3A5LS

Crystal structure of a dictyostelium p109a mg2+-actin in complex with human gelsolin segment 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 38
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3a5lS00
2QTVA 1T2LA 1CFYA 2VILA 1T3XA 2NUTA 1COFA 5KYWA 1JHWA 3EGXB 1HQZ1 1PCXA 4CBUG 1DEJS 1C0FS 1VKKA 1T3YA 2XFAA 1Q8GA 4JD2H 1D0NA 5HVKB 4CBWG 2LLFA 3EFOA 1AHQA 4LIZA 3EGDA 5L6WC 1PD1A 3EG9A 1Q8XA 3CJBG 1M2VA 3EH2A 3FG7A 1PD0A 1NM1G 1M4JA 1WM4A 2FH3A 1M2VB 1P8ZG 5IVUA 3FG6A 4PKIG 4PKHB 5KYXB 1CNUA 1AK6A 2MOTA 1M2OA 3L50A 1NPHA 5A1MA 1MDUA 2W0IA 3CJCG 1TMWA 1C0GS 1EQYS 1TVJA 4CBXG 1YVNG 3FFNA 2MV2A 2NUTB 2KVKA 2FH2A 3EGXA 5KYWB 4KEFA 1F7SA 3EGDB 2LXXA 3EG9B 1ESVS 1J72A 1AK7A 2HD7A 1SVQA 3CI5G 5KYUB 2MP4A 2XF1A 1SVYA 1SVRA 3EH1A 1KCQA 1VFQA 5HVKD 2FGHA 1WFSA 2VACA 4Z94G 3FFKA 1X67A 2FF3A 3TU5B 5FAEA 3A5MS 1NLVG 2FH4A 5KYYA 5KYUA 3DAWB 1RGIG 1P8XA 5FAFA 1QPVA 3EFOB 3A5OS 3A5NS 1NMDG 4S10C 2VIKA 5KYYB 4KEDA 1T44G 2FF6G 1D4XG 1H1VG 1UDMA 4BEX1 3Q2BA 1V6FA 2NUPB 2L72A 3A5LS 2FH1A 1WNJA 2D8BA 5KYNA 3CIPG 2NUPA 5DD2A 2I2QA 5KYXA 4KEEA 4PKGG 2LJ8A 1YAGG
chains in the Genus database with same CATH superfamily
2QTVA 1T2LA 1CFYA 2VILA 1T3XA 2NUTA 1COFA 5KYWA 1JHWA 3EGXB 1HQZ1 1PCXA 4CBUG 1DEJS 1C0FS 1VKKA 1T3YA 2XFAA 1Q8GA 4JD2H 1D0NA 5HVKB 4CBWG 2LLFA 3EFOA 1AHQA 3DA7A 3EGDA 4LIZA 5L6WC 1PD1A 3EG9A 1Q8XA 3CJBG 1M2VA 3EH2A 3FG7A 1PD0A 1NM1G 1M4JA 1WM4A 2FH3A 1M2VB 1P8ZG 5IVUA 3FG6A 4PKIG 4PKHB 5KYXB 1CNUA 1AK6A 2MOTA 1M2OA 3L50A 1NPHA 5A1MA 1MDUA 2W0IA 3CJCG 1TMWA 1C0GS 1EQYS 1TVJA 4CBXG 1YVNG 3FFNA 2MV2A 2NUTB 2KVKA 2FH2A 3EGXA 5KYWB 4KEFA 1F7SA 3EGDB 2LXXA 3EG9B 1ESVS 1J72A 1AK7A 2HD7A 1SVQA 3CI5G 5KYUB 2MP4A 2XF1A 1SVYA 1SVRA 3EH1A 1KCQA 1VFQA 5HVKD 2FGHA 1WFSA 2VACA 4Z94G 3FFKA 1X67A 2FF3A 3TU5B 5FAEA 3A5MS 1NLVG 2FH4A 5KYYA 5KYUA 3DAWB 1RGIG 1P8XA 5FAFA 1QPVA 3EFOB 3A5OS 3A5NS 1NMDG 4S10C 2VIKA 5KYYB 4KEDA 1T44G 2FF6G 1D4XG 1H1VG 1UDMA 4BEX1 3Q2BA 1V6FA 2NUPB 2L72A 3A5LS 2FH1A 1WNJA 2D8BA 5KYNA 3CIPG 2NUPA 5DD2A 2I2QA 5KYXA 4KEEA 4PKGG 2LJ8A 1YAGG
chains in the Genus database with same CATH topology
