3A5NC

Crystal structure of a dictyostelium p109a ca2+-actin in complex with human gelsolin segment 1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
359
Chain Sequence
b'QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 117
structure length 359
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5nC03
2QXLA 2Q97A 4H5VA 4BRFA 5AQYA 3L6QA 4H0OA 3VEXA 5F1XA 1NM1A 5AFUA 3FZHA 3ZEUA 3CJAA 4BROA 5BPMA 3SJHA 1C0GA 3UKRB 3WXIA 3AAPA 2GELA 2A42A 3WEEA 5EOYA 3R9PA 4BRQA 1D4XA 1NGCA 2P9PA 3MK6A 3CJCA 3JS6A 4I6MB 3LDLA 4CZEA 3DXKB 3L4IA 2QW9A 3W3DA 3DAWA 4HTLA 3FR0A 3TU5A 4FOEA 2CGJA 4BR7A 4BRGA 2P9LB 1NGJA 5AQTA 2IVPA 3CJBA 1HJOA 4GY2B 2A5XA 3H3OB 1NWKA 4NB4A 1U6ZA 3I8BA 2VCPA 3MN9A 4H03B 3KZBA 4L3QA 3RSEA 1DEJA 3WT0A 3C7NB 3GE1A 4CI6A 4FWNA 3O1WA 5BRFA 3UKRA 3UB5A 2W41A 5AR0A 3QDKA 1G99A 1MDUB 3VEVA 1NGAA 2V7YA 3LDPA 1Z6RA 3U8XA 5I9EB 2A40A 3O8MA 1MWKA 4I6MA 3DXKA 3L0QA 4C23A 4DB3A 2QWLA 4EHTA 3A5MC 2P9SA 2QWOA 2UYTA 2AP1A 5ELZA 2GWKA 2YHXA 5KQDA 1KAXA 2YHWA 2YI1A 2P9LA 2D1KA 1BG3A 4PL7A 2GTDA 4B1YB 1LCUA 4BRAA 2ASMA 3VEWA 3MCPA 3ID8A 2NZTA 2ZWHA 4Y0WA 1BUPA 1T6DA 3DJCA 2IVNA 4ISFA 3C7NA 1MA9B 4CJ7A 4FWSA 3GG4A 4IXCA 3GBTA 4BRIA 1T6CA 2J4RA 1OKJA 1ZC6A 5LJVA 3QFPA 4JNEA 3FE1A 5ADXA 1HKBA 3CJ9A 4H0PA 4DCHA 2E2NA 4H5WA 3WUHA 4BG8A 5KPRA 5AQWA 2GWJA 1QQNA 4BR0A 4DQ8A 3B8AX 3VPZA 2A3ZA 4H0XB 1DKGD 1QZ6A 2E8AA 3QFUA 4BGAA 2NRHA 4B9QA 1BDGA 4FPAA 5FPDA 3IUCA 1ZBSA 1YAGA 3DXMB 1C0FA 4BQLA 5JMVA 1BA1A 2D0PA 4FWMA 3A5NC 3EL2A 5AQUA 4M63C 3WXLA 1GLAG 1KXPA 1E4FT 1NGEA 3O6WA 4IJNA 3W0LA 4ISEA 4PKIA 3D2EB 2E1ZA 3MMVA 3SLCA 4BQZA 3AARA 3VEZA 2FF6A 2Q1NA 4CD3A 3MN7A 4B1VA 4K43A 3H46O 4BRNA 2DPNA 2D0OA 2GUPA 4M7YA 2CGKA 2AA4A 4BC4A 4BVPA 3O08A 4JD2B 1BOTO 3M1FA 3ULEB 3BP8A 5JLFA 3GDQA 4JHDA 3FLCO 3VF4A 4PKGA 5EY4A 3LL3A 3CETA 3DXMA 5BN8A 4FWQA 4QS7A 3QB0A 4H0YB 3EZWA 3VESA 2QM1A 1X3MA 1SQKA 5KPTA 1E4GT 2CGLA 5BN9A 3WXKA 4PKHA 4RTFD 3D2EA 2Q36A 2E88A 5BRHA 5JICA 3D7EO 1ATSA 2EWSA 1NGDA 1JCGA 5AQPA 4YDUA 1X9JA 2E1YA 1GLJO 3SMSA 4MO4A 5AQQA 1GLFO 2I7NA 4O8KA 4E1JA 2ASOA 4M7XA 4JD2A 1NGBA 3EKUA 3IFRA 4K25A 4JN4A 5AQXA 4DHYA 3DWLA 5AQRA 2BUPA 4B1XB 4IO8A 1BA0A 5AQFA 4BC2A 4H5RA 2W40A 1S22A 1Z05A 1TUYA 2H3GX 4BG9A 2OANA 2E2PA 4BR2A 3SMPA 4Z94A 3CHWA 2VWBA 3A8YA 5AQHA 2YJFA 1XUPO 5EVZA 4B1WB 3S41A 1GLDG 1HUXA 3VENA 1JCEA 1TYQB 1NLVA 1WOQA 1J6ZA 4FOIA 5AQVA 3MN6A 3I33A 1NGGA 1GLCG 3VETA 2NLXA 2E2QA 3BF3A 2IVOA 4BRMA 3ZETB 4KBOA 2BTFA 3M3ZA 3QBWA 2KHOA 4CZGA 5BRDA 4CBWA 1EQYA 3FZLA 3BEXA 2FLOA 4NO7A 4CZMA 1HKCA 4GNIA 4CD1A 1WUAA 1ATRA 1NMDA 5AQOA 1BWFO 4FO0A 3KHYA 5EX5A 1NGIA 1Q18A 1HLUA 4H0TB 3AY9A 3F9MA 4JAXA 3QICA 4MLHA 4BC3A 4BRDA 2F9WA 4MLEA 5BPNA 1T44A 1V4SA 1RDWX 3HM8A 4FSVA 5E26A 3VGLA 3D2FB 4BGBA 2Q0UA 3QMLA 4HWIA 3LDNA 3C0BA 3CQXA 4IJAA 4FWPA 4XH4A 3CIPA 2P9KB 2V51B 2P9UB 3KVGA 3R6MA 1TYQA 2FSJA 1GLEG 5LY3A 3O4WA 4B1ZA 3G25A 4B1UB 1GLLO 4XEIA 3VGKA 3ZETA 4CZIA 3H45C 3EO3A 4H0VB 3BUZB 3MDQA 4CZLA 5LJWA 2IIRA 5AQZA 2P9PB 1SZ2A 3VEOA 3CI5A 2Q2RA 3LM2A 3FGUA 5AQNA 3SK3A 1GLBG 1LOTB 3P4IA 5F2RA 4CBXA 3VERA 2YJEA 3FZKA 4A2BA 2QWMA 3A5LC 5AQMA 1S3XA 1YUWA 2FF3B 3U9DA 2ZGZA 3A5OC 3D2FA 1SAZA 1XQSC 3EKSA 3VOVA 3HZ6A 3MN5A 4EFHA 2P9KA 3ATUA 2P9UA 5KQ8A 2HF4A 4FWLA 3LDOA 2YHYA 1XC3A 4BRPA 4FL9A 4QS8A 2QWRA 4BRKA 5JLHA 2GEMA 4WQ5A 5AFUH 1R59O 4QS9A 4XH5A 1HX1A 3RSEB 4EAHD 3LDQA 4A61A 1IG8A 1RFQA 4YDUC 2VYPA 1BO5O 3OHRA 1KAYA 1QQMA 5BR9A 3CERA 4IWVA 1BU6O 1HPMA 5FPNA 1MWMA 3O80A 4ISGA 4O5FA 5TKYA 5AQLA 4FWOA 3ZX0A 2Q31A 2P9SB 2PAVA 1DGKN 3UE5A 3ATVA 3ULEA 1JCFA 1NGFA 2FSNA 3VGMA 1NBWA 3BF1A 2HOEA 2V52B 5AQIA 5AZJB 3WXJA 3U4LA 5AZIB 3JXUA 5AQKA 5AQSA 1YXQA 3HBTA 4RCHA 3U9ZA 5AQGA 1CZAN 3CJ7A 2ASPA 2Q0RA 4CBUA 2ITMA 2F9TA 4FPBA 3H1QA 4AM7A 2HMPA 3FZFA 4CZHA 3EN9A 5CE3A 1ESVA 2P9NB 1QZ5A 3WQTA 3WQUA 2FSKA 1YVNA 2QWPA 2D4WA 4EIAA 4H5NA 4K41A 3HTVA 3M6GA 3QBXA 4A2AA 4BR4A 3UKUB 2PBDA 4BR9A 1Y64A 4XH1A 1U2VB 1X3NA 3ENOA 2ZGYA 3O1BA 4PL8A 2WUSA 5B8HA 2FXUA 3ZX2A 3ZX3A 1K8KB 1RGIA 3HSCA 1P8ZA 2A41A 4H5TA 5KPZA 2V7ZA 1IJJA 4BRLA 5AZJA 4CZKA 5AZIA 2E2OA 4LC9B 1NGHA 3ENHA 3FFKB 5EXWA 4BVOA 2P9IB 2E20A 3HI0A 4MO5A 4K42A 5FPEA 4J8FA 2CH6A 4WYBA 1TUUA 3H1VX 1V4TA 5ADXH 3H3NO 2P9NA 3R8EA 4F9OA 1HKGA 3ZEUB 1QQOA 3IMXA 4AM6A 3TPQA 3UKUA 1H1VA 2A6AA 2YCHA 3FZMA 2QWNA 3O5BA 2I7PA 4A62A 4JHDB 4BC5A 5BREA 3WEEB 1U2VA 2CH5A 5F0XA 4EHUA 3CQYA 4BR5A 4RWTA 5E84A 3GL1A 3VF6A 4BREA 1K8KA 4WQ4C 3J8AA 4BRCA 3CJ1A 2HF3A 2ZF5O 5FPMA 1KAZA 3IDHA 4CZJA 4BRHA 4WQ4A 3LM9A 4FWRA 3VF2A 3AAQA 4FWKA 3H6EA 3A0IX 4IZ9A 4CZFA 5BPLA 1ATNA 2P9IA 3GOIA 5AQJA 4WQ5C 3VEYA 2QWQA 1QHAA 1ZXOA
chains in the Genus database with same CATH superfamily
2Q97A 4H5VA 3RR8A 3VQEA 3AVAA 3PIPL 4I9LA 3M8RA 4CF1A 1JLCA 5GADP 5BPMA 1WN7A 2XY8A 1RT4A 3CJAA 3VN5A 3VQ7A 4CESA 5C0YA 4AILC 3VQBA 2GELA 2HHQA 5C2DA 1D4XA 3CJCA 1HYSA 3E9LA 3DXKB 4BWJA 2A1SA 4K8ZA 3W3DA 3T7ZA 2NRRA 4IOCL 3HJFA 4BWMA 3NMUA 2ZQBA 3CCQN 4FOEA 1KC8O 5AQTA 2IVPA 4GY2B 1HJOA 4FLWA 3MEDA 2PYLA 4C1NK 4NB4A 1U6ZA 3V9SA 2NRTA 3D0PA 1YVUA 2XY5A 5GAGP 1XC9A 3AVJA 1NOYA 3CC7N 4CI6A 3UKRA 3LP1A 3QDKA 3LPTA 3T19A 1BQNA 3O8MA 1QSSA 4KI4A 3MCAB 1YJ9N 4DB3A 5M1KA 2QWLA 4WFAL 3A5MC 2P9SA 1LWCA 1O13A 2UYTA 4IG0A 3K5LA 1S1XA 5KQDA 1KAXA 3L8BA 1IG9A 4DTPA 3NHGA 4DFMA 3DLEA 4PL7A 2GTDA 2XRIA 4B1YB 4MDBA 4BRAA 3MCPA 2ZWHA 2W6LA 3S5TA 1FKPA 4EP5A 1WBDA 2X74A 4ISFA 3F9KA 4NLBA 1TKXA 3KD5E 3GG4A 3GBTA 1S1WA 3SI6A 4KKOA 4PA1A 1HNIA 1I39A 3CCJN 3OYMA 1VSDA 2O8DB 1RTJA 3WUHA 5CY4A 4BG8A 5IWAK 3MEGA 5AQWA 5KRTA 2IS3A 4DQ8A 3VPZA 2A3ZA 4BGAA 2O8EB 3DRPA 5C10A 2OCEA 3THYB 4BQLA 4ILHA 5HRNA 3QINA 4KB0A 4QCLA 4MQ3A 3WXLA 1GLAG 1E4FT 1HQEA 2PFUA 2Z1JA 3OBYA 4KHWA 1RDDA 5IT9O 2WC9A 3P31A 3CFRA 3VEZA 1QVGM 3O3FA 4J2EA 4FJKA 4JI0K 2X6NA 3O08A 4KV8A 3L2UA 4LFCK 3LAMA 3ULEB 5C25A 4JYAK 3SYZA 4ID1A 5EY4A 3DXMA 2UUBK 3C95A 4FCYA 3EZWA 1X3MA 4TSXA 4FW1A 2JLEA 4KHNA 1SQKA 2Q36A 2I5JA 3V81A 5JICA 4DQPA 1N36K 1RBSA 4YDUA 1REVA 3E01A 1HPZA 3VTHA 1SS6A 4MO4A 4E72A 3ZSXA 1GLFO 3CC2N 4UQGA 2G8HA 1JL1A 4JD2A 2IC3A 3IFRA 4K25A 4DHYA 3SQ0A 1KD1O 2BGGA 4EP4A 4JKAA 4B1XB 4IO8A 3CCEN 1BGXT 1BA0A 5AQFA 1NKEA 4KREA 3NGYA 2W40A 3TSUA 3NGIA 4M45A 3LPUA 4BG9A 3B6PA 1XMOK 4FJMA 2E2PA 1S1UA 1VSIA 4C8NA 4JV5K 3CHWA 5AQHA 4B08A 5EVZA 1NK5A 1WAFA 3VENA 1TYQB 1NLVA 1LWEA 1J6ZA 3I0SA 4CF2A 4YOXA 3MN6A 3I33A 4CK2A 2NLXA 3BF3A 2XHBA 3ZETB 3CF5L 2BTFA 2KHOA 3SBTA 3BEXA 3U6FA 2HHXA 3MXIA 2PYJA 4DSIA 3AO5A 5JVHL 2D0AA 4DKWA 1HLUA 1IBKK 4CECA 3QICA 4BC3A 2F9WA 4MLEA 3NCIA 5BPNA 3JSMA 1T44A 5GIPA 3MEEA 1EWQA 1L3UA 3CD6N 3ZT2A 4BGBA 4BE7B 4HWIA 3LDNA 4PY5A 3CQXA 3CIPA 5KGWA 3TWHA 2V51B 2HSTA 1NJXA 3OW2M 2FSJA 4I7FA 1D9DA 3G25A 3KTQA 3R3LA 4CZIA 5SWMA 2RHKA 4WFBL 4DTMA 3HYFA 3CMAN 4H8KA 2HNZA 3NGZA 4E3SA 3C65A 1EP4A 4CZLA 3DMJA 4OPHA 1TK8A 2OZSA 4U67L 3K5MA 3VQCA 2P9PB 3L2VA 3OYNA 2FBYA 1SZ2A 3QNOA 3TAEA 3SQ1A 3SK3A 3P4IA 1WSHA 3SJJA 3FZKA 2QXFA 1KSPA 3BDPA 2HHIA 3OYCA 2FF3B 3CMEN 2ZGZA 3J81O 3K2PA 3DM2A 1L3SA 1YTUA 3CCMN 3KLIA 3G10A 1I94K 4N76A 2P9UA 2HF4A 1XC3A 2JWKA 4RW9A 1N6QA 5JENA 3TI0A 5AFUH 2HB5A 1VQLN 1HX1A 3CM5A 4RG8A 4I9QA 3LDQA 1KRPA 5J2PA 4ZTFA 3AVFA 2VYPA 3OHRA 1QSYA 2DY4A 1KAYA 5M1OA 3CERA 2YNFA 4IWVA 1BI4B 4JKGB 1U4BA 3SQ4A 1UA1A 4CEQA 1NOZA 3UE5A 3ULEA 1C0TA 4DF4A 3OYLA 1NGFA 1QSLA 3L3UA 4JK8A 2V52B 1TVRA 1CZBA 5AZJB 4OGEA 3WXJA 4CHPA 3J7YP 3HBTA 4RCHA 4KPYA 2HNYA 5KI6A 4CHYA 2HW3A 1A5VA 2HBLA 3QNNA 3ZSOA 1QZ5A 2HBMA 4K41A 4B8AB 3HTVA 3RVCA 3NFAA 3I56N 2EHGA 1Y64A 3AVBA 3VQQA 3P5JA 4CFCA 4FJLA 3K0SA 3CYGA 4KHQA 2ZD1A 2FXUA 3ZX3A 2BH1A 4G9ZA 1XHXA 1VK0A 3HSCA 1P8ZA 2A41A 4FJ5A 4H5TA 1CXQA 1XWLA 1IJJA 4JEPA 4BRLA 3OYFA 2Q3SA 3PV8A 5AZIA 4N56A 1L3TA 2O8BA 3FFKB 4CJVA 5EXWA 2ZJPL 1BIZA 2P9IB 4MO5A 4J8FA 4Z4GA 