3A5NC

Crystal structure of a dictyostelium p109a ca2+-actin in complex with human gelsolin segment 1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
359
Chain Sequence
b'QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 117
structure length 359
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5nC03
2E2PA 4H5NA 5BN9A 1K8KB 4FWMA 1RGIA 1GLBG 2HF3A 4B1YB 3AAQA 4XH1A 3MMVA 3MN5A 1GLLO 3BF1A 5AQPA 4CD3A 3OHRA 4H0PA 3DXMA 2V7YA 4ISGA 2P9PB 1S22A 4CZIA 3U9ZA 1D4XA 4BRCA 3CJ7A 3CJ9A 3W0LA 4GY2B 3LDQA 3ZX3A 5ADXH 3GOIA 1EQYA 1TUYA 3WXJA 4I6MA 1R59O 1T6CA 2UYTA 3MDQA 4M63C 3UKUB 3ATVA 4DHYA 2YHXA 4QS7A 2VCPA 3UE5A 3H46O 1GLDG 2BTFA 4BRAA 1LOTB 2Q31A 3VF6A 4CZKA 1XUPO 2DPNA 2FSJA 3CQXA 3FZMA 4ISEA 1SAZA 4ISFA 2P9NA 1NGJA 3GG4A 1P8ZA 3TU5A 4M7YA 3VERA 3MK6A 3DJCA 3BF3A 4BR2A 2W40A 3U4LA 1ZXOA 5E84A 1LCUA 2QWOA 3JXUA 4WYBA 5JMVA 2I7NA 5LJWA 5AZIA 4CZJA 5AFUH 4BREA 1V4SA 2YHYA 2QWLA 2GELA 5AQIA 5BRHA 1QHAA 3AARA 5FPDA 2IVOA 1JCEA 3WXKA 2KHOA 5AQQA 5JLHA 4B1VA 4MLEA 3BP8A 3FR0A 2QWMA 5AQTA 3ZX2A 3VGKA 3EZWA 3HI0A 1NGCA 2GWKA 4J8FA 2A3ZA 3SK3A 3R6MA 2FLOA 1NGHA 2QM1A 1NGBA 2P9SB 4BRPA 5BR9A 2V52B 2ASMA 5AQKA 3SMPA 2A41A 3L6QA 4M7XA 5F0XA 3DWLA 3FLCO 3VEXA 2YCHA 3CJCA 3UKRB 2Q97A 1QQMA 4BRMA 1Q18A 4WQ4A 4BGAA 3WEEA 3GDQA 2CH6A 1ZBSA 4IJAA 2GWJA 5AZIB 2Q36A 1SZ2A 4BR9A 4YDUC 3CI5A 4H0VB 3ID8A 2QW9A 3S41A 3J8AA 4B1UB 2ZWHA 5BREA 4H5VA 1KAXA 1KAZA 2QWQA 4BR4A 3VGLA 4K42A 1NBWA 4FOEA 2VWBA 3A5NC 2HOEA 4BRKA 1TYQB 2OANA 4BGBA 4CJ7A 5BN8A 1GLAG 2AP1A 3WQTA 3TPQA 3FZHA 3GE1A 1HKCA 3D2FA 1U2VA 2QWRA 5TKYA 1QQNA 1Y64A 3EL2A 3O8MA 4MO4A 5AQHA 1HKBA 4A2AA 1BA1A 5AZJA 5AQOA 3VEOA 1NGFA 1X3NA 4H0TB 3SJHA 4MLHA 5BPMA 1HKGA 3FGUA 1WOQA 1GLJO 3ULEA 3WXIA 3O80A 4BRNA 3ZEUB 3FE1A 2H3GX 3A5OC 1HJOA 4RTFD 4XH5A 3EKUA 2V51B 2ZGZA 3SLCA 5EVZA 3HZ6A 2GTDA 3EKSA 4PKGA 4BQLA 2P9LA 2FF3B 2FXUA 4NO7A 1BDGA 2E20A 4JHDA 5AQXA 4YDUA 1KXPA 3RSEB 3B8AX 3MN9A 3D7EO 1G99A 3CETA 3VGMA 3U9DA 1BU6O 4K41A 1ZC6A 2ZGYA 3IFRA 4HTLA 4A62A 2J4RA 2GEMA 2P9IB 2P9UA 4QS9A 4B1ZA 1NMDA 5ELZA 5JICA 3FZKA 4CBXA 1YXQA 5LY3A 4KBOA 2E2QA 1WUAA 3DXKA 4EFHA 2FF6A 4FPBA 3WT0A 3D2FB 3VENA 3C0BA 3VETA 4BC5A 1HLUA 3LDNA 2VYPA 2E8AA 3O1BA 4CZFA 4K43A 2Q0RA 1V4TA 3LDLA 3L0QA 3LDPA 2V7ZA 3VPZA 3QBWA 4FSVA 4BC2A 3EN9A 2YJEA 2CH5A 5B8HA 4NB4A 2E1ZA 5KPRA 4CZGA 5AQMA 3R8EA 4PKHA 3DXMB 4EHTA 3ZETA 4BROA 3MN7A 3IUCA 3CJAA 2PAVA 2P9LB 4BR5A 1C0GA 4FO0A 3HBTA 4I6MB 3ATUA 3HTVA 3O6WA 1QQOA 4BR0A 5E26A 4BRIA 5BPNA 1BO5O 3QFUA 1XQSC 5AQWA 2QXLA 3C7NA 1NM1A 1C0FA 1JCFA 4Z94A 4JN4A 4BG8A 1DGKN 4Y0WA 3H3NO 3LM9A 2FSNA 4FWSA 2P9NB 1Z05A 3GBTA 4L3QA 1YVNA 1U6ZA 3D2EA 2ITMA 3ZX0A 4F9OA 3LDOA 4JD2A 3CQYA 4FWPA 2BUPA 3A0IX 1NGEA 5BRDA 4PL8A 2CGJA 4H5RA 4AM6A 4CZMA 4O5FA 4A61A 3P4IA 2ZF5O 4B9QA 4FWLA 3WQUA 3M6GA 2Q1NA 3KHYA 4BRFA 5AFUA 4BVPA 4K25A 4IZ9A 1DEJA 5CE3A 3GL1A 3M3ZA 4C23A 4CBUA 4RWTA 3FZLA 2P9PA 5EY4A 