3A5NC

Crystal structure of a dictyostelium p109a ca2+-actin in complex with human gelsolin segment 1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
359
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
molecule keywords Gelsolin
molecule tags Contractile protein
source organism Homo sapiens
total genus 117
structure length 359
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5nC03
5BPMA 1LOTB 3ZX3A 3VGLA 2VCPA 1BOTO 2IVNA 1TYQB 2QWMA 4CZLA 3O80A 4BR9A 5AQYA 2FSJA 3VGMA 4I6MA 5CE3A 4IJNA 4CZKA 5I9EB 4IWVA 3VOVA 3VPZA 3JS6A 1Q18A 1X9JA 4JD2A 2ZGZA 1YXQA 1G99A 3D2EB 3DXKB 4IZ9A 2ASPA 3A5MC 5JLFA 4DQ8A 2D0OA 5FPEA 2VWBA 2J4RA 3VF6A 1YVNA 4C23A 5BREA 3H1QA 2A6AA 3FZKA 3CI5A 3WEEA 3LL3A 3D7EO 3MK6A 2A40A 4XH4A 1JCGA 1MWMA 1QZ5A 3U9DA 1S3XA 5AQOA 3CJCA 3ZETA 5AR0A 1NGAA 2Q1NA 4MO4A 3O08A 1GLCG 4IJAA 3D2FA 4IO8A 3W3DA 4GY2B 3UE5A 1NMDA 3EKUA 4Z94A 3UKRA 1C0GA 2V7YA 3ATVA 3FZMA 2FSNA 3ATUA 4ISFA 2ZGYA 4QS7A 2GWKA 1NGHA 3ENOA 1V4SA 1WOQA 4CZJA 2E2NA 3UB5A 3WXJA 5ADXA 4MO5A 4DB3A 5F1XA 3EKSA 3VEOA 2CH5A 2V52B 5AQZA 1KAZA 4CD1A 3ZX0A 1NGGA 1GLFO 3GOIA 1ESVA 4MLHA 4JHDA 1HX1A 2QM1A 4JN4A 3SK3A 2ITMA 3IFRA 2CGJA 2HMPA 3H1VX 1DGKN 5AZJB 4B1ZA 2A42A 3WXIA 4FSVA 4CBWA 2I7PA 4J8FA 3WXKA 2GWJA 3DWLA 4H5RA 2P9UB 2P9LA 1Z6RA 5EVZA 1T6CA 1U2VA 4PKHA 2HF3A 4EHTA 4CZGA 3M1FA 3MDQA 3DXMB 4CZFA 2W40A 5ELZA 5KPRA 4FWKA 3GL1A 5JICA 2GEMA 5F0XA 2QW9A 2CH6A 3CHWA 1HKBA 4FPBA 4CD3A 1BDGA 4FOEA 1V4TA 1CZAN 3EO3A 3ZEUA 1J6ZA 3KZBA 5AQNA 1H1VA 1NLVA 1BU6O 2HOEA 4AM7A 4BR2A 4GNIA 4H5VA 2Q0UA 3H46O 3I8BA 2P9SB 3H45C 2DPNA 2V51B 2Q2RA 4FL9A 3LDPA 4ISEA 3O6WA 1BUPA 1NGJA 5BPNA 2P9KA 2NRHA 3IUCA 1BWFO 2FXUA 3BP8A 4JNEA 1GLBG 4HWIA 3RSEA 4M7YA 4BQZA 5KPZA 3AARA 4I6MB 2YI1A 1HKGA 3BEXA 4PKGA 3LDOA 3FLCO 4JD2B 4L3QA 5AQKA 4BRDA 2YJFA 4H5TA 4BC5A 3BF3A 2V7ZA 1IJJA 2Q31A 4H0XB 2CGLA 3VF2A 1Y64A 1NGDA 2GUPA 5BRFA 3HI0A 2I7NA 1XC3A 3MCPA 1BG3A 4H5WA 4BRIA 1KAYA 4YDUA 4RTFD 3VERA 4A2AA 3CIPA 1D4XA 3WEEB 3QMLA 5AQXA 4NB4A 4WQ4A 3AY9A 4DCHA 3QBWA 5ADXH 5E26A 3ENHA 3CERA 4O8KA 4EIAA 5AQFA 3B8AX 3ZETB 2OANA 2CGKA 3EZWA 4BRKA 1MWKA 2QWNA 3MN6A 5KQDA 2A41A 3D2FB 4BRLA 1BA0A 3EN9A 3VETA 5AQGA 1RDWX 1LCUA 4BG9A 4EFHA 3UKRB 3M3ZA 3BF1A 3VEWA 5AZIA 3CJBA 3DAWA 3VEYA 3UKUA 2YCHA 2P9PA 1OKJA 2ZF5O 2E88A 1JCEA 3QDKA 3J8AA 3LM2A 2FF3B 4B1YB 4HTLA 3P4IA 2E2PA 4WYBA 4FWNA 3HSCA 4XEIA 3CQYA 3U8XA 2F9WA 4BVOA 3G25A 3A5OC 5LJWA 3AAPA 3FR0A 4YDUC 3M6GA 4MLEA 1ATRA 1KXPA 4M7XA 3QB0A 4BR5A 4CZIA 2NLXA 1HLUA 3WQTA 1XQSC 3CJAA 3MN5A 5AQJA 2E2QA 4JHDB 3SMPA 1E4FT 5LY3A 2IIRA 4H0VB 4IXCA 3VEVA 3S41A 2QXLA 3VEXA 2ZWHA 4FWOA 4WQ4C 4CZMA 4DHYA 4CI6A 4K43A 5AQQA 1KAXA 4BR0A 3DJCA 2P9LB 2IVPA 2QWQA 1NGBA 1U2VB 2NZTA 2YHYA 3IDHA 4FO0A 4CJ7A 4BGBA 3SJHA 2A5XA 3MN7A 3O5BA 5BN9A 3R6MA 4A61A 1ATSA 2YHWA 5EX5A 1QQNA 4O5FA 1BO5O 4BGAA 3C0BA 2E1YA 3FFKB 5AFUH 1P8ZA 4CZEA 2QWPA 2A3ZA 1SQKA 3HM8A 1JCFA 5AQRA 1ZC6A 4FOIA 3CETA 3ZEUB 5AQVA 5AQUA 3GDQA 3FZLA 1WUAA 4PL8A 1E4GT 1YUWA 4A62A 4WQ5A 4FWPA 2AA4A 3VENA 3CJ9A 2ASOA 3U9ZA 3GE1A 5EY4A 4B1VA 2P9IA 1GLLO 2P9KB 4H03B 1R59O 4FPAA 3QICA 4FWMA 3VF4A 3RSEB 5KQ8A 5AFUA 4FWRA 3FZHA 3VGKA 3JXUA 1QHAA 4BC2A 1X3NA 3SLCA 5BN8A 4H0TB 1DEJA 5AQPA 4BRHA 1K8KA 2W41A 5E84A 5F2RA 1GLDG 3TPQA 4CBUA 5LJVA 1SZ2A 5KPTA 4BREA 3C7NA 1QQOA 1HKCA 1NGEA 3ULEA 3F9MA 3HZ6A 2P9NA 3SMSA 4BRGA 1DKGD 4PL7A 4A2BA 4B9QA 2E1ZA 3MMVA 5BR9A 3FZFA 3VESA 1HUXA 5TKYA 2AP1A 2PBDA 4WQ5C 3LDLA 1X3MA 1NGIA 3L4IA 4EHUA 4QS8A 3A0IX 2YJEA 1TYQA 1GLJO 3WUHA 1YAGA 5AQIA 3BUZB 4RCHA 1EQYA 3FGUA 2YHXA 2EWSA 1Z05A 4H5NA 5B8HA 2Q97A 1ZBSA 2E8AA 3CJ7A 4K41A 4H0OA 2QWOA 2H3GX 5FPNA 1C0FA 2ASMA 5AZIB 4BRCA 1MA9B 2KHOA 3UKUB 3D2EA 2P9PB 2QWLA 3DXKA 3A5LC 3O1BA 3CQXA 1XUPO 3KVGA 4CBXA 5AQLA 3WT0A 2FSKA 3U4LA 2UYTA 2VYPA 3R8EA 3R9PA 2IVOA 3ZX2A 4H0YB 5FPMA 3A8YA 3GBTA 3FE1A 1GLAG 4RWTA 3L6QA 3WQUA 3QFUA 2FLOA 4BRNA 3LDQA 4B1UB 2GELA 3QBXA 2QWRA 4B1WB 4BC3A 5AQMA 5AQTA 4BG8A 4BQLA 4AM6A 3H3OB 2PAVA 4BVPA 1IG8A 5AQSA 1NGFA 1S22A 1TUYA 1ATNA 1GLEG 2HF4A 4K42A 5BRDA 1SAZA 5AQWA 4E1JA 4B1XB 1NM1A 2BTFA 3HTVA 2E2OA 4BROA 2BUPA 1HJOA 1TUUA 4KBOA 4CZHA 3HBTA 1BA1A 3TU5A 3I33A 3QFPA 2D4WA 4BRMA 4JAXA 4XH5A 5JMVA 4BR4A 2E20A 5BRHA 5JLHA 4FWSA 3MN9A 5AZJA 2D1KA 1NBWA 3GG4A 4QS9A 2Q36A 2P9UA 3L0QA 1ZXOA 2D0PA 5AQHA 4F9OA 3O4WA 2P9IB 4ISGA 1NGCA 3DXMA 4XH1A 2WUSA 2GTDA 3A5NC 3AAQA 4M63C 5EXWA 4LC9B 4Y0WA 3KHYA 3EL2A 3O1WA 5EOYA 1RFQA 4H0PA 1U6ZA 3W0LA 4BRAA 1RGIA 4BC4A 1K8KB 3H3NO 1T44A 1T6DA 2Q0RA 1MDUB 3IMXA 4FWLA 3VEZA 3H6EA 3LM9A 4BR7A 4EAHD 1HPMA 3C7NB 4K25A 4FWQA 3OHRA 4PKIA 3CJ1A 1NWKA 3ULEB 4NO7A 5BPLA 3O8MA 2P9NB 4BRQA 1QZ6A 2P9SA 2F9TA 4BRFA 4BRPA 5FPDA 2FF6A 3LDNA 1QQMA 3WXLA 3ID8A
chains in the Genus database with same CATH superfamily
1ASVA 4CHPA 5BPMA 1LOTB 1W2BM 3VGLA 3V9UA 3R1XA 4BR9A 5AQYA 3VGMA 1BI4A 3NVMA 4I6MA 4IJNA 5J2PA 4IWVA 3PV8A 2FBYA 3JS6A 3MCAB 3OYBA 1YXQA 4HCCA 3IRXA 3BY5A 1RT3A 3D2EB 1B9FA 3DLHA 3DXKB 4M3XA 1TKZA 2GV9A 5JLFA 3MWTA 5FPEA 1NJZA 4IEIA 1KLMA 3QEXA 2XY5A 4OO1J 2VQEK 2A6AA 3KLHA 2E6MA 1T8EA 1VK0A 3CI5A 3LL3A 3D7EO 3D0PA 5HLFA 3S3OA 2ZD1A 2A40A 3QIPA 1JCGA 3DOLA 5AQOA 3CJCA 3KLIA 2XY7A 1T3VA 3O08A 1GLCG 4IJAA 3OVNA 2ETJA 3EKUA 2F96A 3ZSWA 4CW7B 3RMCA 1VQON 4Z94A 3UKRA 2WTUA 3FZMA 2HBKA 3LWMA 1W0HA 3DLRA 4ISFA 4FZYA 4QS7A 2GWKA 3CC7N 1NGHA 5KGWA 4XIUA 4JI8K 1V4SA 1WOQA 4CZJA 3QEIA 3TAPA 2E2NA 3WXJA 4X65K 4BWJA 2X78A 2V52B 5AQZA 3O3FA 3P39A 2ZJRL 3L2UA 3GOIA 1VQNN 4MLHA 3OA9A 3EY1A 2GUIA 4JN4A 3SK3A 3E9PA 2CGJA 1WSHA 3IG1A 1GOBA 5FRMA 3DWLA 3QO9A 1IBLK 3HP6A 1Z6RA 5EVZA 1T6CA 3HYFA 2HF3A 3EE8A 1LWCA 5ELZA 2OTJN 1NJWA 4DR1K 1C0UA 4JKBA 1HKBA 4I9LA 1RDDA 3K59A 4KI4A 3KK3A 4AHVA 3WNEA 3FFIA 5GIPA 3WNGA 4JI4K 2VG5A 4CECA 1ZBUA 3HPOA 4IFVA 4E7IA 3V6DA 2RPIA 1TGOA 2YNFA 3ZT0A 1DTQA 2OPSA 3AA3A 1NNEA 3OY9A 3ZSVA 4Q5VA 1TVRA 4EZ9A 4DQSA 3K0SA 5TKWA 1HNVA 3LP2A 2NRHA 3IUCA 4N47A 3NF9A 4ILHA 3L3UA 2FXUA 5GIOA 3T69A 5EU7A 3CCSN 4X64K 1HPZA 3S3MA 3RRGA 4CF8A 4OLAA 1BI4B 3AARA 4I6MB 4PKGA 4B9TA 3P5JA 3LDOA 4BWMA 4FJIA 2DFFA 4L3QA 2Z1GA 2YJFA 3OS1A 3OYKA 1IJJA 2Q31A 3T19A 3ZSZA 1WBBA 3CMEN 5BRFA 1BG3A 4BRIA 4RTFD 4HUFA 2PYLA 4FZZA 3SAHA 4E7KA 4CJ3A 1XI1A 3PY8A 3AY9A 5CYMA 4MQ3A 4B3RK 2OANA 2FBVA 1MWKA 4OPAA 3OW2M 3MN6A 4FJNA 5KQDA 4ZTFA 2YNHA 3EN9A 1KCFA 3V1OA 4EFHA 1NG9A 3ZSXA 4DSLA 3KK2A 4W5NA 4U7BA 3UKRB 3M3ZA 4CJ5A 1L5UA 5AZIA 4DFKA 3UKUA 4BY9C 3NGIA 3L2QA 1JCEA 3MAQA 3LWLA 3CM5A 3ZT3A 1XMOK 3J8AA 3MX5A 2FC0A 3OS0A 1IO2A 2DY4A 3DI6A 4NYFA 3S5TA 2B5JA 4BVOA 3O9TA 4GKJK 1RDBA 4MLEA 1ATRA 4C1NK 2C1GA 2HBLA 1YVUA 3WQTA 4DMNA 3MN5A 1ITGA 5AQJA 1E4FT 5LY3A 2IIRA 4PUOA 3J80O 4IXCA 3S41A 3VEXA 4CERA 4CZMA 4NXNK 3VTHA 3DJCA 4R79A 2IVPA 2YNIA 3CMAN 3QEPA 2NZTA 4DLEA 3O5BA 5BN9A 3TTCA 1RDAA 2WC9A 1VHXA 1VSIA 1JL1A 4O5FA 5CY4A 2ZM6K 3NFAA 3FFKB 3TARA 4DQIA 3SI6A 5J1EA 3HM8A 2HVHA 1D9FA 3LPUA 3PUFA 3Q7BA 3DLLL 4LFBK 4C8LA 1S1WA 1B9DA 4KPYA 4IOAL 4WQ5A 1ZBHA 1Z26A 3AVFA 4NLBA 4KV8A 4BDYA 4BDZA 3ISNC 4B1VA 1I94K 2P9IA 3TSUA 3TTFA 5JS2A 4C8OA 1GOCA 3CYGA 4CEEA 4DG1A 3PX6A 3VQEA 2X74A 4FJ9A 3SAGA 4WFAL 2Z1JA 3K5NA 4FK0A 1EXQA 1FK9A 1X3NA 3HT3A 2VG7A 3TAFA 4DQQA 2W41A 1VQ7N 1NK4A 1BQMA 3RTVA 1ASUA 1HKCA 4F3OA 1CLQA 3KKSA 3HZ6A 4YORA 4A2BA 4YNQA 1LWEA 1NMNA 4PHTX 1HUXA 3SPYA 2LSNA 3AGRA 4ZHRA 2ATQA 2Y1JA 4JK7A 4LF7K 4TSXA 4E72A 1TAUA 5CR4A 2W42A 5BR8K 5AQIA 3BUZB 1Z05A 3SCXA 5B8HA 2NNWA 4CJQA 1ZBSA 2E8AA 3CJ7A 1NK9A 2H3GX 5FPNA 4LF4K 5AZIB 5GAHP 3UKUB 3DLBA 2WOMA 3A5LC 4E19A 4KRFA 1XUPO 2HHVA 4CBXA 5AQLA 3U4LA 3G4SN 3R9PA 2IVOA 2YX6A 3OYMA 4C8MA 4DKWA 3TSPA 4MDBA 4PY5A 4DTOA 3WQUA 4FM2A 1KFDA 3THWA 1LAWA 4B1UB 1S9GA 3S3NA 1ZBFA 5AQTA 2F8TA 1QS4A 3SQ4A 4CGIA 3LAKA 1RT2A 4CIEA 4F2SA 4MDAA 4F2RA 2F7TA 3RMAA 2HF4A 4DR6K 5A2QO 1WSGA 