3A5MS

Crystal structure of a dictyostelium p109i mg2+-actin in complex with human gelsolin segment 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 38
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3a5mS00
2NUTB 3EGDA 3FG6A 1MDUA 4S10C 5KYUA 1VFQA 4PKHB 4CBUG 4BEX1 3FFNA 5DD2A 2LXXA 1RGIG 1P8XA 5KYWA 5HVKB 1PD0A 1P8ZG 1D0NA 1T3XA 1NPHA 4JD2H 3EG9A 2NUPA 4PKIG 2VACA 3EFOA 1YAGG 5HVKD 2I2QA 2D8BA 1M2VB 1M2OA 3EGDB 2HD7A 1C0GS 3A5MS 1H1VG 1AHQA 2MOTA 4Z94G 4CBWG 5KYNA 1PCXA 3CJCG 1QPVA 3FG7A 3A5LS 4KEFA 5KYWB 1D4XG 4LIZA 3EGXB 2KVKA 1UDMA 1V6FA 2QTVA 5FAEA 2NUPB 1SVQA 3L50A 3CI5G 5KYYA 1M2VA 2MP4A 3CJBG 1CFYA 3CIPG 2VIKA 1WM4A 1VKKA 1SVRA 1NMDG 2XFAA 1JHWA 1TMWA 2MV2A 2FF6G 5A1MA 2VILA 1COFA 1PD1A 2XF1A 2W0IA 3A5NS 4PKGG 1T3YA 2LLFA 3EH2A 2FH4A 3EGXA 1AK6A 5FAFA 1CNUA 3EH1A 1NLVG 2FH3A 4KEEA 5KYYB 2LJ8A 1KCQA 3DAWB 5KYXA 1Q8GA 4CBXG 5IVUA 2L72A 1ESVS 1HQZ1 1T2LA 2FGHA 1F7SA 2NUTA 5KYUB 1DEJS 5L6WC 3Q2BA 1YVNG 4KEDA 1M4JA 1C0FS 1EQYS 3A5OS 3FFKA 2FF3A 2FH1A 5KYXB 1AK7A 1J72A 1X67A 1WFSA 1SVYA 3EG9B 1WNJA 3EFOB 3TU5B 1TVJA 1NM1G 2FH2A 1T44G 1Q8XA
chains in the Genus database with same CATH superfamily
2NUTB 3EGDA 3FG6A 1MDUA 4S10C 5KYUA 1VFQA 4PKHB 4CBUG 4BEX1 3FFNA 5DD2A 2LXXA 1RGIG 1P8XA 5KYWA 5HVKB 1PD0A 1P8ZG 1D0NA 1T3XA 1NPHA 4JD2H 3EG9A 2NUPA 4PKIG 2VACA 3EFOA 1YAGG 5HVKD 2I2QA 2D8BA 1M2VB 1M2OA 3EGDB 2HD7A 1C0GS 3A5MS 1H1VG 1AHQA 2MOTA 4Z94G 4CBWG 5KYNA 1PCXA 3CJCG 1QPVA 3FG7A 3A5LS 4KEFA 5KYWB 1D4XG 4LIZA 3EGXB 2KVKA 1UDMA 1V6FA 2QTVA 5FAEA 2NUPB 1SVQA 3L50A 3CI5G 5KYYA 1M2VA 2MP4A 3CJBG 1CFYA 3CIPG 2VIKA 1WM4A 1VKKA 1SVRA 1NMDG 2XFAA 1JHWA 1TMWA 2MV2A 2FF6G 5A1MA 2VILA 1COFA 1PD1A 2XF1A 2W0IA 3A5NS 4PKGG 1T3YA 2LLFA 3EH2A 2FH4A 3EGXA 1AK6A 5FAFA 1CNUA 3EH1A 1NLVG 2FH3A 4KEEA 5KYYB 2LJ8A 1KCQA 3DAWB 5KYXA 1Q8GA 4CBXG 5IVUA 2L72A 1ESVS 1HQZ1 1T2LA 2FGHA 1F7SA 2NUTA 3DA7A 5KYUB 1DEJS 5L6WC 3Q2BA 1YVNG 4KEDA 1M4JA 1C0FS 1EQYS 3A5OS 3FFKA 2FF3A 2FH1A 5KYXB 1AK7A 1J72A 1X67A 1WFSA 1SVYA 3EG9B 1WNJA 3EFOB 3TU5B 1TVJA 1NM1G 2FH2A 1T44G 1Q8XA
chains in the Genus database with same CATH topology