1WSFA 1C0MA 1LWFA 3NF8A 4C8LA 3IS9A 1N5YA 4WF9L 1YHQN 3R8EA 4Q5VA 1VRTA 5HRSA 1H1VA 2AJQA 1WSIA 4FYDA 3O5BA 2KZMA 2I7PA 4A62A 3T3FA 4JHDB 4IOAL 4RWTA 4EHUA 3VQ8A 5EU7A 2P1JA 3GL1A 4F8RA 1K8KA 5A2QO 4BRCA 3CCVN 1KAZA 3ENBA 3LM9A 3VF2A 1RCHA 4FWKA 2X78A 3JAMO 3RMBA 2QWQA 4YFUA 1ZXOA 3DI6A 2HBKA 3HSTB 4BRFA 5HP1A 4FLZA 5F1XA 2ATQA 4DTJA 5AFUA 1BQMA 4Z4CA 3FZHA 3ZSVA 4CJEA 3ZEUA 3SJHA 3WXIA 3UKRB 3NH2A 2KKZA 2RF2A 4OKEA 4CGFA 5LMUK 5EOYA 3C94A 2O8CA 4IO9L 4NCAA 4BRQA 2P9PA 3JS6A 3LDLA 4JKDA 4CF8A 3L4IA 1IH7A 2QW9A 5DMRA 4HHTA 3DAWA 3OBWA 5K14A 4IFEA 4HUEA 4B3TK 4HTLA 3FR0A 3TU5A 1VQ5N 2FBXA 2CGJA 3L2QA 4BR7A 4FJXA 4KHUA 2A5XA 3AV9A 3O9QA 1WSJA 4CHZA 2KW4A 1ASUA 3LWLA 3WNHA 2VCPA 3K57A 3AVIA 1UAXA 1D8YA 3KZBA 3HVTA 3HM9A 3ZSYA 3GE1A 4FJHA 2O4IA 3AA4A 3O1WA 4LF7K 3UB5A 3TTDA 1RT6A 1RT5A 5AR0A 3NF9A 1J5OA 5MLCQ 3VQAA 3LDPA 2YNGA 3U8XA 5I9EB 2A40A 3CXCM 3CG7A 1C0UA 1Q86O 3L0QA 3TABA 5C15A 4EHTA 4DR3K 2QWOA 4HUFA 3LP2A 4DTSA 2AP1A 1K73O 4J2DA 4O44A 4M3RA 1NK9A 1BG3A 3MWTA 3DLRA 2WFBA 1NK8A 3CFOA 4CJWA 2ASMA 3FFIA 1EETA 3V1RA 1BUPA 3RWUA 1ASWA 4ZHRA 3C7NA 1MA9B 4JI2K 1WLJA 4FWSA 4IXCA 4BRIA 2QA4N 1WNSA 1OKJA 4YOVA 4DQQA 2QEXN 3ZYYX 4FM0A 2E6MA 4Y1CA 4JNEA 5M1NA 4W5NA 4H0PA 4DCHA 4ZTJA 4JRPA 2E2NA 4Z4EA 3LALA 4OLBA 4CGDA 3O9RA 4CFDA 4BR0A 3B8AX 4H0XB 3J7ZO 3QFUA 2D5RA 3HVRA 3N4QA 5FPDA 1TK0A 3O9TA 3DXMB 2Z1HA 5JMVA 4CJKA 3AVLA 4W5RA 4IKFA 1YJWN 2D0PA 5AQUA 4M63C 4U7BA 3W0LA 5HL7L 4PKIA 5J2NA 3MMVA 3G0ZA 2OPRA 2VWKA 2FF6A 2XY6A 1JLGA 3PX6A 1NK6A 4YOWA 3TSQA 1KVCA 4A59A 2D0OA 4M7YA 1X9MA 5D3GA 4BVPA 2AA4A 4BC4A 1S9GA 4JD2B 4GVMA 3Q7BA 2F8SA 1DTTA 3BP8A 3HPGA 3GDQA 4JHDA 1NJIO 3FLCO 3VF4A 4FXDA 2HHWA 4E1NA 3LL3A 3F73A 5M1QA 4F2RA 4FWQA 4QS7A 4LF8K 5GAHP 3QB0A 2GV9A 4KB1A 5M1FA 1E4GT 4IFYA 4K0KK 4LF6K 3WXKA 4RTFD 2EWSA 1JCGA 1SL0A 5AQPA 3LP0A 2RPIA 3PX0A 5E41A 1XI1A 1GLJO 3SMSA 2OPQA 1ILYA 3OYGA 4CIGA 1FKOA 4B3SK 3BZCA 2HHSA 4GMJB 3S3MA 3WNGA 1EO1A 3DWLA 5AQRA 4R5PA 2BUPA 2OTJN 1TGOA 4BC2A 1S22A 4Z4IA 4YOTA 2H3GX 4KFBA 4CEBA 4X64K 1YJNN 2OANA 2FC0A 1KVAA 4M42A 2OA8A 1RBVA 3VQPA 3AA5X 4BDYA 2BDPA 4Z94A 3ASMA 1ZBLA 1M90O 4HVJA 3VTIA 1XUPO 3IKMA 1GLDG 1VQPN 4LSLA 4CFBA 3AGKA 4FLXA 4FOIA 3IRXA 1NGGA 3ZCMA 2E2QA 4BRMA 4KHPK 3QBWA 4CBWA 5J2MA 4CZMA 3ALYA 2FBVA 4GNIA 1TK5A 1VSLA 3BY5A 3DOLA 1RTIA 1NMDA 4DR2K 4JLHA 3P38A 1BWFO 3KHYA 2F8TA 3O3GA 4B8CA 4H0TB 3E66A 1T05A 4EZ6A 1RILA 4UY8O 4MLHA 1K8AO 3HM8A 4FSVA 1U49A 4JKBA 4OPAA 4DQIA 3LZIA 3C0BA 2RKIA 3O4QA 4FWPA 2P9UB 3J7AP 3OS0A 4B9VA 1GLEG 1Q81O 2KZZA 1EWRA 2OTLN 2UXBK 4XEIA 3HK2A 2HBJA 4H0VB 3DRRA 4JRQA 4NLCA 1CXUA 5LJWA 3K9JA 4R79A 4M41A 2IIRA 5AQZA 1C6VA 3LM2A 1W2BM 1NJWA 5AQNA 1GLBG 1LOTB 5JVGL 4CBXA 4HCCA 2ITGA 4NXMK 2QWMA 2KFZA 1S6PA 1NK0A 2VQFK 5AQMA 1S3XA 3A5OC 1SAZA 3IAYA 3K58A 2P9KA 1IKWA 3LDOA 3AO4A 1TL3A 4QS8A 2ZJRL 3HP6A 4OKKA 4BRKA 1XHZA 2RN2A 5JLHA 4WQ5A 3SAGA 3RSEB 1Q9XA 3S3NA 2HHVA 1Z25A 4YDUC 4X65K 4M3UA 4O55A 4CJTA 4CIEA 4PUOA 3OYKA 5BR9A 1IBMK 1HNVA 3NE6A 4BDZA 1YF5L 4ISGA 4C8MA 4CGHA 5TKYA 4FVMA 3ZX0A 3UIQA 2YV0X 1QTMA 2OPSA 1SL2A 1DGKN 4JK7A 3AO1A 3C6AA 3PSFA 3AO2A 2FSNA 3D6RA 2HOEA 4Z4FA 3OS2A 1Q9YA 5AZIB 3LAKA 2O8BB 1YXQA 3DYAA 1VQ8N 1Y97A 3THVA 4J2BA 1NKBA 4OLAA 4CBUA 5AJ3K 1VQ9N 2E4LA 1JLAA 4FPBA 4AHVA 4CZHA 2HMPA 3EN9A 1T3VA 4OPJA 1M1KO 1OH6A 3SV4A 3WQTA 3WQUA 3QBXA 4KH5A 2O8FA 2NRWA 4BR4A 3QIOA 1S5JA 3S3OA 4NYFA 1KFDA 4OKJA 4Z4HA 4DQSA 4M3ZA 4PL8A 3ZX2A 1K8KB 5FRMA 1WSEA 3V9UA 3V9XA 3VQ6A 4LC9B 2X6SA 1NGHA 1ZYQA 5C12A 4CJRA 4BVOA 2ZJQL 4JI4K 4PQUA 3K59A 1QE1A 2Z1GA 3HI0A 1IV0A 3LWMA 2CH6A 3AO3A 3H3NO 4A5AA 2P9NA 5HROA 3D45A 2HNDA 4QOZB 3HPHA 3ZEUB 3M8SA 1QQOA 3TPQA 3UKUA 2A6AA 5LMNK 3THWA 4CGIA 5CYQA 4CGJA 4LF9K 3TAQA 3VQ5A 3CQYA 2O8CB 2VG7A 5E84A 1S72N 1N32K 3OYEA 3HL8A 5C2FA 3OYJA 5FRNA 4WQ4C 4FJNA 4M3WA 3KKRA 3J8AA 4X62K 2B5JA 2QKKA 3CFPA 4CEAA 2HMIA 4IDKA 4NCBA 4WQ4A 4I2PA 3TSPA 3H6EA 3E9OA 4M3TA 4IZ9A 1ATNA 4OGCA 4CF0A 4CEFA 4BY9C 2ETJA 1D9FA 2DFEA 5DM7L 3L6QA 4H0OA 3VEXA 4CW7B 4WFNL 4JKEA 1KFSA 4C8OA 3F5TA 4BROA 3KIOA 5BR8K 4DV7K 3AAPA 1W97L 2WBNA 2A42A 3WEEA 4RW8A 4YNQA 4CF9A 3CCSN 1NGCA 3MK6A 4GV6A 2DFFA 5JS1A 1KTQA 2EX3A 4DR6K 4CIFA 1JXBA 4FK2A 1SKRA 3E9PA 3OYDA 2UUAK 1NGJA 5GINA 3CJBA 1YT3A 1X1PA 3QO9A 3R1XA 3I8BA 4GW6A 4DV5K 3MN9A 4RW4A 4ID5A 4LD0A 4GKKK 1KVBA 4H03B 4L3QA 4FJJA 3RSEA 1DEJA 2KLAA 3C7NB 3SCXA 2D0BA 3I0RA 4DG1A 2W41A 2HHTA 1NMNA 3T1AA 4Y1DA 4FW2A 2V7YA 3L2RA 4A57A 1Z6RA 1Q8IA 4EZ9A 4JKHA 1KCFA 4I6MA 4Z0UA 4YOYA 3E1YA 3OYAA 2VG5A 3SUNA 3V1QA 1GOAA 4CHQA 4HUGA 5ELZA 4CJFA 3HPOA 4DV6K 2YHXA 3ZLJA 3TARA 2P9LA 2DTUA 4DLEA 5FDLA 3M8PA 5DK5A 3VEWA 3KJVA 4DSFA 2NZTA 4Y0WA 5C24A 3QESA 3MECA 2XO7A 4FM1A 4OX9K 2IVNA 3CCLN 2QKBA 4OPKA 3ZT0A 3L2WA 4CEDA 2J4RA 1ZC6A 3HOTA 3G6EN 5LJVA 3QFPA 3FE1A 3LZJA 1HKBA 3RRHA 2DFHA 1A5XA 1C1CA 5HBMA 2NRXA 3A2FA 1XMQK 4L8RB 1NNEA 3K5NA 1T8EA 5KPRA 2GWJA 1QQNA 2IOCA 2NRVA 1QZ6A 2NRHA 4FPAA 1HRHA 3ZSQA 1C0FA 2QK9A 3ITHA 4CJQA 1TAQA 1BA1A 4FWMA 4JS5A 3EL2A 4DR4K 3ID6A 3VQ4A 2YKMA 4IJNA 1KXPA 1NGEA 2WONA 3O6WA 4DUYK 4ISEA 1W7AA 1U04A 1S6QA 4CVNE 1RBTA 2E1ZA 3SLCA 3AARA 3CCRN 1GOBA 3KWIA 3RMCA 4DWIA 3MN7A 3EZ5A 3H46O 4N5SA 1BL3A 4LFAK 4BE2A 2A1RA 2GUPA 3PY8A 5J2QA 3THXA 4JI5K 3KLFA 1OH5A 1X9WA 2GX9A 3M1FA 3WXMB 5JLFA 3KK2A 4WE1A 2HVIA 4B3OA 4PKGA 2KFNA 1EKEA 1W0HA 3PUFA 3HP9A 3CETA 3U3GA 5BN8A 3SV3A 2Y1JA 4B9MA 3PO4A 2QM1A 5KPTA 3B6OA 5BN9A 4B9UA 4PKHA 2VG6A 3J80O 3D2EA 4KAZA 2E88A 3T69A 3C6UA 1ATSA 3DLHA 4DTUA 1NGDA 4F3OA 4DFKA 1BISA 3V6DA 1X9JA 1RT3A 3NDKA 5AQQA 4GKJK 2I7NA 1VQ7N 2ASOA 3KWGA 1VSEA 2JGUA 1BIUA 3EKUA 4JI1K 4JN4A 4DV2K 3N4PA 3DLKA 4DSJA 1TKTA 4OO1J 4H5RA 4IFVA 1Z05A 3DLGA 3I55N 3OA9A 1TV6A 4AHRA 5CR4A 4BR2A 4CEOA 4DQRA 4CJSA 3NH0A 3SMPA 4YHHK 3CM6A 2W42A 2P5GA 3ZSWA 3SUQA 2VWBA 3A8YA 4ILGB 1I3AA 2YJFA 4HTUA 3S41A 1TKDA 5FROA 2O4GA 1HUXA 4DTRA 1WOQA 1VQ6N 4N41A 1HNXK 3VETA 1GLCG 4DSEA 1IBLK 4KBOA 3M3ZA 4CZGA 3QEIA 4W5QA 1EQYA 3FZLA 2FLOA 4NO7A 4FZZA 1HKCA 2OPPA 3MX5A 1ATRA 5EX5A 1JLFA 1RT2A 2G8KA 1XNRK 4DLGA 2GBZA 3HRGA 3AY9A 4JAXA 3G4SN 1QHTA 1V4SA 1RDWX 2HHHK 5E26A 4ILJA 4FVUA 2Q0UA 3DOKA 1L5UA 5I42A 3VA0A 1GOCA 2P9KB 4K8XA 4YORA 4DTNA 3P1GA 1IKYA 1NG9A 1VSMA 2IGIA 4JI8K 1T7PA 4DV1K 3CCUN 4O4GA 3EEQA 2B6AA 3RTVA 1UOCA 1JKHA 3VGKA 1EX4A 1YI2N 1S1TA 3BUZB 1UWBA 3OJUA 3MDQA 4CEZA 5LL6Z 4BACA 4FLYA 1X9SA 1DTQA 3KKSA 3VEOA 3CI5A 4CERA 1Q82O 1JLBA 1WBBA 4E0DA 3SZ2A 3VERA 4A2BA 3V4IA 1VQ4N 3A5LC 1YUWA 2QI2A 1N33K 4DUZK 1FXXA 3D2FA 4YY3K 1B9FA 1ZBFA 3VOVA 4EFHA 3ATUA 4FWLA 4BRPA 1VQMN 4FL9A 4LH4A 3QEWA 4RW6A 3C6TA 4KI6A 1R59O 1UA0A 4EAHD 2OYQA 3QETA 1RFQA 2PY5A 4CE9A 1J54A 4B9LA 1BO5O 3T1YK 1QQMA 3HOSA 5KRSA 4CK1A 1RDUA 5FPNA 4C8KA 4FK4A 1MWMA 1B92A 2O8FB 1FW6A 2BE2A 4CK3A 3SNNA 3NH1A 2PAVA 3ATVA 2HHUA 4DV3K 4E7IA 3P83D 3LANA 1VRUA 1NBWA 3BF1A 5AQIA 2W00A 3KK3A 4N47A 3U4LA 1U45A 3ULDA 1A5WA 1IKXA 1HNWK 3ISNC 5AQGA 3K5OA 1N34K 1OH7A 2ASPA 4NCGA 2ITMA 1JLQA 3H1QA 4DU4A 5HLFA 3FZFA 4CJ4A 5FLXO 3TAFA 1LV5A 1ESVA 2P9NB 1RBUA 3PIOL 2FSKA 1YVNA 2QWPA 4EIAA 1LW2A 3QERA 3UKUB 3THWB 3CC4N 1WSGA 4XH1A 1Z26A 1S1VA 4JI6K 5B8HA 2QTDA 1RGIA 1YTAA 5T7BA 3ZSZA 2RE2A 5KPZA 4Q0BA 2E6LA 4C1NI 4CZKA 3ZT4A 5SZTA 1TL1A 1OVQA 2R7YA 3SUOA 2IDOA 3V9WA 3SUPA 1NJYA 4JI7K 1J53A 1VSJA 4DFPA 4CHNA 5FPEA 4DSKA 3ZSRA 4MFBA 4WYBA 2UXDK 3H1VX 4KTQA 1V4TA 4E19A 5ADXH 3Q7CA 1MU2A 4F9OA 4DR7K 1RBRA 1NK4A 4GV3A 1K6YA 4FLUA 3IMXA 4FLTA 2YCHA 3FZMA 2QWNA 4M3XA 5BREA 3WEEB 1U2VA 3O3HA 4FJ7A 4OVLA 1JL2A 3VF6A 5H1SQ 4KTZA 3QIPA 4AQYK 3CJ1A 4CZJA 4BRHA 5CZ1A 1FJGK 4FWRA 1RTHA 3A0IX 4CZFA 5BPLA 2UXCK 4B3MK 3GOIA 1VSHA 4WQ5C 3VEYA 4IG3A 1QHAA 1OVYA 4XH4A 1R0AA 2QXLA 2ZM6K 3HO1A 3O9SA 5AQYA 4CHOA 4JS4A 1NM1A 1DT9A 3LDSA 2G8WA 1C0GA 3DLLL 3CYMA 3V9ZA 4BECA 3PO5A 4CGGA 4E1MA 