4CJEA 4E1JA 4KTZA 2P5GA 2BTFA 1KRPA 3THYA 4KBOA 4A5BA 3HBTA 3NE6A 1JLGA 3QFPA 4BR4A 5LMUK 4EZ6A 4CJRA 3VQAA 5JLHA 3OBYA 3KK7A 4FWSA 5C0YA 5AZJA 1NK6A 1VSJA 4YOXA 1Q86O 3AV9A 3GG4A 3I55N 2P9UA 3O4NA 3QETA 1VRUA 1ZXOA 3RRHA 3VQBA 2FBXA 2P9IB 4FJHA 4KFBA 4ISGA 3HK2A 3OYHA 1NGCA 5EXWA 1KTQA 4LF8K 1NKCA 3KIOA 1WSFA 4B3TK 1OVYA 1O1WA 3JSMA 5DM7L 2UUBK 4YHHK 1RGIA 4Z4EA 1RNHA 2Q0RA 1MDUB 5GAEP 3LM9A 1JLEA 3T1HK 4BR7A 4JRQA 1YT3A 2ZJQL 4PKIA 3OHRA 1NWKA 4JI6K 1OH8A 3VQ9A 4AF1A 1HQEA 1XNRK 1CXUA 3WNHA 2F9TA 3LDNA 3WXLA 5E41A 3ID8A 1CZ9A 4IOCL 1N6QA 4N41A 1A5VA 1NK5A 4DTMA 1HMVA 2IVNA 2QWMA 4NCGA 3CC2N 4CZLA 4JKDA 3ENBA 2FSJA 3BDPA 2XY6A 3PX0A 3VPZA 4DUYK 1Q18A 1X9JA 4DTNA 4FXDA 2BDPA 5CZ1A 3I0SA 3DOKA 3CQ8A 3NBPA 4Z4IA 2D0OA 4FLUA 4DV1K 3H1QA 1TK8A 3WEEA 4KHNA 4JK9A 3V4IA 2HNZA 4JI1K 4XH4A 3O9SA 2XO7A 1MWMA 3NH1A 1KSPA 2D0BA 3THWB 4FLVA 2Q1NA 4MO4A 3D2FA 3M8QA 4GY2B 3UE5A 5FLXO 1NMDA 1C0TA 4KHYA 3SNNA 2JWKA 1ZYQA 4FW2A 3ATUA 3CM6A 1RTDA 2X6NA 3ENOA 4GMJB 1U47A 4NYNA 1K73O 3THYB 5ADXA 1U49A 1N8RO 3SZ2A 4DSFA 2KFNA 3EKSA 3VEOA 4J2EA 1KAZA 1BCOA 5C25A 5H1SQ 1N34K 4JHDA 2ITMA 2HMPA 5AZJB 1DGKN 4LSLA 4B1ZA 4BE2A 3VQDA 2A42A 2JGUA 2I7PA 3WXKA 4BACA 4H5RA 2P9UB 4FM1A 1DTTA 3OYCA 3CC4N 1UA0A 4CZFA 4I2QA 3S9HA 5KPRA 3GL1A 3AO3A 5JICA 4LF6K 3CHWA 3MEGA 1TK5A 3KJVA 1Q82O 1IG9A 2EX3A 4FJKA 1HYZA 4CD3A 1BDGA 1V4TA 4KB0A 3NMUA 4BE7B 1LWFA 1VQ4N 1C1CA 1J6ZA 3ZCMA 1NLVA 1BU6O 2HHXA 2HOEA 1UA1A 4DF8A 4GNIA 3SUNA 2Q0UA 3H46O 4O44A 4YOYA 2A1SA 1ZBLA 2V51B 1DLOA 5FRNA 1BL3A 4CEQA 2KFZA 5BPNA 1J54A 2P9KA 3RR7A 2HHTA 1K9MO 4B9NA 1GLBG 1YI2N 5KPZA 4IDHA 4WF9L 1HKGA 1WSEA 3QIOA 2NRTA 4BRDA 1EKEA 1C6VA 4H5TA 4BC5A 3BF3A 4O0JA 2QKKA 1UOCA 4DQPA 4FJGA 1S9EA 3LP1A 4XJXA 3QERA 1S1XA 2I7NA 1VSFA 3HRGA 5KTQA 4A2AA 3CIPA 1D4XA 1Q8IA 3K5MA 3QNNA 4UQGA 2YHAA 3WEEB 4DFMA 5M1OA 1FKPA 4DLGA 5E26A 1KFSA 4JKFA 4O8KA 5AQFA 3B8AX 4JKEA 4JI0K 3D2FB 1YITN 1TKDA 1VAZA 5AJ3K 4JI5K 4CVNE 3MWPA 3THVA 3VEWA 2IGIA 3O9QA 4U67L 1TAQA 2YCHA 2P9PA 3VTIA 3NGYA 1NK7A 3LM2A 1LV5A 2E2PA 1MU2A 3HSCA 4FK2A 4RW4A 4EP5A 4DR7K 3ZYYX 3CQYA 2HMIA 4YDUC 3M6GA 2G8KA 3QB0A 4BR5A 4CZIA 2NLXA 5CZ2A 3CJAA 4K8XA 4JHDB 2OZMA 2W6LA 2G8HA 4I7FA 4FWOA 4WQ4C 4CI6A 5C2FA 3AVCA 4K43A 3F73A 4OKKA 4GV3A 3G0ZA 2QWQA 4FO0A 4CJ7A 2O8EA 4BGBA 5KRTA 4YOTA 2G8WA 4CFCA 5EX5A 1A5XA 1QQNA 1BO5O 1VQKN 2E1YA 3V9XA 2P51A 3G6EN 1P8ZA 1Q81O 3L2VA 4CZEA 3DLKA 2A3ZA 4LD0A 1SQKA 1KVCA 3SQ1A 4KHSA 4FOIA 1YTUA 5AQUA 3GDQA 2NRZA 4JI2K 1YUWA 1QVFM 3ZT2A 4FWPA 3TR8A 4BEBA 2AA4A 4CGDA 1J9AA 3U9ZA 3J7YP 4FCYA 4JV5K 4ELVA 5LMNK 1P90A 2P9KB 2VG6A 3SUOA 4DTPA 4FPAA 3QICA 2WBNA 4C8NA 1RT6A 4RW6A 4FWRA 3FZHA 2W00A 4KREA 4BC2A 3SLCA 1VQ8N 2PFUA 2HHQA 5BN8A 3CCRN 3LP3A 3O4QA 4GW6A 3AA5X 1XHXA 4BRHA 3KLEA 4DQRA 5HP1A 5E84A 1EP4A 4CBUA 1HRHA 4DR3K 4B3MK 1QQOA 5HRSA 3ULEA 3F9MA 2I5JA 4BRGA 1DKGD 1VSEA 3DRRA 5BR9A 5TKYA 3LZJA 1NKBA 2O8CA 1X3MA 4RW8A 1NGIA 3L4IA 1N32K 4QS8A 3A0IX 1TYQA 4DSKA 4FLZA 1YIJN 4RCHA 5FDLA 2O4GA 1B92A 4HHTA 3CFOA 3TANA 3OJSA 1YTAA 4BRCA 4CK1A 1YHQN 2P9PB 2QWLA 3TSQA 3C6TA 5IWAK 4AHRA 2F8SA 4DTJA 1NJXA 2QK9A 3NGZA 2FSKA 3AA4A 4AH9A 3R8EA 4O0IA 3KK1A 5FPMA 3A8YA 3I56N 4OLBA 1GLAG 3L6QA 2YNGA 2PYJA 3MXIA 1KD1O 1QE1A 4BRNA 2X6SA 1RBVA 1S72N 2O8FA 1K6YA 5J2NA 3VQCA 2Z1IA 4MFBA 2O8EB 4PA1A 3P1GA 4PWDA 3AVHA 3HM9A 4FJ8A 2R7YA 1GLEG 4K42A 4KTQA 5AQWA 1TKTA 3AO4A 1HNWK 2W6KA 3HTVA 1JLAA 3NH2A 1HJOA 1JXEA 1VQLN 2ITGA 3LZIA 1QVGM 2OPPA 1SS6A 3F9KA 3O9RA 4ILGB 4N56A 5KRSA 4JI3K 3QLHA 3MN9A 1HYVA 4G9ZA 1NBWA 3L0QA 3G71N 3MECA 2XHBA 4ELTA 1W97L 1XHZA 4DTUA 3O4WA 5GAGP 3AVJA 2P5OA 3DXMA 4XH1A 2GTDA 3AAQA 3HJFA 4M63C 2G8UA 4Y0WA 5C10A 3KHYA 1T7PA 3AVKA 3VQPA 4OPKA 1QSYA 1IBKK 1SKWA 3VMFB 4NCAA 3CPEA 5GADP 1S5JA 4DV4K 4GKKK 2UU9K 1S1UA 3PO4A 4IBNA 4KB1A 4BC4A 4QAGA 4OPJA 3AGKA 1T6DA 3IMXA 3VEZA 1X1PA 4K8ZA 4FW1A 4KH5A 4EAHD 1WAJA 3ULEB 4CEAA 1W7AA 4GVEA 3CCEN 4F8RA 1OH5A 4BRFA 4CJSA 4CJFA 1BISA 4E0DA 4FJXA 2O8CB 4YOUA 4B8AB 4DTSA 1QSLA 1SV5A 1TYQB 3M8RA 3O80A 3OYEA 3L2WA 4DWIA 5CE3A 4AILC 3VOVA 4CGHA 4CHZA 2KLAA 1G99A 3K57A 4CCHA 4GV6A 1JLQA 4IZ9A 1J53A 3CCUN 2ASPA 3ALYA 4DQ8A 3ASMA 3SV3A 2VWBA 2J4RA 3VF6A 4Z4FA 2DFHA 3ZT1A 4C8KA 1U04A 1NJIO 4CF2A 4B3OA 1QZ5A 1RT5A 3U9DA 1S3XA 3ZETA 3V81A 4DS5A 1KVAA 5HOOA 5AR0A 1NGAA 4JKAA 4IO8A 4J2BA 2O8FB 3V1QA 3W3DA 1IKVA 5C15A 2V7YA 3ATVA 1VQ6N 3PSIA 1FJGK 1I3AA 1OH7A 2JLEA 1WSIA 1K8AO 4EP4A 3UB5A 4MO5A 5C2DA 2HHIA 1FKOA 1L3SA 4NCBA 3EEQA 4CD1A 1KQSM 2IS3A 3ZX0A 4KHPK 1NGGA 3SJJA 1NOYA 4A57A 1HX1A 2QM1A 4DV3K 3Q7CA 3V9SA 3IFRA 3UIQA 2QTDA 3WXIA 2VQFK 4CBWA 1RCHA 1U2VA 1SKRA 3F5TA 4EHTA 4A5AA 3DRPA 3MDQA 2VWKA 3DXMB 1M1KO 3CCJN 1L3VA 4FWKA 1HNZK 3TABA 3CYMA 5F0XA 1D8YA 4V19S 3BGRA 4CEBA 2ZJPL 1Q9XA 4FOEA 3K9KA 4CJWA 3OYNA 3EO3A 3V1RA 2IAJA 3ZEUA 1U4BA 3KZBA 5AQNA 1N36K 1VSHA 1VQ5N 4QOZB 4BR2A 3VQ5A 1VSDA 4YOVA 3RR8A 3C95A 3HL8A 3VA0A 3HSTB 2E6LA 2DPNA 4OGEA 2Q2RA 4FL9A 3LDPA 4ISEA 5M1QA 1Y97A 5HROA 1NGJA 4NXMK 4FLWA 3DRSA 3OYLA 4DU1A 3BP8A 4JNEA 3DM2A 3SPZA 4OKJA 4HWIA 3BZCA 3RSEA 4CESA 4BQZA 3CCLN 4CEZA 4M3WA 2YI1A 1F21A 3BEXA 2HB5A 2RF2A 1JLBA 2FBTA 4GVMA 1NJYA 2HNDA 3FLCO 3SBGA 2HHSA 3AVIA 2V7ZA 1VQMN 4H0XB 3VF2A 5M1NA 1NGDA 3R3LA 1KVBA 3MCPA 1XC3A 3CFPA 3JAMO 4Z4HA 4ZTJA 1OH6A 3ZSOA 1RBUA 4IFEA 3P38A 4JKGA 3QMLA 4ILJA 1IBMK 5AQXA 4NB4A 5ADXH 3ENHA 4EIAA 3ZETB 4BRKA 2CGKA 4QCLA 1QSSA 4BRLA 1BA0A 1LW2A 3VETA 5AQGA 4CJLA 4IG0A 1RDWX 1LCUA 5K14A 1WN7A 3VEYA 3DAWA 3P83D 4CK3A 1VSKA 1CXQA 1J5EK 2ZF5O 4DTXA 2E88A 3N4QA 2RE2A 3TAMA 1QTMA 1HQUA 4RW7A 3NH0A 4B1YB 3O3GA 4HTLA 3P4IA 3SBTA 4WYBA 4FWNA 4LH4A 3CG7A 1ZBIA 2Y1IA 2F9WA 4JLHA 2BANA 1VQ9N 3AAPA 3FR0A 5JVHL 4DR5K 1HLUA 4F4KA 1VSLA 2E2QA 3NF8A 3SMPA 4H0VB 3KD1E 4CFAA 4W5RA 4O8UA 2QXLA 4IO9L 2ZWHA 1T05A 4DHYA 4KAZA 4IG3A 4JKHA 3U3GA 1KAXA 4BR0A 1RTHA 3PO5A 3LALA 1NGBA 1U2VB 2YHYA 5C42A 3TI0A 3M8PA 3SJHA 1GOAA 3AO2A 3R6MA 4A61A 2YHWA 4CEOA 4YFUA 4DU3A 4BGAA 4J2DA 2E4LA 4W5QA 3E9LA 3CCMN 4LF9K 4M3ZA 4Z4CA 2QWPA 2NRWA 3OYFA 3EYZA 3VQQA 4FJLA 1JCFA 1ZC6A 4M45A 3CETA 1RT4A 4O55A 3ZEUB 5AQVA 4FJMA 4PL8A 1E4GT 3PX4A 4LF5K 2UUAK 4A62A 1R0AA 3C6HA 4CJTA 5DK5A 1LAVA 1HNIA 1R59O 3VF4A 3RSEB 4DSJA 4M3YA 5M1KA 3VGKA 2O8DA 3VN5A 1QHAA 4CGGA 3ID6A 3AVNA 3QNOA 3HXMA 4H0TB 1DEJA 3J7ZO 3B6PA 4WFNL 2UXDK 3LDSA 3PLAA 5KPTA 5C12A 3T1YK 1RTIA 5M1FA 3NF6A 4RG8A 4CJKA 2KKZA 2OYQA 3RMDA 1WSJA 4JKGB 4PL7A 2QXFA 4B9QA 2XRIA 2E1ZA 4E1MA 3FZFA 3K2PA 2AP1A 2PBDA 4WQ5C 1RT1A 5HRNA 2F4VK 2YHBA 2YJEA 2DFEA 2OPQA 1GLJO 3FGUA 4FLYA 2NRVA 4ICLA 1N5YA 2Q97A 4Q0BA 3AVMA 4K41A 4H0OA 2QWOA 2ASMA 2VGNA 1KLNA 2KTQA 4CHOA 2KHOA 4JS5A 4CHQA 3L8BA 3O1BA 3SUPA 2HBJA 2UUCK 2YKMA 1SUQA 2UYTA 4CJVA 1XWLA 1SL2A 2QKBA 4DV0K 1NKEA 4RWTA 3NVKA 3ITHA 4DUZK 3QFUA 2FLOA 3AO5A 4CEFA 3OYDA 3LDQA 3C65A 2GELA 3QBXA 2QWRA 4BC3A 4BG8A 1I39A 4BQLA 5LL6Z 1W9HA 4M3UA 2PAVA 4WFBL 4DSIA 4BVPA 4B9LA 4Y1DA 1IG8A 5AQSA 3T7ZA 3OJUA 4H4MA 2HSTA 4FM0A 1BHLA 1ATNA 2Z1HA 1EX4A 1YF5L 1BIUA 1NM1A 4R5PA 2E2OA 3NHGA 4DV2K 2OTLN 3O9UA 3AO1A 3LAMA 1S1VA 1C1BA 1BA1A 4I2PA 3TU5A 5I3UA 3I33A 4E7LA 2PY5A 2D4WA 4E7HA 3NF7A 4XH5A 3LANA 4DFPA 2E20A 2AJQA 2O8BA 3WNFA 3A2FA 3TAGA 4QS9A 3K5LA 3VA3A 5FROA 2D0PA 3AVGA 5AQHA 2UXCK 2NRXA 4M3TA 3E01A 4CFDA 3KKRA 3SAFA 3NAEA 3A5NC 1BIZA 4LH5A 4LC9B 5DM6L 3EL2A 3O1WA 3OTOK 4DF4A 1ILYA 2O8DB 4DSEA 4DR2K 1VQPN 3U6FA 4H0PA 4JEPA 1U6ZA 3W0LA 4BRAA 2D0AA 1T44A 4JYAK 1RDUA 3H6EA 1BQNA 1HPMA 1X9MA 1C1AA 4CHNA 4FK4A 4FWQA 1IKYA 3CJ1A 1EWQA 1M90O 3O8MA 4OVLA 5D3GA 4BRQA 4Y1CA 2P9SA 1E3MA 3TAEA 4BRPA 5JENA 4CJUA 4HTUA 4M41A 3ZX3A 2VCPA 1BOTO 3QINA 4FLXA 1RTJA 3VQ7A 4LFCK 1X9WA 4CZKA 5I9EB 4BE0A 3E9OA 2OZSA 4KHUA 3HOSA 4JD2A 2ZGZA 4KHQA 1REVA 3THXA 3A5MC 3F2KA 1YVNA 2D5RA 2QI2A 3DYAA 4C23A 5BREA 3FZKA 3SV4A 4AHUA 2OA8A 4K0KK 4RW9A 