3DHDA 2CLLA 1XLMA 9XIMA 2ZXQA 1UC4A 3K2GA 1CGWA 3SN4A 3NL5A 3SEPA 2IPJA 5LIKX 3EXSA 3THDA 1R3RA 3AHYA 3P8IA 2BSLA 1J96A 4KF1A 1F61A 1K9TA 2ZX6A 2ZTKA 4M7TA 4RX0A 3JR2A 4L9ZA 3PZNA 4R34A 5EBAA 4ZQCA 5TF0A 1EO5A 4HMNA 5HMDA 3GXNA 3Q58A 1PYFA 4LSBA 5FESA 3UXAA 1KTNA 4UTKA 2P0IA 1EXPA 3CUFA 1XGEA 1JFHA 1FCBA 4HCHA 4A3UA 1XKJA 4RUBA 1W3LA 4M6UA 3VDBA 2ZE3A 5I77A 4W4QA 1M65A 4OVXA 2O9RA 1U5JA 2VO5A 2HISA 3RLVA 3C2YA 4NNCA 3PSVA 2QGHA 3UJSA 2FQIA 3TW9A 1ZALA 3C52A 3KTXA 3DOPA 4PCFA 3CHEA 1CLVA 1GT8A 2FGBA 1A47A 2YKKA 3PULA 3T42A 4DJEC 1T41A 2OPJA 3GNNA 1IXQA 1J01A 1GOXA 3W6LA 3NVDA 6ALDA 3AHXA 3SCPA 5DXXA 1G4SA 3MSDA 4EXBA 4PMYA 4AX6A 3T8QA 3FS2A 5A69A 2E0PA 1NOWA 3GUGA 2HXUA 3BAYA 1A3WA 3UD6A 3VO0A 3G3DA 4FXJA 4QSHA 2PTDA 1TTQA 1UJQA 3HN3A 2QAPA 2QMKA 3HPFA 5D4YA 3O3RA 1KM4A 2PEVA 4ZOAA 3G1AA 1BXNA 1RK5A 6XIAA 1VCGA 2XFWA 4Q4KA 1QBAA 1BHGA 5DRCA 5AFDA 2XFYA 3C61A 1E9LA 4IZGA 3W1AA 4QEEA 2NQLA 3ABRA 3WK2A 1VCFA 4AEOA 1CXHA 3D46A 5CZTA 2J9ZA 3GNRA 4RDVA 4JQ2A 1QUMA 1M3UA 4LYQA 3CMFA 2BY3A 1AJ2A 5EMYA 4JN7A 3QXBA 4DI9A 3RCYA 1LL7A 3KZPA 4HNLA 3PB0A 3BLDA 1JD9A 2X42A 2GK1B 1RPKA 1V6VA 3BSHA 3UW6A 4B16A 3P5ZA 2HV5A 3KDOA 1OK6A 5I23A 4M82A 4PL1A 4RW5A 4XZNX 1UP3A 3IK2A 1JVNA 4AMCA 3CYJA 1PWMA 2WANA 4ZQNA 1C90A 5HULA 1U5VA 4B15A 1E1CA 5E6ZA 3WQCA 1Z6KA 1Z89A 1XD0A 2HWGA 4QR6A 2VZTA 4XTDA 5BNKA 2HK0A 5HJLA 3BW4A 2BDQA 4DJDC 3DIPA 3SQLA 4N9CA 4J3XA 2PDIA 4L7ZA 2HVOA 4AUBA 2QHAA 3LHZA 4MAZA 3BJSA 3IJ7A 3KUMA 1OINA 4IUGA 3O0KA 3P7YA 1KFEA 4H8NA 3R0KA 4H7VA 1A5CA 5FAGA 1TV4A 4KCVA 1K6AA 2X0SA 1VFOA 3CIVA 4PCTA 1KRAC 4PUNA 4JOMA 5BRQA 4O50A 1VS1A 1DJZA 1Q6OA 4C6QA 5A2BA 2YBTA 3WBEA 1F5ZA 4L6OA 3WQFA 3NCOA 1UP2A 3L4UA 3BURA 2IPFA 1NFBA 1TTJA 2OT1A 5FJRA 5HQMA 4LXFA 4ZR8A 1HZYA 2QGYA 2CWXA 5A2AA 1VBGA 3CHDA 1AQMA 4PMQA 1WX0A 3S2NA 4WQ6A 2FIQA 5F1VA 5AC6A 4A35A 3PNZA 4PZVA 4V33A 1ESWA 1R47A 3T2PA 5JH2A 4HK5A 1GW1A 3B40A 2OYLA 3P2VA 5ABFB 4IPJA 1BEUA 3B8IA 1PO9A 4MGGA 1W5OA 2Y7GA 3N6QA 2XWEA 4QJ5B 4X3ZA 2VEFA 4KKXA 1SZNA 2REQA 2BG5A 1PKYA 3NL2A 2DW6A 5BYWA 4DM1A 2OLHA 1EDTA 1QO2A 4XIAA 3ZOAA 4N02A 4RW3A 4ZEPA 3QQ1A 4CNNA 3WBAA 1HFBA 5AKQA 3TWAA 3E0VA 4GJIA 4DJDA 4F2TA 3SUWA 3L2LA 1X6UA 4J1OA 1FH8A 3GTNA 2Z29A 2CBVA 5AYZA 1XRSA 2YCEA 3GTFA 1TIWA 3AROA 3DAQA 2ZXBA 2CLPA 3BMWA 4C5ZA 1GVOA 4MNKA 3WQ6A 4D6GA 2XZ7A 2DH2A 