3TR8A 3R9PA 1VQNN 4I6MB 4KHYA 4CZEA 1U47A 2ZE2A 4PWDA 1RDBA 4DV4K 4X66K 4AHUA 1JJ2M 4BRGA 2P9LB 2G8UA 1SKWA 3H3OB 3OY9A 1NWKA 3O9UA 4I2QA 3TAMA 1U48A 1P90A 1J5EK 1EXQA 3WT0A 5HRRA 3QEPA 1VSKA 3QLHA 4FWNA 3WNEA 2Z1IA 5BRFA 2NRZA 2WOMA 3KK1A 4KO0A 4FLVA 1G99A 1MDUB 3VEVA 1NGAA 1JLEA 1DLOA 4FZYA 3EY1A 1ITGA 1MWKA 2W6KA 3DXKA 2VGNA 4C23A 1HQUA 3M5RA 4LSNA 3OTOK 4JI3K 2GWKA 1IKVA 2YHWA 2YI1A 3TTCA 2F96A 4FZXC 4AH9A 2D1KA 1FK9A 2B4JA 3K9KA 1LCUA 5JS2A 3BZKA 4CJUA 3OYIA 3NVMA 3ID8A 5CZ2A 2G8FA 1T6DA 3AVGA 3DJCA 4KRFA 4JKCA 4O0JA 3I8DA 4DR1K 4CJ7A 4H4MA 3HXMA 1NU0A 4NXNK 4M3YA 4B3RK 1T6CA 2UUCK 2YKNA 4ELVA 5ADXA 4DR5K 4B9TA 3THXB 2Y1IA 3CJ9A 4H5WA 1O1WA 4LY7A 3DLBA 2YNIA 4DV0K 1C1BA 1DKGD 2E8AA 3AVCA 4B9QA 3TANA 1BDGA 4E7KA 3IUCA 2IAJA 1ZBSA 1YAGA 1RTDA 4F4KA 3A5NC 2KTQA 4DS4A 4AHCA 4DU1A 5CHIA 2G8VA 1ZBHA 3QEXA 4G1QA 3D2EB 2LSNA 4BQZA 4F3TA 2Q1NA 4CD3A 3AA3A 4B1VA 4K43A 2XY7A 1LAVA 4BRNA 1J9AA 2DPNA 4H4OA 2CGKA 3PSIA 1BOTO 2YNHA 2O8DA 1ASVA 1K9MO 1SUQA 4ELUA 2HVHA 2E5LK 4IEIA 3MX2A 1RT1A 1Q7YO 3EYZA 4DSLA 2O8EA 4BDPA 3AVHA 3THYA 3VMFB 3NAEA 4H0YB 4ELTA 1KQSM 3VESA 1F21A 1NKCA 2VQEK 3EE8A 2CGLA 3QEVA 4DU3A 4AHSA 3AVNA 3H08A 4V19S 5BRHA 3RMDA 3D7EO 3RMAA 4E7HA 3AA2A 2E1YA 3M8QA 1NK7A 4O5BA 4O8KA 4E1JA 4ICLA 4M7XA 3SBGA 1NGBA 1OH8A 5AQXA 3S9HA 3OJSA 4CEEA 2WTUA 2OZMA 1SKSA 1TKZA 4JKFA 4DS5A 4XIUA 3HT3A 2NUBA 1TUYA 3P39A 1RDCA 1HNZK 3KD1E 3O4NA 3L3VA 1RT7A 1B9DA 4IEEA 3JYTA 1VQKN 4FK0A 2G8IA 3SPZA 1YIJN 4B1WB 4E89A 4DF8A 3MXMA 2UU9K 1JCEA 3OYHA 5GIOA 1RDAA 3KK7A 3CQ8A 5AQVA 1HMVA 1QVFM 3OS1A 3CPWM 2IVOA 5DM6L 5TKWA 1ZBIA 5BRDA 3AGRA 1JXEA 3KLHA 4CD1A 1WUAA 4MDAA 5AQOA 4FO0A 1NGIA 5M1PA 1Q18A 3TTFA 3VQDA 4IDHA 4DMNA 3RRGA 3F9MA 1WB9A 4BRDA 2PZSA 4F2SA 4CJ5A 1CZ9A 2VGMA 3AVKA 3VGLA 3D2FB 5KGXA 3QMLA 4IBNA 4IJAA 3OYBA 3KVGA 3R6MA 1TYQA 3LP3A 4KH4A 4XJXA 4BE0A 5LY3A 3O4WA 4B1ZA 4OJRA 1RNHA 4B1UB 5J1EA 1KLNA 1GLLO 3ZETA 1HYZA 3H45C 3EO3A 4FJ8A 4A5BA 4LFBK 4WCEL 3V1OA 4GV9A 4E7LA 1BCOA 1HJRA 4FJ9A 3MWPA 2D0CA 4JK9A 1QQCA 2F7TA 2Q2RA 3FGUA 1BCMA 5F2RA 3U3YA 2YJEA 4CJLA 3SAHA 3U9DA 1KLMA 1XQSC 3EKSA 3HZ6A 3MN5A 5KQ8A 5I3UA 1SV5A 1W9HA 4DFJA 2YHYA 1VAZA 2QWRA 4LF4K 3G71N 4NYNA 3CPEA 3WNFA 2GEMA 4QS9A 4XH5A 1QS4A 4A61A 1IG8A 4AF1A 4CCHA 4QAGA 3MAQA 3NBPA 2YHBA 4CJ3A 4O8UA 1LW0A 1BU6O 1HPMA 3T1HK 1E3MA 3O80A 4O5FA 1ZBUA 1BHLA 4LH5A 3PX4A 1TAUA 5AQLA 4FWOA 4FJGA 2NNWA 2Q31A 3PLAA 3RR7A 1CLQA 2P9SB 5GAEP 4DTOA 1JCFA 4J2AA 1IO2A 1HR0K 1HYVA 3VGMA 4CFAA 3SQ2A 3NF7A 4RW7A 1VHXA 3JXUA 3NVKA 5AQKA 5AQSA 4PHTX 3ZT1A 3U9ZA 1S9EA 4W5OA 2F4VK 1CZAN 4BEBA 3CJ7A 2Q0RA 5HOOA 2F9TA 4B9NA 3F2KA 3AVMA 4AM7A 5CE3A 3BGRA 1LAWA 1BI4A 4JKGA 2D4WA 4H5NA 3M6GA 4A2AA 4B9SA 3KLEA 4BE1A 1T03A 5CYMA 2PBDA 3OVNA 4BR9A 4HCBA 2C1GA 2P51A 5KTQA 1U2VB 1X3NA 3ENOA 2ZGYA 3O1BA 2JWLA 2WUSA 2YHAA 1NJZA 4CJPA 2V7ZA 4KHSA 3ZT3A 5AZJA 1VSFA 2E2OA 1SL1A 2KQ2A 2YX6A 3ENHA 3NF6A 5C42A 4FJIA 1L3VA 2E20A 2C1IA 1G15A 4K42A 4AHTA 4LF5K 1TUUA 3C6HA 1HKGA 4FM2A 4AM6A 4KTWA 2VWJA 3EE9A 4BC5A 3MXJA 1N8RO 5F0XA 2CH5A 4BR5A 2FBTA 5HRPA 2BANA 3DRSA 4IOXA 1XNQK 3SAFA 4GVEA 2P5OA 4DTXA 3SPYA 4KH6A 4BREA 3TAGA 4YOUA 1YITN 2HF3A 1VQON 2ZF5O 5FPMA 1WAJA 1C1AA 3IDHA 3VA3A 4E7JA 4O0IA 3AAQA 3L4QA 3TAPA 2P9IA 5AQJA 3KLGA 3IG1A 1D5AA 4W5TA 3VQ9A 2GUIA
chains in the Genus database with same CATH topology
2QXLA 2Q97A 4H5VA 2HBKA 3O9SA 4BRFA 5AQYA 3PIPL 3L6QA 4H0OA 3VEXA 5F1XA 1NM1A 1DT9A 4JKEA 5AFUA 4WFNL 3FZHA 5GADP 3ZEUA 3CJAA 3F5TA 4BROA 5BPMA 5C0YA 3SJHA 1C0GA 3UKRB 3WXIA 3DLLL 3AAPA 4BECA 1W97L 2GELA 2KKZA 2WBNA 2A42A 5C2DA 3WEEA 5EOYA 3CCSN 4IO9L 3R9PA 4BRQA 1D4XA 1NGCA 2P9PA 3MK6A 3CJCA 4GV6A 1VQNN 3JS6A 4I6MB 3LDLA 4CZEA 3E9LA 3DXKB 4JKDA 3L4IA 2QW9A 3W3DA 3T7ZA 3DAWA 2NRRA 3OBWA 4IFEA 4IOCL 3NMUA 4HTLA 3FR0A 3TU5A 3CCQN 1VQ5N 3E9PA 4FOEA 2CGJA 1KC8O 4BR7A 4BRGA 1JJ2M 2P9LB 1NGJA 5AQTA 2IVPA 3CJBA 1HJOA 4GY2B 5GINA 2A5XA 3H3OB 4C1NK 3O9QA 1NWKA 4NB4A 3R1XA 1U6ZA 3I8BA 3O9UA 2NRTA 2VCPA 3MN9A 5GAGP 4H03B 1P90A 3KZBA 4L3QA 3RSEA 1DEJA 2KLAA 3WT0A 3C7NB 3CC7N 3GE1A 4CI6A 4FWNA 3O1WA 5BRFA 2NRZA 3UKRA 3UB5A 3TTDA 2W41A 5AR0A 3QDKA 1G99A 1MDUB 5MLCQ 3VEVA 1NGAA 2V7YA 3LDPA 4A57A 1Z6RA 3U8XA 4JKHA 5I9EB 2A40A 3O8MA 3CXCM 1MWKA 4I6MA 3MCAB 4YOYA 3E1YA 1YJ9N 3DXKA 2VGNA 3L0QA 4C23A 3M5RA 4DB3A 5C15A 5M1KA 2QWLA 4WFAL 4EHTA 3A5MC 2P9SA 2QWOA 1O13A 2UYTA 2AP1A 5ELZA 2GWKA 1K73O 2YHXA 5KQDA 1KAXA 2YHWA 2YI1A 3TTCA 2P9LA 2D1KA 1BG3A 4PL7A 2GTDA 3MWTA 2WFBA 4B1YB 3K9KA 1LCUA 4MDBA 4BRAA 2ASMA 3VEWA 3MCPA 3NVMA 3ID8A 2NZTA 2ZWHA 4Y0WA 1BUPA 1T6DA 3DJCA 2IVNA 3CCLN 4ISFA 4JKCA 4NLBA 3C7NA 1MA9B 4CJ7A 4FWSA 3GG4A 4IXCA 3GBTA 4BRIA 1T6CA 2QA4N 2J4RA 1OKJA 1ZC6A 4YOVA 3HOTA 2QEXN 3G6EN 3ZYYX 5LJVA 3QFPA 4JNEA 3FE1A 5ADXA 1HKBA 5M1NA 3CCJN 3CJ9A 4H0PA 4DCHA 2NRXA 2E2NA 4H5WA 3WUHA 4BG8A 3O9RA 5KPRA 5AQWA 2GWJA 1QQNA 2NRVA 4BR0A 4DQ8A 3B8AX 3VPZA 2A3ZA 4H0XB 3J7ZO 1DKGD 1QZ6A 2E8AA 3QFUA 4BGAA 2NRHA 4B9QA 1BDGA 3N4QA 4FPAA 5FPDA 3IUCA 1ZBSA 5C10A 3O9TA 1YAGA 3DXMB 1C0FA 4BQLA 5JMVA 4ILHA 1YJWN 1BA1A 2D0PA 4FWMA 3A5NC 3EL2A 5AQUA 3ID6A 4M63C 3WXLA 1GLAG 1KXPA 1E4FT 1NGEA 2PFUA 3O6WA 3OBYA 4IJNA 3W0LA 4ISEA 5HL7L 4PKIA 3D2EB 2WC9A 2E1ZA 3MMVA 3P31A 3SLCA 4BQZA 3AARA 3VEZA 3CCRN 2FF6A 2Q1NA 3KWIA 4CD3A 1QVGM 3MN7A 4B1VA 4K43A 3H46O 4BRNA 4YOWA 3TSQA 4A59A 2DPNA 2D0OA 2GUPA 4M7YA 2CGKA 2AA4A 4BC4A 4BVPA 3O08A 4JD2B 1BOTO 2GX9A 3Q7BA 1K9MO 3M1FA 3ULEB 3WXMB 3BP8A 4IEIA 5JLFA 3GDQA 3MX2A 4JHDA 1Q7YO 1NJIO 3FLCO 3VF4A 4PKGA 5EY4A 3LL3A 3CETA 3DXMA 5M1QA 3VMFB 5BN8A 4FWQA 4QS7A 5GAHP 3QB0A 4H0YB 1KQSM 3EZWA 3VESA 2QM1A 1X3MA 1SQKA 5KPTA 5M1FA 3EE8A 1E4GT 2CGLA 5BN9A 3WXKA 4PKHA 4RTFD 3D2EA 2Q36A 2E88A 3T69A 5BRHA 5JICA 3D7EO 1ATSA 2EWSA 1NGDA 1JCGA 5AQPA 4YDUA 1X9JA 2E1YA 3VTHA 1SS6A 1GLJO 3SMSA 4MO4A 5AQQA 1ILYA 3CC2N 1GLFO 2I7NA 4O8KA 4E1JA 1VQ7N 2ASOA 3KWGA 4M7XA 4JD2A 3SBGA 1NGBA 3EKUA 3IFRA 4K25A 4JN4A 5AQXA 4DHYA 1KD1O 3DWLA 5AQRA 1EO1A 3N4PA 2BUPA 4JKAA 4IO8A 4B1XB 3CCEN 1BA0A 5AQFA 2OTJN 4OO1J 4JKFA 4BC2A 4H5RA 2W40A 1S22A 3TSUA 1Z05A 4YOTA 3I55N 1TUYA 3P39A 3OA9A 2H3GX 1YJNN 4BG9A 2OANA 2E2PA 5CR4A 4BR2A 3SMPA 4IEEA 1VQKN 4Z94A 3CHWA 2VWBA 3A8YA 4ILGB 3VTIA 1M90O 5AQHA 2YJFA 1YIJN 1XUPO 5EVZA 4B1WB 3IKMA 3S41A 1GLDG 1HUXA 3VENA 1JCEA 1TYQB 1VQPN 1NLVA 1WOQA 1J6ZA 5GIOA 3KK7A 1VQ6N 3AGKA 4FOIA 5AQVA 4YOXA 3MN6A 3I33A 1NGGA 1GLCG 3VETA 1QVFM 2NLXA 3CPWM 2E2QA 3BF3A 2IVOA 4BRMA 3ZETB 5DM6L 3CF5L 4KBOA 2BTFA 3M3ZA 3QBWA 2KHOA 5TKWA 4CZGA 5BRDA 3AGRA 4CBWA 1EQYA 3FZLA 3SBTA 3BEXA 2FLOA 4NO7A 4CZMA 1HKCA 4GNIA 4CD1A 1WUAA 3MX5A 4MDAA 1ATRA 1NMDA 5AQOA 3P38A 1BWFO 4FO0A 3KHYA 5EX5A 1NGIA 5JVHL 5M1PA 1Q18A 4DKWA 1HLUA 3TTFA 4H0TB 3E66A 4IDHA 3HRGA 4UY8O 3AY9A 3F9MA 4JAXA 3G4SN 3QICA 4MLHA 4BC3A 4BRDA 2F9WA 4MLEA 5BPNA 1T44A 1V4SA 5GIPA 1K8AO 1RDWX 3HM8A 4FSVA 3CD6N 5E26A 2VGMA 4ILJA 4JKBA 4OPAA 3VGLA 3D2FB 4BGBA 2Q0UA 4FVUA 4BE7B 3QMLA 4HWIA 3LDNA 3C0BA 3CQXA 4IJAA 4FWPA 4XH4A 3CIPA 2P9KB 4YORA 2V51B 2HSTA 2P9UB 3KVGA 3R6MA 3OW2M 1TYQA 2FSJA 4KH4A 4XJXA 1GLEG 5LY3A 3O4WA 4B1ZA 3G25A 4B1UB 3CCUN 1Q81O 3R3LA 2OTLN 1GLLO 4XEIA 3VGKA 3ZETA 4CZIA 1YI2N 2HBJA 2RHKA 3H45C 4WFBL 3EO3A 4H0VB 3BUZB 4A5BA 3CMAN 4NLCA 4WCEL 3MDQA 4GV9A 3C65A 4CZLA 3K9JA 4R79A 4OPHA 5LJWA 3MWPA 2IIRA 4U67L 5AQZA 2P9PB 4JK9A 1SZ2A 3VEOA 3CI5A 2F7TA 2Q2RA 3LM2A 1W2BM 3FGUA 1Q82O 5AQNA 3SK3A 1GLBG 1LOTB 3P4IA 5F2RA 4CBXA 3VERA 5JVGL 2YJEA 3FZKA 4A2BA 2QWMA 3SAHA 1VQ4N 3A5LC 5AQMA 1S3XA 1YUWA 2FF3B 2QI2A 3U9DA 2ZGZA 3CMEN 3A5OC 3D2FA 1SAZA 1XQSC 3EKSA 3CCMN 3VOVA 3HZ6A 3MN5A 4EFHA 2P9KA 3ATUA 2P9UA 5KQ8A 2HF4A 4FWLA 3LDOA 2YHYA 1XC3A 4BRPA 1VQMN 1VAZA 4FL9A 4QS8A 2QWRA 2ZJRL 3G71N 2JWKA 4BRKA 3CPEA 5JLHA 2GEMA 4WQ5A 5AFUH 1R59O 4QS9A 4XH5A 3SAGA 1HX1A 3RSEB 1VQLN 4EAHD 