2HNYA 3MK6A 1S6QA 4CJ4A 4H4OA 3V9WA 2NUBA 4CJPA 3OYGA 3VQ6A 2IC3A 1NK8A 1D5AA 1EETA 1HNXK 4X62K 1JL2A 4OJRA 1C0GA 4CEDA 4CF0A 3KD5E 2FSNA 2G8FA 2ZGYA 4KTWA 2G8IA 3ULDA 4IKFA 1YJWN 5M1PA 3RMBA 2B6AA 4B9MA 4DB3A 5F1XA 4JS4A 2CH5A 4B3SK 3C6AA 4JRPA 2KW4A 3E66A 1GLFO 2QEXN 4DTRA 1ESVA 3CD6N 1BGXT 1WLJA 3H1VX 4CF1A 4FLTA 2O8BB 3KLGA 3U3YA 4CGJA 4I9QA 1IKXA 4FSVA 4J8FA 2GWJA 4ELUA 2NRRA 2P9LA 4PKHA 2JWLA 4HUGA 1IH7A 1U45A 1N33K 4CZGA 3M1FA 4WE1A 5I42A 4CE9A 4E1NA 2W40A 1XNQK 2HHHK 2RN2A 3H08A 1HYSA 2GEMA 2QW9A 2CH6A 4KH4A 1XC9A 2ZQBA 3LPTA 2KZZA 1U48A 2PZSA 4FPBA 3ZLJA 3KLFA 1CZAN 3J81O 3D6RA 4DR4K 3L2RA 1H1VA 1RBSA 4AM7A 2VGMA 4H5VA 5J2QA 2OCEA 1X9SA 3HPGA 3I8BA 2P9SB 1RDCA 3L4QA 3KWGA 3AVLA 3H45C 1WB9A 3VQ8A 3O6WA 2BGGA 3KTQA 1BUPA 3OBWA 2KQ2A 2D0CA 3MX2A 1BWFO 2A1RA 4DU4A 3ZT4A 5HRRA 4M7YA 1SL1A 2HVIA 1YJNN 4NLCA 1RBTA 4JKCA 4JD2B 5AQKA 3EE9A 5SZTA 3C6UA 2CGLA 3THXB 1Y64A 4OGCA 3OS2A 4BECA 4BDPA 2GUPA 3HI0A 4O4GA 4YOWA 4H5WA 3EZ5A 1KAYA 4YDUA 2IDOA 4G1QA 2BH1A 3VERA 1Q7YO 5CYQA 3MEEA 4FVUA 4AHTA 2GX9A 4AHCA 2ZE2A 4WQ4A 4DCHA 1T03A 3QBWA 1KC8O 4CHYA 3CERA 4HCBA 4KHWA 3EZWA 5HL7L 2QWNA 2A41A 4IDKA 3OYJA 1WNSA 3O3HA 3MXMA 4BG9A 1FXXA 4CGFA 2DTUA 2XY8A 3BF1A 4GV9A 3K58A 3CJBA 1JKHA 1OKJA 1YJ9N 3QDKA 1WBDA 2FF3B 4DFJA 4OKEA 5JS1A 4X66K 4XEIA 3U8XA 4N76A 2YKNA 4AQYK 3G25A 3A5OC 5LJWA 1JJ2M 3DLGA 1C0MA 1VRTA 1KXPA 4M7XA 3HO1A 1NOZA 1IV0A 3P31A 1XQSC 2HHWA 2IOCA 3SQ2A 3L3VA 4Z0UA 3IS9A 3VEVA 4YY3K 4H8KA 4J2AA 3N4PA 3DMJA 5AQQA 4Z4GA 1HJRA 2P9LB 3IDHA 2OPRA 2A5XA 2WONA 3MN7A 5J2MA 4B8CA 3PIOL 5MLCQ 5SWMA 1ATSA 2HHUA 4B9SA 5HRPA 3LP0A 3VQ4A 3MXJA 3C0BA 3SYZA 5IT9O 5AFUH 4E3SA 1TL1A 1Z25A 1TL3A 5CHIA 3CPWM 5GINA 5AQRA 3CCVN 2VWJA 1L3UA 3FZLA 2HBMA 3RWUA 1WUAA 1S6PA 3ZSYA 3HOTA 1NK0A 3KWIA 1RT7A 3VENA 4FJ7A 3CJ9A 3M5RA 4DV7K 2ASOA 3GE1A 5EY4A 4FJ5A 1S1TA 1GLLO 1EO1A 4H03B 5T7BA 4FWMA 1O13A 5KQ8A 5AFUA 1JLFA 4CF9A 2O4IA 3JXUA 4JK8A 1TK0A 3QEVA 5AQPA 5JVGL 2G8VA 1K8KA 5F2RA 1GLDG 3TPQA 5LJVA 3HPHA 1SZ2A 4BREA 3C7NA 3QESA 3B6OA 4FJJA 1NGEA 1SKSA 1HR0K 1RBRA 2P9NA 3SMSA 3TWHA 2KZMA 3E1YA 3MMVA 3VESA 1JLCA 5DMRA 4DV5K 1UWBA 3LDLA 4EHUA 3I0RA 4CIGA 3PSFA 1YAGA 3WUHA 4LFAK 4KO0A 1Q9YA 1EQYA 2YHXA 2EWSA 4H5NA 4CK2A 3PIPL 4HVJA 2E5LK 3D45A 4IOXA 4JI7K 3K9JA 4BE1A 1C0FA 1MA9B 3AVAA 1RILA 3D2EA 1OVQA 3DXKA 2B4JA 3I8DA 1QHTA 3WXMB 2QA4N 3J7AP 3CQXA 4UY8O 3KVGA 3C94A 3WT0A 1JXBA 2VYPA 3K5OA 3ZX2A 1UAXA 4H0YB 4WCEL 3SUQA 1DT9A 2EHGA 4E7JA 2BE2A 1VSMA 2P1JA 4KI6A 3RVCA 4CIFA 1LW0A 3GBTA 4OPHA 3FE1A 3HVRA 4M3RA 3NDKA 1TV6A 3AVBA 4L8RB 3TTDA 1SL0A 4B1WB 4IFYA 5AQMA 1EWRA 4AM6A 3H3OB 4KKOA 4B08A 2RHKA 5HBMA 3DLEA 3V9ZA 3NCIA 1NGFA 1S22A 2RKIA 1NU0A 1TUYA 4LSNA 5BRDA 1SAZA 2GBZA 5KGXA 4B1XB 4BROA 1FW6A 4DS4A 2HW3A 2BUPA 1TUUA 4CZHA 1WAFA 5C24A 3IAYA 2UXBK 3T3FA 4A59A 2Q3SA 3JYTA 4KH6A 4IEEA 1A5WA 4BRMA 1ASWA 4JAXA 5JMVA 3CXCM 3CCQN 3BZKA 3CF5L 5BRHA 4PQUA 3SQ0A 3AA2A 3HP9A 3T1AA 1TKXA 2D1KA 3OYIA 3G10A 1BCMA 4LY7A 3OYAA 3TAQA 2Q36A 1L3TA 4F9OA 1CZBA 1G15A 3MEDA 3HVTA 2C1IA 3M8SA 2WUSA 3ZSQA 3CFRA 3IKMA 4OX9K 4AHSA 5EOYA 1RFQA 3ZSRA 1J5OA 4N5SA 4F3TA 4W5OA 3QEWA 4ID5A 1K8KB 3H3NO 4CFBA 4W5TA 4FWLA 2WFBA 4M42A 4FVMA 2YV0X 3C7NB 4DV6K 4K25A 4B9UA 4B9VA 4NO7A 5BPLA 4C1NI 4FYDA 1QQCA 4HUEA 1IKWA 2P9NB 4ID1A 4O5BA 1QZ6A 1XMQK 1D9DA 4E89A 4FZXC 5FPDA 2FF6A 5KI6A 1QQMA
chains in the Genus database with same CATH topology
4YOUA 5BPMA 1LOTB 3ZX3A 3VGLA 2VCPA 1BOTO 1W2BM 2IVNA 1TYQB 2QWMA 3CC2N 3R1XA 4JKDA 3ENBA 3O80A 4BR9A 4CZLA 5AQYA 2FSJA 3VGMA 3NVMA 4I6MA 5CE3A 4IJNA 4CZKA 5I9EB 4IWVA 3VOVA 3VPZA 3E9OA 3JS6A 1Q18A 3HOSA 3MCAB 1X9JA 2KLAA 2ZGZA 1YXQA 1G99A 4JD2A 3D2EB 4GV6A 3DXKB 4IZ9A 3CCUN 2ASPA 3A5MC 5JLFA 4DQ8A 2D0OA 3MWTA 5FPEA 4IEIA 2VWBA 2J4RA 3F2KA 3VF6A 1YVNA 2QI2A 4OO1J 4C23A 5BREA 3H1QA 2A6AA 3FZKA 3CI5A 3WEEA 3LL3A 3D7EO 3MK6A 4JK9A 1NJIO 2A40A 4XH4A 1JCGA 3O9SA 1MWMA 1QZ5A 3U9DA 1S3XA 5AQOA 3CJCA 3ZETA 5HOOA 1T3VA 1NGAA 2Q1NA 4MO4A 4JKAA 5AR0A 3O08A 1GLCG 4IJAA 3D2FA 4IO8A 3W3DA 4GY2B 3UE5A 1NMDA 3EKUA 5C15A 4Z94A 1VQON 3UKRA 1C0GA 2JWKA 2V7YA 3ATVA 3FZMA 1VQ6N 2FSNA 2HBKA 3ATUA 4ISFA 2ZGYA 4QS7A 2GWKA 3CC7N 1NGHA 3ENOA 1V4SA 1WOQA 1YJWN 4CZJA 1K73O 5M1PA 2E2NA 1K8AO 3UB5A 3WXJA 5ADXA 4MO5A 1N8RO 4DB3A 5C2DA 5F1XA 3EKSA 3VEOA 2CH5A 2V52B 5AQZA 1KAZA 3C6AA 3P39A 5H1SQ 2ZJRL 4CD1A 1KQSM 3ZX0A 3E66A 1NGGA 1GLFO 3GOIA 2QEXN 1VQNN 1ESVA 4MLHA 3OA9A 3CD6N 4JHDA 4A57A 1HX1A 2QM1A 4JN4A 3SK3A 3E9PA 3Q7CA 2ITMA 3IFRA 2CGJA 2HMPA 3H1VX 1DGKN 2QTDA 5AZJB 4B1ZA 2A42A 3WXIA 4FSVA 4CBWA 2I7PA 4J8FA 3WXKA 2GWJA 3DWLA 4H5RA 2P9UB 2NRRA 2P9LA 1Z6RA 5EVZA 1T6CA 1U2VA 4PKHA 2HF3A 2JWLA 3F5TA 4EHTA 3CC4N 4A5AA 4CZGA 3M1FA 3MDQA 3DXMB 3EE8A 4CZFA 2W40A 5ELZA 5KPRA 1M1KO 2OTJN 3CCJN 4FWKA 3GL1A 5JICA 2GEMA 5F0XA 2QW9A 2CH6A 4KH4A 3CHWA 4JKBA 1HKBA 1Q82O 4FPBA 2ZJPL 4CD3A 1BDGA 4FOEA 5GIPA 1V4TA 3K9KA 3NMUA 1CZAN 4BE7B 3EO3A 3D6RA 1VQ4N 3ZEUA 1J6ZA 3KZBA 5AQNA 1H1VA 1NLVA 1VQ5N 1BU6O 2HOEA 4AM7A 4BR2A 2VGMA 4GNIA 4H5VA 2Q0UA 3H46O 4YOVA 4YOYA 3I8BA 2P9SB 3L4QA 3KWGA 3H45C 2DPNA 2V51B 2Q2RA 4FL9A 3LDPA 4ISEA 3O6WA 5M1QA 1BUPA 3OBWA 5TKWA 1NGJA 5BPNA 2P9KA 2NRHA 3IUCA 3MX2A 1K9MO 1BWFO 4ILHA 2FXUA 3BP8A 4JNEA 1GLBG 3T69A 5GIOA 1YI2N 4HWIA 3RSEA 3CCSN 4M7YA 4BQZA 5KPZA 1YJNN 4IDHA 3CCLN 3AARA 4I6MB 4NLCA 2YI1A 1HKGA 3BEXA 4PKGA 4WF9L 3LDOA 2NRTA 3FLCO 4JD2B 4JKCA 4L3QA 5AQKA 2YJFA 3EE9A 4H5TA 3BF3A 3SBGA 4BC5A 4BRDA 2V7ZA 1IJJA 2Q31A 1VQMN 4H0XB 2CGLA 3VF2A 5M1NA 1Y64A 4XJXA 3CMEN 4BECA 1NGDA 2GUPA 3R3LA 3HI0A 2I7NA 1XC3A 3MCPA 5BRFA 4YOWA 1BG3A 3HRGA 4H5WA 4BRIA 1KAYA 4YDUA 4RTFD 2BH1A 3VERA 1Q7YO 4IFEA 3CIPA 3P38A 1D4XA 4A2AA 3SAHA 4JKGA 3WEEB 4FVUA 5M1OA 3QMLA 2GX9A 4ILJA 5AQXA 4NB4A 4WQ4A 3AY9A 4DCHA 3QBWA 5ADXH 5E26A 1KC8O 3ENHA 3CERA 4JKFA 4O8KA 5AQFA 4EIAA 3B8AX 3ZETB 2OANA 2CGKA 3EZWA 4BRKA 5HL7L 4OPAA 1MWKA 2QWNA 3OW2M 3MN6A 4JKEA 5KQDA 2A41A 3D2FB 4BRLA 1BA0A 1VAZA 1YITN 3EN9A 3VETA 5AQGA 1RDWX 1LCUA 4BG9A 4EFHA 4U7BA 3UKRB 3M3ZA 3MWPA 3BF1A 4GV9A 3VEWA 5AZIA 3CJBA 3DAWA 3O9QA 3VEYA 4U67L 3UKUA 4IO9L 2YCHA 2P9PA 4BY9C 1OKJA 2ZF5O 2E88A 3N4QA 3VTIA 1JCEA 2RE2A 1YJ9N 3QDKA 3J8AA 3LM2A 2FF3B 3MX5A 4B1YB 4HTLA 3P4IA 2E2PA 3SBTA 4WYBA 4FWNA 3HSCA 4XEIA 3ZYYX 3CQYA 3U8XA 2F9WA 4BVOA 3G25A 3A5OC 3O9TA 5LJWA 1JJ2M 1VQ9N 3AAPA 3FR0A 4YDUC 5JVHL 3M6GA 4MLEA 1ATRA 4C1NK 1KXPA 4M7XA 2C1GA 3QB0A 2HBLA 4BR5A 4CZIA 2NLXA 1HLUA 3WQTA 3P31A 1XQSC 3CJAA 3MN5A 5AQJA 2E2QA 4JHDB 3SMPA 1E4FT 5LY3A 2IIRA 4H0VB 4IXCA 3VEVA 4O8UA 2QXLA 3S41A 2ZWHA 4FWOA 4WQ4C 3VEXA 4CZMA 4DHYA 4CI6A 3N4PA 4JKHA 4K43A 5AQQA 1KAXA 4BR0A 5C2FA 3VTHA 3DJCA 4R79A 2P9LB 4GV3A 2IVPA 3CMAN 2QWQA 1NGBA 1U2VB 2NZTA 2YHYA 3IDHA 4FO0A 4CJ7A 4BGBA 3SJHA 2A5XA 3MN7A 3O5BA 5BN9A 3PIOL 4YOTA 5MLCQ 3R6MA 3TTCA 4A61A 1ATSA 2WC9A 2YHWA 5EX5A 1QQNA 4O5FA 1BO5O 4BGAA 1VQKN 3C0BA 2E1YA 3E9LA 3G6EN 3FFKB 5AFUH 3CCMN 1P8ZA 1Q81O 4CZEA 2QWPA 5CHIA 3CPWM 2NRWA 5GINA 2A3ZA 1SQKA 3HM8A 1JCFA 5AQRA 1ZC6A 4FOIA 3CETA 3ZEUB 3CCVN 5AQVA 5AQUA 3Q7BA 3GDQA 3DLLL 3FZLA 2HBMA 1WUAA 2NRZA 4PL8A 1E4GT 1YUWA 4A62A 1QVFM 4IOAL 3C6HA 4WQ5A 4FWPA 3HOTA 3KWIA 4BEBA 2AA4A 3VENA 3CJ9A 3M5RA 4NLBA 2ASOA 3U9ZA 3GE1A 5EY4A 4B1VA 1P90A 1GLLO 2P9KB 2P9IA 3TSUA 3TTFA 1EO1A 4H03B 1R59O 4FPAA 3QICA 4FWMA 2WBNA 1O13A 3VF4A 3RSEB 5KQ8A 5AFUA 3SAGA 4FWRA 4WFAL 5M1KA 3FZHA 3VGKA 2W00A 3JXUA 4JK8A 1QHAA 4BC2A 1X3NA 3SLCA 1VQ8N 2PFUA 3ID6A 5BN8A 3CCRN 4H0TB 1DEJA 5AQPA 4BRHA 3J7ZO 5JVGL 4WFNL 4IOCL 1K8KA 1VQ7N 2W41A 5E84A 5F2RA 1GLDG 3TPQA 4CBUA 5LJVA 3PLAA 1SZ2A 5KPTA 4BREA 5C12A 3C7NA 1QQOA 1HKCA 5M1FA 1NGEA 3ULEA 3F9MA 3HZ6A 2KKZA 4YORA 2P9NA 3SMSA 4JKGB 4BRGA 1DKGD 4PL7A 4A2BA 4B9QA 3E1YA 2E1ZA 3MMVA 4PHTX 5BR9A 3FZFA 3VESA 1HUXA 5TKYA 3AGRA 2AP1A 2PBDA 4WQ5C 3LDLA 1X3MA 1NGIA 3L4IA 