2NUTB 3EGDA 3FG6A 1MDUA 4S10C 5KYUA 1VFQA 4PKHB 4CBUG 4BEX1 3FFNA 5DD2A 2LXXA 1RGIG 1P8XA 5KYWA 5HVKB 1PD0A 1P8ZG 1D0NA 1T3XA 1NPHA 4JD2H 3EG9A 2NUPA 4PKIG 2VACA 3EFOA 1YAGG 5HVKD 2I2QA 2D8BA 1M2VB 1M2OA 3EGDB 2HD7A 1C0GS 3A5MS 1H1VG 1AHQA 2MOTA 4Z94G 4CBWG 5KYNA 1PCXA 3CJCG 1QPVA 3FG7A 3A5LS 4KEFA 5KYWB 1D4XG 4LIZA 3EGXB 2KVKA 1UDMA 1V6FA 2QTVA 5FAEA 2NUPB 1SVQA 3L50A 3CI5G 5KYYA 1M2VA 2MP4A 3CJBG 1CFYA 3CIPG 2VIKA 1WM4A 1VKKA 1SVRA 1NMDG 2XFAA 1JHWA 1TMWA 2MV2A 2FF6G 5A1MA 2VILA 1COFA 1PD1A 2XF1A 2W0IA 3A5NS 4PKGG 1T3YA 2LLFA 3EH2A 2FH4A 3EGXA 1AK6A 5FAFA 1CNUA 3EH1A 1NLVG 2FH3A 4KEEA 5KYYB 2LJ8A 1KCQA 3DAWB 5KYXA 1Q8GA 4CBXG 5IVUA 2L72A 1ESVS 1HQZ1 1T2LA 2FGHA 1F7SA 2NUTA 3DA7A 5KYUB 1DEJS 5L6WC 3Q2BA 1YVNG 4KEDA 1M4JA 1C0FS 1EQYS 3A5OS 3FFKA 2FF3A 2FH1A 5KYXB 1AK7A 1J72A 1X67A 1WFSA 1SVYA 3EG9B 1WNJA 3EFOB 3TU5B 1TVJA 1NM1G 2FH2A 1T44G 1Q8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUT B;  3EGD A;  3FG6 A;  1MDU A;  4S10 C;  5KYU A;  1VFQ A;  4PKH B;  4CBU G;  4BEX 1;  3FFN A;  5DD2 A;  2LXX A;  1RGI G;  1P8X A;  5KYW A;  5HVK B;  1PD0 A;  1P8Z G;  1D0N A;  1T3X A;  1NPH A;  4JD2 H;  3EG9 A;  2NUP A;  4PKI G;  2VAC A;  3EFO A;  1YAG G;  5HVK D;  2I2Q A;  2D8B A;  1M2V B;  1M2O A;  3EGD B;  2HD7 A;  1C0G S;  3A5M S;  1H1V G;  1AHQ A;  2MOT A;  4Z94 G;  4CBW G;  5KYN A;  1PCX A;  3CJC G;  1QPV A;  3FG7 A;  3A5L S;  4KEF A;  5KYW B;  1D4X G;  4LIZ A;  3EGX B;  2KVK A;  1UDM A;  1V6F A;  2QTV A;  5FAE A;  2NUP B;  1SVQ A;  3L50 A;  3CI5 G;  5KYY A;  1M2V A;  2MP4 A;  3CJB G;  1CFY A;  3CIP G;  2VIK A;  1WM4 A;  1VKK A;  1SVR A;  1NMD G;  2XFA A;  1JHW A;  1TMW A;  2MV2 A;  2FF6 G;  5A1M A;  2VIL A;  1COF A;  1PD1 A;  2XF1 A;  2W0I A;  3A5N S;  4PKG G;  1T3Y A;  2LLF A;  3EH2 A;  2FH4 A;  3EGX A;  1AK6 A;  5FAF A;  1CNU A;  3EH1 A;  1NLV G;  2FH3 A;  4KEE A;  5KYY B;  2LJ8 A;  1KCQ A;  3DAW B;  5KYX A;  1Q8G A;  4CBX G;  5IVU A;  2L72 A;  1ESV S;  1HQZ 1;  1T2L A;  2FGH A;  1F7S A;  2NUT A;  5KYU B;  1DEJ S;  5L6W C;  3Q2B A;  1YVN G;  4KED A;  1M4J A;  1C0F S;  1EQY S;  3A5O S;  3FFK A;  2FF3 A;  2FH1 A;  5KYX B;  1AK7 A;  1J72 A;  1X67 A;  1WFS A;  1SVY A;  3EG9 B;  1WNJ A;  3EFO B;  3TU5 B;  1TVJ A;  1NM1 G;  2FH2 A;  1T44 G;  1Q8X A; 
#chains in the Genus database with same CATH topology
 2NUT B;  3EGD A;  3FG6 A;  1MDU A;  4S10 C;  5KYU A;  1VFQ A;  4PKH B;  4CBU G;  4BEX 1;  3FFN A;  5DD2 A;  2LXX A;  1RGI G;  1P8X A;  5KYW A;  5HVK B;  1PD0 A;  1P8Z G;  1D0N A;  1T3X A;  1NPH A;  4JD2 H;  3EG9 A;  2NUP A;  4PKI G;  2VAC A;  3EFO A;  1YAG G;  5HVK D;  2I2Q A;  2D8B A;  1M2V B;  1M2O A;  3EGD B;  2HD7 A;  1C0G S;  3A5M S;  1H1V G;  1AHQ A;  