4F0SA 3L4WA 1JZ6A 1Y65A 3T78A 5M1TA 4BWLC 3AHVA 1C7TA 4IX2A 3LB0A 3B4YA 4HOZA 4L1WA 1BKHA 1W5MA 5HBFA 2J9YA 4UTWA 4GIRA 4MTVA 1EUNA 1FKXA 2TPSA 2YL8A 4MB4A 3EWDA 3QC3A 4UFHA 1S1RA 1ZHAA 3OA3A 2Z27A 4OBSA 3H26A 3RM8A 3WL1A 3HPZA 4IPLA 1J18A 5G1MA 2QCHA 1ZCOA 1ONWA 4LPCA 2JIEA 3W86A 3V0SA 1SW7A 3KWSA 4IPIA 1P0KA 3E1F1 3VIMA 4GZIA 3TQVA 4TXEA 4PUUA 5DCBA 1DJNA 1GK8A 4WOQA 3R58A 1OD0A 1W3IA 3R94A 4C6JA 3T08A 3URQA 2ZZ3A 4K6AA 2OVLA 4UMCA 3TYDA 4DF0A 3O63A 2DJXA 1W9PA 1DIOA 4GVIA 3POCA 4MJMA 1V51A 3V0TA 3U7BA 2WJEA 1JF5A 5BU6A 1XV8A 2YLLA 2WJZA 1O1HA 3JU2A 4Z2IA 2UBPC 1ISXA 3EWXA 1M9HA 1F07A 3L4TA 3PG9A 4HSOA 2J27A 1IQ8A 3KVMA 2ZVRA 3U2CA 5CC3A 4P8XA 3SUVA 1QI4A 4DWSA 2PLMA 3UPBA 3GHRA 4NJJA 3DXIA 1QW9A 4CGTA 4LAOA 4NUWA 1UIOA 3FFSA 2Q71A 4O15A 3G77A 3M7SA 1SZRA 3I7RA 4N9EA 4Y9MA 1UROA 3CK5A 1J9YA 1EJSC 5D32A 2GFTA 3V1PA 3DCPA 2XH2A 1W9XA 2YZRA 2VGBA 3OBKA 4D6HA 1HJSA 2VOTA 4PEKA 5CKSA 4C90A 1QR7A 3R43A 2D2HA 4KWWA 4L6HA 4EPBC 2GYIA 1VBJA 1YMYA 2IQTA 1SO4A 3VDCA 3LCGA 5XIAA 4ZVJA 2TODA 2CETA 2PB1A 2H3DA 1W5QA 1E9IA 1E73M 3C0LA 3ITLA 2CXEA 5KETA 3WQ5A 1UA7A 3FIGA 2OX1A 1TVLA 3T2QA 2FVKA 1TJ0A 2HXTA 3DERA 3ITGA 5I3FA 1DIEA 2VEGA 3PTDA 4C1NB 3SDOA 5DX7A 3H54A 1A0DA 2ATMA 3GWQA 3S83A 3WDIA 3KCLA 1EOKA 3QM3A 4HJWA 3CZJA 4IJBA 3G22A 1KKRA 2EPNA 2RJHA 3F4CA 2PRMA 3CL8A 4J35A 1LJYA 1JZ8A 4JTHA 3ARRA 3ES8A 4BY3A 2OLAA 3ABSA 1H0GA 2Z1BA 1NU5A 2B4GA 3CAWA 2YA1A 4TTGA 1G9HA 3MHFA 2ZX7A 4YYFA 2OODA 4TO8A 3PVFA 3DENA 3EWCA 5FF0A 1KFWA 3HGSA 3LCIA 2GGGA 1OK4A 1JYNA 3QPEA 3WK3A 2XINA 2PDWA 5CLWA 2Y85A 4Q32A 3UF9A 1CXIA 3WEOA 1HKIA 4LUSB 3L2IA 5A5WA 1XD1A 4XZHA 1KXHA 3TN6A 2AGTA 1B30A 1HKMA 4DBDA 3KOZA 4YTSA 1QPRA 3QOMA 4Q3MA 2BY0A 4CU7A 1P6WA 3C4UA 4R7WA 1W0MA 1E6PA 4MWAE 4H41A 4JEJA 4JFWA 1IV8A 2PZNA 2QZRA 3GR4A 3SI9A 4HBKA 4E4UA 3RNDA 1R3SA 1KBIA 2EG7A 4GO9A 5BRPA 3LOTA 3RPMA 3UT0A 4NX5A 4HYWA 4XD4A 1AD1A 4DYEA 1BTMA 5G4HC 1DE5A 2BLEA 4L61A 5DCEA 2ZZ6A 1JUBA 1S2WA 2CBUA 3V7PA 4LYPA 3C0SA 4GIYA 1ELSA 1CB2A 4C91A 3OLEA 4AYGA 3MMWA 3GTIA 2E1WA 1OFOA 1UH3A 4WVXA 3ZO9A 3NO5A 4XKYB 4A6GA 4BWLA 1MI3A 3PUOA 4DXXA 1EZWA 5HWJA 3RX4A 3SGZA 3G0UA 1PJ9A 3ALGA 3WH9A 3BK0A 1TR9A 1GYNA 3OLGA 3L7RA 3TUUA 1B4EA 3PBVA 1KXVA 3I3DA 4NZ3A 3H23A 3BLEA 3HURA 4AH7A 1HKVA 3NEHA 3DYPA 2R1NA 2YXGA 4WD0A 4DY1A 1LOSA 4H7CA 2GDUA 3EMCA 1VPXA 