4FWNA 2AA4A 2GUPA 4IWVA 5KQ8A 4AM7A 1YUWA 1BA0A 1MWMA 4EAHD 1DKGD 1S3XA 4CBWA 3WXLA 2P9KA 3UKUA 4BC3A 3LM2A 2QWNA 3F9MA 3C7NB 4BVOA 3WUHA 4FOIA 3O08A 3BUZB 1BOTO 3HSCA 4A2BA 4BC4A 1NLVA 3BEXA 5AQSA 3KVGA 2D4WA 5AQLA 3I33A 4FWQA 5FPEA 3VEZA 1IG8A 3D2EB 5AQGA 5BRFA 4MO5A 4O8KA 5AR0A 1XC3A 3VF2A 1ATSA 4BG9A 4BRQA 2E2OA 1ATRA 3HM8A 3AAPA 4EHUA 1H1VA 3WEEB 3QICA 2IIRA 4CZHA 1MA9B 3UB5A 4E1JA 3CJBA 3A8YA 4JAXA 1X9JA 1YAGA 1HUXA 4FWKA 3I8BA 3VOVA 2A5XA 2E88A 4IXCA 3QBXA 1KAYA 1RFQA 1BWFO 1TUUA 2QWPA 1MDUB 4QS8A 4WQ5C 1GLCG 5AQVA 5EXWA 3CHWA 3LL3A 4DCHA 2I7PA 4DQ8A 3H45C 1RDWX 2P9KB 1U2VB 3FZFA 3W3DA 4DB3A 3JS6A 1X3MA 3IDHA 3VEYA 5EOYA 5LJVA 5AZJB 4FL9A 4H0OA 2A6AA 5EX5A 4GNIA 2W41A 4BRDA 3H6EA 3ULEB 2P9SA 4CD1A 4B1XB 3H3OB 4H0XB 2Q0UA 4BRHA 2IVPA 5KPTA 3VESA 4JNEA 3QFPA 3DAWA 3VEVA 2A42A 2A40A 3UKRA 1JCGA 1E4GT 4JHDB 4HWIA 3MCPA 4FWOA 5ADXA 4WQ4C 2D0OA 4BRGA 3L4IA 3CIPA 2YHWA 5AQRA 3O5BA 4PKIA 1NGIA 5I9EB 2PBDA 4WQ5A 4B1WB 1ESVA 3R9PA 2P9UB 3SMSA 3ENHA 1ATNA 2Q2RA 3MN6A 3H1QA 3U8XA 5KPZA 1QZ6A 3QDKA 1NWKA 3FFKB 3DXKB 2YJFA 3O4WA 3O1WA 2ASOA 1TYQA 2WUSA 4H5WA 2CGLA 5KQDA 2NRHA 1CZAN 3H1VX 2EWSA 2FSKA 3IMXA 5F2RA 5FPNA 2F9WA 3VEWA 4CZEA 1QZ5A 2IVNA 3KZBA 4BQZA 1K8KA 3QMLA 4FWRA 5AQUA 1BG3A 3EO3A 3ZEUA 4H0YB 3ENOA 2E1YA 1J6ZA 2NZTA 4LC9B 1NGDA 1SQKA 3A5LC 3AY9A 3ZETB 2E2NA 2D1KA 1Z6RA 1E4FT 5AQYA 1T6DA 2ASPA 2HMPA 5BPLA 5JLFA 3QB0A 4XEIA 5FPMA 1GLFO 4PL7A 1GLEG 4IJNA 1NGAA 4XH4A 3RSEA 5AQFA 3A5MC 4FPAA 2YI1A 1NGGA 4EIAA 1IJJA 5F1XA 4BRLA 5AQZA 1MWKA 5AQJA 2P9IA 1HPMA 4RCHA 4BR7A 3CJ1A 3M1FA 1OKJA 2D0PA 3VF4A 2F9TA 4CI6A 4JD2B 1BUPA 3G25A 3CERA 1HX1A 2CGKA 2HF4A 4H03B 4IO8A 5AQNA 4CZLA 1T44A 4H5TA 2NLXA
chains in the Genus database with same CATH superfamily
2YNGA 4LFAK 5GINA 3KTQA 5KGXA 3OYBA 4ELVA 5HL7L 4DSKA 1KC8O 1D4XA 4BRCA 4DMNA 3CJ9A 4GY2B 3LDQA 3ZT1A 1U47A 1N34K 3ZX3A 4BE2A 3GOIA 1TUYA 1RTJA 3SUNA 3ATVA 3J80O 1RT7A 2YHXA 2VCPA 1X9SA 4B3SK 4KTQA 4BRAA 1YTAA 1T8EA 2Q31A 3NGYA 4CFBA 2W42A 2FSJA 3FZMA 3K57A 3LZJA 1OH6A 2PY5A 4ISFA 1JLGA 2P9NA 1YTUA 1NGJA 3GG4A 3VERA 3AO4A 3M5RA 3U4LA 2QWOA 3CM5A 4OGCA 4E7LA 2XHBA 3HK2A 2UUAK 3EEQA 5AFUH 3S3NA 1V4SA 2YHYA 2YNHA 2ITGA 5AQIA 3DLBA 3OYAA 4DWIA 1GOBA 3F5TA 1HNZK 1JCEA 5J2PA 4BWMA 3QETA 4BE1A 4IDHA 1NK7A 4MLEA 4Z4EA 3U3GA 1HJRA 2ZJRL 3EZWA 1IKYA 1VSKA 4J8FA 2O4GA 3R6MA 1JLAA 1NGHA 3SQ0A 3LALA 2KZZA 4YOTA 4CECA 4OPAA 4CJWA 5LL6Z 1IKWA 5C15A 4CJ4A 4NLBA 2VGNA 3L3UA 3JYTA 3K5LA 4N41A 2A41A 2OA8A 4M7XA 2HHVA 2OZSA 4E7JA 1RT4A 1QQMA 4BRMA 3ZT3A 4DTPA 1VRUA 3GDQA 1ZBSA 4PA1A 1YVUA 2GWJA 3SQ2A 4RW6A 2RKIA 2Q36A 3LAMA 4G1QA 4B8CA 1ZBFA 4GVMA 1T7PA 4G9ZA 4KREA 4BR9A 4YDUC 3CI5A 1JL1A 5JENA 4N5SA 1TL3A 3J8AA 4CF2A 4B1UB 1J5OA 3Q7BA 3LZIA 4OKJA 1HR0K 1EXQA 3C95A 3SV4A 2O8EA 1KAXA 3NAEA 3IRXA 1GOCA 3VGLA 1NBWA 4FOEA 1TYQB 1TL1A 3FZHA 4AQYK 3HSTB 1U2VA 1HNIA 3SUPA 2F4VK 4UQGA 4CJKA 3SPYA 3O9RA 3O8MA 3OJUA 5AZJA 