4JK7A 4EHUA 4QS8A 3A0IX 2YJEA 1TYQA 1GLJO 3WUHA 1YAGA 5CR4A 5AQIA 1YIJN 3BUZB 4RCHA 1EQYA 3FGUA 2YHXA 2EWSA 1Z05A 2NRVA 4H5NA 2NNWA 5B8HA 3PIPL 2Q97A 1ZBSA 2E8AA 3CJ7A 4IOXA 4K41A 4H0OA 2QWOA 2H3GX 3K9JA 5FPNA 2VGNA 1C0FA 2ASMA 5AZIB 4BRCA 1MA9B 5GAHP 2KHOA 3UKUB 1YHQN 3D2EA 2P9PB 2QWLA 3DXKA 3TSQA 3A5LC 3WXMB 2QA4N 3O1BA 2HBJA 3CQXA 1XUPO 3KVGA 4UY8O 4CBXA 5AQLA 3WT0A 2FSKA 3U4LA 3G4SN 2UYTA 2VYPA 3R8EA 3R9PA 2IVOA 3ZX2A 2YX6A 4H0YB 4WCEL 1DT9A 5FPMA 3A8YA 3I56N 3RVCA 4DKWA 3TSPA 3GBTA 4OPHA 4MDBA 3FE1A 1GLAG 4RWTA 3NVKA 3L6QA 3WQUA 1KD1O 3QFUA 2FLOA 3TTDA 4BRNA 3LDQA 4B1UB 3C65A 2GELA 3QBXA 2QWRA 4B1WB 4BC3A 1S72N 5AQMA 5AQTA 4BG8A 4BQLA 4AM6A 3H3OB 2PAVA 2RHKA 4WFBL 4BVPA 1IG8A 5AQSA 3T7ZA 1NGFA 1S22A 1TUYA 2HSTA 4MDAA 2F7TA 1ATNA 1GLEG 2HF4A 4K42A 5BRDA 1SAZA 5AQWA 1YF5L 4E1JA 4B1XB 1NM1A 2BTFA 3HTVA 2E2OA 4BROA 2OTLN 3O9UA 2BUPA 1HJOA 1TUUA 4KBOA 4A5BA 4CZHA 3HBTA 1VQLN 1BA1A 3TU5A 3I33A 4A59A 1QVGM 3QFPA 4KH6A 4IEEA 2D4WA 4BRMA 4JAXA 4XH5A 5JMVA 4BR4A 4ILGB 1SS6A 3O9RA 3CXCM 3CCQN 2E20A 3CF5L 5BRHA 5JLHA 5C0YA 3OBYA 3KK7A 4FWSA 3MN9A 5AZJA 2D1KA 4G9ZA 4YOXA 1Q86O 1NBWA 3GG4A 3I55N 4QS9A 2Q36A 2P9UA 3L0QA 3G71N 1ZXOA 2D0PA 5AQHA 1W97L 4F9OA 3O4WA 5GAGP 2P9IB 2NRXA 4ISGA 3SAFA 2C1IA 1NGCA 3DXMA 4XH1A 2WUSA 2GTDA 3A5NC 3AAQA 4M63C 5EXWA 4LC9B 5DM6L 4Y0WA 5C10A 3IKMA 3KHYA 3EL2A 3O1WA 3VMFB 5EOYA 1RFQA 1ILYA 1OVYA 3CPEA 5GADP 5DM7L 1VQPN 4H0PA 4JEPA 1U6ZA 3W0LA 4BRAA 1RGIA 4BC4A 1K8KB 3H3NO 3AGKA 1T44A 1T6DA 2Q0RA 1MDUB 3IMXA 4FWLA 3VEZA 2WFBA 5GAEP 1RDUA 3H6EA 3LM9A 4BR7A 4KH5A 4EAHD 1HPMA 3C7NB 2ZJQL 4K25A 4FWQA 3OHRA 4PKIA 3CJ1A 1NWKA 3ULEB 4NO7A 3CCEN 4GVEA 4C1NI 5BPLA 3O8MA 4AF1A 1M90O 2P9NB 4BRQA 1QZ6A 2P9SA 2F9TA 4BRFA 4BRPA 5FPDA 2FF6A 3LDNA 1QQMA 3WXLA 3ID8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPM A;  1LOT B;  3ZX3 A;  3VGL A;  2VCP A;  1BOT O;  2IVN A;  1TYQ B;  2QWM A;  4CZL A;  3O80 A;  4BR9 A;  5AQY A;  2FSJ A;  3VGM A;  4I6M A;  5CE3 A;  4IJN A;  4CZK A;  5I9E B;  4IWV A;  3VOV A;  3VPZ A;  3JS6 A;  1Q18 A;  1X9J A;  4JD2 A;  2ZGZ A;  1YXQ A;  1G99 A;  3D2E B;  3DXK B;  4IZ9 A;  2ASP A;  3A5M C;  5JLF A;  4DQ8 A;  2D0O A;  5FPE A;  2VWB A;  2J4R A;  3VF6 A;  1YVN A;  4C23 A;  5BRE A;  3H1Q A;  2A6A A;  3FZK A;  3CI5 A;  3WEE A;  3LL3 A;  3D7E O;  3MK6 A;  2A40 A;  4XH4 A;  1JCG A;  1MWM A;  1QZ5 A;  3U9D A;  1S3X A;  5AQO A;  3CJC A;  3ZET A;  5AR0 A;  1NGA A;  2Q1N A;  4MO4 A;  3O08 A;  1GLC G;  4IJA A;  3D2F A;  4IO8 A;  3W3D A;  4GY2 B;  3UE5 A;  1NMD A;  3EKU A;  4Z94 A;  3UKR A;  1C0G A;  2V7Y A;  3ATV A;  3FZM A;  2FSN A;  3ATU A;  4ISF A;  2ZGY A;  4QS7 A;  2GWK A;  1NGH A;  3ENO A;  1V4S A;  1WOQ A;  4CZJ A;  2E2N A;  3UB5 A;  3WXJ A;  5ADX A;  4MO5 A;  4DB3 A;  5F1X A;  3EKS A;  3VEO A;  2CH5 A;  2V52 B;  5AQZ A;  1KAZ A;  4CD1 A;  3ZX0 A;  1NGG A;  1GLF O;  3GOI A;  1ESV A;  4MLH A;  4JHD A;  1HX1 A;  2QM1 A;  4JN4 A;  3SK3 A;  2ITM A;  3IFR A;  2CGJ A;  2HMP A;  3H1V X;  1DGK N;  5AZJ B;  4B1Z A;  2A42 A;  3WXI A;  4FSV A;  4CBW A;  2I7P A;  4J8F A;  3WXK A;  2GWJ A;  3DWL A;  4H5R A;  2P9U B;  2P9L A;  1Z6R A;  5EVZ A;  1T6C A;  1U2V A;  4PKH A;  2HF3 A;  4EHT A;  4CZG A;  3M1F A;  3MDQ A;  3DXM B;  4CZF A;  2W40 A;  5ELZ A;  5KPR A;  4FWK A;  3GL1 A;  5JIC A;  2GEM A;  5F0X A;  2QW9 A;  2CH6 A;  3CHW A;  1HKB A;  4FPB A;  4CD3 A;  1BDG A;  4FOE A;  1V4T A;  1CZA N;  3EO3 A;  3ZEU A;  1J6Z A;  3KZB A;  5AQN A;  1H1V A;  1NLV A;  1BU6 O;  2HOE A;  4AM7 A;  4BR2 A;  4GNI A;  4H5V A;  2Q0U A;  3H46 O;  3I8B A;  2P9S B;  3H45 C;  2DPN A;  2V51 B;  2Q2R A;  4FL9 A;  3LDP A;  4ISE A;  3O6W A;  1BUP A;  1NGJ A;  5BPN A;  2P9K A;  2NRH A;  3IUC A;  1BWF O;  2FXU A;  3BP8 A;  4JNE A;  1GLB G;  4HWI A;  3RSE A;  4M7Y A;  4BQZ A;  5KPZ A;  3AAR A;  4I6M B;  2YI1 A;  1HKG A;  3BEX A;  4PKG A;  3LDO A;  3FLC O;  4JD2 B;  4L3Q A;  5AQK A;  4BRD A;  2YJF A;  4H5T A;  4BC5 A;  3BF3 A;  2V7Z A;  1IJJ A;  2Q31 A;  4H0X B;  2CGL A;  3VF2 A;  1Y64 A;  1NGD A;  2GUP A;  5BRF A;  3HI0 A;  2I7N A;  1XC3 A;  3MCP A;  1BG3 A;  4H5W A;  4BRI A;  1KAY A;  4YDU A;  4RTF D;  3VER A;  4A2A A;  3CIP A;  1D4X A;  3WEE B;  3QML A;  5AQX A;  4NB4 A;  4WQ4 A;  3AY9 A;  4DCH A;  3QBW A;  5ADX H;  5E26 A;  3ENH A;  3CER A;  4O8K A;  4EIA A;  5AQF A;  3B8A X;  3ZET B;  2OAN A;  2CGK A;  3EZW A;  4BRK A;  1MWK A;  2QWN A;  3MN6 A;  5KQD A;  2A41 A;  3D2F B;  4BRL A;  1BA0 A;  3EN9 A;  3VET A;  5AQG A;  1RDW X;  1LCU A;  4BG9 A;  4EFH A;  3UKR B;  3M3Z A;  3BF1 A;  3VEW A;  5AZI A;  3CJB A;  3DAW A;  3VEY A;  3UKU A;  2YCH A;  2P9P A;  1OKJ A;  2ZF5 O;  2E88 A;  1JCE A;  3QDK A;  3J8A A;  3LM2 A;  2FF3 B;  4B1Y B;  4HTL A;  3P4I A;  2E2P A;  4WYB A;  4FWN A;  3HSC A;  4XEI A;  3CQY A;  3U8X A;  2F9W A;  4BVO A;  3G25 A;  3A5O C;  5LJW A;  3AAP A;  3FR0 A;  4YDU C;  3M6G A;  4MLE A;  1ATR A;  1KXP A;  4M7X A;  3QB0 A;  4BR5 A;  4CZI A;  2NLX A;  1HLU A;  3WQT A;  1XQS C;  3CJA A;  3MN5 A;  5AQJ A;  2E2Q A;  4JHD B;  3SMP A;  1E4F T;  5LY3 A;  2IIR A;  4H0V B;  4IXC A;  3VEV A;  3S41 A;  2QXL A;  3VEX A;  2ZWH A;  4FWO A;  4WQ4 C;  4CZM A;  4DHY A;  4CI6 A;  4K43 A;  5AQQ A;  1KAX A;  4BR0 A;  3DJC A;  2P9L B;  2IVP A;  2QWQ A;  1NGB A;  1U2V B;  2NZT A;  2YHY A;  3IDH A;  4FO0 A;  4CJ7 A;  4BGB A;  3SJH A;  2A5X A;  3MN7 A;  3O5B A;  5BN9 A;  3R6M A;  4A61 A;  1ATS A;  2YHW A;  5EX5 A;  1QQN A;  4O5F A;  1BO5 O;  4BGA A;  3C0B A;  2E1Y A;  3FFK B;  5AFU H;  1P8Z A;  4CZE A;  2QWP A;  2A3Z A;  1SQK A;  3HM8 A;  1JCF A;  5AQR A;  1ZC6 A;  4FOI A;  3CET A;  3ZEU B;  5AQV A;  5AQU A;  3GDQ A;  3FZL A;  1WUA A;  4PL8 A;  1E4G T;  1YUW A;  4A62 A;  4WQ5 A;  4FWP A;  2AA4 A;  3VEN A;  3CJ9 A;  2ASO A;  3U9Z A;  3GE1 A;  5EY4 A;  4B1V A;  2P9I A;  1GLL O;  2P9K B;  4H03 B;  1R59 O;  4FPA A;  3QIC A;  4FWM A;  3VF4 A;  3RSE B;  5KQ8 A;  5AFU A;  4FWR A;  3FZH A;  3VGK A;  3JXU A;  1QHA A;  4BC2 A;  1X3N A;  3SLC A;  5BN8 A;  4H0T B;  1DEJ A;  5AQP A;  4BRH A;  1K8K A;  2W41 A;  5E84 A;  5F2R A;  1GLD G;  3TPQ A;  4CBU A;  5LJV A;  1SZ2 A;  5KPT A;  4BRE A;  3C7N A;  1QQO A;  1HKC A;  1NGE A;  3ULE A;  3F9M A;  3HZ6 A;  2P9N A;  3SMS A;  4BRG A;  1DKG D;  4PL7 A;  4A2B A;  4B9Q A;  2E1Z A;  3MMV A;  5BR9 A;  3FZF A;  3VES A;  1HUX A;  5TKY A;  2AP1 A;  2PBD A;  4WQ5 C;  3LDL A;  1X3M A;  1NGI A;  3L4I A;  4EHU A;  4QS8 A;  3A0I X;  2YJE A;  1TYQ A;  1GLJ O;  3WUH A;  1YAG A;  5AQI A;  3BUZ B;  4RCH A;  1EQY A;  3FGU A;  2YHX A;  2EWS A;  1Z05 A;  4H5N A;  5B8H A;  2Q97 A;  1ZBS A;  2E8A A;  3CJ7 A;  4K41 A;  4H0O A;  2QWO A;  2H3G X;  5FPN A;  1C0F A;  2ASM A;  5AZI B;  4BRC A;  1MA9 B;  2KHO A;  3UKU B;  3D2E A;  2P9P B;  2QWL A;  3DXK A;  3A5L C;  3O1B A;  3CQX A;  1XUP O;  3KVG A;  4CBX A;  5AQL A;  3WT0 A;  2FSK A;  3U4L A;  2UYT A;  2VYP A;  3R8E A;  3R9P A;  2IVO A;  3ZX2 A;  4H0Y B;  5FPM A;  3A8Y A;  3GBT A;  3FE1 A;  1GLA G;  4RWT A;  3L6Q A;  3WQU A;  3QFU A;  2FLO A;  4BRN A;  3LDQ A;  4B1U B;  2GEL A;  3QBX A;  2QWR A;  4B1W B;  4BC3 A;  5AQM A;  5AQT A;  4BG8 A;  4BQL A;  4AM6 A;  3H3O B;  2PAV A;  4BVP A;  1IG8 A;  5AQS A;  1NGF A;  1S22 A;  1TUY A;  1ATN A;  1GLE G;  2HF4 A;  4K42 A;  5BRD A;  1SAZ A;  5AQW A;  4E1J A;  4B1X B;  1NM1 A;  2BTF A;  3HTV A;  2E2O A;  4BRO A;  2BUP A;  1HJO A;  1TUU A;  4KBO A;  4CZH A;  3HBT A;  1BA1 A;  3TU5 A;  3I33 A;  3QFP A;  2D4W A;  4BRM A;  4JAX A;  4XH5 A;  5JMV A;  4BR4 A;  2E20 A;  5BRH A;  5JLH A;  4FWS A;  3MN9 A;  5AZJ A;  2D1K A;  1NBW A;  3GG4 A;  4QS9 A;  2Q36 A;  2P9U A;  3L0Q A;  1ZXO A;  2D0P A;  5AQH A;  4F9O A;  3O4W A;  2P9I B;  4ISG A;  1NGC A;  3DXM A;  4XH1 A;  2WUS A;  2GTD A;  3A5N C;  3AAQ A;  4M63 C;  5EXW A;  4LC9 B;  4Y0W A;  3KHY A;  3EL2 A;  3O1W A;  5EOY A;  1RFQ A;  4H0P A;  1U6Z A;  3W0L A;  4BRA A;  1RGI A;  4BC4 A;  1K8K B;  3H3N O;  1T44 A;  1T6D A;  2Q0R A;  1MDU B;  3IMX A;  4FWL A;  3VEZ A;  3H6E A;  3LM9 A;  4BR7 A;  4EAH D;  1HPM A;  3C7N B;  4K25 A;  4FWQ A;  3OHR A;  4PKI A;  3CJ1 A;  1NWK A;  3ULE B;  4NO7 A;  5BPL A;  3O8M A;  2P9N B;  4BRQ A;  1QZ6 A;  2P9S A;  2F9T A;  4BRF A;  4BRP A;  5FPD A;  2FF6 A;  3LDN A;  1QQM A;  3WXL A;  3ID8 A; 