4MY8A 3RG6A 3SSZA 4X63A 1J0YA 4P7QA 3NVTA 3CZLA 1OYAA 3IVUA 4PMUA 1XFBA 3N11A 5EA9A 2FHCA 5KEZA 4JX5A 3FSTA 4DBUA 3JS3A 3UJFA 3I6RA 1CNVA 3OHMB 3WDQA 1BAGA 2C0HA 8XIAA 4DN1A 4DYJA 3CT2A 3VNYA 1C92A 3B04A 2NLYA 1AMYA 2B81A 1UUMA 1E5NA 2QJGA 4C1LA 3W2LA 4GINA 4JKLA 4QJ4B 2FTYA 3URBA 2QCEA 2HPIA 3CUJA 5FEPA 4LF2A 1H7WA 1E4NA 3KS5A 1LBLA 4MYAA 1JAEA 4US5D 3QW4B 4M6PA 2J6XA 3ZMRA 2QVNA 2RDUA 4M5PA 4CQAA 1KBKA 3WFLA 2YCKX 4B9YA 1QOPA 5HR6A 4AVFA 2Q8XA 1CLKA 4I5XA 5A6BD 3L4YA 5D2YA 1RVGA 4C6BA 4W5ZA 4A3RA 4PBEA 4ZFCA 4AIEA 4I3GA 1MO0A 5JBEA 5T91A 1GZ1A 1Y5VA 1GOWA 2FZBA 1QWKA 4Z0SA 4WF7A 1JUKA 2ATSA 3D5HA 3WBYA 4F40A 1H11A 5FAJA 3TLLA 3LSCA 4YU1A 3FLUA 2QDHA 1RLDA 4H8UA 4US5A 3UJRA 3AWNA 3DDMA 3PBUA 3G18A 1CTNA 3ANUA 4UTHA 4TMCA 4YHEA 2A7RA 1UD5A 3HU7A 4F0LA 2IKGA 4PR4A 1H0IA 4I7WA 4ZO6A 1FFRA 3M6YA 4P7OA 3WLSA 3RYSA 1C29A 1XYFA 2NXHA 2ZWYA 1M7XA 3RX3A 1KGWA 4LX4A 3LTPA 1EP2A 3MSRA 4NASA 1DHPA 2VURA 4L56A 3EYPA 4DRSA 3EPMA 1EJXC 2BY2A 2WNQA 7PTDA 4IISA 1IXNA 3VPLA 4QJ1A 2V5BA 3ARQA 3Q94A 4QP0A 1LL4A 4JTIA 1QJWA 1ONXA 4G2DA 1QI2A 3B9NA 4HNUA 1NELA 3IAQA 5D03A 4C65A 4TV6A 1O4UA 2Q09A 4XAPA 4GG9A 1QO5A 3CBWA 1W3HA 4HSHA 1BVNP 2W6RA 2R24A 4X60A 3ITXA 4S3CA 4JYEA 2O7SA 4W89A 5A6TC 2WCAA 5DY2A 4V27A 3M5VA 1W91A 5B7ZA 5C71A 1J0ZA 3TSDA 3QSRA 4KWSA 4LAZA 3FEQA 2ALRA 4CD4A 1Y8BA 4YMZA 2R1MA 3NURA 3OBAA 3RR1A 3TSBA 2W61A 5A8MA 2XYLA 4D8AA 1WAUA 1OY0A 4YS1A 3QPZA 3IIVA 3MKKA 3S6DA 1HQTA 1YNPA 1F3TA 3NPWA 4W85A 2FYMA 3WD2A 1JR1A 1HKKA 3FYPA 4O1BA 1UC5A 4L4MA 2C79A 2ZOXA 3MKVA 3LHWA 2PSNA 3EPOA 2UY4A 4GI6A 1MEIA 5D33A 1O94A 2OGYA 3OVRA 2VFFA 3UZXA 2ZUWA 5DMMA 4KBXA 2P8BA 5AYIA 4S1FA 4ZQRA 2DZTA 2XZ9A 4DUOA 2VOMA 4Q4QA 4AB4A 1MMFA 5EFFA 4WSJA 2JK2A 2ZZ7A 2Y61A 4GZ7A 3THUA 1JEZA 3IJQA 4IIDA 3OEXA 3PB2A 2PZ0A 4ZTYA 5KZ6A 1FWWA 3WJZA 3HQ1A 1DJQA 2CHRA 2OKOA 3GXFA 4PMOA 3N6HA 2CLKA 1MQQA 4ICCX 7XIMA 2WNNA 4F0HA 3FY1A 4GHRA 3ZJ8A 2FZDA 4K68A 1KD0A 4FLSA 4AWUA 3ELFA 1J0KA 3A9IA 3IGHX 4HZ8A 3QJAA 5JMUA 4QE1A 2YYUA 2V0TA 4LF1A 1SUXA 3R0UA 4OECA 1OFPA 4S23A 1S2AA 4UTTC 3PZOA 3SCQA 3AYRA 4HNVA 3VKAA 3A4XA 2Y8VA 3CUZA 2VX6A 3ARUA 3A5VA 4WKFA 1ZP4A 2ZUMA 3SFKA 1JPDX 3VC5A 1W2VA 1JNDA 3TTQA 3CGTA 4ORIA 3B05A 1H09A 2PGEA 2PRHA 3VOGA 2VUNA 5CXPA 1KFJA 1GZGA 2I14A 5JUVA 1KBBA 1UOZA 1T5AA 4W7VA 3BAKA 2EPOA 1J10A 4Q4SA 3N9SA 1WDDA 