1NGFA 5BPMA 1HKGA 3G0ZA 2OZMA 1EP4A 3FGUA 3ULEA 4Y1CA 5M1KA 1HYSA 5C42A 4LF5K 4IBNA 4XH5A 3BY5A 1KRPA 3EKSA 2O4IA 4PKGA 4BQLA 3C94A 3KLHA 2HBLA 1BDGA 2HVHA 4IG0A 4FM2A 4B3RK 3MN9A 4JK9A 1N32K 4FJHA 4JI4K 4FLWA 3PUFA 1JXEA 4JKGA 3O9UA 4QS9A 4B1ZA 4W5NA 5ELZA 5JICA 3FZKA 4CBXA 4HUGA 4ZHRA 3DXKA 3MCAB 4EFHA 3D2FB 2HNYA 4BDPA 1XHZA 1RT3A 4BC5A 3E9OA 2P5OA 3AV9A 1HNWK 1HLUA 1TK5A 4CJFA 3LDNA 3O1BA 5HRNA 4K43A 5JS2A 1V4TA 3LDLA 1RT6A 3RMBA 3QBWA 3MAQA 3L4QA 4J2AA 2HHTA 4KPYA 2E1ZA 4CW7B 1TAQA 5AQMA 5HRPA 3AA2A 1C1BA 3KLEA 3HBTA 3ATUA 3A2FA 1NJZA 4Z0UA 4BR0A 1BO5O 1XQSC 5AQWA 3BZCA 1K6YA 4DQIA 1JCFA 4KB0A 1U4BA 2DTUA 3H3NO 2P9NB 1ZYQA 1U6ZA 1ASWA 2ITMA 2BUPA 4IOXA 3KK2A 3A0IX 1NJYA 2UXDK 3TI0A 4C1NK 4LF7K 1FW6A 2EX3A 1YJ9N 4FWLA 3WQUA 1SL2A 2PYLA 2DFFA 3CYGA 4IOAL 5AFUA 5J2NA 1DEJA 3M3ZA 3DLGA 4C23A 4RWTA 2XRIA 4OGEA 2F7TA 5C2DA 4LF6K 5DMRA 1N36K 1TKZA 4IWVA 1YUWA 3C65A 3SYZA 2P9KA 4IEEA 1WAJA 4BC3A 3C7NB 4JI0K 4FOIA 4A59A 5C0YA 3HSCA 3WXMB 4CK3A 5AQSA 1XI1A 1DTTA 4WF9L 3KVGA 1IBMK 3VQ7A 4BY9C 3ISNC 5FPEA 3VEZA 3D2EB 1N33K 4O8KA 1NK8A 3OYGA 1Y97A 4GW6A 1WLJA 2UU9K 4CJ5A 1TV6A 4DFKA 2B4JA 4CEOA 3AVIA 1CLQA 5JS1A 4JAXA 2E88A 4BECA 3QBXA 4RW9A 3ZSOA 4HTUA 3VMFB 2E6MA 1MDUB 2O8EB 4NYFA 4WQ5C 1S1UA 5IWAK 3CHWA 3LL3A 3PSIA 4PY5A 2HNZA 1RDWX 3H45C 1U2VB 3W3DA 2BGGA 1X3MA 3VEYA 3V1OA 1ITGA 1Q8IA 5AZJB 4FM0A 4I7FA 3MEDA 2W41A 3H6EA 4HUFA 3ULEB 4FJ8A 1S9EA 3H3OB 3OYHA 4JEPA 3TAEA 3HPOA 4BRHA 3LANA 1X1PA 1YT3A 3QFPA 3DAWA 4JI6K 1HNXK 3THWA 4F2RA 1RBVA 1MU2A 4KHYA 4CJVA 1Q86O 1CXQA 3MCPA 3P1GA 4DTUA 3VQQA 1NNEA 4DLEA 3CIPA 4Y1DA 3O3FA 3S9HA 5I9EB 1LW2A 2NRRA 4HVJA 1ATNA 3MN6A 3H1QA 3U8XA 3QDKA 1KLMA 4ILHA 3DXKB 4JYAK 3LPUA 4Z4CA 3RMAA 3T1AA 4JKHA 3D0PA 1TKDA 3NMUA 2EWSA 1E3MA 3IMXA 1WSJA 3QEXA 2PYJA 5H1SQ 3R3LA 2KLAA 1W97L 1BG3A 3ULDA 2AJQA 3F9KA 4WCEL 4LC9B 2NZTA 5GIOA 3L2WA 4N47A 1WSEA 4X64K 3T3FA 4H8KA 2D0AA 2HHHK 5BPLA 5JLFA 3QB0A 3DLKA 1GLEG 1KVBA 2X6SA 3RSEA 1OVYA 3QINA 3THXA 2YI1A 4E3SA 1NGGA 3I0SA 4CGJA 3TSQA 1S1VA 2JWLA 2Z1HA 1JXBA 2GUIA 2P9IA 4DTRA 2QA4N 1HPMA 4RCHA 4BR7A 3HYFA 4I9QA 1OKJA 3AVAA 3V4IA 3S3OA 3VF4A 1S72N 4CI6A 2NRZA 2YV0X 4B08A 4DS4A 2PZSA 3C6TA 4GVEA 1HX1A 1I3AA 2CGKA 4CEEA 5AQNA 3CCRN 1VQNN 2E2PA 2OPSA 5GAHP 1U48A 4B9NA 4H5NA 4Z4IA 5BN9A 1K8KB 1GLBG 3WNHA 3AAQA 3MMVA 1D5AA 3MN5A 1GLLO 4FM1A 2R7YA 2KW4A 1LWEA 1XNRK 1Q82O 1RT1A 3ZSZA 3U9ZA 5T7BA 4CCHA 4CGDA 4KH4A 1S1XA 1EQYA 2PFUA 3DMJA 4KH5A 1R59O 1T6CA 1W7AA 4DHYA 3UE5A 1EWRA 3AA3A 3CCSN 4FZZA 2OPRA 1DT9A 4R5PA 3ASMA 1LOTB 1ASVA 1ZBIA 4C8NA 4CZKA 4E7HA 1XUPO 3J7AP 1SAZA 5GAGP 4IOCL 1KQSM 2F96A 3TU5A 4M7YA 3DJCA 2VG6A 3BF3A 5DM7L 3THVA 1IBLK 1HRHA 4DUYK 4OPJA 1ZXOA 1D9FA 3LP1A 3JXUA 4KH6A 5JMVA 2I7NA 5KTQA 4KHUA 5BRHA 1C0TA 3SUQA 4QCLA 3AARA 2IVOA 3WXKA 5AQQA 1T05A 3PO4A 3ENBA 3LAKA 1EX4A 5HRRA 4CGGA 3ZSYA 4KTWA 1A5XA 3ZX2A 2HW3A 3TSPA 1N5YA 3LWMA 3HI0A 1KSPA 1NGCA 4LSNA 4HCCA 