#chains in the Genus database with same CATH topology
 1ASV A;  4CHP A;  5BPM A;  1LOT B;  1W2B M;  3VGL A;  3V9U A;  3R1X A;  4BR9 A;  5AQY A;  3VGM A;  1BI4 A;  3NVM A;  4I6M A;  4IJN A;  5J2P A;  4IWV A;  3PV8 A;  2FBY A;  3JS6 A;  3MCA B;  3OYB A;  1YXQ A;  4HCC A;  3IRX A;  3BY5 A;  1RT3 A;  3D2E B;  1B9F A;  3DLH A;  3DXK B;  4M3X A;  1TKZ A;  2GV9 A;  5JLF A;  3MWT A;  5FPE A;  1NJZ A;  4IEI A;  1KLM A;  3QEX A;  2XY5 A;  4OO1 J;  2VQE K;  2A6A A;  3KLH A;  2E6M A;  1T8E A;  1VK0 A;  3CI5 A;  3LL3 A;  3D7E O;  3D0P A;  5HLF A;  3S3O A;  2ZD1 A;  2A40 A;  3QIP A;  1JCG A;  3DOL A;  5AQO A;  3CJC A;  3KLI A;  2XY7 A;  1T3V A;  3O08 A;  1GLC G;  4IJA A;  3OVN A;  2ETJ A;  3EKU A;  2F96 A;  3ZSW A;  4CW7 B;  3RMC A;  1VQO N;  4Z94 A;  3UKR A;  2WTU A;  3FZM A;  2HBK A;  3LWM A;  1W0H A;  3DLR A;  4ISF A;  4FZY A;  4QS7 A;  2GWK A;  3CC7 N;  1NGH A;  5KGW A;  4XIU A;  4JI8 K;  1V4S A;  1WOQ A;  4CZJ A;  3QEI A;  3TAP A;  2E2N A;  3WXJ A;  4X65 K;  4BWJ A;  2X78 A;  2V52 B;  5AQZ A;  3O3F A;  3P39 A;  2ZJR L;  3L2U A;  3GOI A;  1VQN N;  4MLH A;  3OA9 A;  3EY1 A;  2GUI A;  4JN4 A;  3SK3 A;  3E9P A;  2CGJ A;  1WSH A;  3IG1 A;  1GOB A;  5FRM A;  3DWL A;  3QO9 A;  1IBL K;  3HP6 A;  1Z6R A;  5EVZ A;  1T6C A;  3HYF A;  2HF3 A;  3EE8 A;  1LWC A;  5ELZ A;  2OTJ N;  1NJW A;  4DR1 K;  1C0U A;  4JKB A;  1HKB A;  4I9L A;  1RDD A;  3K59 A;  4KI4 A;  3KK3 A;  4AHV A;  3WNE A;  3FFI A;  5GIP A;  3WNG A;  4JI4 K;  2VG5 A;  4CEC A;  1ZBU A;  3HPO A;  4IFV A;  4E7I A;  3V6D A;  2RPI A;  1TGO A;  2YNF A;  3ZT0 A;  1DTQ A;  2OPS A;  3AA3 A;  1NNE A;  3OY9 A;  3ZSV A;  4Q5V A;  1TVR A;  4EZ9 A;  4DQS A;  3K0S A;  5TKW A;  1HNV A;  3LP2 A;  2NRH A;  3IUC A;  4N47 A;  3NF9 A;  4ILH A;  3L3U A;  2FXU A;  5GIO A;  3T69 A;  5EU7 A;  3CCS N;  4X64 K;  1HPZ A;  3S3M A;  3RRG A;  4CF8 A;  4OLA A;  1BI4 B;  3AAR A;  4I6M B;  4PKG A;  4B9T A;  3P5J A;  3LDO A;  4BWM A;  4FJI A;  2DFF A;  4L3Q A;  2Z1G A;  2YJF A;  3OS1 A;  3OYK A;  1IJJ A;  2Q31 A;  3T19 A;  3ZSZ A;  1WBB A;  3CME N;  5BRF A;  1BG3 A;  4BRI A;  4RTF D;  4HUF A;  2PYL A;  4FZZ A;  3SAH A;  4E7K A;  4CJ3 A;  1XI1 A;  3PY8 A;  3AY9 A;  5CYM A;  4MQ3 A;  4B3R K;  2OAN A;  2FBV A;  1MWK A;  4OPA A;  3OW2 M;  3MN6 A;  4FJN A;  5KQD A;  4ZTF A;  2YNH A;  3EN9 A;  1KCF A;  3V1O A;  4EFH A;  1NG9 A;  3ZSX A;  4DSL A;  3KK2 A;  4W5N A;  4U7B A;  3UKR B;  3M3Z A;  4CJ5 A;  1L5U A;  5AZI A;  4DFK A;  3UKU A;  4BY9 C;  3NGI A;  3L2Q A;  1JCE A;  3MAQ A;  3LWL A;  3CM5 A;  3ZT3 A;  1XMO K;  3J8A A;  3MX5 A;  2FC0 A;  3OS0 A;  1IO2 A;  2DY4 A;  3DI6 A;  4NYF A;  3S5T A;  2B5J A;  4BVO A;  3O9T A;  4GKJ K;  1RDB A;  4MLE A;  1ATR A;  4C1N K;  2C1G A;  2HBL A;  1YVU A;  3WQT A;  4DMN A;  3MN5 A;  1ITG A;  5AQJ A;  1E4F T;  5LY3 A;  2IIR A;  4PUO A;  3J80 O;  4IXC A;  3S41 A;  3VEX A;  4CER A;  4CZM A;  4NXN K;  3VTH A;  3DJC A;  4R79 A;  2IVP A;  2YNI A;  3CMA N;  3QEP A;  2NZT A;  4DLE A;  3O5B A;  5BN9 A;  3TTC A;  1RDA A;  2WC9 A;  1VHX A;  1VSI A;  1JL1 A;  4O5F A;  5CY4 A;  2ZM6 K;  3NFA A;  3FFK B;  3TAR A;  4DQI A;  3SI6 A;  5J1E A;  3HM8 A;  2HVH A;  1D9F A;  3LPU A;  3PUF A;  3Q7B A;  3DLL L;  4LFB K;  4C8L A;  1S1W A;  1B9D A;  4KPY A;  4IOA L;  4WQ5 A;  1ZBH A;  1Z26 A;  3AVF A;  4NLB A;  4KV8 A;  4BDY A;  4BDZ A;  3ISN C;  4B1V A;  1I94 K;  2P9I A;  3TSU A;  3TTF A;  5JS2 A;  4C8O A;  1GOC A;  3CYG A;  4CEE A;  4DG1 A;  3PX6 A;  3VQE A;  2X74 A;  4FJ9 A;  3SAG A;  4WFA L;  2Z1J A;  3K5N A;  4FK0 A;  1EXQ A;  1FK9 A;  1X3N A;  3HT3 A;  2VG7 A;  3TAF A;  4DQQ A;  2W41 A;  1VQ7 N;  1NK4 A;  1BQM A;  3RTV A;  1ASU A;  1HKC A;  4F3O A;  1CLQ A;  3KKS A;  3HZ6 A;  4YOR A;  4A2B A;  4YNQ A;  1LWE A;  1NMN A;  4PHT X;  1HUX A;  3SPY A;  2LSN A;  3AGR A;  4ZHR A;  2ATQ A;  2Y1J A;  4JK7 A;  4LF7 K;  4TSX A;  4E72 A;  1TAU A;  5CR4 A;  2W42 A;  5BR8 K;  5AQI A;  3BUZ B;  1Z05 A;  3SCX A;  5B8H A;  2NNW A;  4CJQ A;  1ZBS A;  2E8A A;  3CJ7 A;  1NK9 A;  2H3G X;  5FPN A;  4LF4 K;  5AZI B;  5GAH P;  3UKU B;  3DLB A;  2WOM A;  3A5L C;  4E19 A;  4KRF A;  1XUP O;  2HHV A;  4CBX A;  5AQL A;  3U4L A;  3G4S N;  3R9P A;  2IVO A;  2YX6 A;  3OYM A;  4C8M A;  4DKW A;  3TSP A;  4MDB A;  4PY5 A;  4DTO A;  3WQU A;  4FM2 A;  1KFD A;  3THW A;  1LAW A;  4B1U B;  1S9G A;  3S3N A;  1ZBF A;  5AQT A;  2F8T A;  1QS4 A;  3SQ4 A;  4CGI A;  3LAK A;  1RT2 A;  4CIE A;  4F2S A;  4MDA A;  4F2R A;  2F7T A;  3RMA A;  2HF4 A;  4DR6 K;  5A2Q O;  1WSG A;  4CJE A;  4E1J A;  4KTZ A;  2P5G A;  2BTF A;  1KRP A;  3THY A;  4KBO A;  4A5B A;  3HBT A;  3NE6 A;  1JLG A;  3QFP A;  4BR4 A;  5LMU K;  4EZ6 A;  4CJR A;  3VQA A;  5JLH A;  3OBY A;  3KK7 A;  4FWS A;  5C0Y A;  5AZJ A;  1NK6 A;  1VSJ A;  4YOX A;  1Q86 O;  3AV9 A;  3GG4 A;  3I55 N;  2P9U A;  3O4N A;  3QET A;  1VRU A;  1ZXO A;  3RRH A;  3VQB A;  2FBX A;  2P9I B;  4FJH A;  4KFB A;  4ISG A;  3HK2 A;  3OYH A;  1NGC A;  5EXW A;  1KTQ A;  4LF8 K;  1NKC A;  3KIO A;  1WSF A;  4B3T K;  1OVY A;  1O1W A;  3JSM A;  5DM7 L;  2UUB K;  4YHH K;  1RGI A;  4Z4E A;  1RNH A;  2Q0R A;  1MDU B;  5GAE P;  3LM9 A;  1JLE A;  3T1H K;  4BR7 A;  4JRQ A;  1YT3 A;  2ZJQ L;  4PKI A;  3OHR A;  1NWK A;  4JI6 K;  1OH8 A;  3VQ9 A;  4AF1 A;  1HQE A;  1XNR K;  1CXU A;  3WNH A;  2F9T A;  3LDN A;  3WXL A;  5E41 A;  3ID8 A;  1CZ9 A;  4IOC L;  1N6Q A;  4N41 A;  1A5V A;  1NK5 A;  4DTM A;  1HMV A;  2IVN A;  2QWM A;  4NCG A;  3CC2 N;  4CZL A;  4JKD A;  3ENB A;  2FSJ A;  3BDP A;  2XY6 A;  3PX0 A;  3VPZ A;  4DUY K;  1Q18 A;  1X9J A;  4DTN A;  4FXD A;  2BDP A;  5CZ1 A;  3I0S A;  3DOK A;  3CQ8 A;  3NBP A;  4Z4I A;  2D0O A;  4FLU A;  4DV1 K;  3H1Q A;  1TK8 A;  3WEE A;  4KHN A;  4JK9 A;  3V4I A;  2HNZ A;  4JI1 K;  4XH4 A;  3O9S A;  2XO7 A;  1MWM A;  3NH1 A;  1KSP A;  2D0B A;  3THW B;  4FLV A;  2Q1N A;  4MO4 A;  3D2F A;  3M8Q A;  4GY2 B;  3UE5 A;  5FLX O;  1NMD A;  1C0T A;  4KHY A;  3SNN A;  2JWK A;  1ZYQ A;  4FW2 A;  3ATU A;  3CM6 A;  1RTD A;  2X6N A;  3ENO A;  4GMJ B;  1U47 A;  4NYN A;  1K73 O;  3THY B;  5ADX A;  1U49 A;  1N8R O;  3SZ2 A;  4DSF A;  2KFN A;  3EKS A;  3VEO A;  4J2E A;  1KAZ A;  1BCO A;  5C25 A;  5H1S Q;  1N34 K;  4JHD A;  2ITM A;  2HMP A;  5AZJ B;  1DGK N;  4LSL A;  4B1Z A;  4BE2 A;  3VQD A;  2A42 A;  2JGU A;  2I7P A;  3WXK A;  4BAC A;  4H5R A;  2P9U B;  4FM1 A;  1DTT A;  3OYC A;  3CC4 N;  1UA0 A;  4CZF A;  4I2Q A;  3S9H A;  5KPR A;  3GL1 A;  3AO3 A;  5JIC A;  4LF6 K;  3CHW A;  3MEG A;  1TK5 A;  3KJV A;  1Q82 O;  1IG9 A;  2EX3 A;  4FJK A;  1HYZ A;  4CD3 A;  1BDG A;  1V4T A;  4KB0 A;  3NMU A;  4BE7 B;  1LWF A;  1VQ4 N;  1C1C A;  1J6Z A;  3ZCM A;  1NLV A;  1BU6 O;  2HHX A;  2HOE A;  1UA1 A;  4DF8 A;  4GNI A;  3SUN A;  2Q0U A;  3H46 O;  4O44 A;  4YOY A;  2A1S A;  1ZBL A;  2V51 B;  1DLO A;  5FRN A;  1BL3 A;  4CEQ A;  2KFZ A;  5BPN A;  1J54 A;  2P9K A;  3RR7 A;  2HHT A;  1K9M O;  4B9N A;  1GLB G;  1YI2 N;  5KPZ A;  4IDH A;  4WF9 L;  1HKG A;  1WSE A;  3QIO A;  2NRT A;  4BRD A;  1EKE A;  1C6V A;  4H5T A;  4BC5 A;  3BF3 A;  4O0J A;  2QKK A;  1UOC A;  4DQP A;  4FJG A;  1S9E A;  3LP1 A;  4XJX A;  3QER A;  1S1X A;  2I7N A;  1VSF A;  3HRG A;  5KTQ A;  4A2A A;  3CIP A;  1D4X A;  