2XVKA 1FBAA 4UFMA 3N15A 2V9DA 1XCXA 3WUFA 4B2DD 5LXEA 3UQNA 1B0IA 1LZOA 1KRBC 1R86A 4LUIA 1XIEA 2A7NA 5E0FA 1N55A 1IT7A 5D8ZA 1XYMA 3NA8A 1DXFA 3PUDA 4QDPA 3VOIA 4HPXA 5I3HA 5C9UA 1OSEA 1HJWA 3NWRA 4AX7A 4G7EB 4JQ1A 4HK7A 3G6LA 1E9ZB 3VIGA 3WQDA 3O6YX 2OFJA 4EF8A 2OMAA 2OO0A 1VFUA 1F4AA 2EHHA 2WMIB 3N4EA 3S9ZA 3RCMA 1PDZA 4DLMA 3C8FA 3IJLA 3V0UA 5IBXA 1HUVA 3PFMA 2DZVA 3N18A 4JTSA 4LB4A 4S3FA 2VP8A 5CPOA 2OZTA 2G97A 4FEZA 3ANVA 3K46A 2G3FA 1RJQA 3MO4A 3W07A 1XR2A 2ONEA 3VDGA 5DLCA 4QISA 4NXSA 3DKLA 3IGSA 3DU0A 3PZGA 1XLIA 5D2VA 2WHLA 1FCQA 2H9AA 3N29A 1PZ2A 1WDSA 1ZJAA 4QQUA 4UQ9A 1GVEA 3CT7A 1R0MA 5I3GA 3Q65A 3W88A 4UFKA 8A3HA 4FNPA 3PZIA 1LOLA 3SQMA 1GQJA 2CFFA 3MJYA 1V08A 2W0UA 2PWHA 4KERA 4H9VA 1KGXA 2XISA 3QV7A 3P5YA 1AL7A 2PWEA 3TR2A 2RH9A 4W87A 1L6SA 1FFQA 2XSXA 2OT0A 1US3A 4PCSA 5TAOA 3EB3A 3KBVA 4DBWA 3W28A 4HPHA 1VBUA 3NZPA 4KFPA 1C7SA 5MKGB 1V0NA 2J78A 2J7DA 5K4XA 2GOKA 4PUDA 1XXXA 4Y8EA 5KTLA 5J8LA 4NAEB 3CQIA 4CQBA 2FB3A 1TFVA 1D3GA 2Z28A 4KEZA 1VKFA 5E6YA 4M24A 2E5CA 1EF2A 1K7XA 4O0KA 1E70M 3E0LA 1G7VA 2YW4A 4C6DA 2Q3RA 5HA7A 4BEQA 2RJGA 2YA2A 1T8XA 3DBNA 3UPMA 1U2YA 2VX4A 5G5IA 5CSUA 4E4FA 1PSCA 4L4OA 3GC5A 1PVNA 4JTQA 1O12A 4B5NA 1RAKA 2QT3A 1F4HA 5CSYA 3WENA 3PC0A 3LNPA 3TC7A 4MB1A 5K2ZA 4MM1A 1PHWA 4FNSA 1YPIA 1SR0A 3RRXA 5AHLA 1W56A 1AJZA 3IJ6A 4QDWA 5MF5A 3GZ3A 1XLGA 4E2DA 1FXQA 4CN1A 3W29A 3A9BA 3NQ7A 4TVUA 3OYZA 4HA3A 1JDEA 5AY7A 4TUFA 1UWRA 1TPC1 3UCQA 3HPAA 3WUBA 4H2CA 1M5WA 2VQTA 4IJCA 4KGJA 1DKWA 4RKAA 3V1HA 4LB3A 4JEQA 2XIJA 5BMXA 1WNOA 2PE4A 1HO4A 4P7LA 1TQXA 5G1YA 4BA0A 5D8WA 1HVXA 3SIZA 4CUCA 3H24A 3UZWA 1BKSA 2DY3A 4YN5A 4D6IA 3NPXA 4J3SA 2EKCA 2FZ8A 1XICA 1WXZA 2EBNA 3B8SA 3IS4A 4MIMA 3QH2A 2JBMA 1GWJA 2Q02A 2HBVA 4LALA 4UQCA 1H63A 2ISSA 2VDHA 2WSYA 3N04A 1ITUA 1L6FA 2QEZA 3CH0A 3MUZ1 3YPIA 4BS0A 3DFQA 3ARTA 1WKEA 4N4QA 1XC6A 1VENA 3E74A 4UMAA 3F5LA 1VIZA 3CQKA 4ERAA 6ENLA 3VNLA 3WH6A 3BAIA 3HG2A 3OW1A 1JCMP 3EB4A 4XBSA 3WD1A 3G8EA 5HPOA 4GYPC 4H9ZA 3UJ2A 5LIUX 1YNYA 3M0HA 1HTIA 1A5LC 3ABQA 3RMJA 1M6JA 4KIEA 1GOQA 1VLIA 2KZHA 1FHLA 1S2TA 4H6QA 2HPMA 4Z0JA 4NL1A 1KC7A 4HYVA 1FHUA 2DUXA 2WMGA 2WSKA 3M41A 3WFZA 5EKYA 3WNMA 4H9XA 5A8QA 2DIKA 1Z7AA 2D2OA 1EGMA 4JTUA 4RE2A 1A5KC 4QLJA 1QASA 2WLYA 4QX4A 5D38A 1G6CA 3PTQA 1EX5A 4UTWC 4IMGA 3MV01 4GJJA 4CD6A 5BRBA 3BPWA 