3LDQA 4A61A 1IG8A 4AF1A 1RFQA 4YDUC 2VYPA 4U7BA 1BO5O 3OHRA 1KAYA 1QQMA 5M1OA 5BR9A 3CERA 4O8UA 3HOSA 4IWVA 1RDUA 1BU6O 1HPMA 5FPNA 4JKGB 1MWMA 1YF5L 3O80A 4ISGA 4O5FA 5TKYA 5AQLA 4FWOA 3ZX0A 2NNWA 2Q31A 3PLAA 2P9SB 2PAVA 1DGKN 4JK7A 3ATVA 3UE5A 3ULEA 5GAEP 3C6AA 1JCFA 1NGFA 2FSNA 3D6RA 3VGMA 1NBWA 3BF1A 2HOEA 4JK8A 2V52B 5CHIA 5AQIA 2W00A 5AZJB 3WXJA 3U4LA 5AZIB 3JXUA 1Q86O 3NVKA 5AQKA 5AQSA 1YXQA 4PHTX 3HBTA 4RCHA 3U9ZA 5AQGA 1VQ8N 1CZAN 4BEBA 3CJ7A 2ASPA 2Q0RA 4CBUA 2ITMA 5HOOA 2F9TA 1VQ9N 4FPBA 3H1QA 3F2KA 4AM7A 2HMPA 3FZFA 4CZHA 3EN9A 1T3VA 2HBLA 5CE3A 1M1KO 1ESVA 2P9NB 4JKGA 1QZ5A 3WQTA 3WQUA 3PIOL 2FSKA 1YVNA 2QWPA 2D4WA 2HBMA 4H5NA 4K41A 4EIAA 3HTVA 3M6GA 3QBXA 3RVCA 4KH5A 4A2AA 2NRWA 4BR4A 3UKUB 3I56N 2PBDA 4BR9A 3CC4N 1Y64A 2C1GA 4XH1A 1U2VB 1X3NA 3ENOA 2ZGYA 3O1BA 2JWLA 4PL8A 2WUSA 2QTDA 2FXUA 3ZX2A 3ZX3A 1K8KB 5B8HA 1RGIA 2BH1A 4G9ZA 3HSCA 1P8ZA 2A41A 4H5TA 2RE2A 5KPZA 2V7ZA 1IJJA 4JEPA 4BRLA 5AZJA 4C1NI 4CZKA 5AZIA 2E2OA 4LC9B 1NGHA 2YX6A 3ENHA 3FFKB 5C12A 5EXWA 2ZJPL 4BVOA 2ZJQL 2P9IB 2E20A 2C1IA 3HI0A 4MO5A 4K42A 5FPEA 4J8FA 2CH6A 4WYBA 1TUUA 3H1VX 1V4TA 5ADXH 3Q7CA 3H3NO 4A5AA 2P9NA 4WF9L 1YHQN 3R8EA 4F9OA 3C6HA 1HKGA 4GV3A 3ZEUB 1QQOA 3IMXA 4AM6A 3TPQA 3UKUA 1H1VA 2A6AA 3EE9A 2YCHA 3FZMA 2QWNA 3O5BA 2I7PA 4A62A 4JHDB 4BC5A 1N8RO 5BREA 4IOAL 3WEEB 1U2VA 2CH5A 5F0XA 4EHUA 3CQYA 4BR5A 4RWTA 5E84A 4IOXA 1S72N 3SAFA 3GL1A 4GVEA 3VF6A 5C2FA 4KH6A 4BREA 5H1SQ 1K8KA 4WQ4C 3J8AA 4BRCA 4YOUA 3CJ1A 1YITN 2HF3A 1VQON 2ZF5O 5FPMA 1KAZA 3CCVN 3IDHA 4CZJA 4BRHA 3ENBA 4WQ4A 3LM9A 4FWRA 3VF2A 3AAQA 3L4QA 4FWKA 3H6EA 3TSPA 3A0IX 3E9OA 4IZ9A 4CZFA 5BPLA 1ATNA 2P9IA 3GOIA 5AQJA 4BY9C 4WQ5C 3VEYA 2QWQA 1QHAA 5DM7L 1OVYA 1ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXL A;  2Q97 A;  4H5V A;  4BRF A;  5AQY A;  3L6Q A;  4H0O A;  3VEX A;  5F1X A;  1NM1 A;  5AFU A;  3FZH A;  3ZEU A;  3CJA A;  4BRO A;  5BPM A;  3SJH A;  1C0G A;  3UKR B;  3WXI A;  3AAP A;  2GEL A;  2A42 A;  3WEE A;  5EOY A;  3R9P A;  4BRQ A;  1D4X A;  1NGC A;  2P9P A;  3MK6 A;  3CJC A;  3JS6 A;  4I6M B;  3LDL A;  4CZE A;  3DXK B;  3L4I A;  2QW9 A;  3W3D A;  3DAW A;  4HTL A;  3FR0 A;  3TU5 A;  4FOE A;  2CGJ A;  4BR7 A;  4BRG A;  2P9L B;  1NGJ A;  5AQT A;  2IVP A;  3CJB A;  1HJO A;  4GY2 B;  2A5X A;  3H3O B;  1NWK A;  4NB4 A;  1U6Z A;  3I8B A;  2VCP A;  3MN9 A;  4H03 B;  3KZB A;  4L3Q A;  3RSE A;  1DEJ A;  3WT0 A;  3C7N B;  3GE1 A;  4CI6 A;  4FWN A;  3O1W A;  5BRF A;  3UKR A;  3UB5 A;  2W41 A;  5AR0 A;  3QDK A;  1G99 A;  1MDU B;  3VEV A;  1NGA A;  2V7Y A;  3LDP A;  1Z6R A;  3U8X A;  5I9E B;  2A40 A;  3O8M A;  1MWK A;  4I6M A;  3DXK A;  3L0Q A;  4C23 A;  4DB3 A;  2QWL A;  4EHT A;  3A5M C;  2P9S A;  2QWO A;  2UYT A;  2AP1 A;  5ELZ A;  2GWK A;  2YHX A;  5KQD A;  1KAX A;  2YHW A;  2YI1 A;  2P9L A;  2D1K A;  1BG3 A;  4PL7 A;  2GTD A;  4B1Y B;  1LCU A;  4BRA A;  2ASM A;  3VEW A;  3MCP A;  3ID8 A;  2NZT A;  2ZWH A;  4Y0W A;  1BUP A;  1T6D A;  3DJC A;  2IVN A;  4ISF A;  3C7N A;  1MA9 B;  4CJ7 A;  4FWS A;  3GG4 A;  4IXC A;  3GBT A;  4BRI A;  1T6C A;  2J4R A;  1OKJ A;  1ZC6 A;  5LJV A;  3QFP A;  4JNE A;  3FE1 A;  5ADX A;  1HKB A;  3CJ9 A;  4H0P A;  4DCH A;  2E2N A;  4H5W A;  3WUH A;  4BG8 A;  5KPR A;  5AQW A;  2GWJ A;  1QQN A;  4BR0 A;  4DQ8 A;  3B8A X;  3VPZ A;  2A3Z A;  4H0X B;  1DKG D;  1QZ6 A;  2E8A A;  3QFU A;  4BGA A;  2NRH A;  4B9Q A;  1BDG A;  4FPA A;  5FPD A;  3IUC A;  1ZBS A;  1YAG A;  3DXM B;  1C0F A;  4BQL A;  5JMV A;  1BA1 A;  2D0P A;  4FWM A;  3A5N C;  3EL2 A;  5AQU A;  4M63 C;  3WXL A;  1GLA G;  1KXP A;  1E4F T;  1NGE A;  3O6W A;  4IJN A;  3W0L A;  4ISE A;  4PKI A;  3D2E B;  2E1Z A;  3MMV A;  3SLC A;  4BQZ A;  3AAR A;  3VEZ A;  2FF6 A;  2Q1N A;  4CD3 A;  3MN7 A;  4B1V A;  4K43 A;  3H46 O;  4BRN A;  2DPN A;  2D0O A;  2GUP A;  4M7Y A;  2CGK A;  2AA4 A;  4BC4 A;  4BVP A;  3O08 A;  4JD2 B;  1BOT O;  3M1F A;  3ULE B;  3BP8 A;  5JLF A;  3GDQ A;  4JHD A;  3FLC O;  3VF4 A;  4PKG A;  5EY4 A;  3LL3 A;  3CET A;  3DXM A;  5BN8 A;  4FWQ A;  4QS7 A;  3QB0 A;  4H0Y B;  3EZW A;  3VES A;  2QM1 A;  1X3M A;  1SQK A;  5KPT A;  1E4G T;  2CGL A;  5BN9 A;  3WXK A;  4PKH A;  4RTF D;  3D2E A;  2Q36 A;  2E88 A;  5BRH A;  5JIC A;  3D7E O;  1ATS A;  2EWS A;  1NGD A;  1JCG A;  5AQP A;  4YDU A;  1X9J A;  2E1Y A;  1GLJ O;  3SMS A;  4MO4 A;  5AQQ A;  1GLF O;  2I7N A;  4O8K A;  4E1J A;  2ASO A;  4M7X A;  4JD2 A;  1NGB A;  3EKU A;  3IFR A;  4K25 A;  4JN4 A;  5AQX A;  4DHY A;  3DWL A;  5AQR A;  2BUP A;  4B1X B;  4IO8 A;  1BA0 A;  5AQF A;  4BC2 A;  4H5R A;  2W40 A;  1S22 A;  1Z05 A;  1TUY A;  2H3G X;  4BG9 A;  2OAN A;  2E2P A;  4BR2 A;  3SMP A;  4Z94 A;  3CHW A;  2VWB A;  3A8Y A;  5AQH A;  2YJF A;  1XUP O;  5EVZ A;  4B1W B;  3S41 A;  1GLD G;  1HUX A;  3VEN A;  1JCE A;  1TYQ B;  1NLV A;  1WOQ A;  1J6Z A;  4FOI A;  5AQV A;  3MN6 A;  3I33 A;  1NGG A;  1GLC G;  3VET A;  2NLX A;  2E2Q A;  3BF3 A;  2IVO A;  4BRM A;  3ZET B;  4KBO A;  2BTF A;  3M3Z A;  3QBW A;  2KHO A;  4CZG A;  5BRD A;  4CBW A;  1EQY A;  3FZL A;  3BEX A;  2FLO A;  4NO7 A;  4CZM A;  1HKC A;  4GNI A;  4CD1 A;  1WUA A;  1ATR A;  1NMD A;  5AQO A;  1BWF O;  4FO0 A;  3KHY A;  5EX5 A;  1NGI A;  1Q18 A;  1HLU A;  4H0T B;  3AY9 A;  3F9M A;  4JAX A;  3QIC A;  4MLH A;  4BC3 A;  4BRD A;  2F9W A;  4MLE A;  5BPN A;  1T44 A;  1V4S A;  1RDW X;  3HM8 A;  4FSV A;  5E26 A;  3VGL A;  3D2F B;  4BGB A;  2Q0U A;  3QML A;  4HWI A;  3LDN A;  3C0B A;  3CQX A;  4IJA A;  4FWP A;  4XH4 A;  3CIP A;  2P9K B;  2V51 B;  2P9U B;  3KVG A;  3R6M A;  1TYQ A;  2FSJ A;  1GLE G;  5LY3 A;  3O4W A;  4B1Z A;  3G25 A;  4B1U B;  1GLL O;  4XEI A;  3VGK A;  3ZET A;  4CZI A;  3H45 C;  3EO3 A;  4H0V B;  3BUZ B;  3MDQ A;  4CZL A;  5LJW A;  2IIR A;  5AQZ A;  2P9P B;  1SZ2 A;  3VEO A;  3CI5 A;  2Q2R A;  3LM2 A;  3FGU A;  5AQN A;  3SK3 A;  1GLB G;  1LOT B;  3P4I A;  5F2R A;  4CBX A;  3VER A;  2YJE A;  3FZK A;  4A2B A;  2QWM A;  3A5L C;  5AQM A;  1S3X A;  1YUW A;  2FF3 B;  3U9D A;  2ZGZ A;  3A5O C;  3D2F A;  1SAZ A;  1XQS C;  3EKS A;  3VOV A;  3HZ6 A;  3MN5 A;  4EFH A;  2P9K A;  3ATU A;  2P9U A;  5KQ8 A;  2HF4 A;  4FWL A;  3LDO A;  2YHY A;  1XC3 A;  4BRP A;  4FL9 A;  4QS8 A;  2QWR A;  4BRK A;  5JLH A;  2GEM A;  4WQ5 A;  5AFU H;  1R59 O;  4QS9 A;  4XH5 A;  1HX1 A;  3RSE B;  4EAH D;  3LDQ A;  4A61 A;  1IG8 A;  1RFQ A;  4YDU C;  2VYP A;  1BO5 O;  3OHR A;  1KAY A;  1QQM A;  5BR9 A;  3CER A;  4IWV A;  1BU6 O;  1HPM A;  5FPN A;  1MWM A;  3O80 A;  4ISG A;  4O5F A;  5TKY A;  5AQL A;  4FWO A;  3ZX0 A;  2Q31 A;  2P9S B;  2PAV A;  1DGK N;  3UE5 A;  3ATV A;  3ULE A;  1JCF A;  1NGF A;  2FSN A;  3VGM A;  1NBW A;  3BF1 A;  2HOE A;  2V52 B;  5AQI A;  5AZJ B;  3WXJ A;  3U4L A;  5AZI B;  3JXU A;  5AQK A;  5AQS A;  1YXQ A;  3HBT A;  4RCH A;  3U9Z A;  5AQG A;  1CZA N;  3CJ7 A;  2ASP A;  2Q0R A;  4CBU A;  2ITM A;  2F9T A;  4FPB A;  3H1Q A;  4AM7 A;  2HMP A;  3FZF A;  4CZH A;  3EN9 A;  5CE3 A;  1ESV A;  2P9N B;  1QZ5 A;  3WQT A;  3WQU A;  2FSK A;  1YVN A;  2QWP A;  2D4W A;  4EIA A;  4H5N A;  4K41 A;  3HTV A;  3M6G A;  3QBX A;  4A2A A;  4BR4 A;  3UKU B;  2PBD A;  4BR9 A;  1Y64 A;  4XH1 A;  1U2V B;  1X3N A;  3ENO A;  2ZGY A;  3O1B A;  4PL8 A;  2WUS A;  5B8H A;  2FXU A;  3ZX2 A;  3ZX3 A;  1K8K B;  1RGI A;  3HSC A;  1P8Z A;  2A41 A;  4H5T A;  5KPZ A;  2V7Z A;  1IJJ A;  4BRL A;  5AZJ A;  4CZK A;  5AZI A;  2E2O A;  4LC9 B;  1NGH A;  3ENH A;  3FFK B;  5EXW A;  4BVO A;  2P9I B;  2E20 A;  3HI0 A;  4MO5 A;  4K42 A;  5FPE A;  4J8F A;  2CH6 A;  4WYB A;  1TUU A;  3H1V X;  1V4T A;  5ADX H;  3H3N O;  2P9N A;  3R8E A;  4F9O A;  1HKG A;  3ZEU B;  1QQO A;  3IMX A;  4AM6 A;  3TPQ A;  3UKU A;  1H1V A;  2A6A A;  2YCH A;  3FZM A;  2QWN A;  3O5B A;  2I7P A;  4A62 A;  4JHD B;  4BC5 A;  5BRE A;  3WEE B;  1U2V A;  2CH5 A;  5F0X A;  4EHU A;  3CQY A;  4BR5 A;  4RWT A;  5E84 A;  3GL1 A;  3VF6 A;  4BRE A;  1K8K A;  4WQ4 C;  3J8A A;  4BRC A;  3CJ1 A;  2HF3 A;  2ZF5 O;  5FPM A;  1KAZ A;  3IDH A;  4CZJ A;  4BRH A;  4WQ4 A;  3LM9 A;  4FWR A;  3VF2 A;  3AAQ A;  4FWK A;  3H6E A;  3A0I X;  4IZ9 A;  4CZF A;  5BPL A;  1ATN A;  2P9I A;  3GOI A;  5AQJ A;  4WQ5 C;  3VEY A;  2QWQ A;  1QHA A;  1ZXO A; 