2QTVA 1T2LA 1CFYA 2VILA 1T3XA 2NUTA 1COFA 5KYWA 1JHWA 3EGXB 1HQZ1 1PCXA 4CBUG 1DEJS 1C0FS 1VKKA 1T3YA 2XFAA 1Q8GA 4JD2H 1D0NA 5HVKB 4CBWG 2LLFA 3EFOA 1AHQA 3DA7A 3EGDA 4LIZA 5L6WC 1PD1A 3EG9A 1Q8XA 3CJBG 1M2VA 3EH2A 3FG7A 1PD0A 1NM1G 1M4JA 1WM4A 2FH3A 1M2VB 1P8ZG 5IVUA 3FG6A 4PKIG 4PKHB 5KYXB 1CNUA 1AK6A 2MOTA 1M2OA 3L50A 1NPHA 5A1MA 1MDUA 2W0IA 3CJCG 1TMWA 1C0GS 1EQYS 1TVJA 4CBXG 1YVNG 3FFNA 2MV2A 2NUTB 2KVKA 2FH2A 3EGXA 5KYWB 4KEFA 1F7SA 3EGDB 2LXXA 3EG9B 1ESVS 1J72A 1AK7A 2HD7A 1SVQA 3CI5G 5KYUB 2MP4A 2XF1A 1SVYA 1SVRA 3EH1A 1KCQA 1VFQA 5HVKD 2FGHA 1WFSA 2VACA 4Z94G 3FFKA 1X67A 2FF3A 3TU5B 5FAEA 3A5MS 1NLVG 2FH4A 5KYYA 5KYUA 3DAWB 1RGIG 1P8XA 5FAFA 1QPVA 3EFOB 3A5OS 3A5NS 1NMDG 4S10C 2VIKA 5KYYB 4KEDA 1T44G 2FF6G 1D4XG 1H1VG 1UDMA 4BEX1 3Q2BA 1V6FA 2NUPB 2L72A 3A5LS 2FH1A 1WNJA 2D8BA 5KYNA 3CIPG 2NUPA 5DD2A 2I2QA 5KYXA 4KEEA 4PKGG 2LJ8A 1YAGG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTV A;  1T2L A;  1CFY A;  2VIL A;  1T3X A;  2NUT A;  1COF A;  5KYW A;  1JHW A;  3EGX B;  1HQZ 1;  1PCX A;  4CBU G;  1DEJ S;  1C0F S;  1VKK A;  1T3Y A;  2XFA A;  1Q8G A;  4JD2 H;  1D0N A;  5HVK B;  4CBW G;  2LLF A;  3EFO A;  1AHQ A;  4LIZ A;  3EGD A;  5L6W C;  1PD1 A;  3EG9 A;  1Q8X A;  3CJB G;  1M2V A;  3EH2 A;  3FG7 A;  1PD0 A;  1NM1 G;  1M4J A;  1WM4 A;  2FH3 A;  1M2V B;  1P8Z G;  5IVU A;  3FG6 A;  4PKI G;  4PKH B;  5KYX B;  1CNU A;  1AK6 A;  2MOT A;  1M2O A;  3L50 A;  1NPH A;  5A1M A;  1MDU A;  2W0I A;  3CJC G;  1TMW A;  1C0G S;  1EQY S;  1TVJ A;  4CBX G;  1YVN G;  3FFN A;  2MV2 A;  2NUT B;  2KVK A;  2FH2 A;  3EGX A;  5KYW B;  4KEF A;  1F7S A;  3EGD B;  2LXX A;  3EG9 B;  1ESV S;  1J72 A;  1AK7 A;  2HD7 A;  1SVQ A;  3CI5 G;  5KYU B;  2MP4 A;  2XF1 A;  1SVY A;  1SVR A;  3EH1 A;  1KCQ A;  1VFQ A;  5HVK D;  2FGH A;  1WFS A;  2VAC A;  4Z94 G;  3FFK A;  1X67 A;  2FF3 A;  3TU5 B;  5FAE A;  3A5M S;  1NLV G;  2FH4 A;  5KYY A;  5KYU A;  3DAW B;  1RGI G;  1P8X A;  5FAF A;  1QPV A;  3EFO B;  3A5O S;  3A5N S;  1NMD G;  4S10 C;  2VIK A;  5KYY B;  4KED A;  1T44 G;  2FF6 G;  1D4X G;  1H1V G;  1UDM A;  4BEX 1;  3Q2B A;  1V6F A;  2NUP B;  2L72 A;  3A5L S;  2FH1 A;  1WNJ A;  2D8B A;  5KYN A;  3CIP G;  2NUP A;  5DD2 A;  2I2Q A;  5KYX A;  4KEE A;  4PKG G;  2LJ8 A;  1YAG G; 
#chains in the Genus database with same CATH topology
 2QTV A;  1T2L A;  1CFY A;  2VIL A;  1T3X A;  2NUT A;  1COF A;  5KYW A;  1JHW A;  3EGX B;  1HQZ 1;  1PCX A;  4CBU G;  1DEJ S;  1C0F S;  1VKK A;  1T3Y A;  2XFA A;  1Q8G A;  4JD2 H;  1D0N A;  5HVK B;  4CBW G;  2LLF A;  3EFO A;  1AHQ A;  3DA7 A;  3EGD A;  4LIZ A;  5L6W C;  1PD1 A;  3EG9 A;  1Q8X A;  3CJB G;  1M2V A;  3EH2 A;  3FG7 A;  1PD0 A;  1NM1 G;  1M4J A;  