3CV2A 1Z32X 5C2GA 5LHFA 3TEVA 5U4NA 4LQ1A 3U5UA 2FJKA 5F4XA 3NPUA 4NAFB 2XM1A 3GDMA 3RM4A 1TVNA 3MQTA 2FGZA 2P3EA 3VCCA 1W17A 3VIPA 1R9ZA 5A2CA 3KTCA 2ISFA 2WKLA 3AIWA 2XHYA 4FAMA 3NL3A 1N82A 1RQBA 1UBPC 3T4WA 2QV4A 3C6CA 5CBIA 3APTA 1W32A 4XWUA 3TZNA 3PTMA 1VPQA 3GDRA 4TQTA 1ODZA 4G56A 1LDCA 1VAHA 3PZMA 4UQAA 4S3GA 3D6NA 4Z2GA 1JG9A 2XIMA 2Z7KA 1G7UA 1BWKA 1E51A 5E9XA 2AAMA 2YL9A 2POTA 3KHDA 3VA8A 1VCVA 2FKPA 3W1LA 2INZA 1JYXA 1N7KA 5D05A 3S8HA 3FYYA 3N1AA 4M3PA 2QQ6A 1KRCC 5DO8A 4IGMA 4UNKA 1C93A 4DQWA 1BWVA 1W3KA 4B9ZA 4ZOBA 1JXKA 4JTKA 3N2MA 5FEXA 3VU2A 3GFXA 4HNOA 1AL8A 4ZBCA 1LROA 1W1ZA 2ZADA 3TN4A 3RM9A 4RPQA 3KOYA 5JQ9A 2OSXA 3R8RA 1OF6A 2ZRWA 2J8GA 2KX9A 3FKRA 2PODA 4E3VA 4FLRA 3B9AA 4HKPA 4KH2A 3NQ8A 3B8VA 3AZTA 1J2WA 4GZEA 3GTXA 4BFAA 1XH0A 3UETA 3NXFA 4L4PA 3VZYA 3NQAA 1YYAA 4P7NA 3M5ZA 2E9LA 1VF8A 1H41A 3BQ6A 3G0SA 3TSMA 4ZB2A 3IV3A 2J4GA 3REQA 1H1ZA 3FYOA 3WH8A 4DYKA 4AFYA 3L4XA 2HVMA 3H53A 3B8WA 4AF0B 2WMJA 3HG4A 1TVPA 3P0WA 3UCCA 4V15A 4OFCA 3HQPA 1B2YA 1W1YA 1PS9A 3W71A 2V30A 4DWDA 1O6IA 3LHUA 2FPYA 3ATYA 3TFXA 3KBJA 3TVAA 1S2UA 3W6YA 1UR1A 1LT7A 2ZBTA 3THQA 2R8WA 4WHBA 4YTUA 3B8TA 3Q4DA 2YX0A 1JI2A 4MB3A 4XV0A 2A6LA 3ZLGA 3UR2A 2EJ1A 2OYMA 1OX6A 3O8AA 2H90A 4NU7A 4XAGA 2E4TA 3BARA 1AUSL 2PDLA 1V0MA 4JFVA 4K2SA 5FF3A 4HN4A 2R6OA 4PB3A 1UR9A 5HNNA 3UA3A 1DV7A 3VIFA 2OTDA 2Z25A 3UYIA 3WX7A 1P0NA 7A3HA 1EHAA 3QR1A 4Q4RA 4X61A 4CVUA 2PWFA 4XIMA 1NP0A 1H51A 4KWUA 5EFDA 3NYDA 3WDRA 3T0CA 3M0MA 2XDFA 4RXGA 1GONA 3NYZA 5HMEA 4L1GA 1DQUA 3WDJA 1Q85A 2VGIA 3SY5A 1EJUC 2RDXA 2FZ9A 3S1WA 4AWEA 3UG3A 1S5MA 1JZ5A 3EOLA 4WSHA 4O4VA 2FB2A 3N9KA 1CEOA 1Y7VA 1JCXA 1ADDA 5E9AA 4JQ3A 1D3HA 3A3XA 3B0VC 3WUGA 1B1YA 2BOEX 1M1BA 4IPPA 4MJ2A 3W1NA 3GD6A 4EACA 4Z1AA 3EOUA 1DTNA 2IKHA 3OVPA 1QRQA 3I6EA 3O0FA 4MFDA 1HJUA 3CASA 1H1NA 2CNCA 3TYCA 4IT1A 5DMYA 1V0KA 1IEQA 5LHEA 3GW3A 3BLIA 3MCMA 3CTLA 4AZCB 1QOQA 4EANA 9CGTA 3JZEA 3P14A 4Y9NA 3VKCA 3L0KA 3W72A 3LDVA 1WDQA 1UZDA 2IQDA 2PMQA 3KRSA 4A21A 4O0ZA 3MDUA 4IIGA 2PU1A 3G6MA 1Q7MA 1B3OA 3TAKA 3EKZA 4UXDA 1X6LA 1W5PA 4GQ0A 2PA6A 3SCNA 4MWAB 3AZRA 1UWUA 4RDWA 1OCQA 4D1IA 3QHNA 1MQRA 4ADTA 2RUSA 3AWOA 3S4TA 2ZRYA 1IWPA 1IIHA 4XX6A 1H7OA 4TV5A 5H8UA 4DJED 3CTTA 4CCCA 4C6LA 4KWOA 5LGZA 4QJ3B 4GBDA 4DZ5A 2V5LA 3GXPA 1DIDA 1KM0A 4NP7A 2VCBA 1H60A 5GVJA 5HPCA 2QUVA 