#chains in the Genus database with same CATH topology
 2Q97 A;  4H5V A;  3RR8 A;  3VQE A;  3AVA A;  3PIP L;  4I9L A;  3M8R A;  4CF1 A;  1JLC A;  5GAD P;  5BPM A;  1WN7 A;  2XY8 A;  1RT4 A;  3CJA A;  3VN5 A;  3VQ7 A;  4CES A;  5C0Y A;  4AIL C;  3VQB A;  2GEL A;  2HHQ A;  5C2D A;  1D4X A;  3CJC A;  1HYS A;  3E9L A;  3DXK B;  4BWJ A;  2A1S A;  4K8Z A;  3W3D A;  3T7Z A;  2NRR A;  4IOC L;  3HJF A;  4BWM A;  3NMU A;  2ZQB A;  3CCQ N;  4FOE A;  1KC8 O;  5AQT A;  2IVP A;  4GY2 B;  1HJO A;  4FLW A;  3MED A;  2PYL A;  4C1N K;  4NB4 A;  1U6Z A;  3V9S A;  2NRT A;  3D0P A;  1YVU A;  2XY5 A;  5GAG P;  1XC9 A;  3AVJ A;  1NOY A;  3CC7 N;  4CI6 A;  3UKR A;  3LP1 A;  3QDK A;  3LPT A;  3T19 A;  1BQN A;  3O8M A;  1QSS A;  4KI4 A;  3MCA B;  1YJ9 N;  4DB3 A;  5M1K A;  2QWL A;  4WFA L;  3A5M C;  2P9S A;  1LWC A;  1O13 A;  2UYT A;  4IG0 A;  3K5L A;  1S1X A;  5KQD A;  1KAX A;  3L8B A;  1IG9 A;  4DTP A;  3NHG A;  4DFM A;  3DLE A;  4PL7 A;  2GTD A;  2XRI A;  4B1Y B;  4MDB A;  4BRA A;  3MCP A;  2ZWH A;  2W6L A;  3S5T A;  1FKP A;  4EP5 A;  1WBD A;  2X74 A;  4ISF A;  3F9K A;  4NLB A;  1TKX A;  3KD5 E;  3GG4 A;  3GBT A;  1S1W A;  3SI6 A;  4KKO A;  4PA1 A;  1HNI A;  1I39 A;  3CCJ N;  3OYM A;  1VSD A;  2O8D B;  1RTJ A;  3WUH A;  5CY4 A;  4BG8 A;  5IWA K;  3MEG A;  5AQW A;  5KRT A;  2IS3 A;  4DQ8 A;  3VPZ A;  2A3Z A;  4BGA A;  2O8E B;  3DRP A;  5C10 A;  2OCE A;  3THY B;  4BQL A;  4ILH A;  5HRN A;  3QIN A;  4KB0 A;  4QCL A;  4MQ3 A;  3WXL A;  1GLA G;  1E4F T;  1HQE A;  2PFU A;  2Z1J A;  3OBY A;  4KHW A;  1RDD A;  5IT9 O;  2WC9 A;  3P31 A;  3CFR A;  3VEZ A;  1QVG M;  3O3F A;  4J2E A;  4FJK A;  4JI0 K;  2X6N A;  3O08 A;  4KV8 A;  3L2U A;  4LFC K;  3LAM A;  3ULE B;  5C25 A;  4JYA K;  3SYZ A;  4ID1 A;  5EY4 A;  3DXM A;  2UUB K;  3C95 A;  4FCY A;  3EZW A;  1X3M A;  4TSX A;  4FW1 A;  2JLE A;  4KHN A;  1SQK A;  2Q36 A;  2I5J A;  3V81 A;  5JIC A;  4DQP A;  1N36 K;  1RBS A;  4YDU A;  1REV A;  3E01 A;  1HPZ A;  3VTH A;  1SS6 A;  4MO4 A;  4E72 A;  3ZSX A;  1GLF O;  3CC2 N;  4UQG A;  2G8H A;  1JL1 A;  4JD2 A;  2IC3 A;  3IFR A;  4K25 A;  4DHY A;  3SQ0 A;  1KD1 O;  2BGG A;  4EP4 A;  4JKA A;  4B1X B;  4IO8 A;  3CCE N;  1BGX T;  1BA0 A;  5AQF A;  1NKE A;  4KRE A;  3NGY A;  2W40 A;  3TSU A;  3NGI A;  4M45 A;  3LPU A;  4BG9 A;  3B6P A;  1XMO K;  4FJM A;  2E2P A;  1S1U A;  1VSI A;  4C8N A;  4JV5 K;  3CHW A;  5AQH A;  4B08 A;  5EVZ A;  1NK5 A;  1WAF A;  3VEN A;  1TYQ B;  1NLV A;  1LWE A;  1J6Z A;  3I0S A;  4CF2 A;  4YOX A;  3MN6 A;  3I33 A;  4CK2 A;  2NLX A;  3BF3 A;  2XHB A;  3ZET B;  3CF5 L;  2BTF A;  2KHO A;  3SBT A;  3BEX A;  3U6F A;  2HHX A;  3MXI A;  2PYJ A;  4DSI A;  3AO5 A;  5JVH L;  2D0A A;  4DKW A;  1HLU A;  1IBK K;  4CEC A;  3QIC A;  4BC3 A;  2F9W A;  4MLE A;  3NCI A;  5BPN A;  3JSM A;  1T44 A;  5GIP A;  3MEE A;  1EWQ A;  1L3U A;  3CD6 N;  3ZT2 A;  4BGB A;  4BE7 B;  4HWI A;  3LDN A;  4PY5 A;  3CQX A;  3CIP A;  5KGW A;  3TWH A;  2V51 B;  2HST A;  1NJX A;  3OW2 M;  2FSJ A;  4I7F A;  1D9D A;  3G25 A;  3KTQ A;  3R3L A;  4CZI A;  5SWM A;  2RHK A;  4WFB L;  4DTM A;  3HYF A;  3CMA N;  4H8K A;  2HNZ A;  3NGZ A;  4E3S A;  3C65 A;  1EP4 A;  4CZL A;  3DMJ A;  4OPH A;  1TK8 A;  2OZS A;  4U67 L;  3K5M A;  3VQC A;  2P9P B;  3L2V A;  3OYN A;  2FBY A;  1SZ2 A;  3QNO A;  3TAE A;  3SQ1 A;  3SK3 A;  3P4I A;  1WSH A;  3SJJ A;  3FZK A;  2QXF A;  1KSP A;  3BDP A;  2HHI A;  3OYC A;  2FF3 B;  3CME N;  2ZGZ A;  3J81 O;  3K2P A;  3DM2 A;  1L3S A;  1YTU A;  3CCM N;  3KLI A;  3G10 A;  1I94 K;  4N76 A;  2P9U A;  2HF4 A;  1XC3 A;  2JWK A;  4RW9 A;  1N6Q A;  5JEN A;  3TI0 A;  5AFU H;  2HB5 A;  1VQL N;  1HX1 A;  3CM5 A;  4RG8 A;  4I9Q A;  3LDQ A;  1KRP A;  5J2P A;  4ZTF A;  3AVF A;  2VYP A;  3OHR A;  1QSY A;  2DY4 A;  1KAY A;  5M1O A;  3CER A;  2YNF A;  4IWV A;  1BI4 B;  4JKG B;  1U4B A;  3SQ4 A;  1UA1 A;  4CEQ A;  1NOZ A;  3UE5 A;  3ULE A;  1C0T A;  4DF4 A;  3OYL A;  1NGF A;  1QSL A;  3L3U A;  4JK8 A;  2V52 B;  1TVR A;  1CZB A;  5AZJ B;  4OGE A;  3WXJ A;  4CHP A;  3J7Y P;  3HBT A;  4RCH A;  4KPY A;  2HNY A;  5KI6 A;  4CHY A;  2HW3 A;  1A5V A;  2HBL A;  3QNN A;  3ZSO A;  1QZ5 A;  2HBM A;  4K41 A;  4B8A B;  3HTV A;  3RVC A;  3NFA A;  3I56 N;  2EHG A;  1Y64 A;  3AVB A;  3VQQ A;  3P5J A;  4CFC A;  4FJL A;  3K0S A;  3CYG A;  4KHQ A;  2ZD1 A;  2FXU A;  3ZX3 A;  2BH1 A;  4G9Z A;  1XHX A;  1VK0 A;  3HSC A;  1P8Z A;  2A41 A;  4FJ5 A;  4H5T A;  1CXQ A;  1XWL A;  1IJJ A;  4JEP A;  4BRL A;  3OYF A;  2Q3S A;  3PV8 A;  5AZI A;  4N56 A;  1L3T A;  2O8B A;  3FFK B;  4CJV A;  5EXW A;  2ZJP L;  1BIZ A;  2P9I B;  4MO5 A;  4J8F A;  4Z4G A;  1WSF A;  1C0M A;  1LWF A;  3NF8 A;  4C8L A;  3IS9 A;  1N5Y A;  4WF9 L;  1YHQ N;  3R8E A;  4Q5V A;  1VRT A;  5HRS A;  1H1V A;  2AJQ A;  1WSI A;  4FYD A;  3O5B A;  2KZM A;  2I7P A;  4A62 A;  3T3F A;  4JHD B;  4IOA L;  4RWT A;  4EHU A;  3VQ8 A;  5EU7 A;  2P1J A;  3GL1 A;  4F8R A;  1K8K A;  5A2Q O;  4BRC A;  3CCV N;  1KAZ A;  3ENB A;  3LM9 A;  3VF2 A;  1RCH A;  4FWK A;  2X78 A;  3JAM O;  3RMB A;  2QWQ A;  4YFU A;  1ZXO A;  3DI6 A;  2HBK A;  3HST B;  4BRF A;  5HP1 A;  4FLZ A;  5F1X A;  2ATQ A;  4DTJ A;  5AFU A;  1BQM A;  4Z4C A;  3FZH A;  3ZSV A;  4CJE A;  3ZEU A;  3SJH A;  3WXI A;  3UKR B;  3NH2 A;  2KKZ A;  2RF2 A;  4OKE A;  4CGF A;  5LMU K;  5EOY A;  3C94 A;  2O8C A;  4IO9 L;  4NCA A;  4BRQ A;  2P9P A;  3JS6 A;  3LDL A;  4JKD A;  4CF8 A;  3L4I A;  1IH7 A;  2QW9 A;  5DMR A;  4HHT A;  3DAW A;  3OBW A;  5K14 A;  4IFE A;  4HUE A;  4B3T K;  4HTL A;  3FR0 A;  3TU5 A;  1VQ5 N;  2FBX A;  2CGJ A;  3L2Q A;  4BR7 A;  4FJX A;  4KHU A;  2A5X A;  3AV9 A;  3O9Q A;  1WSJ A;  4CHZ A;  2KW4 A;  1ASU A;  3LWL A;  3WNH A;  2VCP A;  3K57 A;  3AVI A;  1UAX A;  1D8Y A;  3KZB A;  3HVT A;  3HM9 A;  3ZSY A;  3GE1 A;  4FJH A;  2O4I A;  3AA4 A;  3O1W A;  4LF7 K;  3UB5 A;  3TTD A;  1RT6 A;  1RT5 A;  5AR0 A;  3NF9 A;  1J5O A;  5MLC Q;  3VQA A;  3LDP A;  2YNG A;  3U8X A;  5I9E B;  2A40 A;  3CXC M;  3CG7 A;  1C0U A;  1Q86 O;  3L0Q A;  3TAB A;  5C15 A;  4EHT A;  4DR3 K;  2QWO A;  4HUF A;  3LP2 A;  4DTS A;  2AP1 A;  1K73 O;  4J2D A;  4O44 A;  4M3R A;  1NK9 A;  1BG3 A;  3MWT A;  3DLR A;  2WFB A;  1NK8 A;  3CFO A;  4CJW A;  2ASM A;  3FFI A;  1EET A;  3V1R A;  1BUP A;  3RWU A;  1ASW A;  4ZHR A;  3C7N A;  1MA9 B;  4JI2 K;  1WLJ A;  4FWS A;  4IXC A;  4BRI A;  2QA4 N;  1WNS A;  1OKJ A;  4YOV A;  4DQQ A;  2QEX N;  3ZYY X;  4FM0 A;  2E6M A;  4Y1C A;  4JNE A;  5M1N A;  4W5N A;  4H0P A;  4DCH A;  4ZTJ A;  4JRP A;  2E2N A;  4Z4E A;  3LAL A;  4OLB A;  4CGD A;  3O9R A;  4CFD A;  4BR0 A;  3B8A X;  4H0X B;  3J7Z O;  3QFU A;  2D5R A;  3HVR A;  3N4Q A;  5FPD A;  1TK0 A;  3O9T A;  3DXM B;  2Z1H A;  5JMV A;  4CJK A;  3AVL A;  4W5R A;  4IKF A;  1YJW N;  2D0P A;  5AQU A;  4M63 C;  4U7B A;  3W0L A;  5HL7 L;  4PKI A;  5J2N A;  3MMV A;  3G0Z A;  2OPR A;  2VWK A;  2FF6 A;  2XY6 A;  1JLG A;  3PX6 A;  1NK6 A;  4YOW A;  3TSQ A;  1KVC A;  4A59 A;  2D0O A;  4M7Y A;  1X9M A;  5D3G A;  4BVP A;  2AA4 A;  4BC4 A;  1S9G A;  4JD2 B;  4GVM A;  3Q7B A;  2F8S A;  1DTT A;  3BP8 A;  3HPG A;  3GDQ A;  4JHD A;  1NJI O;  3FLC O;  3VF4 A;  4FXD A;  2HHW A;  4E1N A;  3LL3 A;  3F73 A;  5M1Q A;  4F2R A;  4FWQ A;  4QS7 A;  4LF8 K;  5GAH