1Q8I A;  3K5M A;  3QNN A;  4UQG A;  2YHA A;  3WEE B;  4DFM A;  5M1O A;  1FKP A;  4DLG A;  5E26 A;  1KFS A;  4JKF A;  4O8K A;  5AQF A;  3B8A X;  4JKE A;  4JI0 K;  3D2F B;  1YIT N;  1TKD A;  1VAZ A;  5AJ3 K;  4JI5 K;  4CVN E;  3MWP A;  3THV A;  3VEW A;  2IGI A;  3O9Q A;  4U67 L;  1TAQ A;  2YCH A;  2P9P A;  3VTI A;  3NGY A;  1NK7 A;  3LM2 A;  1LV5 A;  2E2P A;  1MU2 A;  3HSC A;  4FK2 A;  4RW4 A;  4EP5 A;  4DR7 K;  3ZYY X;  3CQY A;  2HMI A;  4YDU C;  3M6G A;  2G8K A;  3QB0 A;  4BR5 A;  4CZI A;  2NLX A;  5CZ2 A;  3CJA A;  4K8X A;  4JHD B;  2OZM A;  2W6L A;  2G8H A;  4I7F A;  4FWO A;  4WQ4 C;  4CI6 A;  5C2F A;  3AVC A;  4K43 A;  3F73 A;  4OKK A;  4GV3 A;  3G0Z A;  2QWQ A;  4FO0 A;  4CJ7 A;  2O8E A;  4BGB A;  5KRT A;  4YOT A;  2G8W A;  4CFC A;  5EX5 A;  1A5X A;  1QQN A;  1BO5 O;  1VQK N;  2E1Y A;  3V9X A;  2P51 A;  3G6E N;  1P8Z A;  1Q81 O;  3L2V A;  4CZE A;  3DLK A;  2A3Z A;  4LD0 A;  1SQK A;  1KVC A;  3SQ1 A;  4KHS A;  4FOI A;  1YTU A;  5AQU A;  3GDQ A;  2NRZ A;  4JI2 K;  1YUW A;  1QVF M;  3ZT2 A;  4FWP A;  3TR8 A;  4BEB A;  2AA4 A;  4CGD A;  1J9A A;  3U9Z A;  3J7Y P;  4FCY A;  4JV5 K;  4ELV A;  5LMN K;  1P90 A;  2P9K B;  2VG6 A;  3SUO A;  4DTP A;  4FPA A;  3QIC A;  2WBN A;  4C8N A;  1RT6 A;  4RW6 A;  4FWR A;  3FZH A;  2W00 A;  4KRE A;  4BC2 A;  3SLC A;  1VQ8 N;  2PFU A;  2HHQ A;  5BN8 A;  3CCR N;  3LP3 A;  3O4Q A;  4GW6 A;  3AA5 X;  1XHX A;  4BRH A;  3KLE A;  4DQR A;  5HP1 A;  5E84 A;  1EP4 A;  4CBU A;  1HRH A;  4DR3 K;  4B3M K;  1QQO A;  5HRS A;  3ULE A;  3F9M A;  2I5J A;  4BRG A;  1DKG D;  1VSE A;  3DRR A;  5BR9 A;  5TKY A;  3LZJ A;  1NKB A;  2O8C A;  1X3M A;  4RW8 A;  1NGI A;  3L4I A;  1N32 K;  4QS8 A;  3A0I X;  1TYQ A;  4DSK A;  4FLZ A;  1YIJ N;  4RCH A;  5FDL A;  2O4G A;  1B92 A;  4HHT A;  3CFO A;  3TAN A;  3OJS A;  1YTA A;  4BRC A;  4CK1 A;  1YHQ N;  2P9P B;  2QWL A;  3TSQ A;  3C6T A;  5IWA K;  4AHR A;  2F8S A;  4DTJ A;  1NJX A;  2QK9 A;  3NGZ A;  2FSK A;  3AA4 A;  4AH9 A;  3R8E A;  4O0I A;  3KK1 A;  5FPM A;  3A8Y A;  3I56 N;  4OLB A;  1GLA G;  3L6Q A;  2YNG A;  2PYJ A;  3MXI A;  1KD1 O;  1QE1 A;  4BRN A;  2X6S A;  1RBV A;  1S72 N;  2O8F A;  1K6Y A;  5J2N A;  3VQC A;  2Z1I A;  4MFB A;  2O8E B;  4PA1 A;  3P1G A;  4PWD A;  3AVH A;  3HM9 A;  4FJ8 A;  2R7Y A;  1GLE G;  4K42 A;  4KTQ A;  5AQW A;  1TKT A;  3AO4 A;  1HNW K;  2W6K A;  3HTV A;  1JLA A;  3NH2 A;  1HJO A;  1JXE A;  1VQL N;  2ITG A;  3LZI A;  1QVG M;  2OPP A;  1SS6 A;  3F9K A;  3O9R A;  4ILG B;  4N56 A;  5KRS A;  4JI3 K;  3QLH A;  3MN9 A;  1HYV A;  4G9Z A;  1NBW A;  3L0Q A;  3G71 N;  3MEC A;  2XHB A;  4ELT A;  1W97 L;  1XHZ A;  4DTU A;  3O4W A;  5GAG P;  3AVJ A;  2P5O A;  3DXM A;  4XH1 A;  2GTD A;  3AAQ A;  3HJF A;  4M63 C;  2G8U A;  4Y0W A;  5C10 A;  3KHY A;  1T7P A;  3AVK A;  3VQP A;  4OPK A;  1QSY A;  1IBK K;  1SKW A;  3VMF B;  4NCA A;  3CPE A;  5GAD P;  1S5J A;  4DV4 K;  4GKK K;  2UU9 K;  1S1U A;  3PO4 A;  4IBN A;  4KB1 A;  4BC4 A;  4QAG A;  4OPJ A;  3AGK A;  1T6D A;  3IMX A;  3VEZ A;  1X1P A;  4K8Z A;  4FW1 A;  4KH5 A;  4EAH D;  1WAJ A;  3ULE B;  4CEA A;  1W7A A;  4GVE A;  3CCE N;  4F8R A;  1OH5 A;  4BRF A;  4CJS A;  4CJF A;  1BIS A;  4E0D A;  4FJX A;  2O8C B;  4YOU A;  4B8A B;  4DTS A;  1QSL A;  1SV5 A;  1TYQ B;  3M8R A;  3O80 A;  3OYE A;  3L2W A;  4DWI A;  5CE3 A;  4AIL C;  3VOV A;  4CGH A;  4CHZ A;  2KLA A;  1G99 A;  3K57 A;  4CCH A;  4GV6 A;  1JLQ A;  4IZ9 A;  1J53 A;  3CCU N;  2ASP A;  3ALY A;  4DQ8 A;  3ASM A;  3SV3 A;  2VWB A;  2J4R A;  3VF6 A;  4Z4F A;  2DFH A;  3ZT1 A;  4C8K A;  1U04 A;  1NJI O;  4CF2 A;  4B3O A;  1QZ5 A;  1RT5 A;  3U9D A;  1S3X A;  3ZET A;  3V81 A;  4DS5 A;  1KVA A;  5HOO A;  5AR0 A;  1NGA A;  4JKA A;  4IO8 A;  4J2B A;  2O8F B;  3V1Q A;  3W3D A;  1IKV A;  5C15 A;  2V7Y A;  3ATV A;  1VQ6 N;  3PSI A;  1FJG K;  1I3A A;  1OH7 A;  2JLE A;  1WSI A;  1K8A O;  4EP4 A;  3UB5 A;  4MO5 A;  5C2D A;  2HHI A;  1FKO A;  1L3S A;  4NCB A;  3EEQ A;  4CD1 A;  1KQS M;  2IS3 A;  3ZX0 A;  4KHP K;  1NGG A;  3SJJ A;  1NOY A;  4A57 A;  1HX1 A;  2QM1 A;  4DV3 K;  3Q7C A;  3V9S A;  3IFR A;  3UIQ A;  2QTD A;  3WXI A;  2VQF K;  4CBW A;  1RCH A;  1U2V A;  1SKR A;  3F5T A;  4EHT A;  4A5A A;  3DRP A;  3MDQ A;  2VWK A;  3DXM B;  1M1K O;  3CCJ N;  1L3V A;  4FWK A;  1HNZ K;  3TAB A;  3CYM A;  5F0X A;  1D8Y A;  4V19 S;  3BGR A;  4CEB A;  2ZJP L;  1Q9X A;  4FOE A;  3K9K A;  4CJW A;  3OYN A;  3EO3 A;  3V1R A;  2IAJ A;  3ZEU A;  1U4B A;  3KZB A;  5AQN A;  1N36 K;  1VSH A;  1VQ5 N;  4QOZ B;  4BR2 A;  3VQ5 A;  1VSD A;  4YOV A;  3RR8 A;  3C95 A;  3HL8 A;  3VA0 A;  3HST B;  2E6L A;  2DPN A;  4OGE A;  2Q2R A;  4FL9 A;  3LDP A;  4ISE A;  5M1Q A;  1Y97 A;  5HRO A;  1NGJ A;  4NXM K;  4FLW A;  3DRS A;  3OYL A;  4DU1 A;  3BP8 A;  4JNE A;  3DM2 A;  3SPZ A;  4OKJ A;  4HWI A;  3BZC A;  3RSE A;  4CES A;  4BQZ A;  3CCL N;  4CEZ A;  4M3W A;  2YI1 A;  1F21 A;  3BEX A;  2HB5 A;  2RF2 A;  1JLB A;  2FBT A;  4GVM A;  1NJY A;  2HND A;  3FLC O;  3SBG A;  2HHS A;  3AVI A;  2V7Z A;  1VQM N;  4H0X B;  3VF2 A;  5M1N A;  1NGD A;  3R3L A;  1KVB A;  3MCP A;  1XC3 A;  3CFP A;  3JAM O;  4Z4H A;  4ZTJ A;  1OH6 A;  3ZSO A;  1RBU A;  4IFE A;  3P38 A;  4JKG A;  3QML A;  4ILJ A;  1IBM K;  5AQX A;  4NB4 A;  5ADX H;  3ENH A;  4EIA A;  3ZET B;  4BRK A;  2CGK A;  4QCL A;  1QSS A;  4BRL A;  1BA0 A;  1LW2 A;  3VET A;  5AQG A;  4CJL A;  4IG0 A;  1RDW X;  1LCU A;  5K14 A;  1WN7 A;  3VEY A;  3DAW A;  3P83 D;  4CK3 A;  1VSK A;  1CXQ A;  1J5E K;  2ZF5 O;  4DTX A;  2E88 A;  3N4Q A;  2RE2 A;  3TAM A;  1QTM A;  1HQU A;  4RW7 A;  3NH0 A;  4B1Y B;  3O3G A;  4HTL A;  3P4I A;  3SBT A;  4WYB A;  4FWN A;  4LH4 A;  3CG7 A;  1ZBI A;  2Y1I A;  2F9W A;  4JLH A;  2BAN A;  1VQ9 N;  3AAP A;  3FR0 A;  5JVH L;  4DR5 K;  1HLU A;  4F4K A;  1VSL A;  2E2Q A;  3NF8 A;  3SMP A;  4H0V B;  3KD1 E;  4CFA A;  4W5R A;  4O8U A;  2QXL A;  4IO9 L;  2ZWH A;  1T05 A;  4DHY A;  4KAZ A;  4IG3 A;  4JKH A;  3U3G A;  1KAX A;  4BR0 A;  1RTH A;  3PO5 A;  3LAL A;  1NGB A;  1U2V B;  2YHY A;  5C42 A;  3TI0 A;  3M8P A;  3SJH A;  1GOA A;  3AO2 A;  3R6M A;  4A61 A;  2YHW A;  4CEO A;  4YFU A;  4DU3 A;  4BGA A;  4J2D A;  2E4L A;  4W5Q A;  3E9L A;  3CCM N;  4LF9 K;  4M3Z A;  4Z4C A;  2QWP A;  2NRW A;  3OYF A;  3EYZ A;  3VQQ A;  4FJL A;  1JCF A;  1ZC6 A;  4M45 A;  3CET A;  1RT4 A;  4O55 A;  3ZEU B;  5AQV A;  4FJM A;  4PL8 A;  1E4G T;  3PX4 A;  4LF5 K;  2UUA K;  4A62 A;  1R0A A;  3C6H A;  4CJT A;  5DK5 A;  1LAV A;  1HNI A;  1R59 O;  3VF4 A;  3RSE B;  4DSJ A;  4M3Y A;  5M1K A;  3VGK A;  2O8D A;  3VN5 A;  1QHA A;  4CGG A;  3ID6 A;  3AVN A;  3QNO A;  3HXM A;  4H0T B;  1DEJ A;  3J7Z O;  3B6P A;  4WFN L;  2UXD K;  3LDS A;  3PLA A;  5KPT A;  5C12 A;  3T1Y K;  1RTI A;  5M1F A;  3NF6 A;  4RG8 A;  4CJK A;  2KKZ A;  2OYQ A;  3RMD A;  1WSJ A;  4JKG B;  4PL7 A;  2QXF A;  4B9Q A;  2XRI A;  2E1Z A;  4E1M A;  3FZF A;  3K2P A;  2AP1 A;  2PBD A;  4WQ5 C;  1RT1 A;  5HRN A;  2F4V K;  2YHB A;  2YJE A;  2DFE A;  2OPQ A;  1GLJ O;  3FGU A;  4FLY A;  2NRV A;  4ICL A;  1N5Y A;  2Q97 A;  4Q0B A;  3AVM A;  4K41 A;  4H0O A;  2QWO A;  2ASM A;  2VGN A;  1KLN A;  2KTQ A;  4CHO A;  2KHO A;  4JS5 A;  4CHQ A;  3L8B A;  3O1B A;  3SUP A;  2HBJ A;  2UUC K;  2YKM A;  1SUQ A;  2UYT A;  4CJV A;  1XWL A;  1SL2 A;  2QKB A;  4DV0 K;  1NKE A;  4RWT A;  3NVK A;  3ITH A;  4DUZ K;  3QFU A;  2FLO A;  3AO5 A;  4CEF A;  3OYD A;  3LDQ A;  3C65 A;  2GEL A;  3QBX A;  2QWR A;  4BC3 A;  4BG8 A;  1I39 A;  4BQL A;  5LL6 Z;  1W9H A;  4M3U A;  2PAV A;  4WFB L;  4DSI A;  4BVP A;  4B9L A;  4Y1D A;  1IG8 A;  5AQS A;  3T7Z A;  3OJU A;  4H4M A;  2HST A;  4FM0 A;  1BHL A;  1ATN A;  2Z1H A;  1EX4 A;  1YF5 L;  1BIU A;  1NM1 A;  4R5P A;  2E2O A;  3NHG A;  4DV2 