4HHLA 1M7JA 5HUOA 1QMLA 4A2SA 3QVQA 3DN5A 2IPWA 1TPVA 5M2FX 2ADAA 2GVEA 1TRDA 2A0NA 1GVQA 4UOQA 1YPFA 3WNOA 2VX7A 4EKJA 1TRIA 2WMHA 2AMXA 2JEPA 2QCNA 1KB3A 2VDGA 4ZXLA 3OHIA 3LMYA 1OC6A 1ZAJA 2X30A 2A6NA 4PTXA 4OU1A 3AC0A 3WMLA 3O7UA 3SY8A 3ZT6A 3AS0A 1CXLA 3HPXA 4UIOA 1UD2A 2DSVA 3TJIA 4PMZA 3QR0A 2ZKMX 1K02A 3F2CA 1EHNA 1GEHA 2Y88A 5HXMA 2E6YA 2WVVB 3E2RA 4ORMA 5C2XA 3O06A 3CB8A 4MLJA 4Z1CA 1P7TB 3FA5A 1XUZA 1X39A 2Y5JA 4S39A 4QLLA 4K7VA 5AB3A 3BICA 1UQYA 2ISWA 3F4NA 3BSMA 5AECA 4QNEA 4Q4OA 3PY2A 4ZB5A 3IPWA 2RDTA 4PSRA 4H19A 3QZ6A 3RJYA 1VRXA 3UWEA 3W24A 4XAFA 1I2QA 5IDIA 3VYLA 4UC5A 4TIMA 1D8WA 4RNFA 3OA5A 1EGVA 4C6CA 5DANA 2HDJA 3H2NA 5IDZA 1DL3A 1XCWA 4AZ6A 3GNOA 3LTYA 2WCSA 2BHYA 4FPSA 4GH1A 4PUMA 3LUTA 1B3WA 1MXGA 4MB5A 3LZ3A 3U7VA 4IOTA 5T9CE 2FGLA 3KE0A 3TKFA 3P82A 5JBFA 1IGWA 3WLPA 2GL5A 4Q8TA 2CHOA 3QPYA 3SR7A 3WSUA 3R4IA 3ABXA 1V6UA 2G5WA 1VFFA 4ZZ9A 4K1WA 2I5QA 1A0EA 3QZEA 1Q3NA 2A85A 3U3HA 3WMBA 4WKAA 3BWWA 5BROA 4UWMA 3S2JA 2D2GA 4GMEA 1NWTA 7CGTA 2HE8A 3CQJA 2C8NA 3LTSA 4LUYA 4CLMA 1FDJA 2WM1A 1AH3A 2QPXA 4KS0A 5CBBA 3HGJA 4AWSA 1XLJA 1VYPX 1I6NA 3M0JA 3W7KA 1D7KA 3F5JA 5CCZA 3GH4A 4WEVX 2DZBA 1H7PA 4A4AA 3RHGA 4C6PA 5BOFA 3OGRA 3LX9A 5CGTA 2WVVA 2AMGA 3BZJA 1W1B1 1UOKA 4A29A 1BQGA 3A6OA 4DM2A 3PBGA 3A3HA 1UKTA 4FP1A 4Y90A 3U9IA 2H9AB 4D8LA 2J9XA 1EXBA 6TIMA 2E6AA 3CPUA 3PJUA 4LAUA 1VJZA 1OCBA 3ZJ6A 4H04A 3U48A 2WKGA 4Q8OA 1AW5A 1TPB1 3GNPA 2R9RA 5F7UA 2HZGA 3PWAA 4FIQA 4UOJA 3T09A 1Q65A 4YYCA 5HAOA 3VFLA 8CGTA 2ZUSA 4M80A 4CQ9A 5HDRA 2Y2WA 1AJ0A 4AYSA 3STEA 3TK7A 1CYGA 3VIKA 3KXQA 3WLNA 4QAWA 1K03A 7TAAA 3W7PA 3ZXWA 5HNTA 1XW8A 2BVYA 2C0AA 1V3JA 4O28A 1X38A 1HXJA 3DG7A 3UVAA 1YADA 3FVDA 4AIOA 1DP0A 1A5OC 4CEUC 3IIXA 3QGKC 2C1IA 4MAVA 4ROPA 1Q4NX 4DELA 4Y8FA 2Y24A 4HCLA 1Q7QA 5EB8A 1A3XA 5J5DA 2RHGA 2PGRA 1TELA 4TX6A 4UCGA 1TCMA 4HA0A 2MANA 2Z1WA 2V63A 4DVOA 3VNIA 4L9XA 4JTGA 4JNZA 3PZVA 1K7FA 1SFTA 4NI3A 4WJXA 4UQDA 5A6MA 1RP9A 4W88A 1SW3A 2EPMX 1E43A 1Q6LA 2PDHA 2WM0A 2A3CA 3LGGA 2CCRA 7REQB 1HL9A 3LQGA 4MG4A 1ZAIA 4AW7A 5U7SA 3FEMA 4I9AA 2XU2A 3BCDA 3TE9A 1IT8A 2ZZ1A 2XIQA 3GVQA 3TOYA 1AQHA 4E5TA 4M6VA 2GGHA 4UFIA 4MNJA 1O1ZA 5LGXA 3NSNA 3M6DA 3LYEA 1V6WA 4GFSA 1PYMA 3GDLA 4I9MA 2D3LA 3MUY1 5DT5A 2FLIA 3N2OA 4HNNA 4JQAA 3GVVA 3VIIA 3V18A 2X2GA 3AOFA 3AXIA 1N8WA 4O10A 2A79A 