4GKKK 3SK3A 2QM1A 2BH1A 3I56N 1WB9A 1YF5L 4ELTA 3OS2A 2O8BA 2ETJA 1NJWA 1RDUA 2RN2A 3CJCA 3THWB 2Q97A 1S6PA 4N56A 4WQ4A 4A57A 3CQ8A 4NXMK 3NBPA 1RCHA 4ZTJA 3O4NA 5AZIB 2UUBK 1SZ2A 5HROA 4FLZA 1VSMA 3J81O 1L3UA 3ID8A 2QW9A 1RNHA 4M3WA 4H5VA 2QWQA 2WFBA 3D45A 4N76A 1JKHA 2VWBA 3A5NC 4O0JA 4IKFA 1OVQA 5BN8A 2P51A 3TPQA 4B8AB 2QWRA 3D2FA 2UXBK 1QQNA 3NH0A 3T1HK 1HKBA 4A2AA 4DG1A 3K5OA 3CPEA 1X3NA 3AO3A 3SJHA 3LP0A 4WFAL 2C1IA 4FJ9A 3MXIA 4DV6K 3CCMN 1VQON 4WFBL 1NMNA 1BCMA 1HJOA 4JKFA 2V51B 3KK7A 1YHQN 3SAFA 2GTDA 3OYFA 5C2FA 4QOZB 2FXUA 4L8RB 3IAYA 4PQUA 2E20A 3NVKA 4YDUA 3RSEB 4JRQA 3CCLN 3THXB 3R1XA 1RBSA 1IH7A 3VGMA 1J5EK 1VSHA 1BU6O 1LW0A 4K41A 1ZC6A 3IFRA 4HTLA 2W6LA 2P9IB 2DFEA 1NOZA 3NH2A 3CCJN 4FW1A 1K73O 4FPBA 4LH5A 2VQFK 1VQLN 3SBTA 3OYMA 4C1NI 3OYJA 2G8FA 4HCBA 5FROA 3OYIA 4XIUA 3PY8A 2E8AA 2QEXN 4OX9K 3L0QA 3U3YA 3VPZA 5A2QO 4FSVA 3EN9A 2CH5A 5B8HA 4NB4A 4J2DA 1VSLA 1SKWA 4IFVA 3ZETA 4JV5K 5KRSA 1C0GA 4K8ZA 4DUZK 2RPIA 1OH8A 4FLVA 3KKRA 3M8SA 3QFUA 4U67L 4MQ3A 3C7NA 3TWHA 4Z94A 3F73A 1EO1A 3LWLA 4KB1A 4BG8A 1WBDA 4FJMA 3ITHA 1DGKN 4FZXC 1TK0A 2A1RA 3VQEA 2Z1GA 4FJJA 3NFAA 3HP6A 3D2EA 3ZX0A 4B9LA 4F9OA 1SS6A 1S1WA 4JD2A 1YJWN 3E1YA 4CGHA 4UY8O 4KAZA 4A61A 3P4IA 1K9MO 4B9QA 3CYMA 1BCOA 3JSMA 2I5JA 2FBTA 3NVMA 2FBVA 4DV7K 3KHYA 4BRFA 3SNNA 4BVPA 4IZ9A 3K58A 3GL1A 2VGMA 4CBUA 1N8RO 1HYZA 2NRTA 3LDSA 3AVHA 4FWNA 4LY7A 3MX5A 5KQ8A 2D0CA 4X65K 1BA0A 3ALYA 3VQ6A 1S3XA 4RW8A 4CEFA 3UKUA 3F9MA 2ZJQL 1YITN 3O08A 4RW7A 4CK1A 1BGXT 1NLVA 5CZ1A 3ZSRA 2D4WA 3DRSA 5AQLA 4ZTFA 3PO5A 4CF8A 4E0DA 4FWQA 3VQ4A 1IG8A 3QEVA 4DLGA 4YY3K 2O8BB 5AR0A 3L3VA 3VF2A 3CC7N 2KQ2A 4FJGA 4M3UA 2QI2A 4EHUA 3RRGA 1J53A 5HOOA 1RDBA 2VQEK 4CZHA 1MA9B 2ATQA 4DSEA 2VWJA 4IG3A 1RTHA 5SZTA 4CHYA 4PHTX 5C10A 3NF7A 1RFQA 1NJIO 1L5UA 2QWPA 4QS8A 1GLCG 2OTLN 4DCHA 1RTIA 2I7PA 4FCYA 4PWDA 4J2EA 4DQ8A 4AHCA 5EOYA 5LJVA 4DF4A 4H0OA 3SZ2A 2A6AA 3RR8A 3DOKA 4KKOA 2Y1JA 1VSEA 2X78A 1IV0A 3VA0A 3NF9A 2P9SA 3KK1A 4LD0A 4CD1A 4ICLA 3SV3A 2HHWA 4H0XB 2Q0UA 2IVPA 4AHVA 3G10A 3KJVA 3VQ9A 4FJ7A 3VEVA 1RTDA 1RILA 4FZYA 1BI4A 4A5AA 1E4GT 2G8KA 4E1MA 4FLUA 3ZCMA 5JVHL 3CFPA 4O5BA 4FWOA 3L4IA 4O44A 1L3TA 2ZJPL 2YHWA 2HHUA 1VQ7N 4RG8A 1KD1O 2PBDA 4WQ5A 4W5QA 1ESVA 1NKEA 1K8AO 4FJLA 5LMUK 1TKTA 1QZ6A 1BHLA 3FFKB 4AHTA 4CJ3A 2HMIA 1DLOA 2YJFA 4CJQA 3HT3A 2QTDA 3PX4A 1FXXA 2NRHA 4CIFA 3P31A 5FPNA 2F9WA 1QZ5A 2FBXA 2IVNA 3G4SN 4YOYA 1VHXA 1TVRA 4BQZA 3SAHA 1K8KA 4GV6A 3QMLA 4M3RA 3OS1A 4DTNA 3ENOA 2F8TA 3ZETB 1SQKA 2E2NA 5E41A 1QVGM 2X6NA 5AQYA 4DV3K 2NUBA 2ASPA 1VSIA 5FPMA 1QS4A 4PL7A 3KK3A 3L2QA 3VQAA 2IS3A 1HMVA 4DTXA 3G6EN 2IC3A 2EHGA 2HB5A 4BRLA 5F1XA 5AQJA 4DV4K 2D0BA 2ZE2A 1W2BM 1BIUA 3BZKA 4DTMA 1W9HA 4BDYA 3T1YK 2HBMA 4JD2B 3CCVN 2ZD1A 2HF4A 3DLEA 4CZLA 4H5TA 1TKXA 3WNFA 4BEBA 4FWMA 4OJRA 2HF3A 4I2PA 4CJSA 4B1YB 4XH1A 4CESA 3VTHA 1RT2A 1U04A 3BF1A 4CD3A 3OHRA 4H0PA 4CIGA 1NK9A 1XNQK 