1WM4 A;  2FH3 A;  1M2V B;  1P8Z G;  5IVU A;  3FG6 A;  4PKI G;  4PKH B;  5KYX B;  1CNU A;  1AK6 A;  2MOT A;  1M2O A;  3L50 A;  1NPH A;  5A1M A;  1MDU A;  2W0I A;  3CJC G;  1TMW A;  1C0G S;  1EQY S;  1TVJ A;  4CBX G;  1YVN G;  3FFN A;  2MV2 A;  2NUT B;  2KVK A;  2FH2 A;  3EGX A;  5KYW B;  4KEF A;  1F7S A;  3EGD B;  2LXX A;  3EG9 B;  1ESV S;  1J72 A;  1AK7 A;  2HD7 A;  1SVQ A;  3CI5 G;  5KYU B;  2MP4 A;  2XF1 A;  1SVY A;  1SVR A;  3EH1 A;  1KCQ A;  1VFQ A;  5HVK D;  2FGH A;  1WFS A;  2VAC A;  4Z94 G;  3FFK A;  1X67 A;  2FF3 A;  3TU5 B;  5FAE A;  3A5M S;  1NLV G;  2FH4 A;  5KYY A;  5KYU A;  3DAW B;  1RGI G;  1P8X A;  5FAF A;  1QPV A;  3EFO B;  3A5O S;  3A5N S;  1NMD G;  4S10 C;  2VIK A;  5KYY B;  4KED A;  1T44 G;  2FF6 G;  1D4X G;  1H1V G;  1UDM A;  4BEX 1;  3Q2B A;  1V6F A;  2NUP B;  2L72 A;  3A5L S;  2FH1 A;  1WNJ A;  2D8B A;  5KYN A;  3CIP G;  2NUP A;  5DD2 A;  2I2Q A;  5KYX A;  4KEE A;  4PKG G;  2LJ8 A;  1YAG G; 
#chains in the Genus database with same CATH homology
 2QTV A;  1T2L A;  1CFY A;  2VIL A;  1T3X A;  2NUT A;  1COF A;  5KYW A;  1JHW A;  3EGX B;  1HQZ 1;  1PCX A;  4CBU G;  1DEJ S;  1C0F S;  1VKK A;  1T3Y A;  2XFA A;  1Q8G A;  4JD2 H;  1D0N A;  5HVK B;  4CBW G;  2LLF A;  3EFO A;  1AHQ A;  3DA7 A;  3EGD A;  4LIZ A;  5L6W C;  1PD1 A;  3EG9 A;  1Q8X A;  3CJB G;  1M2V A;  3EH2 A;  3FG7 A;  1PD0 A;  1NM1 G;  1M4J A;  1WM4 A;  2FH3 A;  1M2V B;  1P8Z G;  5IVU A;  3FG6 A;  4PKI G;  4PKH B;  5KYX B;  1CNU A;  1AK6 A;  2MOT A;  1M2O A;  3L50 A;  1NPH A;  5A1M A;  1MDU A;  2W0I A;  3CJC G;  1TMW A;  1C0G S;  1EQY S;  1TVJ A;  4CBX G;  1YVN G;  3FFN A;  2MV2 A;  2NUT B;  2KVK A;  2FH2 A;  3EGX A;  5KYW B;  4KEF A;  1F7S A;  3EGD B;  2LXX A;  3EG9 B;  1ESV S;  1J72 A;  1AK7 A;  2HD7 A;  1SVQ A;  3CI5 G;  5KYU B;  2MP4 A;  2XF1 A;  1SVY A;  1SVR A;  3EH1 A;  1KCQ A;  1VFQ A;  5HVK D;  2FGH A;  1WFS A;  2VAC A;  4Z94 G;  3FFK A;  1X67 A;  2FF3 A;  3TU5 B;  5FAE A;  3A5M S;  1NLV G;  2FH4 A;  5KYY A;  5KYU A;  3DAW B;  1RGI G;  1P8X A;  5FAF A;  1QPV A;  3EFO B;  3A5O S;  3A5N S;  1NMD G;  4S10 C;  2VIK A;  5KYY B;  4KED A;  1T44 G;  2FF6 G;  1D4X G;  1H1V G;  1UDM A;  4BEX 1;  3Q2B A;  1V6F A;  2NUP B;  2L72 A;  3A5L S;  2FH1 A;  1WNJ A;  2D8B A;  5KYN A;  3CIP G;  2NUP A;  5DD2 A;  2I2Q A;  5KYX A;  4KEE A;  4PKG G;  2LJ8 A;  1YAG G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...