K;  2OTL N;  3O9U A;  3AO1 A;  3LAM A;  1S1V A;  1C1B A;  1BA1 A;  4I2P A;  3TU5 A;  5I3U A;  3I33 A;  4E7L A;  2PY5 A;  2D4W A;  4E7H A;  3NF7 A;  4XH5 A;  3LAN A;  4DFP A;  2E20 A;  2AJQ A;  2O8B A;  3WNF A;  3A2F A;  3TAG A;  4QS9 A;  3K5L A;  3VA3 A;  5FRO A;  2D0P A;  3AVG A;  5AQH A;  2UXC K;  2NRX A;  4M3T A;  3E01 A;  4CFD A;  3KKR A;  3SAF A;  3NAE A;  3A5N C;  1BIZ A;  4LH5 A;  4LC9 B;  5DM6 L;  3EL2 A;  3O1W A;  3OTO K;  4DF4 A;  1ILY A;  2O8D B;  4DSE A;  4DR2 K;  1VQP N;  3U6F A;  4H0P A;  4JEP A;  1U6Z A;  3W0L A;  4BRA A;  2D0A A;  1T44 A;  4JYA K;  1RDU A;  3H6E A;  1BQN A;  1HPM A;  1X9M A;  1C1A A;  4CHN A;  4FK4 A;  4FWQ A;  1IKY A;  3CJ1 A;  1EWQ A;  1M90 O;  3O8M A;  4OVL A;  5D3G A;  4BRQ A;  4Y1C A;  2P9S A;  1E3M A;  3TAE A;  4BRP A;  5JEN A;  4CJU A;  4HTU A;  4M41 A;  3ZX3 A;  2VCP A;  1BOT O;  3QIN A;  4FLX A;  1RTJ A;  3VQ7 A;  4LFC K;  1X9W A;  4CZK A;  5I9E B;  4BE0 A;  3E9O A;  2OZS A;  4KHU A;  3HOS A;  4JD2 A;  2ZGZ A;  4KHQ A;  1REV A;  3THX A;  3A5M C;  3F2K A;  1YVN A;  2D5R A;  2QI2 A;  3DYA A;  4C23 A;  5BRE A;  3FZK A;  3SV4 A;  4AHU A;  2OA8 A;  4K0K K;  4RW9 A;  2HNY A;  3MK6 A;  1S6Q A;  4CJ4 A;  4H4O A;  3V9W A;  2NUB A;  4CJP A;  3OYG A;  3VQ6 A;  2IC3 A;  1NK8 A;  1D5A A;  1EET A;  1HNX K;  4X62 K;  1JL2 A;  4OJR A;  1C0G A;  4CED A;  4CF0 A;  3KD5 E;  2FSN A;  2G8F A;  2ZGY A;  4KTW A;  2G8I A;  3ULD A;  4IKF A;  1YJW N;  5M1P A;  3RMB A;  2B6A A;  4B9M A;  4DB3 A;  5F1X A;  4JS4 A;  2CH5 A;  4B3S K;  3C6A A;  4JRP A;  2KW4 A;  3E66 A;  1GLF O;  2QEX N;  4DTR A;  1ESV A;  3CD6 N;  1BGX T;  1WLJ A;  3H1V X;  4CF1 A;  4FLT A;  2O8B B;  3KLG A;  3U3Y A;  4CGJ A;  4I9Q A;  1IKX A;  4FSV A;  4J8F A;  2GWJ A;  4ELU A;  2NRR A;  2P9L A;  4PKH A;  2JWL A;  4HUG A;  1IH7 A;  1U45 A;  1N33 K;  4CZG A;  3M1F A;  4WE1 A;  5I42 A;  4CE9 A;  4E1N A;  2W40 A;  1XNQ K;  2HHH K;  2RN2 A;  3H08 A;  1HYS A;  2GEM A;  2QW9 A;  2CH6 A;  4KH4 A;  1XC9 A;  2ZQB A;  3LPT A;  2KZZ A;  1U48 A;  2PZS A;  4FPB A;  3ZLJ A;  3KLF A;  1CZA N;  3J81 O;  3D6R A;  4DR4 K;  3L2R A;  1H1V A;  1RBS A;  4AM7 A;  2VGM A;  4H5V A;  5J2Q A;  2OCE A;  1X9S A;  3HPG A;  3I8B A;  2P9S B;  1RDC A;  3L4Q A;  3KWG A;  3AVL A;  3H45 C;  1WB9 A;  3VQ8 A;  3O6W A;  2BGG A;  3KTQ A;  1BUP A;  3OBW A;  2KQ2 A;  2D0C A;  3MX2 A;  1BWF O;  2A1R A;  4DU4 A;  3ZT4 A;  5HRR A;  4M7Y A;  1SL1 A;  2HVI A;  1YJN N;  4NLC A;  1RBT A;  4JKC A;  4JD2 B;  5AQK A;  3EE9 A;  5SZT A;  3C6U A;  2CGL A;  3THX B;  1Y64 A;  4OGC A;  3OS2 A;  4BEC A;  4BDP A;  2GUP A;  3HI0 A;  4O4G A;  4YOW A;  4H5W A;  3EZ5 A;  1KAY A;  4YDU A;  2IDO A;  4G1Q A;  2BH1 A;  3VER A;  1Q7Y O;  5CYQ A;  3MEE A;  4FVU A;  4AHT A;  2GX9 A;  4AHC A;  2ZE2 A;  4WQ4 A;  4DCH A;  1T03 A;  3QBW A;  1KC8 O;  4CHY A;  3CER A;  4HCB A;  4KHW A;  3EZW A;  5HL7 L;  2QWN A;  2A41 A;  4IDK A;  3OYJ A;  1WNS A;  3O3H A;  3MXM A;  4BG9 A;  1FXX A;  4CGF A;  2DTU A;  2XY8 A;  3BF1 A;  4GV9 A;  3K58 A;  3CJB A;  1JKH A;  1OKJ A;  1YJ9 N;  3QDK A;  1WBD A;  2FF3 B;  4DFJ A;  4OKE A;  5JS1 A;  4X66 K;  4XEI A;  3U8X A;  4N76 A;  2YKN A;  4AQY K;  3G25 A;  3A5O C;  5LJW A;  1JJ2 M;  3DLG A;  1C0M A;  1VRT A;  1KXP A;  4M7X A;  3HO1 A;  1NOZ A;  1IV0 A;  3P31 A;  1XQS C;  2HHW A;  2IOC A;  3SQ2 A;  3L3V A;  4Z0U A;  3IS9 A;  3VEV A;  4YY3 K;  4H8K A;  4J2A A;  3N4P A;  3DMJ A;  5AQQ A;  4Z4G A;  1HJR A;  2P9L B;  3IDH A;  2OPR A;  2A5X A;  2WON A;  3MN7 A;  5J2M A;  4B8C A;  3PIO L;  5MLC Q;  5SWM A;  1ATS A;  2HHU A;  4B9S A;  5HRP A;  3LP0 A;  3VQ4 A;  3MXJ A;  3C0B A;  3SYZ A;  5IT9 O;  5AFU H;  4E3S A;  1TL1 A;  1Z25 A;  1TL3 A;  5CHI A;  3CPW M;  5GIN A;  5AQR A;  3CCV N;  2VWJ A;  1L3U A;  3FZL A;  2HBM A;  3RWU A;  1WUA A;  1S6P A;  3ZSY A;  3HOT A;  1NK0 A;  3KWI A;  1RT7 A;  3VEN A;  4FJ7 A;  3CJ9 A;  3M5R A;  4DV7 K;  2ASO A;  3GE1 A;  5EY4 A;  4FJ5 A;  1S1T A;  1GLL O;  1EO1 A;  4H03 B;  5T7B A;  4FWM A;  1O13 A;  5KQ8 A;  5AFU A;  1JLF A;  4CF9 A;  2O4I A;  3JXU A;  4JK8 A;  1TK0 A;  3QEV A;  5AQP A;  5JVG L;  2G8V A;  1K8K A;  5F2R A;  1GLD G;  3TPQ A;  5LJV A;  3HPH A;  1SZ2 A;  4BRE A;  3C7N A;  3QES A;  3B6O A;  4FJJ A;  1NGE A;  1SKS A;  1HR0 K;  1RBR A;  2P9N A;  3SMS A;  3TWH A;  2KZM A;  3E1Y A;  3MMV A;  3VES A;  1JLC A;  5DMR A;  4DV5 K;  1UWB A;  3LDL A;  4EHU A;  3I0R A;  4CIG A;  3PSF A;  1YAG A;  3WUH A;  4LFA K;  4KO0 A;  1Q9Y A;  1EQY A;  2YHX A;  2EWS A;  4H5N A;  4CK2 A;  3PIP L;  4HVJ A;  2E5L K;  3D45 A;  4IOX A;  4JI7 K;  3K9J A;  4BE1 A;  1C0F A;  1MA9 B;  3AVA A;  1RIL A;  3D2E A;  1OVQ A;  3DXK A;  2B4J A;  3I8D A;  1QHT A;  3WXM B;  2QA4 N;  3J7A P;  3CQX A;  4UY8 O;  3KVG A;  3C94 A;  3WT0 A;  1JXB A;  2VYP A;  3K5O A;  3ZX2 A;  1UAX A;  4H0Y B;  4WCE L;  3SUQ A;  1DT9 A;  2EHG A;  4E7J A;  2BE2 A;  1VSM A;  2P1J A;  4KI6 A;  3RVC A;  4CIF A;  1LW0 A;  3GBT A;  4OPH A;  3FE1 A;  3HVR A;  4M3R A;  3NDK A;  1TV6 A;  3AVB A;  4L8R B;  3TTD A;  1SL0 A;  4B1W B;  4IFY A;  5AQM A;  1EWR A;  4AM6 A;  3H3O B;  4KKO A;  4B08 A;  2RHK A;  5HBM A;  3DLE A;  3V9Z A;  3NCI A;  1NGF A;  1S22 A;  2RKI A;  1NU0 A;  1TUY A;  4LSN A;  5BRD A;  1SAZ A;  2GBZ A;  5KGX A;  4B1X B;  4BRO A;  1FW6 A;  4DS4 A;  2HW3 A;  2BUP A;  1TUU A;  4CZH A;  1WAF A;  5C24 A;  3IAY A;  2UXB K;  3T3F A;  4A59 A;  2Q3S A;  3JYT A;  4KH6 A;  4IEE A;  1A5W A;  4BRM A;  1ASW A;  4JAX A;  5JMV A;  3CXC M;  3CCQ N;  3BZK A;  3CF5 L;  5BRH A;  4PQU A;  3SQ0 A;  3AA2 A;  3HP9 A;  3T1A A;  1TKX A;  2D1K A;  3OYI A;  3G10 A;  1BCM A;  4LY7 A;  3OYA A;  3TAQ A;  2Q36 A;  1L3T A;  4F9O A;  1CZB A;  1G15 A;  3MED A;  3HVT A;  2C1I A;  3M8S A;  2WUS A;  3ZSQ A;  3CFR A;  3IKM A;  4OX9 K;  4AHS A;  5EOY A;  1RFQ A;  3ZSR A;  1J5O A;  4N5S A;  4F3T A;  4W5O A;  3QEW A;  4ID5 A;  1K8K B;  3H3N O;  4CFB A;  4W5T A;  4FWL A;  2WFB A;  4M42 A;  4FVM A;  2YV0 X;  3C7N B;  4DV6 K;  4K25 A;  4B9U A;  4B9V A;  4NO7 A;  5BPL A;  4C1N I;  4FYD A;  1QQC A;  4HUE A;  1IKW A;  2P9N B;  4ID1 A;  4O5B A;  1QZ6 A;  1XMQ K;  1D9D A;  4E89 A;  4FZX C;  5FPD A;  2FF6 A;  5KI6 A;  1QQM A; 
#chains in the Genus database with same CATH homology
 4YOU A;  5BPM A;  1LOT B;  3ZX3 A;  3VGL A;  2VCP A;  1BOT O;  1W2B M;  2IVN A;  1TYQ B;  2QWM A;  3CC2 N;  3R1X A;  4JKD A;  3ENB A;  3O80 A;  4BR9 A;  4CZL A;  5AQY A;  2FSJ A;  3VGM A;  3NVM A;  4I6M A;  5CE3 A;  4IJN A;  4CZK A;  5I9E B;  4IWV A;  3VOV A;  3VPZ A;  3E9O A;  3JS6 A;  1Q18 A;  3HOS A;  3MCA B;  1X9J A;  2KLA A;  2ZGZ A;  1YXQ A;  1G99 A;  4JD2 A;  3D2E B;  4GV6 A;  3DXK B;  4IZ9 A;  3CCU N;  2ASP A;  3A5M C;  5JLF A;  4DQ8 A;  2D0O A;  3MWT A;  5FPE A;  4IEI A;  2VWB A;  2J4R A;  3F2K A;  3VF6 A;  1YVN A;  2QI2 A;  4OO1 J;  4C23 A;  5BRE A;  3H1Q A;  2A6A A;  3FZK A;  3CI5 A;  3WEE A;  3LL3 A;  3D7E O;  3MK6 A;  4JK9 A;  1NJI O;  2A40 A;  4XH4 A;  1JCG A;  3O9S A;  1MWM A;  1QZ5 A;  3U9D A;  1S3X A;  5AQO A;  3CJC A;  3ZET A;  5HOO A;  1T3V A;  1NGA A;  2Q1N A;  4MO4 A;  4JKA A;  5AR0 A;  3O08 A;  1GLC G;  4IJA A;  3D2F A;  4IO8 A;  3W3D A;  4GY2 B;  3UE5 A;  1NMD A;  3EKU A;  5C15 A;  4Z94 A;  1VQO N;  3UKR A;  1C0G A;  2JWK A;  2V7Y A;  3ATV A;  3FZM A;  1VQ6 N;  2FSN A;  2HBK A;  3ATU A;  4ISF A;  2ZGY A;  4QS7 A;  2GWK A;  3CC7 N;  1NGH A;  3ENO A;  1V4S A;  1WOQ A;  1YJW N;  4CZJ A;  1K73 O;  5M1P A;  2E2N A;  1K8A O;  3UB5 A;  3WXJ A;  5ADX A;  4MO5 A;  1N8R O;  4DB3 A;  5C2D A;  5F1X A;  3EKS A;  3VEO A;  2CH5 A;  2V52 B;  5AQZ A;  1KAZ A;  3C6A A;  3P39 A;  5H1S Q;  2ZJR L;  4CD1 A;  1KQS M;  3ZX0 A;  3E66 A;  1NGG A;  1GLF O;  3GOI A;  2QEX N;  1VQN N;  1ESV A;  4MLH A;  3OA9 A;  