P;  3QB0 A;  2GV9 A;  4KB1 A;  5M1F A;  1E4G T;  4IFY A;  4K0K K;  4LF6 K;  3WXK A;  4RTF D;  2EWS A;  1JCG A;  1SL0 A;  5AQP A;  3LP0 A;  2RPI A;  3PX0 A;  5E41 A;  1XI1 A;  1GLJ O;  3SMS A;  2OPQ A;  1ILY A;  3OYG A;  4CIG A;  1FKO A;  4B3S K;  3BZC A;  2HHS A;  4GMJ B;  3S3M A;  3WNG A;  1EO1 A;  3DWL A;  5AQR A;  4R5P A;  2BUP A;  2OTJ N;  1TGO A;  4BC2 A;  1S22 A;  4Z4I A;  4YOT A;  2H3G X;  4KFB A;  4CEB A;  4X64 K;  1YJN N;  2OAN A;  2FC0 A;  1KVA A;  4M42 A;  2OA8 A;  1RBV A;  3VQP A;  3AA5 X;  4BDY A;  2BDP A;  4Z94 A;  3ASM A;  1ZBL A;  1M90 O;  4HVJ A;  3VTI A;  1XUP O;  3IKM A;  1GLD G;  1VQP N;  4LSL A;  4CFB A;  3AGK A;  4FLX A;  4FOI A;  3IRX A;  1NGG A;  3ZCM A;  2E2Q A;  4BRM A;  4KHP K;  3QBW A;  4CBW A;  5J2M A;  4CZM A;  3ALY A;  2FBV A;  4GNI A;  1TK5 A;  1VSL A;  3BY5 A;  3DOL A;  1RTI A;  1NMD A;  4DR2 K;  4JLH A;  3P38 A;  1BWF O;  3KHY A;  2F8T A;  3O3G A;  4B8C A;  4H0T B;  3E66 A;  1T05 A;  4EZ6 A;  1RIL A;  4UY8 O;  4MLH A;  1K8A O;  3HM8 A;  4FSV A;  1U49 A;  4JKB A;  4OPA A;  4DQI A;  3LZI A;  3C0B A;  2RKI A;  3O4Q A;  4FWP A;  2P9U B;  3J7A P;  3OS0 A;  4B9V A;  1GLE G;  1Q81 O;  2KZZ A;  1EWR A;  2OTL N;  2UXB K;  4XEI A;  3HK2 A;  2HBJ A;  4H0V B;  3DRR A;  4JRQ A;  4NLC A;  1CXU A;  5LJW A;  3K9J A;  4R79 A;  4M41 A;  2IIR A;  5AQZ A;  1C6V A;  3LM2 A;  1W2B M;  1NJW A;  5AQN A;  1GLB G;  1LOT B;  5JVG L;  4CBX A;  4HCC A;  2ITG A;  4NXM K;  2QWM A;  2KFZ A;  1S6P A;  1NK0 A;  2VQF K;  5AQM A;  1S3X A;  3A5O C;  1SAZ A;  3IAY A;  3K58 A;  2P9K A;  1IKW A;  3LDO A;  3AO4 A;  1TL3 A;  4QS8 A;  2ZJR L;  3HP6 A;  4OKK A;  4BRK A;  1XHZ A;  2RN2 A;  5JLH A;  4WQ5 A;  3SAG A;  3RSE B;  1Q9X A;  3S3N A;  2HHV A;  1Z25 A;  4YDU C;  4X65 K;  4M3U A;  4O55 A;  4CJT A;  4CIE A;  4PUO A;  3OYK A;  5BR9 A;  1IBM K;  1HNV A;  3NE6 A;  4BDZ A;  1YF5 L;  4ISG A;  4C8M A;  4CGH A;  5TKY A;  4FVM A;  3ZX0 A;  3UIQ A;  2YV0 X;  1QTM A;  2OPS A;  1SL2 A;  1DGK N;  4JK7 A;  3AO1 A;  3C6A A;  3PSF A;  3AO2 A;  2FSN A;  3D6R A;  2HOE A;  4Z4F A;  3OS2 A;  1Q9Y A;  5AZI B;  3LAK A;  2O8B B;  1YXQ A;  3DYA A;  1VQ8 N;  1Y97 A;  3THV A;  4J2B A;  1NKB A;  4OLA A;  4CBU A;  5AJ3 K;  1VQ9 N;  2E4L A;  1JLA A;  4FPB A;  4AHV A;  4CZH A;  2HMP A;  3EN9 A;  1T3V A;  4OPJ A;  1M1K O;  1OH6 A;  3SV4 A;  3WQT A;  3WQU A;  3QBX A;  4KH5 A;  2O8F A;  2NRW A;  4BR4 A;  3QIO A;  1S5J A;  3S3O A;  4NYF A;  1KFD A;  4OKJ A;  4Z4H A;  4DQS A;  4M3Z A;  4PL8 A;  3ZX2 A;  1K8K B;  5FRM A;  1WSE A;  3V9U A;  3V9X A;  3VQ6 A;  4LC9 B;  2X6S A;  1NGH A;  1ZYQ A;  5C12 A;  4CJR A;  4BVO A;  2ZJQ L;  4JI4 K;  4PQU A;  3K59 A;  1QE1 A;  2Z1G A;  3HI0 A;  1IV0 A;  3LWM A;  2CH6 A;  3AO3 A;  3H3N O;  4A5A A;  2P9N A;  5HRO A;  3D45 A;  2HND A;  4QOZ B;  3HPH A;  3ZEU B;  3M8S A;  1QQO A;  3TPQ A;  3UKU A;  2A6A A;  5LMN K;  3THW A;  4CGI A;  5CYQ A;  4CGJ A;  4LF9 K;  3TAQ A;  3VQ5 A;  3CQY A;  2O8C B;  2VG7 A;  5E84 A;  1S72 N;  1N32 K;  3OYE A;  3HL8 A;  5C2F A;  3OYJ A;  5FRN A;  4WQ4 C;  4FJN A;  4M3W A;  3KKR A;  3J8A A;  4X62 K;  2B5J A;  2QKK A;  3CFP A;  4CEA A;  2HMI A;  4IDK A;  4NCB A;  4WQ4 A;  4I2P A;  3TSP A;  3H6E A;  3E9O A;  4M3T A;  4IZ9 A;  1ATN A;  4OGC A;  4CF0 A;  4CEF A;  4BY9 C;  2ETJ A;  1D9F A;  2DFE A;  5DM7 L;  3L6Q A;  4H0O A;  3VEX A;  4CW7 B;  4WFN L;  4JKE A;  1KFS A;  4C8O A;  3F5T A;  4BRO A;  3KIO A;  5BR8 K;  4DV7 K;  3AAP A;  1W97 L;  2WBN A;  2A42 A;  3WEE A;  4RW8 A;  4YNQ A;  4CF9 A;  3CCS N;  1NGC A;  3MK6 A;  4GV6 A;  2DFF A;  5JS1 A;  1KTQ A;  2EX3 A;  4DR6 K;  4CIF A;  1JXB A;  4FK2 A;  1SKR A;  3E9P A;  3OYD A;  2UUA K;  1NGJ A;  5GIN A;  3CJB A;  1YT3 A;  1X1P A;  3QO9 A;  3R1X A;  3I8B A;  4GW6 A;  4DV5 K;  3MN9 A;  4RW4 A;  4ID5 A;  4LD0 A;  4GKK K;  1KVB A;  4H03 B;  4L3Q A;  4FJJ A;  3RSE A;  1DEJ A;  2KLA A;  3C7N B;  3SCX A;  2D0B A;  3I0R A;  4DG1 A;  2W41 A;  2HHT A;  1NMN A;  3T1A A;  4Y1D A;  4FW2 A;  2V7Y A;  3L2R A;  4A57 A;  1Z6R A;  1Q8I A;  4EZ9 A;  4JKH A;  1KCF A;  4I6M A;  4Z0U A;  4YOY A;  3E1Y A;  3OYA A;  2VG5 A;  3SUN A;  3V1Q A;  1GOA A;  4CHQ A;  4HUG A;  5ELZ A;  4CJF A;  3HPO A;  4DV6 K;  2YHX A;  3ZLJ A;  3TAR A;  2P9L A;  2DTU A;  4DLE A;  5FDL A;  3M8P A;  5DK5 A;  3VEW A;  3KJV A;  4DSF A;  2NZT A;  4Y0W A;  5C24 A;  3QES A;  3MEC A;  2XO7 A;  4FM1 A;  4OX9 K;  2IVN A;  3CCL N;  2QKB A;  4OPK A;  3ZT0 A;  3L2W A;  4CED A;  2J4R A;  1ZC6 A;  3HOT A;  3G6E N;  5LJV A;  3QFP A;  3FE1 A;  3LZJ A;  1HKB A;  3RRH A;  2DFH A;  1A5X A;  1C1C A;  5HBM A;  2NRX A;  3A2F A;  1XMQ K;  4L8R B;  1NNE A;  3K5N A;  1T8E A;  5KPR A;  2GWJ A;  1QQN A;  2IOC A;  2NRV A;  1QZ6 A;  2NRH A;  4FPA A;  1HRH A;  3ZSQ A;  1C0F A;  2QK9 A;  3ITH A;  4CJQ A;  1TAQ A;  1BA1 A;  4FWM A;  4JS5 A;  3EL2 A;  4DR4 K;  3ID6 A;  3VQ4 A;  2YKM A;  4IJN A;  1KXP A;  1NGE A;  2WON A;  3O6W A;  4DUY K;  4ISE A;  1W7A A;  1U04 A;  1S6Q A;  4CVN E;  1RBT A;  2E1Z A;  3SLC A;  3AAR A;  3CCR N;  1GOB A;  3KWI A;  3RMC A;  4DWI A;  3MN7 A;  3EZ5 A;  3H46 O;  4N5S A;  1BL3 A;  4LFA K;  4BE2 A;  2A1R A;  2GUP A;  3PY8 A;  5J2Q A;  3THX A;  4JI5 K;  3KLF A;  1OH5 A;  1X9W A;  2GX9 A;  3M1F A;  3WXM B;  5JLF A;  3KK2 A;  4WE1 A;  2HVI A;  4B3O A;  4PKG A;  2KFN A;  1EKE A;  1W0H A;  3PUF A;  3HP9 A;  3CET A;  3U3G A;  5BN8 A;  3SV3 A;  2Y1J A;  4B9M A;  3PO4 A;  2QM1 A;  5KPT A;  3B6O A;  5BN9 A;  4B9U A;  4PKH A;  2VG6 A;  3J80 O;  3D2E A;  4KAZ A;  2E88 A;  3T69 A;  3C6U A;  1ATS A;  3DLH A;  4DTU A;  1NGD A;  4F3O A;  4DFK A;  1BIS A;  3V6D A;  1X9J A;  1RT3 A;  3NDK A;  5AQQ A;  4GKJ K;  2I7N A;  1VQ7 N;  2ASO A;  3KWG A;  1VSE A;  2JGU A;  1BIU A;  3EKU A;  4JI1 K;  4JN4 A;  4DV2 K;  3N4P A;  3DLK A;  4DSJ A;  1TKT A;  4OO1 J;  4H5R A;  4IFV A;  1Z05 A;  3DLG A;  3I55 N;  3OA9 A;  1TV6 A;  4AHR A;  5CR4 A;  4BR2 A;  4CEO A;  4DQR A;  4CJS A;  3NH0 A;  3SMP A;  4YHH K;  3CM6 A;  2W42 A;  2P5G A;  3ZSW A;  3SUQ A;  2VWB A;  3A8Y A;  4ILG B;  1I3A A;  2YJF A;  4HTU A;  3S41 A;  1TKD A;  5FRO A;  2O4G A;  1HUX A;  4DTR A;  1WOQ A;  1VQ6 N;  4N41 A;  1HNX K;  3VET A;  1GLC G;  4DSE A;  1IBL K;  4KBO A;  3M3Z A;  4CZG A;  3QEI A;  4W5Q A;  1EQY A;  3FZL A;  2FLO A;  4NO7 A;  4FZZ A;  1HKC A;  2OPP A;  3MX5 A;  1ATR A;  5EX5 A;  1JLF A;  1RT2 A;  2G8K A;  1XNR K;  4DLG A;  2GBZ A;  3HRG A;  3AY9 A;  4JAX A;  3G4S N;  1QHT A;  1V4S A;  1RDW X;  2HHH K;  5E26 A;  4ILJ A;  4FVU A;  2Q0U A;  3DOK A;  1L5U A;  5I42 A;  3VA0 A;  1GOC A;  2P9K B;  4K8X A;  4YOR A;  4DTN A;  3P1G A;  1IKY A;  1NG9 A;  1VSM A;  2IGI A;  4JI8 K;  1T7P A;  4DV1 K;  3CCU N;  4O4G A;  3EEQ A;  2B6A A;  3RTV A;  1UOC A;  1JKH A;  3VGK A;  1EX4 A;  1YI2 N;  1S1T A;  3BUZ B;  1UWB A;  3OJU A;  3MDQ A;  4CEZ A;  5LL6 Z;  4BAC A;  4FLY A;  1X9S A;  1DTQ A;  3KKS A;  3VEO A;  3CI5 A;  4CER A;  1Q82 O;  1JLB A;  1WBB A;  4E0D A;  3SZ2 A;  3VER A;  4A2B A;  3V4I A;  1VQ4 N;  3A5L C;  1YUW A;  2QI2 A;  1N33 K;  4DUZ K;  1FXX A;  3D2F A;  4YY3 K;  1B9F A;  1ZBF A;  3VOV A;  4EFH A;  3ATU A;  4FWL A;  4BRP A;  1VQM N;  4FL9 A;  4LH4 A;  3QEW A;  4RW6 A;  3C6T A;  4KI6 A;  1R59 O;  1UA0 A;  4EAH D;  2OYQ A;  3QET A;  1RFQ A;  2PY5 A;  4CE9 A;  1J54 A;  4B9L A;  1BO5 O;  3T1Y K;  1QQM A;  3HOS A;  5KRS A;  4CK1 A;  1RDU A;  5FPN A;  4C8K A;  4FK4 A;  1MWM A;  1B92 A;  2O8F B;  1FW6 A;  2BE2 A;  4CK3 A;  3SNN A;  3NH1 A;  2PAV A;  3ATV A;  2HHU A;  4DV3 K;  4E7I A;  3P83 D;  3LAN A;  1VRU A;  1NBW A;  3BF1 A;  5AQI A;  2W00 A;  3KK3 A;  4N47 A;  3U4L A;  1U45 A;  3ULD A;  1A5W A;  1IKX A;  1HNW K;  3ISN C;  5AQG A;  3K5O A;  1N34 K;  1OH7 A;  2ASP A;  4NCG A;  2ITM