4IXXA 3VKBA 4OT7A 3PBYA 2QF7A 4XZ9A 1XJBA 1JPHA 4JD4A 2OQYA 3HO8A 4HOWA 4ZQOA 2CLIA 4KRZA 3IUIA 1ZP3A 2CLEA 3HA1A 4OWGA 4M1BA 1WUEA 1DWIM 3GAYA 4QGCA 3VDHA 2DSZA 4W7UA 2AGKA 4AZBA 3QV9A 1FA2A 3AYSA 1ZQ5A 1CX9A 2DZPA 3MP5A 2HVNA 4ALDA 1QNQA 3L4VA 4LRTA 2WNZA 2W66A 4J3VA 2PCQA 3N2BA 1E72M 2FH6A 3SUSA 2QCCA 4FOJA 1UH2A 1E1CB 1SJCA 3UCDA 1E9YB 3RLHA 2F2KA 2PWDA 1WZMA 1MDRA 6CGTA 1JAKA 3GO2A 4GIAA 1JNEA 3HOJA 1GYMA 1OG6A 4JBRA 1C8XA 3G24A 1JZ7A 1GG0A 4EXQA 2V3FA 2NZLA 1XDMA 2Y70A 4ZL1A 5A6SA 1XX1A 1W37A 5LNVA 4ACZB 2NVDA 3S5ZA 4KPLA 2G0WA 3UNTA 4B5TA 3R6IA 3QOKA 4LUTA 2BGQA 1RJRA 2C71A 3TYBA 1XIHA 1MEWA 3R0DA 1YPXA 3MVIA 4HNCA 3BV4A 2QUUA 2O4QA 4DNMA 2WJFA 4N9DA 1NP2A 3MMUA 4HB7A 5G2WA 4UTJA 5AHIA 3BW3A 4PEEA 5CJMA 5C0QA 3T9PA 3CUXA 1FWTA 1A4LA 3E2VA 1KTCA 4C1KA 3M44A 3N73A 3VAVA 2QPUA 2AQOA 4MYXA 5AC8A 3AU6A 3LPOA 3IJIA 4JX6A 3E5BA 2UY5A 4QCEA 2GJXA 5F4WA 1HP4A 1C9WA 1BF6A 4HHPA 4A3YA 1F6PA 3KBWA 5I78A 5E0CA 4MDOA 3PWIA 2D0FA 3OZYA 2VVNA 5FA5A 3LA4A 2X0HA 1L8PA 3MUIA 2NQHA 1N8IA 3LPFA 4WGXA 3UP8A 1W1TA 3URNA 3BOXA 1EWDA 1TPFA 4BI6A 5I3IA 4Q8PA 4FMVA 1KM2A 3C3UA 4RPPA 4RCXA 1YIXA 5I7GA 3HGOA 4D6CA 3P0XA 4PTWA 3HB9A 3L66A 3UWZA 1R38A 4AD5A 1JRBA 4HTBA 2OJPA 1H49A 5CEWA 1EYEA 1OFAA 4YPJA 3ATZA 1ZL1A 4FLOA 2PWGA 2ACRA 2HNHA 3VM5A 4F48A 4F0KA 2VEKA 2PDBA 2D0GA 3WQ8A 5ABTA 3RFAA 3LG3A 5BXRA 3NSMA 1D8CA 3CIXA 3ITOA 1Q63A 4Y9AA 1CXKA 1J0HA 3KRZA 1ZCCA 3R8HA 4E3TA 4ML9A 1IZJA 4AVNA 1ZFJA 3PZTA 2VKZG 1RQHA 1ALDA 1XYAA 1XSKA 3BLOA 4QS6A 3SUTA 1TUXA 5C55A 3AZSA 4LAKA 3GNXA 1HJXA 1ME7A 3W7LA 1HX0A 1HP5A 1KQYA 4JX4A 3XINA 4IMFA 3M16A 1XRFA 3BOLA 1KFCA 1VFLA 3VGFA 3BLFA 4R7OA 3MSYA 3UXKA 3KRUA 2V2CA 5CZJA 2WC7A 2NV1A 4P5UA 3TA9A 3CPGA 1CXEA 1DYSA 1Q8AA 1E0TA 2F84A 1VBRA 2W3ZA 2BGSA 2OSWA 4RXFA 4J3UA 3UWYA 3E2QA 4OIFA 4EX4A 1NWUA 3EWYA 2DH3A 1DTUA 4JTAA 3S1UA 1U1HA 2DORA 3TZFA 3WF0A 1LLZA 4NNBA 1F7BA 4XG1A 4AXKA 2DZUA 3H7UA 1DQXA 4DLFA 8XIMA 4YTQA 3CUHA 2PDYA 4GISA 4H8VA 1YXDA 1BRLA 4IICA 4PRRA 3PN8A 5FL1A 3SRDA 3VCNA 3T07A 3V5CA 3K13A 2A3AA 3MP4A 4MHBA 1FWSA 3G1VA 3GSMA 3W1PA 2XIIA 5EMMA 1V3MA 4JXCA 3N2CA 1W9BM 2PUZA 3OU8A 5I3KA 1DEDA 3WD3A 3UZ5A 4ZXOA 4X9YA 3TQ0A 3RCNA 3QN3A 1UZ4A 2OX4A 2J8TA 2DIEA 4RV3A 5CC6A 2PD9A 3WQVA 4O0QA 2Y89A 4QHRA 4G8TA 1YXYA 3S2CA 2E68A 3APYA 3MW7A 1S3TC 1HJVA 4X9SA 4RZ6A 1ZBKA 1S5NA 