3CD6 N;  4JHD A;  4A57 A;  1HX1 A;  2QM1 A;  4JN4 A;  3SK3 A;  3E9P A;  3Q7C A;  2ITM A;  3IFR A;  2CGJ A;  2HMP A;  3H1V X;  1DGK N;  2QTD A;  5AZJ B;  4B1Z A;  2A42 A;  3WXI A;  4FSV A;  4CBW A;  2I7P A;  4J8F A;  3WXK A;  2GWJ A;  3DWL A;  4H5R A;  2P9U B;  2NRR A;  2P9L A;  1Z6R A;  5EVZ A;  1T6C A;  1U2V A;  4PKH A;  2HF3 A;  2JWL A;  3F5T A;  4EHT A;  3CC4 N;  4A5A A;  4CZG A;  3M1F A;  3MDQ A;  3DXM B;  3EE8 A;  4CZF A;  2W40 A;  5ELZ A;  5KPR A;  1M1K O;  2OTJ N;  3CCJ N;  4FWK A;  3GL1 A;  5JIC A;  2GEM A;  5F0X A;  2QW9 A;  2CH6 A;  4KH4 A;  3CHW A;  4JKB A;  1HKB A;  1Q82 O;  4FPB A;  2ZJP L;  4CD3 A;  1BDG A;  4FOE A;  5GIP A;  1V4T A;  3K9K A;  3NMU A;  1CZA N;  4BE7 B;  3EO3 A;  3D6R A;  1VQ4 N;  3ZEU A;  1J6Z A;  3KZB A;  5AQN A;  1H1V A;  1NLV A;  1VQ5 N;  1BU6 O;  2HOE A;  4AM7 A;  4BR2 A;  2VGM A;  4GNI A;  4H5V A;  2Q0U A;  3H46 O;  4YOV A;  4YOY A;  3I8B A;  2P9S B;  3L4Q A;  3KWG A;  3H45 C;  2DPN A;  2V51 B;  2Q2R A;  4FL9 A;  3LDP A;  4ISE A;  3O6W A;  5M1Q A;  1BUP A;  3OBW A;  5TKW A;  1NGJ A;  5BPN A;  2P9K A;  2NRH A;  3IUC A;  3MX2 A;  1K9M O;  1BWF O;  4ILH A;  2FXU A;  3BP8 A;  4JNE A;  1GLB G;  3T69 A;  5GIO A;  1YI2 N;  4HWI A;  3RSE A;  3CCS N;  4M7Y A;  4BQZ A;  5KPZ A;  1YJN N;  4IDH A;  3CCL N;  3AAR A;  4I6M B;  4NLC A;  2YI1 A;  1HKG A;  3BEX A;  4PKG A;  4WF9 L;  3LDO A;  2NRT A;  3FLC O;  4JD2 B;  4JKC A;  4L3Q A;  5AQK A;  2YJF A;  3EE9 A;  4H5T A;  3BF3 A;  3SBG A;  4BC5 A;  4BRD A;  2V7Z A;  1IJJ A;  2Q31 A;  1VQM N;  4H0X B;  2CGL A;  3VF2 A;  5M1N A;  1Y64 A;  4XJX A;  3CME N;  4BEC A;  1NGD A;  2GUP A;  3R3L A;  3HI0 A;  2I7N A;  1XC3 A;  3MCP A;  5BRF A;  4YOW A;  1BG3 A;  3HRG A;  4H5W A;  4BRI A;  1KAY A;  4YDU A;  4RTF D;  2BH1 A;  3VER A;  1Q7Y O;  4IFE A;  3CIP A;  3P38 A;  1D4X A;  4A2A A;  3SAH A;  4JKG A;  3WEE B;  4FVU A;  5M1O A;  3QML A;  2GX9 A;  4ILJ A;  5AQX A;  4NB4 A;  4WQ4 A;  3AY9 A;  4DCH A;  3QBW A;  5ADX H;  5E26 A;  1KC8 O;  3ENH A;  3CER A;  4JKF A;  4O8K A;  5AQF A;  4EIA A;  3B8A X;  3ZET B;  2OAN A;  2CGK A;  3EZW A;  4BRK A;  5HL7 L;  4OPA A;  1MWK A;  2QWN A;  3OW2 M;  3MN6 A;  4JKE A;  5KQD A;  2A41 A;  3D2F B;  4BRL A;  1BA0 A;  1VAZ A;  1YIT N;  3EN9 A;  3VET A;  5AQG A;  1RDW X;  1LCU A;  4BG9 A;  4EFH A;  4U7B A;  3UKR B;  3M3Z A;  3MWP A;  3BF1 A;  4GV9 A;  3VEW A;  5AZI A;  3CJB A;  3DAW A;  3O9Q A;  3VEY A;  4U67 L;  3UKU A;  4IO9 L;  2YCH A;  2P9P A;  4BY9 C;  1OKJ A;  2ZF5 O;  2E88 A;  3N4Q A;  3VTI A;  1JCE A;  2RE2 A;  1YJ9 N;  3QDK A;  3J8A A;  3LM2 A;  2FF3 B;  3MX5 A;  4B1Y B;  4HTL A;  3P4I A;  2E2P A;  3SBT A;  4WYB A;  4FWN A;  3HSC A;  4XEI A;  3ZYY X;  3CQY A;  3U8X A;  2F9W A;  4BVO A;  3G25 A;  3A5O C;  3O9T A;  5LJW A;  1JJ2 M;  1VQ9 N;  3AAP A;  3FR0 A;  4YDU C;  5JVH L;  3M6G A;  4MLE A;  1ATR A;  4C1N K;  1KXP A;  4M7X A;  2C1G A;  3QB0 A;  2HBL A;  4BR5 A;  4CZI A;  2NLX A;  1HLU A;  3WQT A;  3P31 A;  1XQS C;  3CJA A;  3MN5 A;  5AQJ A;  2E2Q A;  4JHD B;  3SMP A;  1E4F T;  5LY3 A;  2IIR A;  4H0V B;  4IXC A;  3VEV A;  4O8U A;  2QXL A;  3S41 A;  2ZWH A;  4FWO A;  4WQ4 C;  3VEX A;  4CZM A;  4DHY A;  4CI6 A;  3N4P A;  4JKH A;  4K43 A;  5AQQ A;  1KAX A;  4BR0 A;  5C2F A;  3VTH A;  3DJC A;  4R79 A;  2P9L B;  4GV3 A;  2IVP A;  3CMA N;  2QWQ A;  1NGB A;  1U2V B;  2NZT A;  2YHY A;  3IDH A;  4FO0 A;  4CJ7 A;  4BGB A;  3SJH A;  2A5X A;  3MN7 A;  3O5B A;  5BN9 A;  3PIO L;  4YOT A;  5MLC Q;  3R6M A;  3TTC A;  4A61 A;  1ATS A;  2WC9 A;  2YHW A;  5EX5 A;  1QQN A;  4O5F A;  1BO5 O;  4BGA A;  1VQK N;  3C0B A;  2E1Y A;  3E9L A;  3G6E N;  3FFK B;  5AFU H;  3CCM N;  1P8Z A;  1Q81 O;  4CZE A;  2QWP A;  5CHI A;  3CPW M;  2NRW A;  5GIN A;  2A3Z A;  1SQK A;  3HM8 A;  1JCF A;  5AQR A;  1ZC6 A;  4FOI A;  3CET A;  3ZEU B;  3CCV N;  5AQV A;  5AQU A;  3Q7B A;  3GDQ A;  3DLL L;  3FZL A;  2HBM A;  1WUA A;  2NRZ A;  4PL8 A;  1E4G T;  1YUW A;  4A62 A;  1QVF M;  4IOA L;  3C6H A;  4WQ5 A;  4FWP A;  3HOT A;  3KWI A;  4BEB A;  2AA4 A;  3VEN A;  3CJ9 A;  3M5R A;  4NLB A;  2ASO A;  3U9Z A;  3GE1 A;  5EY4 A;  4B1V A;  1P90 A;  1GLL O;  2P9K B;  2P9I A;  3TSU A;  3TTF A;  1EO1 A;  4H03 B;  1R59 O;  4FPA A;  3QIC A;  4FWM A;  2WBN A;  1O13 A;  3VF4 A;  3RSE B;  5KQ8 A;  5AFU A;  3SAG A;  4FWR A;  4WFA L;  5M1K A;  3FZH A;  3VGK A;  2W00 A;  3JXU A;  4JK8 A;  1QHA A;  4BC2 A;  1X3N A;  3SLC A;  1VQ8 N;  2PFU A;  3ID6 A;  5BN8 A;  3CCR N;  4H0T B;  1DEJ A;  5AQP A;  4BRH A;  3J7Z O;  5JVG L;  4WFN L;  4IOC L;  1K8K A;  1VQ7 N;  2W41 A;  5E84 A;  5F2R A;  1GLD G;  3TPQ A;  4CBU A;  5LJV A;  3PLA A;  1SZ2 A;  5KPT A;  4BRE A;  5C12 A;  3C7N A;  1QQO A;  1HKC A;  5M1F A;  1NGE A;  3ULE A;  3F9M A;  3HZ6 A;  2KKZ A;  4YOR A;  2P9N A;  3SMS A;  4JKG B;  4BRG A;  1DKG D;  4PL7 A;  4A2B A;  4B9Q A;  3E1Y A;  2E1Z A;  3MMV A;  4PHT X;  5BR9 A;  3FZF A;  3VES A;  1HUX A;  5TKY A;  3AGR A;  2AP1 A;  2PBD A;  4WQ5 C;  3LDL A;  1X3M A;  1NGI A;  3L4I A;  4JK7 A;  4EHU A;  4QS8 A;  3A0I X;  2YJE A;  1TYQ A;  1GLJ O;  3WUH A;  1YAG A;  5CR4 A;  5AQI A;  1YIJ N;  3BUZ B;  4RCH A;  1EQY A;  3FGU A;  2YHX A;  2EWS A;  1Z05 A;  2NRV A;  4H5N A;  2NNW A;  5B8H A;  3PIP L;  2Q97 A;  1ZBS A;  2E8A A;  3CJ7 A;  4IOX A;  4K41 A;  4H0O A;  2QWO A;  2H3G X;  3K9J A;  5FPN A;  2VGN A;  1C0F A;  2ASM A;  5AZI B;  4BRC A;  1MA9 B;  5GAH P;  2KHO A;  3UKU B;  1YHQ N;  3D2E A;  2P9P B;  2QWL A;  3DXK A;  3TSQ A;  3A5L C;  3WXM B;  2QA4 N;  3O1B A;  2HBJ A;  3CQX A;  1XUP O;  3KVG A;  4UY8 O;  4CBX A;  5AQL A;  3WT0 A;  2FSK A;  3U4L A;  3G4S N;  2UYT A;  2VYP A;  3R8E A;  3R9P A;  2IVO A;  3ZX2 A;  2YX6 A;  4H0Y B;  4WCE L;  1DT9 A;  5FPM A;  3A8Y A;  3I56 N;  3RVC A;  4DKW A;  3TSP A;  3GBT A;  4OPH A;  4MDB A;  3FE1 A;  1GLA G;  4RWT A;  3NVK A;  3L6Q A;  3WQU A;  1KD1 O;  3QFU A;  2FLO A;  3TTD A;  4BRN A;  3LDQ A;  4B1U B;  3C65 A;  2GEL A;  3QBX A;  2QWR A;  4B1W B;  4BC3 A;  1S72 N;  5AQM A;  5AQT A;  4BG8 A;  4BQL A;  4AM6 A;  3H3O B;  2PAV A;  2RHK A;  4WFB L;  4BVP A;  1IG8 A;  5AQS A;  3T7Z A;  1NGF A;  1S22 A;  1TUY A;  2HST A;  4MDA A;  2F7T A;  1ATN A;  1GLE G;  2HF4 A;  4K42 A;  5BRD A;  1SAZ A;  5AQW A;  1YF5 L;  4E1J A;  4B1X B;  1NM1 A;  2BTF A;  3HTV A;  2E2O A;  4BRO A;  2OTL N;  3O9U A;  2BUP A;  1HJO A;  1TUU A;  4KBO A;  4A5B A;  4CZH A;  3HBT A;  1VQL N;  1BA1 A;  3TU5 A;  3I33 A;  4A59 A;  1QVG M;  3QFP A;  4KH6 A;  4IEE A;  2D4W A;  4BRM A;  4JAX A;  4XH5 A;  5JMV A;  4BR4 A;  4ILG B;  1SS6 A;  3O9R A;  3CXC M;  3CCQ N;  2E20 A;  3CF5 L;  5BRH A;  5JLH A;  5C0Y A;  3OBY A;  3KK7 A;  4FWS A;  3MN9 A;  5AZJ A;  2D1K A;  4G9Z A;  4YOX A;  1Q86 O;  1NBW A;  3GG4 A;  3I55 N;  4QS9 A;  2Q36 A;  2P9U A;  3L0Q A;  3G71 N;  1ZXO A;  2D0P A;  5AQH A;  1W97 L;  4F9O A;  3O4W A;  5GAG P;  2P9I B;  2NRX A;  4ISG A;  3SAF A;  2C1I A;  1NGC A;  3DXM A;  4XH1 A;  2WUS A;  2GTD A;  3A5N C;  3AAQ A;  4M63 C;  5EXW A;  4LC9 B;  5DM6 L;  4Y0W A;  5C10 A;  3IKM A;  3KHY A;  3EL2 A;  3O1W A;  3VMF B;  5EOY A;  1RFQ A;  1ILY A;  1OVY A;  3CPE A;  5GAD P;  5DM7 L;  1VQP N;  4H0P A;  4JEP A;  1U6Z A;  3W0L A;  4BRA A;  1RGI A;  4BC4 A;  1K8K B;  3H3N O;  3AGK A;  1T44 A;  1T6D A;  2Q0R A;  1MDU B;  3IMX A;  4FWL A;  3VEZ A;  2WFB A;  5GAE P;  1RDU A;  3H6E A;  3LM9 A;  4BR7 A;  4KH5 A;  4EAH D;  1HPM A;  3C7N B;  2ZJQ L;  4K25 A;  4FWQ A;  3OHR A;  4PKI A;  3CJ1 A;  1NWK A;  3ULE B;  4NO7 A;  3CCE N;  4GVE A;  4C1N I;  5BPL A;  3O8M A;  4AF1 A;  1M90 O;  2P9N B;  4BRQ A;  1QZ6 A;  2P9S A;  2F9T A;  4BRF A;  4BRP A;  5FPD A;  2FF6 A;  3LDN A;  1QQM A;  3WXL A;  3ID8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...