A;  1JLQ A;  3H1Q A;  4DU4 A;  5HLF A;  3FZF A;  4CJ4 A;  5FLX O;  3TAF A;  1LV5 A;  1ESV A;  2P9N B;  1RBU A;  3PIO L;  2FSK A;  1YVN A;  2QWP A;  4EIA A;  1LW2 A;  3QER A;  3UKU B;  3THW B;  3CC4 N;  1WSG A;  4XH1 A;  1Z26 A;  1S1V A;  4JI6 K;  5B8H A;  2QTD A;  1RGI A;  1YTA A;  5T7B A;  3ZSZ A;  2RE2 A;  5KPZ A;  4Q0B A;  2E6L A;  4C1N I;  4CZK A;  3ZT4 A;  5SZT A;  1TL1 A;  1OVQ A;  2R7Y A;  3SUO A;  2IDO A;  3V9W A;  3SUP A;  1NJY A;  4JI7 K;  1J53 A;  1VSJ A;  4DFP A;  4CHN A;  5FPE A;  4DSK A;  3ZSR A;  4MFB A;  4WYB A;  2UXD K;  3H1V X;  4KTQ A;  1V4T A;  4E19 A;  5ADX H;  3Q7C A;  1MU2 A;  4F9O A;  4DR7 K;  1RBR A;  1NK4 A;  4GV3 A;  1K6Y A;  4FLU A;  3IMX A;  4FLT A;  2YCH A;  3FZM A;  2QWN A;  4M3X A;  5BRE A;  3WEE B;  1U2V A;  3O3H A;  4FJ7 A;  4OVL A;  1JL2 A;  3VF6 A;  5H1S Q;  4KTZ A;  3QIP A;  4AQY K;  3CJ1 A;  4CZJ A;  4BRH A;  5CZ1 A;  1FJG K;  4FWR A;  1RTH A;  3A0I X;  4CZF A;  5BPL A;  2UXC K;  4B3M K;  3GOI A;  1VSH A;  4WQ5 C;  3VEY A;  4IG3 A;  1QHA A;  1OVY A;  4XH4 A;  1R0A A;  2QXL A;  2ZM6 K;  3HO1 A;  3O9S A;  5AQY A;  4CHO A;  4JS4 A;  1NM1 A;  1DT9 A;  3LDS A;  2G8W A;  1C0G A;  3DLL L;  3CYM A;  3V9Z A;  4BEC A;  3PO5 A;  4CGG A;  4E1M A;  3TR8 A;  3R9P A;  1VQN N;  4I6M B;  4KHY A;  4CZE A;  1U47 A;  2ZE2 A;  4PWD A;  1RDB A;  4DV4 K;  4X66 K;  4AHU A;  1JJ2 M;  4BRG A;  2P9L B;  2G8U A;  1SKW A;  3H3O B;  3OY9 A;  1NWK A;  3O9U A;  4I2Q A;  3TAM A;  1U48 A;  1P90 A;  1J5E K;  1EXQ A;  3WT0 A;  5HRR A;  3QEP A;  1VSK A;  3QLH A;  4FWN A;  3WNE A;  2Z1I A;  5BRF A;  2NRZ A;  2WOM A;  3KK1 A;  4KO0 A;  4FLV A;  1G99 A;  1MDU B;  3VEV A;  1NGA A;  1JLE A;  1DLO A;  4FZY A;  3EY1 A;  1ITG A;  1MWK A;  2W6K A;  3DXK A;  2VGN A;  4C23 A;  1HQU A;  3M5R A;  4LSN A;  3OTO K;  4JI3 K;  2GWK A;  1IKV A;  2YHW A;  2YI1 A;  3TTC A;  2F96 A;  4FZX C;  4AH9 A;  2D1K A;  1FK9 A;  2B4J A;  3K9K A;  1LCU A;  5JS2 A;  3BZK A;  4CJU A;  3OYI A;  3NVM A;  3ID8 A;  5CZ2 A;  2G8F A;  1T6D A;  3AVG A;  3DJC A;  4KRF A;  4JKC A;  4O0J A;  3I8D A;  4DR1 K;  4CJ7 A;  4H4M A;  3HXM A;  1NU0 A;  4NXN K;  4M3Y A;  4B3R K;  1T6C A;  2UUC K;  2YKN A;  4ELV A;  5ADX A;  4DR5 K;  4B9T A;  3THX B;  2Y1I A;  3CJ9 A;  4H5W A;  1O1W A;  4LY7 A;  3DLB A;  2YNI A;  4DV0 K;  1C1B A;  1DKG D;  2E8A A;  3AVC A;  4B9Q A;  3TAN A;  1BDG A;  4E7K A;  3IUC A;  2IAJ A;  1ZBS A;  1YAG A;  1RTD A;  4F4K A;  3A5N C;  2KTQ A;  4DS4 A;  4AHC A;  4DU1 A;  5CHI A;  2G8V A;  1ZBH A;  3QEX A;  4G1Q A;  3D2E B;  2LSN A;  4BQZ A;  4F3T A;  2Q1N A;  4CD3 A;  3AA3 A;  4B1V A;  4K43 A;  2XY7 A;  1LAV A;  4BRN A;  1J9A A;  2DPN A;  4H4O A;  2CGK A;  3PSI A;  1BOT O;  2YNH A;  2O8D A;  1ASV A;  1K9M O;  1SUQ A;  4ELU A;  2HVH A;  2E5L K;  4IEI A;  3MX2 A;  1RT1 A;  1Q7Y O;  3EYZ A;  4DSL A;  2O8E A;  4BDP A;  3AVH A;  3THY A;  3VMF B;  3NAE A;  4H0Y B;  4ELT A;  1KQS M;  3VES A;  1F21 A;  1NKC A;  2VQE K;  3EE8 A;  2CGL A;  3QEV A;  4DU3 A;  4AHS A;  3AVN A;  3H08 A;  4V19 S;  5BRH A;  3RMD A;  3D7E O;  3RMA A;  4E7H A;  3AA2 A;  2E1Y A;  3M8Q A;  1NK7 A;  4O5B A;  4O8K A;  4E1J A;  4ICL A;  4M7X A;  3SBG A;  1NGB A;  1OH8 A;  5AQX A;  3S9H A;  3OJS A;  4CEE A;  2WTU A;  2OZM A;  1SKS A;  1TKZ A;  4JKF A;  4DS5 A;  4XIU A;  3HT3 A;  2NUB A;  1TUY A;  3P39 A;  1RDC A;  1HNZ K;  3KD1 E;  3O4N A;  3L3V A;  1RT7 A;  1B9D A;  4IEE A;  3JYT A;  1VQK N;  4FK0 A;  2G8I A;  3SPZ A;  1YIJ N;  4B1W B;  4E89 A;  4DF8 A;  3MXM A;  2UU9 K;  1JCE A;  3OYH A;  5GIO A;  1RDA A;  3KK7 A;  3CQ8 A;  5AQV A;  1HMV A;  1QVF M;  3OS1 A;  3CPW M;  2IVO A;  5DM6 L;  5TKW A;  1ZBI A;  5BRD A;  3AGR A;  1JXE A;  3KLH A;  4CD1 A;  1WUA A;  4MDA A;  5AQO A;  4FO0 A;  1NGI A;  5M1P A;  1Q18 A;  3TTF A;  3VQD A;  4IDH A;  4DMN A;  3RRG A;  3F9M A;  1WB9 A;  4BRD A;  2PZS A;  4F2S A;  4CJ5 A;  1CZ9 A;  2VGM A;  3AVK A;  3VGL A;  3D2F B;  5KGX A;  3QML A;  4IBN A;  4IJA A;  3OYB A;  3KVG A;  3R6M A;  1TYQ A;  3LP3 A;  4KH4 A;  4XJX A;  4BE0 A;  5LY3 A;  3O4W A;  4B1Z A;  4OJR A;  1RNH A;  4B1U B;  5J1E A;  1KLN A;  1GLL O;  3ZET A;  1HYZ A;  3H45 C;  3EO3 A;  4FJ8 A;  4A5B A;  4LFB K;  4WCE L;  3V1O A;  4GV9 A;  4E7L A;  1BCO A;  1HJR A;  4FJ9 A;  3MWP A;  2D0C A;  4JK9 A;  1QQC A;  2F7T A;  2Q2R A;  3FGU A;  1BCM A;  5F2R A;  3U3Y A;  2YJE A;  4CJL A;  3SAH A;  3U9D A;  1KLM A;  1XQS C;  3EKS A;  3HZ6 A;  3MN5 A;  5KQ8 A;  5I3U A;  1SV5 A;  1W9H A;  4DFJ A;  2YHY A;  1VAZ A;  2QWR A;  4LF4 K;  3G71 N;  4NYN A;  3CPE A;  3WNF A;  2GEM A;  4QS9 A;  4XH5 A;  1QS4 A;  4A61 A;  1IG8 A;  4AF1 A;  4CCH A;  4QAG A;  3MAQ A;  3NBP A;  2YHB A;  4CJ3 A;  4O8U A;  1LW0 A;  1BU6 O;  1HPM A;  3T1H K;  1E3M A;  3O80 A;  4O5F A;  1ZBU A;  1BHL A;  4LH5 A;  3PX4 A;  1TAU A;  5AQL A;  4FWO A;  4FJG A;  2NNW A;  2Q31 A;  3PLA A;  3RR7 A;  1CLQ A;  2P9S B;  5GAE P;  4DTO A;  1JCF A;  4J2A A;  1IO2 A;  1HR0 K;  1HYV A;  3VGM A;  4CFA A;  3SQ2 A;  3NF7 A;  4RW7 A;  1VHX A;  3JXU A;  3NVK A;  5AQK A;  5AQS A;  4PHT X;  3ZT1 A;  3U9Z A;  1S9E A;  4W5O A;  2F4V K;  1CZA N;  4BEB A;  3CJ7 A;  2Q0R A;  5HOO A;  2F9T A;  4B9N A;  3F2K A;  3AVM A;  4AM7 A;  5CE3 A;  3BGR A;  1LAW A;  1BI4 A;  4JKG A;  2D4W A;  4H5N A;  3M6G A;  4A2A A;  4B9S A;  3KLE A;  4BE1 A;  1T03 A;  5CYM A;  2PBD A;  3OVN A;  4BR9 A;  4HCB A;  2C1G A;  2P51 A;  5KTQ A;  1U2V B;  1X3N A;  3ENO A;  2ZGY A;  3O1B A;  2JWL A;  2WUS A;  2YHA A;  1NJZ A;  4CJP A;  2V7Z A;  4KHS A;  3ZT3 A;  5AZJ A;  1VSF A;  2E2O A;  1SL1 A;  2KQ2 A;  2YX6 A;  3ENH A;  3NF6 A;  5C42 A;  4FJI A;  1L3V A;  2E20 A;  2C1I A;  1G15 A;  4K42 A;  4AHT A;  4LF5 K;  1TUU A;  3C6H A;  1HKG A;  4FM2 A;  4AM6 A;  4KTW A;  2VWJ A;  3EE9 A;  4BC5 A;  3MXJ A;  1N8R O;  5F0X A;  2CH5 A;  4BR5 A;  2FBT A;  5HRP A;  2BAN A;  3DRS A;  4IOX A;  1XNQ K;  3SAF A;  4GVE A;  2P5O A;  4DTX A;  3SPY A;  4KH6 A;  4BRE A;  3TAG A;  4YOU A;  1YIT N;  2HF3 A;  1VQO N;  2ZF5 O;  5FPM A;  1WAJ A;  1C1A A;  3IDH A;  3VA3 A;  4E7J A;  4O0I A;  3AAQ A;  3L4Q A;  3TAP A;  2P9I A;  5AQJ A;  3KLG A;  3IG1 A;  1D5A A;  4W5T A;  3VQ9 A;  2GUI A; 
#chains in the Genus database with same CATH homology
 2QXL A;  2Q97 A;  4H5V A;  2HBK A;  3O9S A;  4BRF A;  5AQY A;  3PIP L;  3L6Q A;  4H0O A;  3VEX A;  5F1X A;  1NM1 A;  1DT9 A;  4JKE A;  5AFU A;  4WFN L;  3FZH A;  5GAD P;  3ZEU A;  3CJA A;  3F5T A;  4BRO A;  5BPM A;  5C0Y A;  3SJH A;  1C0G A;  3UKR B;  3WXI A;  3DLL L;  3AAP A;  4BEC A;  1W97 L;  2GEL A;  2KKZ A;  2WBN A;  2A42 A;  5C2D A;  3WEE A;  5EOY A;  3CCS N;  4IO9 L;  3R9P A;  4BRQ A;  1D4X A;  1NGC A;  2P9P A;  3MK6 A;  3CJC A;  4GV6 A;  1VQN N;  3JS6 A;  4I6M B;  3LDL A;  4CZE A;  3E9L A;  3DXK B;  4JKD A;  3L4I A;  2QW9 A;  3W3D A;  3T7Z A;  3DAW A;  2NRR A;  3OBW A;  4IFE A;  4IOC L;  3NMU A;  4HTL A;  3FR0 A;  3TU5 A;  3CCQ N;  1VQ5 N;  3E9P A;  4FOE A;  2CGJ A;  1KC8 O;  4BR7 A;  4BRG A;  1JJ2 M;  2P9L B;  1NGJ A;  5AQT A;  2IVP A;  3CJB A;  1HJO A;  4GY2 B;  5GIN A;  2A5X A;  3H3O B;  4C1N K;  3O9Q A;  1NWK A;  4NB4 A;  3R1X A;  1U6Z A;  3I8B A;  3O9U A;  2NRT A;  2VCP A;  3MN9 A;  5GAG P;  4H03 B;  1P90 A;  3KZB A;  4L3Q A;  3RSE A;  1DEJ A;  2KLA A;  3WT0 A;  3C7N B;  3CC7 N;  3GE1 A;  4CI6 A;  4FWN A;  3O1W A;  5BRF A;  2NRZ A;  3UKR A;  3UB5 A;  3TTD A;  2W41 A;  5AR0 A;  3QDK A;  1G99 A;  1MDU B;  5MLC Q;  3VEV A;  1NGA A;  2V7Y A;  3LDP A;  4A57 A;  1Z6R A;  3U8X A;  4JKH A;  5I9E B;  2A40 A;  3O8M A;  3CXC M;  1MWK A;  4I6M A;  3MCA B;  4YOY A;  3E1Y A;  1YJ9 N;  3DXK A;  2VGN A;  3L0Q A;  4C23 A;  3M5R A;  4DB3 A;  5C15 A;  5M1K A;  2QWL A;  4WFA L;  4EHT A;  3A5M C;  2P9S A;  2QWO A;  1O13 A;  