1GOAA 2V7YA 1HQUA 4ISGA 1S22A 4CZIA 2OPPA 1M90O 3CJ7A 3DLLL 4C8KA 5ADXH 5FRMA 1RBRA 4I6MA 4M63C 4CEQA 3UKUB 4QS7A 3WNEA 4B9SA 1T3VA 1YJNN 1GLDG 2BTFA 1VQKN 1WN7A 4CJRA 5J2MA 5CYMA 3CD6N 1TGOA 2DPNA 4ISEA 3QNNA 4DR4K 4CVNE 2GX9A 4NCAA 4OKKA 3OTOK 3MK6A 3O4QA 4CHOA 4BR2A 2W40A 5K14A 3AGRA 5E84A 3QEWA 2P1JA 1CZ9A 4JI1K 4BE7B 3SCXA 1FJGK 4WYBA 4O4GA 2OPQA 4BWJA 4AILC 3DI6A 1I39A 5AZIA 3OJSA 3TSUA 3I8DA 4EP4A 1EETA 2GELA 5KI6A 3SQ4A 1KTQA 3AA5X 4YHHK 1QHAA 4HUEA 1CXUA 3HO1A 4YFUA 3CFRA 2KHOA 5JLHA 2W00A 3FR0A 3PIPL 4DR2K 1M1KO 3QESA 1XHXA 1W0HA 3TARA 2GWKA 4YOWA 3C6AA 2FLOA 2ZQBA 4I2QA 4OVLA 3K9JA 3MX2A 3K5NA 2D5RA 2P9SB 4BRPA 4M45A 5BR9A 3TAGA 4C8OA 4E89A 3CC2N 3KWGA 2HHXA 3L6QA 3OA9A 3DWLA 3VEXA 4B9MA 1BQMA 2YCHA 3MXJA 5MLCQ 1BI4B 4WFNL 2G8WA 4CK2A 4BGAA 3WEEA 2CH6A 2QKKA 3QERA 4CHPA 1VQ5N 2WC9A 1WSGA 5IT9O 3MECA 4CIEA 3S41A 5M1NA 3QIOA 1KAZA 3DOLA 3PX0A 4BR4A 3SUOA 5DM6L 5LMNK 4FK2A 2HOEA 4LF9K 4BGBA 3WQTA 3GE1A 1HKCA 3OBYA 5M1OA 1Y64A 1F21A 5AQHA 2BE2A 3SJJA 4CF1A 4MLHA 4O0IA 4C8MA 3WXIA 3O80A 3Q7CA 4JKBA 3A5OC 1B9DA 3AVGA 4LF4K 4RTFD 2Q3SA 3RMCA 1O1WA 2ZGZA 5EVZA 4Q0BA 4DS5A 2FF3B 2VG7A 4NO7A 3SAGA 1C6VA 2FC0A 2LSNA 3NF6A 1LAWA 1G15A 2O8FA 3TAFA 4FLYA 3OYDA 3HVRA 1G99A 3AGKA 3DYAA 4AHRA 2IDOA 4M3YA 1ZBLA 4A62A 3ZT4A 4H4MA 4DF8A 4FJXA 1BQNA 1U45A 4DFPA 4I9LA 2QK9A 2E2QA 1X9WA 4CJPA 1S1TA 2FF6A 3NH1A 3TTFA 5KRTA 3WT0A 4LFBK 1EWQA 4DFMA 3C0BA 1VK0A 3SBGA 2G8UA 1REVA 3IS9A 3VTIA 3OYEA 1LWCA 4CZFA 3AO1A 2YHBA 2Q0RA 3LDPA 4M3XA 1RBTA 2YJEA 3QEIA 1WBBA 1XMQK 4DR6K 3V9ZA 5HLFA 4EHTA 1VQ9N 3QLHA 4BROA 3MN7A 1VQMN 1JJ2M 2PAVA 2BDPA 2P9LB 4FO0A 5I3UA 4I6MB 5FDLA 3CCEN 4PUOA 1HPZA 3TTDA 3HXMA 5BPNA 2YNFA 1VQ8N 3JAMO 4Z4GA 1C0FA 4JN4A 2XY5A 1A5WA 4Y0WA 4JI7K 4M3ZA 2FSNA 4FWSA 1Z05A 3THYA 3GBTA 4CFAA 3NF8A 4L3QA 3IG1A 1FKPA 3AVLA 3N4QA 4B9TA 4W5RA 3L2UA 2JGUA 3CQYA 5C12A 2CGJA 3OS0A 5HP1A 4O5FA 3G71N 5D3GA 3E9PA 3VQ5A 3O9TA 3M6GA 2Q1NA 3K5MA 4K25A 1ILYA 3FFIA 4CJUA 3PIOL 1VSJA 3FZLA 3ZSQA 5I42A 2DY4A 2P9PA 5EY4A 1CZBA 4OLAA 1LWFA 2AA4A 4FJNA 1XWLA 4AM7A 3P83D 4CBWA 3WXLA 1X9MA 4BVOA 2HBKA 4AHUA 3WUHA 4DTJA 4TSXA 3ZSVA 4B3TK 3M8RA 4A2BA 3K59A 2P5GA 4OKEA 4DR3K 5CY4A 2G8VA 4DSJA 4MO5A 3I55N 4BRQA 1ATSA 1N6QA 1UA0A 3ZYYX 3AO5A 3CFOA 3HM8A 2HHQA 3WEEB 5GIPA 5C24A 2JWKA 3VQCA 3UB5A 3O3GA 3CJBA 1HNVA 1J9AA 4YORA 2XY6A 4NXNK 3QEPA 4R79A 4FWKA 3I8BA 3LP3A 3EY1A 2A5XA 4IXCA 1NK6A 4NYNA 1BWFO 3K9KA 1ASUA 1TUUA 1JLQA 3S5TA 2NRXA 3N4PA 4DV5K 5TKWA 2HVIA 3V6DA 5AQVA 2DFHA 1NK0A 3P38A 3P5JA 1FKOA 4DB3A 4B3MK 1WSFA 3IDHA 3AVKA 1S6QA 4FL9A 5CYQA 5EX5A 4X62K 4GNIA 4BRDA 4CJLA 5HBMA 1VSFA 3DRRA 1U49A 4DQSA 4O8UA 4H4OA 4JNEA 3AVMA 3HOTA 2A40A 3UKRA 1JCGA 1IO2A 3DRPA 1WSIA 4QAGA 3MWPA 4HWIA 5GADP 2O8FB 4KHSA 4WQ4C 4BRGA 3NHGA 3HPGA 5AQRA 3O5BA 3I0RA 1NGIA 4FVUA 4FJ5A 1SKRA 3R9PA 3SMSA 3OYKA 1QHTA 3J7YP 2F8SA 4F3OA 3O4WA 1KCFA 2ASOA 3O1WA 4H5WA 4F4KA 5KQDA 1SL0A 4B9VA 