2MOT A;  4Z94 G;  4CBW G;  5KYN A;  1PCX A;  3CJC G;  1QPV A;  3FG7 A;  3A5L S;  4KEF A;  5KYW B;  1D4X G;  4LIZ A;  3EGX B;  2KVK A;  1UDM A;  1V6F A;  2QTV A;  5FAE A;  2NUP B;  1SVQ A;  3L50 A;  3CI5 G;  5KYY A;  1M2V A;  2MP4 A;  3CJB G;  1CFY A;  3CIP G;  2VIK A;  1WM4 A;  1VKK A;  1SVR A;  1NMD G;  2XFA A;  1JHW A;  1TMW A;  2MV2 A;  2FF6 G;  5A1M A;  2VIL A;  1COF A;  1PD1 A;  2XF1 A;  2W0I A;  3A5N S;  4PKG G;  1T3Y A;  2LLF A;  3EH2 A;  2FH4 A;  3EGX A;  1AK6 A;  5FAF A;  1CNU A;  3EH1 A;  1NLV G;  2FH3 A;  4KEE A;  5KYY B;  2LJ8 A;  1KCQ A;  3DAW B;  5KYX A;  1Q8G A;  4CBX G;  5IVU A;  2L72 A;  1ESV S;  1HQZ 1;  1T2L A;  2FGH A;  1F7S A;  2NUT A;  3DA7 A;  5KYU B;  1DEJ S;  5L6W C;  3Q2B A;  1YVN G;  4KED A;  1M4J A;  1C0F S;  1EQY S;  3A5O S;  3FFK A;  2FF3 A;  2FH1 A;  5KYX B;  1AK7 A;  1J72 A;  1X67 A;  1WFS A;  1SVY A;  3EG9 B;  1WNJ A;  3EFO B;  3TU5 B;  1TVJ A;  1NM1 G;  2FH2 A;  1T44 G;  1Q8X A; 
#chains in the Genus database with same CATH homology
 2NUT B;  3EGD A;  3FG6 A;  1MDU A;  4S10 C;  5KYU A;  1VFQ A;  4PKH B;  4CBU G;  4BEX 1;  3FFN A;  5DD2 A;  2LXX A;  1RGI G;  1P8X A;  5KYW A;  5HVK B;  1PD0 A;  1P8Z G;  1D0N A;  1T3X A;  1NPH A;  4JD2 H;  3EG9 A;  2NUP A;  4PKI G;  2VAC A;  3EFO A;  1YAG G;  5HVK D;  2I2Q A;  2D8B A;  1M2V B;  1M2O A;  3EGD B;  2HD7 A;  1C0G S;  3A5M S;  1H1V G;  1AHQ A;  2MOT A;  4Z94 G;  4CBW G;  5KYN A;  1PCX A;  3CJC G;  1QPV A;  3FG7 A;  3A5L S;  4KEF A;  5KYW B;  1D4X G;  4LIZ A;  3EGX B;  2KVK A;  1UDM A;  1V6F A;  2QTV A;  5FAE A;  2NUP B;  1SVQ A;  3L50 A;  3CI5 G;  5KYY A;  1M2V A;  2MP4 A;  3CJB G;  1CFY A;  3CIP G;  2VIK A;  1WM4 A;  1VKK A;  1SVR A;  1NMD G;  2XFA A;  1JHW A;  1TMW A;  2MV2 A;  2FF6 G;  5A1M A;  2VIL A;  1COF A;  1PD1 A;  2XF1 A;  2W0I A;  3A5N S;  4PKG G;  1T3Y A;  2LLF A;  3EH2 A;  2FH4 A;  3EGX A;  1AK6 A;  5FAF A;  1CNU A;  3EH1 A;  1NLV G;  2FH3 A;  4KEE A;  5KYY B;  2LJ8 A;  1KCQ A;  3DAW B;  5KYX A;  1Q8G A;  4CBX G;  5IVU A;  2L72 A;  1ESV S;  1HQZ 1;  1T2L A;  2FGH A;  1F7S A;  2NUT A;  3DA7 A;  5KYU B;  1DEJ S;  5L6W C;  3Q2B A;  1YVN G;  4KED A;  1M4J A;  1C0F S;  1EQY S;  3A5O S;  3FFK A;  2FF3 A;  2FH1 A;  5KYX B;  1AK7 A;  1J72 A;  1X67 A;  1WFS A;  1SVY A;  3EG9 B;  1WNJ A;  3EFO B;  3TU5 B;  1TVJ A;  1NM1 G;  2FH2 A;  1T44 G;  1Q8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...