2UYT A;  2AP1 A;  5ELZ A;  2GWK A;  1K73 O;  2YHX A;  5KQD A;  1KAX A;  2YHW A;  2YI1 A;  3TTC A;  2P9L A;  2D1K A;  1BG3 A;  4PL7 A;  2GTD A;  3MWT A;  2WFB A;  4B1Y B;  3K9K A;  1LCU A;  4MDB A;  4BRA A;  2ASM A;  3VEW A;  3MCP A;  3NVM A;  3ID8 A;  2NZT A;  2ZWH A;  4Y0W A;  1BUP A;  1T6D A;  3DJC A;  2IVN A;  3CCL N;  4ISF A;  4JKC A;  4NLB A;  3C7N A;  1MA9 B;  4CJ7 A;  4FWS A;  3GG4 A;  4IXC A;  3GBT A;  4BRI A;  1T6C A;  2QA4 N;  2J4R A;  1OKJ A;  1ZC6 A;  4YOV A;  3HOT A;  2QEX N;  3G6E N;  3ZYY X;  5LJV A;  3QFP A;  4JNE A;  3FE1 A;  5ADX A;  1HKB A;  5M1N A;  3CCJ N;  3CJ9 A;  4H0P A;  4DCH A;  2NRX A;  2E2N A;  4H5W A;  3WUH A;  4BG8 A;  3O9R A;  5KPR A;  5AQW A;  2GWJ A;  1QQN A;  2NRV A;  4BR0 A;  4DQ8 A;  3B8A X;  3VPZ A;  2A3Z A;  4H0X B;  3J7Z O;  1DKG D;  1QZ6 A;  2E8A A;  3QFU A;  4BGA A;  2NRH A;  4B9Q A;  1BDG A;  3N4Q A;  4FPA A;  5FPD A;  3IUC A;  1ZBS A;  5C10 A;  3O9T A;  1YAG A;  3DXM B;  1C0F A;  4BQL A;  5JMV A;  4ILH A;  1YJW N;  1BA1 A;  2D0P A;  4FWM A;  3A5N C;  3EL2 A;  5AQU A;  3ID6 A;  4M63 C;  3WXL A;  1GLA G;  1KXP A;  1E4F T;  1NGE A;  2PFU A;  3O6W A;  3OBY A;  4IJN A;  3W0L A;  4ISE A;  5HL7 L;  4PKI A;  3D2E B;  2WC9 A;  2E1Z A;  3MMV A;  3P31 A;  3SLC A;  4BQZ A;  3AAR A;  3VEZ A;  3CCR N;  2FF6 A;  2Q1N A;  3KWI A;  4CD3 A;  1QVG M;  3MN7 A;  4B1V A;  4K43 A;  3H46 O;  4BRN A;  4YOW A;  3TSQ A;  4A59 A;  2DPN A;  2D0O A;  2GUP A;  4M7Y A;  2CGK A;  2AA4 A;  4BC4 A;  4BVP A;  3O08 A;  4JD2 B;  1BOT O;  2GX9 A;  3Q7B A;  1K9M O;  3M1F A;  3ULE B;  3WXM B;  3BP8 A;  4IEI A;  5JLF A;  3GDQ A;  3MX2 A;  4JHD A;  1Q7Y O;  1NJI O;  3FLC O;  3VF4 A;  4PKG A;  5EY4 A;  3LL3 A;  3CET A;  3DXM A;  5M1Q A;  3VMF B;  5BN8 A;  4FWQ A;  4QS7 A;  5GAH P;  3QB0 A;  4H0Y B;  1KQS M;  3EZW A;  3VES A;  2QM1 A;  1X3M A;  1SQK A;  5KPT A;  5M1F A;  3EE8 A;  1E4G T;  2CGL A;  5BN9 A;  3WXK A;  4PKH A;  4RTF D;  3D2E A;  2Q36 A;  2E88 A;  3T69 A;  5BRH A;  5JIC A;  3D7E O;  1ATS A;  2EWS A;  1NGD A;  1JCG A;  5AQP A;  4YDU A;  1X9J A;  2E1Y A;  3VTH A;  1SS6 A;  1GLJ O;  3SMS A;  4MO4 A;  5AQQ A;  1ILY A;  3CC2 N;  1GLF O;  2I7N A;  4O8K A;  4E1J A;  1VQ7 N;  2ASO A;  3KWG A;  4M7X A;  4JD2 A;  3SBG A;  1NGB A;  3EKU A;  3IFR A;  4K25 A;  4JN4 A;  5AQX A;  4DHY A;  1KD1 O;  3DWL A;  5AQR A;  1EO1 A;  3N4P A;  2BUP A;  4JKA A;  4IO8 A;  4B1X B;  3CCE N;  1BA0 A;  5AQF A;  2OTJ N;  4OO1 J;  4JKF A;  4BC2 A;  4H5R A;  2W40 A;  1S22 A;  3TSU A;  1Z05 A;  4YOT A;  3I55 N;  1TUY A;  3P39 A;  3OA9 A;  2H3G X;  1YJN N;  4BG9 A;  2OAN A;  2E2P A;  5CR4 A;  4BR2 A;  3SMP A;  4IEE A;  1VQK N;  4Z94 A;  3CHW A;  2VWB A;  3A8Y A;  4ILG B;  3VTI A;  1M90 O;  5AQH A;  2YJF A;  1YIJ N;  1XUP O;  5EVZ A;  4B1W B;  3IKM A;  3S41 A;  1GLD G;  1HUX A;  3VEN A;  1JCE A;  1TYQ B;  1VQP N;  1NLV A;  1WOQ A;  1J6Z A;  5GIO A;  3KK7 A;  1VQ6 N;  3AGK A;  4FOI A;  5AQV A;  4YOX A;  3MN6 A;  3I33 A;  1NGG A;  1GLC G;  3VET A;  1QVF M;  2NLX A;  3CPW M;  2E2Q A;  3BF3 A;  2IVO A;  4BRM A;  3ZET B;  5DM6 L;  3CF5 L;  4KBO A;  2BTF A;  3M3Z A;  3QBW A;  2KHO A;  5TKW A;  4CZG A;  5BRD A;  3AGR A;  4CBW A;  1EQY A;  3FZL A;  3SBT A;  3BEX A;  2FLO A;  4NO7 A;  4CZM A;  1HKC A;  4GNI A;  4CD1 A;  1WUA A;  3MX5 A;  4MDA A;  1ATR A;  1NMD A;  5AQO A;  3P38 A;  1BWF O;  4FO0 A;  3KHY A;  5EX5 A;  1NGI A;  5JVH L;  5M1P A;  1Q18 A;  4DKW A;  1HLU A;  3TTF A;  4H0T B;  3E66 A;  4IDH A;  3HRG A;  4UY8 O;  3AY9 A;  3F9M A;  4JAX A;  3G4S N;  3QIC A;  4MLH A;  4BC3 A;  4BRD A;  2F9W A;  4MLE A;  5BPN A;  1T44 A;  1V4S A;  5GIP A;  1K8A O;  1RDW X;  3HM8 A;  4FSV A;  3CD6 N;  5E26 A;  2VGM A;  4ILJ A;  4JKB A;  4OPA A;  3VGL A;  3D2F B;  4BGB A;  2Q0U A;  4FVU A;  4BE7 B;  3QML A;  4HWI A;  3LDN A;  3C0B A;  3CQX A;  4IJA A;  4FWP A;  4XH4 A;  3CIP A;  2P9K B;  4YOR A;  2V51 B;  2HST A;  2P9U B;  3KVG A;  3R6M A;  3OW2 M;  1TYQ A;  2FSJ A;  4KH4 A;  4XJX A;  1GLE G;  5LY3 A;  3O4W A;  4B1Z A;  3G25 A;  4B1U B;  3CCU N;  1Q81 O;  3R3L A;  2OTL N;  1GLL O;  4XEI A;  3VGK A;  3ZET A;  4CZI A;  1YI2 N;  2HBJ A;  2RHK A;  3H45 C;  4WFB L;  3EO3 A;  4H0V B;  3BUZ B;  4A5B A;  3CMA N;  4NLC A;  4WCE L;  3MDQ A;  4GV9 A;  3C65 A;  4CZL A;  3K9J A;  4R79 A;  4OPH A;  5LJW A;  3MWP A;  2IIR A;  4U67 L;  5AQZ A;  2P9P B;  4JK9 A;  1SZ2 A;  3VEO A;  3CI5 A;  2F7T A;  2Q2R A;  3LM2 A;  1W2B M;  3FGU A;  1Q82 O;  5AQN A;  3SK3 A;  1GLB G;  1LOT B;  3P4I A;  5F2R A;  4CBX A;  3VER A;  5JVG L;  2YJE A;  3FZK A;  4A2B A;  2QWM A;  3SAH A;  1VQ4 N;  3A5L C;  5AQM A;  1S3X A;  1YUW A;  2FF3 B;  2QI2 A;  3U9D A;  2ZGZ A;  3CME N;  3A5O C;  3D2F A;  1SAZ A;  1XQS C;  3EKS A;  3CCM N;  3VOV A;  3HZ6 A;  3MN5 A;  4EFH A;  2P9K A;  3ATU A;  2P9U A;  5KQ8 A;  2HF4 A;  4FWL A;  3LDO A;  2YHY A;  1XC3 A;  4BRP A;  1VQM N;  1VAZ A;  4FL9 A;  4QS8 A;  2QWR A;  2ZJR L;  3G71 N;  2JWK A;  4BRK A;  3CPE A;  5JLH A;  2GEM A;  4WQ5 A;  5AFU H;  1R59 O;  4QS9 A;  4XH5 A;  3SAG A;  1HX1 A;  3RSE B;  1VQL N;  4EAH D;  3LDQ A;  4A61 A;  1IG8 A;  4AF1 A;  1RFQ A;  4YDU C;  2VYP A;  4U7B A;  1BO5 O;  3OHR A;  1KAY A;  1QQM A;  5M1O A;  5BR9 A;  3CER A;  4O8U A;  3HOS A;  4IWV A;  1RDU A;  1BU6 O;  1HPM A;  5FPN A;  4JKG B;  1MWM A;  1YF5 L;  3O80 A;  4ISG A;  4O5F A;  5TKY A;  5AQL A;  4FWO A;  3ZX0 A;  2NNW A;  2Q31 A;  3PLA A;  2P9S B;  2PAV A;  1DGK N;  4JK7 A;  3ATV A;  3UE5 A;  3ULE A;  5GAE P;  3C6A A;  1JCF A;  1NGF A;  2FSN A;  3D6R A;  3VGM A;  1NBW A;  3BF1 A;  2HOE A;  4JK8 A;  2V52 B;  5CHI A;  5AQI A;  2W00 A;  5AZJ B;  3WXJ A;  3U4L A;  5AZI B;  3JXU A;  1Q86 O;  3NVK A;  5AQK A;  5AQS A;  1YXQ A;  4PHT X;  3HBT A;  4RCH A;  3U9Z A;  5AQG A;  1VQ8 N;  1CZA N;  4BEB A;  3CJ7 A;  2ASP A;  2Q0R A;  4CBU A;  2ITM A;  5HOO A;  2F9T A;  1VQ9 N;  4FPB A;  3H1Q A;  3F2K A;  4AM7 A;  2HMP A;  3FZF A;  4CZH A;  3EN9 A;  1T3V A;  2HBL A;  5CE3 A;  1M1K O;  1ESV A;  2P9N B;  4JKG A;  1QZ5 A;  3WQT A;  3WQU A;  3PIO L;  2FSK A;  1YVN A;  2QWP A;  2D4W A;  2HBM A;  4H5N A;  4K41 A;  4EIA A;  3HTV A;  3M6G A;  3QBX A;  3RVC A;  4KH5 A;  4A2A A;  2NRW A;  4BR4 A;  3UKU B;  3I56 N;  2PBD A;  4BR9 A;  3CC4 N;  1Y64 A;  2C1G A;  4XH1 A;  1U2V B;  1X3N A;  3ENO A;  2ZGY A;  3O1B A;  2JWL A;  4PL8 A;  2WUS A;  2QTD A;  2FXU A;  3ZX2 A;  3ZX3 A;  1K8K B;  5B8H A;  1RGI A;  2BH1 A;  4G9Z A;  3HSC A;  1P8Z A;  2A41 A;  4H5T A;  2RE2 A;  5KPZ A;  2V7Z A;  1IJJ A;  4JEP A;  4BRL A;  5AZJ A;  4C1N I;  4CZK A;  5AZI A;  2E2O A;  4LC9 B;  1NGH A;  2YX6 A;  3ENH A;  3FFK B;  5C12 A;  5EXW A;  2ZJP L;  4BVO A;  2ZJQ L;  2P9I B;  2E20 A;  2C1I A;  3HI0 A;  4MO5 A;  4K42 A;  5FPE A;  4J8F A;  2CH6 A;  4WYB A;  1TUU A;  3H1V X;  1V4T A;  5ADX H;  3Q7C A;  3H3N O;  4A5A A;  2P9N A;  4WF9 L;  1YHQ N;  3R8E A;  4F9O A;  3C6H A;  1HKG A;  4GV3 A;  3ZEU B;  1QQO A;  3IMX A;  4AM6 A;  3TPQ A;  3UKU A;  1H1V A;  2A6A A;  3EE9 A;  2YCH A;  3FZM A;  2QWN A;  3O5B A;  2I7P A;  4A62 A;  4JHD B;  4BC5 A;  1N8R O;  5BRE A;  4IOA L;  3WEE B;  1U2V A;  2CH5 A;  5F0X A;  4EHU A;  3CQY A;  4BR5 A;  4RWT A;  5E84 A;  4IOX A;  1S72 N;  3SAF A;  3GL1 A;  4GVE A;  3VF6 A;  5C2F A;  4KH6 A;  4BRE A;  5H1S Q;  1K8K A;  4WQ4 C;  3J8A A;  4BRC A;  4YOU A;  3CJ1 A;  1YIT N;  2HF3 A;  1VQO N;  2ZF5 O;  5FPM A;  1KAZ A;  3CCV N;  3IDH A;  4CZJ A;  4BRH A;  3ENB A;  4WQ4 A;  3LM9 A;  4FWR A;  3VF2 A;  3AAQ A;  3L4Q A;  4FWK A;  3H6E A;  3TSP A;  3A0I X;  3E9O A;  4IZ9 A;  4CZF A;  5BPL A;  1ATN A;  2P9I A;  3GOI A;  5AQJ A;  4BY9 C;  4WQ5 C;  3VEY A;  2QWQ A;  1QHA A;  5DM7 L;  1OVY A;  1ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...