1KVCA 4NCGA 1NU0A 4K8XA 3H1VX 2FSKA 5F2RA 3VEWA 4CZEA 3KZBA 4KTZA 4DTSA 1UAXA 4DV1K 1D8YA 4FWRA 5AQUA 3EO3A 3ZEUA 4KV8A 4H0YB 1LAVA 3NGZA 4Z4FA 1NGDA 1UOCA 2D1KA 3L2RA 1E4FT 1Q9XA 4ELUA 4JKAA 3U6FA 4FYDA 3OVNA 3MEGA 3RVCA 4XEIA 1GLFO 4DSLA 4IJNA 4XH4A 5AQFA 3E66A 3CCQN 1QSSA 4EIAA 4YNQA 2XY8A 4X66K 4Z4HA 5AQZA 1MWKA 4LF8K 4O55A 1HYVA 1YI2N 3DLRA 1A5VA 3THYB 2WBNA 3M1FA 4JI3K 1UWBA 4IO9L 3DM2A 3AVCA 3HRGA 4CEBA 2F9TA 2A1SA 3T7ZA 4KFBA 5J2QA 4NLCA 3G25A 4LH4A 4K0KK 4H03B 3C6UA 2JLEA 2KTQA 2RF2A 1T44A 2NLXA 4B9UA 1RGIA 1VSDA 4MDAA 3CM6A 4CEZA 5AQPA 3LP2A 3NCIA 2O8CA 3DXMA 2P9PB 2IGIA 4FJKA 2C1GA 3W0LA 5BR8K 3WXJA 5AJ3K 1VQPN 1Z25A 4KHNA 3MDQA 2UYTA 3ZT0A 1NK5A 3AVFA 3H46O 3MEEA 3VF6A 3BGRA 2E5LK 3CQXA 3OBWA 2UUCK 1NG9A 2XY7A 4DR1K 1P8ZA 2RHKA 1ZBUA 4CF0A 4YOXA 5CZ2A 1VRTA 4CJEA 3NGIA 1LCUA 4M3TA 3TR8A 3L2VA 3MWTA 4Q5VA 3SI6A 4U7BA 5LJWA 4M42A 4JKEA 4CZJA 2WOMA 4BREA 3V9UA 2QWLA 3RTVA 3AO2A 1BIZA 2QXFA 2G8HA 5FPDA 4F8RA 3TANA 4B1VA 2E4LA 3BP8A 2QWMA 1WAFA 5AQTA 3V1RA 5M1FA 4BE0A 1VAZA 3VGKA 4GV3A 4EZ9A 3V9SA 4OPKA 4HHTA 4F2SA 2A3ZA 4DSIA 3DLHA 1JLEA 4KO0A 3CG7A 3QIPA 1QSLA 5M1QA 1NGBA 4W5OA 3AA4A 1JLBA 2V52B 4DQPA 2ASMA 5AQKA 3SMPA 2NNWA 5F0XA 3FLCO 1Q81O 3E01A 2ZM6K 3VQ8A 3UKRB 3KLFA 1Q18A 3V1QA 2KFZA 4IJAA 4DV2K 4JKDA 4CJTA 5FRNA 4AF1A 4JI2K 4H0VB 3TTCA 1SL1A 3OW2M 1C0MA 2ZWHA 4F3TA 5BREA 1C1AA 4OLBA 3HJFA 3K0SA 4K42A 4BRKA 4FLXA 4DQRA 1NOYA 4C8LA 3O9QA 2OANA 4CJ7A 3PLAA 1GLAG 2AP1A 5TKYA 2YNIA 3EL2A 1YIJN 4MO4A 1KLNA 3HM9A 1BA1A 1NJXA 5AQOA 3VEOA 3O9SA 4H0TB 1R0AA 4ILJA 3OYCA 3TAPA 1QTMA 1WOQA 1GLJO 4BRNA 1Q9YA 3HOSA 3ZEUB 2O8DA 2YKNA 3FE1A 2H3GX 1C0UA 1S5JA 3KIOA 1RDAA 2OTJN 3EKUA 3SLCA 3HZ6A 4EZ6A 4FXDA 3EZ5A 4CHNA 2P9LA 1TK8A 4JHDA 5AQXA 3OYLA 1KXPA 4CGFA 3B8AX 3D7EO 3CETA 3U9DA 2WTUA 2ZGYA 3AVBA 3TAQA 5JVGL 4YOVA 2KZMA 2J4RA 2GEMA 2P9UA 4DU4A 1NMDA 2Y1IA 1YXQA 5LY3A 4KBOA 4WE1A 3VQBA 1WUAA 3H08A 4MFBA 3NE6A 4FVMA 1KFDA 3SQ1A 1TAUA 3VENA 3VETA 4IFEA 2HNDA 2VYPA 3TABA 4CFCA 2GBZA 4FLTA 3E9LA 2V7ZA 4BC2A 4CHQA 3ZT2A 5KPRA 3VQDA 1JL2A 3R8EA 1SV5A 4PKHA 3DXMB 4ID1A 4CZGA 4DQQA 3CF5L 2O8CB 4A5BA 3IUCA 3CJAA 1QQCA 4BR5A 3C6HA 2KKZA 3V9XA 3HTVA 3O6WA 2G8IA 1QQOA 5J1EA 2RE2A 5E26A 4BRIA 3NDKA 1QSYA 4FK0A 2HHSA 2QXLA 1NM1A 4JKGB 4KHPK 2Z1IA 2HHIA 2B6AA 5M1PA 3EE8A 4CEAA 3LM9A 3PSFA 1DTQA 3VA3A 1BISA 2XO7A 2B5JA 1YVNA 3AVNA 3KD1E 5FLXO 4BACA 3LDOA 1RBUA 4JK8A 4IDKA 4FWPA 2UXCK 1NGEA 1SUQA 5BRDA 4PL8A 4CZMA 4H5RA 4AM6A 3B6PA 3T19A 2ZF5O 1IG9A 2VWKA 3WNGA 1RDDA 4B3OA 1LV5A 4GV9A 3CXCM 3SPZA 2KFNA 3T69A 1IKVA 2HBJA 1XC9A 4ID5A 5CE3A 4CE9A 2YX6A 3B6OA 4AHSA 3CPWM 1B92A 1NKBA 2GUPA 1ZBHA 3AVJA 4E72A 1MWMA 4EAHD 1DKGD 3LM2A 2QWNA 3QO9A 3OY9A 4EP5A 2OCEA 4AH9A 4JRPA 3BUZB 1BOTO 4CF9A 4BC4A 4KI4A 2Z1JA 3KLIA 5EU7A 3O3HA 3L8BA 3BEXA 3K2PA 3P39A 3ZLJA 2IOCA 2VG5A 3ZSXA 3I33A 2YKMA 1FK9A 5AQGA 5BRFA 3ZSWA 1XC3A 4BG9A 3V81A 3RWUA 2E2OA 4JS5A 1ATRA 1Q7YO 