3SCWA 3PM6A 4QG6A 5JVLA 2X16A 2G4FA 2GQAA 4A8LA 5FL0A 2Z7GA 5FJIA 3ZS4A 2PDXA 3FGCA 1VZWA 5AVNA 2O56A 4ERIA 1KM1A 5LA1A 2PP3A 4FZIA 4KCUA 3K8KA 1YE6A 1FDZA 4JL1A 3FXGA 4FIRA 4GLEA 3MV11 4Z1DA 2EPLX 1JZ3A 3ITCA 3L21A 3OVQA 1XLFA 2QV5A 4DJFC 5A6BA 3KP1A 3FV9A 4X0NA 3VXGA 4IFKA 1NFGA 2R1LA 2ZRZA 1RK6A 4JY9A 3MWAA 3EKGA 4B3KA 4NQ1A 4C7FA 1F05A 1F9CA 3K5XA 4WXZA 1R6WA 1UG6A 3ENLA 3ONCA 1KLZA 3UWQA 3N14A 5CSSA 3PFRA 1VYRA 4GX9A 3C0QA 3QYSA 4GVFA 1O66A 1PB0A 1SFJA 4NYUA 3PHAA 3LCWA 4O16A 1W1A1 1J79A 2ZXDA 3EXRA 3GVWA 2CLMA 2QNEA 3JVAA 2DVXA 2Y1HA 4NVTA 4B3ZA 3VK5A 1Q4WA 5BMWA 3W1XA 3QZAA 4LWWA 3WLMA 3IARA 4XD5A 2QXWA 3W2UA 3RO6A 1OF8A 3W82A 3IVSA 4HU4A 3DYOA 4WJEA 1LUCA 2Y62A 4W8AA 1OZMA 1QNSA 2GJPA 3BLKA 3TAOA 1OM0A 2I57A 1GW9A 1I0BA 5LSMA 5BWFA 3OLIA 3CV1A 2Z26A 1OFRA 3SJNA 3IJDA 2DJLA 4RE4A 1E6QM 4XKMA 2DT3A 2INFA 1G5AA 3WBXA 4IF2A 4MVAA 3LN3A 2VC5A 2F6XA 3VGHA 2WC4A 4Q7NA 3E0WA 1P1XA 2D23A 3C8NA 2ZQ0A 1J11A 1TZ7A 3NO3A 1L6GA 2ZRXA 4QIUA 1HIZA 1JDAA 1V7YA 4BJHA 4Q8VA 1WOAA 1XHGA 3GAKA 4LVAA 3CQHA 1BRLB 2B7PA 3KBMA 2X1SA 1M41A 2R82A 4JNMA 3SGUA 3MANA 1PUDA 4MY9A 4JDBA 4PRWA 4TVDA 4IFKB 3VOCA 3VD9A 1NY1A 1WZAA 1ZZMA 4ZE5A 3TIMA 4PA8A 4MPQA 1Q2RA 3IGXA 3HG3A 1R2RA 4HU3A 4U4MA 3GIQA 2QUNA 1LL6A 1Z41A 4L4LA 3QTGA 4G6CA 4LYRA 1VFSA 3HV9A 4H9YA 5CC7A 2OG9A 3ARPA 1I60A 1ZBVA 1YDNA 4W93A 2OQHA 4BF9A 4X0VA 1MW3A 1CIUA 4NG3A 3E0FA 2PD5A 2UWFA 1DJIA 4PMVA 3KOFA 2Q8LA 3S1GA 3TYZA 3OODA 5C7HA 1XPYA 3S5NA 5LA2A 1X1OA 1R46A 1W9VA 3NZ1A 3BSGA 1VEOA 3WQEA 3PZ9A 1BFNA 2Y7EA 3UZZA 1PDYA 1CW2A 3WELA 3TU9A 1E6ZA 4LCQA 5REQA 3ZT7A 3UESA 3W01A 3BG5A 4IPNB 4NZCA 3BLPX 4IIEA 3Q37A 3PP7A 4HZMA 3G8RA 3WJWA 3IV8A 3QFWA 4CNSA 2MUCA 4GI9A 2NX9A 2WAGA 3IIZA 1IZKA 4JIRA 2PTXA 3VINA 4FOKA 3VNJA 5AOUA 4FX6M 4OTKA 4PGLA 2DZAA 4ZTXA 1KFLA 4Z2KA 5F1UA 2ZX9A 4EWND 1TPUA 1IXOA 3S2MA 2WBKA 1OGBA 3QC0A 2YIHA 5EBUA 1QAPA 1ADOA 1UASA 3RO8A 1XIIA 5M17A 1BVWA 3S3GA 4AD1A 2YR1A 1MUMA 1UMYA 3MY9A 4MNLA 3RX2A 5T26A 2R14A 2V2DA 1AW1A 2PDQA 4UMBA 1FCUA 4F8XA 4CVWA 5CGMA 4JIIX 1QHOA 3SBFA 3M4HA 3TN5A 1A5MC 4OOUA 3EOSA 4RE3A 1ZGDA 1KM3A 3G1YA 2OCZA 4OUIA 1EP1A 3OQ8A 2QCGA 3L5LA 3NZQA 1LRNA 1T6MA 3W2MA 5AC4A 4LS0A 5I06A 3KX6A 4ZO8A 1LLOA 4AZHA 4C6KA 1AZ2A 2EF9A 2YPIA 4IQDA 4CNTA 3TTOA 1W3JA 1EQCA 4YHGA 1RCXB 4M29A 3IRSA 1S39A 4WK9A 3RRAA 4F66A 1XIFA