5CR4A 3CMEN 4LFCK 3F2KA 1C1CA 2WONA 3AAPA 4CHZA 1H1VA 2HSTA 2IIRA 3QICA 4E1JA 3A8YA 3KD5E 1X9JA 1YAGA 1HUXA 4GMJB 4DU3A 4J2BA 3VOVA 4FW2A 3ID6A 1KAYA 4OPHA 4CERA 1VQ6N 4E7IA 4E7KA 1Z26A 1NK4A 4M41A 5GAEP 5EXWA 1P90A 2FBYA 4V19S 4RW4A 3PV8A 4KI6A 3FZFA 2P9KB 4JK7A 3JS6A 2YHAA 4JI8K 2BANA 1QE1A 4E19A 4FK4A 4DR5K 3KWIA 3TAMA 3HP9A 3CMAN 2O8DB 4B1XB 3M8QA 1T03A 4OO1J 1IBKK 5KPTA 3KKSA 3VESA 5C25A 2NRVA 2A42A 5KGWA 3EE9A 4JHDB 3UIQA 4YOUA 5ADXA 2D0OA 3M8PA 3HL8A 1L3SA 1KVAA 1EKEA 3KLGA 4DKWA 1OH7A 1RT5A 4PKIA 4JI5K 1WNSA 1O13A 4DV0K 3MXMA 4B1WB 2NRWA 2P9UB 3ENHA 1L3VA 1IKXA 1S9GA 1JLFA 2Q2RA 5KPZA 1NWKA 3RR7A 3PX6A 1HQEA 1KFSA 4KHWA 1BL3A 2X74A 5SWMA 1TYQA 2WUSA 2CGLA 3V9WA 4ILGB 4XJXA 4JLHA 3OYNA 1UA1A 3BDPA 1CZAN 4BDZA 1I94K 2W6KA 4IEIA 4GKJK 3CCUN 4KRFA 3IKMA 4W5TA 1NKCA 1RDCA 4E1NA 2E6LA 4DU1A 2E1YA 1J6ZA 4FJIA 3AY9A 3A5LC 3D6RA 1XMOK 2GV9A 1Z6RA 1OH5A 1T6DA 1WSHA 1VQ4N 2HMPA 4CGIA 5HRSA 4DR7K 4IFYA 2QKBA 1NGAA 2IAJA 3A5MC 4FPAA 3EYZA 3HPHA 3RRHA 3J7ZO 1IJJA 4DSFA 5CHIA 1SKSA 3HVTA 1J54A 4CFDA 4CEDA 3CJ1A 1JLCA 3CC4N 2D0PA 3RMDA 2OYQA 4NCBA 3S3MA 1BUPA 4JS4A 1D9DA 3LPTA 4JKCA 3CERA 4MDBA 4DTOA 4LSLA 4KHQA 3VQPA 1QVFM 1B9FA 4IO8A 5DK5A 4DFJA 3QNOA 3VN5A
chains in the Genus database with same CATH topology
2E2PA 5GAHP 4H5NA 5BN9A 1K8KB 4BEBA 4FWMA 1RGIA 1GLBG 2HF3A 5GINA 4B1YB 3AAQA 4XH1A 4MDAA 3VTHA 3MMVA 3MN5A 1GLLO 3BF1A 5AQPA 4CD3A 3OHRA 4H0PA 3DXMA 5HL7L 2V7YA 4ISGA 2P9PB 1S22A 4CZIA 1Q82O 3U9ZA 1D4XA 4BRCA 1KC8O 4KH4A 1M90O 3CJ7A 3DLLL 2C1GA 3CJ9A 3W0LA 4GY2B 3LDQA 3ZX3A 5ADXH 3GOIA 1EQYA 1TUYA 2PFUA 3WXJA 4KH5A 1VQPN 4I6MA 1R59O 1T6CA 2UYTA 3MDQA 4M63C 3UKUB 3ATVA 4DHYA 2YHXA 4QS7A 2VCPA 3UE5A 3CCSN 3H46O 1T3VA 1YJNN 1DT9A 1GLDG 5KQ8A 2BTFA 1VQKN 4BRAA 1LOTB 2Q31A 3VF6A 4CZKA 3CD6N 1XUPO 2DPNA 2FSJA 3CQXA 3FZMA 4ISEA 3OBWA 1SAZA 4ISFA 5GAGP 2P9NA 4IOCL 1NGJA 1KQSM 3GG4A 2GX9A 1P8ZA 3TU5A 2RHKA 4M7YA 3VERA 3MK6A 3DJCA 3M5RA 3BF3A 4BR2A 4YOXA 5DM7L 2W40A 3U4LA 1ZXOA 3AGRA 5E84A 1LCUA 2QWOA 4BE7B 3MWTA 3JXUA 4WYBA 4KH6A 5JMVA 4U7BA 2I7NA 5LJWA 5AZIA 4JKEA 4CZJA 5AFUH 3TSUA 4BREA 1V4SA 2YHYA 2QWLA 2GELA 5AQIA 5BRHA 1VQNN 1QHAA 3AARA 5FPDA 2IVOA 3F5TA 1JCEA 3WXKA 2KHOA 5AQQA 5JLHA 4IDHA 4B1VA 3ENBA 2W00A 4MLEA 3BP8A 3FR0A 2QWMA 5AQTA 5M1FA 3PIPL 3ZX2A 1M1KO 1VAZA 3TSPA 3VGKA 3EZWA 2ZJRL 4GV3A 3HI0A 1NGCA 2GWKA 4J8FA 2A3ZA 3SK3A 4YOWA 3C6AA 3R6MA 2FLOA 1NGHA 3K9JA 3MX2A 5M1QA 2QM1A 1NGBA 2BH1A 2P9SB 4BRPA 5BR9A 2V52B 3I56N 4YOTA 4OPAA 5C15A 2ASMA 4NLBA 2VGNA 3KWGA 2NNWA 5AQKA 3SMPA 3CC2N 1YF5L 2A41A 3L6QA 3OA9A 4M7XA 5F0XA 3DWLA 3FLCO 3VEXA 1Q81O 1RDUA 2YCHA 3CJCA 3UKRB 5MLCQ 4WFNL 2Q97A 1QQMA 4BRMA 1Q18A 4WQ4A 4BGAA 4A57A 3WEEA 3GDQA 2CH6A 1ZBSA 4IJAA 4JKDA 2GWJA 5AZIB 4AF1A 2Q36A 1SZ2A 1VQ5N 4G9ZA 2WC9A 4BR9A 4YDUC 3CI5A 4H0VB 3TTCA 3ID8A 3OW2M 2QW9A 3S41A 3J8AA 4B1UB 2ZWHA 3Q7BA 5M1NA 5BREA 4H5VA 1KAXA 1KAZA 2QWQA 2WFBA 4BR4A 5DM6L 3VGLA 4K42A 1NBWA 4FOEA 2VWBA 3A5NC 2HOEA 4BRKA 1TYQB 3O9QA 2OANA 4BGBA 4CJ7A 5BN8A 3PLAA 1GLAG 2AP1A 3WQTA 3TPQA 3FZHA 3GE1A 1HKCA 2QWRA 1U2VA 3D2FA 3OBYA 5M1OA 1QQNA 5TKYA 1Y64A 3EL2A 3O9RA 3O8MA 1YIJN 4MO4A 5AQHA 1HKBA 4A2AA 1BA1A 5AZJA 3CPEA 5AQOA 3VEOA 1NGFA 1X3NA 3O9SA 4H0TB 4ILJA 3SJHA 4MLHA 5BPMA 1HKGA 4WFAL 2C1IA 3FGUA 1WOQA 1GLJO 3ULEA 3WXIA 3O80A 4BRNA 3Q7CA 3HOSA 5M1KA 4WFBL 3ZEUB 3CCMN 1VQON 3FE1A 4JKBA 2H3GX 3A5OC 1HJOA 4RTFD 4JKFA 2OTJN 4XH5A 3EKUA 2V51B 3KK7A 2ZGZA 1YHQN 3SLCA 5EVZA 3SAFA 3HZ6A 2GTDA 3EKSA 4PKGA 4BQLA 2P9LA 2FF3B 5C2FA 2FXUA 2HBLA 4NO7A 1BDGA 3SAGA 2E20A 4JHDA 5AQXA 3NVKA 4YDUA 1KXPA 3RSEB 3B8AX 3CCLN 3MN9A 3D7EO 3R1XA 1G99A 3CETA 3VGMA 3U9DA 3AGKA 4JKGA 1BU6O 4K41A 1ZC6A 2ZGYA 3IFRA 3O9UA 4HTLA 5JVGL 4YOVA 4A62A 2J4RA 2GEMA 2P9IB 2P9UA 4QS9A 4B1ZA 1NMDA 5ELZA 5JICA 3FZKA 4CBXA 3CCJN 1YXQA 5LY3A 4KBOA 2E2QA 1WUAA 3DXKA 3MCAB 4EFHA 2FF6A 1K73O 4FPBA 3TTFA 3WT0A 3D2FB 3VENA 3C0BA 3VETA 3SBGA 1VQLN 3SBTA 4C1NI 4BC5A 3E9OA 4IFEA 1HLUA 3VTIA 3LDNA 2VYPA 2E8AA 3O1BA 4CZFA 2QEXN 4K43A 2Q0RA 1V4TA 3LDLA 3L0QA 3LDPA 3E9LA 2V7ZA 3VPZA 3QBWA 4FSVA 4BC2A 3EN9A 3L4QA 2YJEA 2CH5A 5B8HA 4NB4A 2E1ZA 5KPRA 4CZGA 5AQMA 3R8EA 4PKHA 3DXMB 4EHTA 3CF5L 1VQ9N 3ZETA 4A5BA 4BROA 3MN7A 3IUCA 1VQMN 1JJ2M 3CJAA 2PAVA 2P9LB 4BR5A 1C0GA 4FO0A 3C6HA 3HBTA 2KKZA 3ATUA 4I6MB 3HTVA 3O6WA 3CCEN 1QQOA 4BR0A 3TTDA 2RE2A 5E26A 4BRIA 1BO5O 5BPNA 3QFUA 4U67L 1XQSC 5AQWA 1VQ8N 2QXLA 1NM1A 3C7NA 4JKGB 1C0FA 1JCFA 4Z94A 1EO1A 4JN4A 5M1PA 4BG8A 3EE8A 1DGKN 4Y0WA 3H3NO 3LM9A 2FSNA 4FWSA 2P9NB 1Z05A 3GBTA 4L3QA 1YVNA 1U6ZA 3D2EA 3N4QA 2ITMA 3ZX0A 4F9OA 3LDOA 1SS6A 4JD2A 3CQYA 4JK8A 4FWPA 2BUPA 4IOXA 3E1YA 3A0IX 5C12A 1NGEA 5BRDA 1YJWN 4PL8A 2CGJA 4H5RA 4AM6A 4CZMA 4UY8O 4C1NK 4O5FA 4A61A 3P4IA 3G71N 3E9PA 1K9MO 2ZF5O 4B9QA 1YJ9N 4FWLA 3WQUA 3O9TA 4GV9A 3M6GA 3NVMA 3CXCM 3T69A 2Q1NA 2HBJA 3KHYA 4BRFA 4IOAL 5AFUA 4BVPA 4K25A 4IZ9A 1DEJA 2YX6A 5CE3A 1ILYA 3GL1A 3M3ZA 2VGMA 3PIOL 4C23A 4CBUA 4RWTA 3FZLA 2NRTA 1N8RO 2P9PA 5C2DA 3CPWM 2F7TA 5EY4A 4FWNA 2AA4A 2GUPA 3MX5A 4IWVA 4AM7A 1YUWA 1BA0A 1MWMA 3C65A 4EAHD 1DKGD 1S3XA 4CBWA 3WXLA 2P9KA 4IEEA 3UKUA 4BC3A 3LM2A 2QWNA 3F9MA 3C7NB 4BVOA 2HBKA 2ZJQL 3WUHA 4FOIA 4A59A 1YITN 5C0YA 3O08A 3BUZB 1BOTO 3HSCA 4A2BA 4BC4A 1NLVA 3WXMB 3BEXA 3P39A 5AQSA 4WF9L 3KVGA 2D4WA 5AQLA 4BY9C 3I33A 4FWQA 5FPEA 3VEZA 1IG8A 3D2EB 5AQGA 5BRFA 4MO5A 4O8KA 3I55N 5AR0A 1XC3A 3VF2A 1ATSA 4BG9A 4BRQA 3CC7N 3ZYYX 2E2OA 1ATRA 1Q7YO 5CR4A 3CMEN 3HM8A 2QI2A 3F2KA 3AAPA 4EHUA 1H1VA 3WEEB 5GIPA 2HSTA 2IIRA 3QICA 1MA9B 2JWKA 4CZHA 5HOOA 3UB5A 4E1JA 3CJBA 3A8YA 4YORA 4JAXA 1X9JA 1YAGA 1HUXA 4R79A 4FWKA 3I8BA 3VOVA 4PHTX 2A5XA 5C10A 3ID6A 2E88A 4IXCA 4BECA 3QBXA 1KAYA 1RFQA 4OPHA 3VMFB 1NJIO 1BWFO 3K9KA 1TUUA 2QWPA 1VQ6N 1MDUB 4QS8A 2NRXA 3N4PA 5TKWA 4WQ5C 5GAEP 1GLCG 5AQVA 2OTLN 5EXWA 1P90A 3CHWA 3LL3A 4DCHA 2I7PA 3P38A 4DQ8A 3H45C 1RDWX 2P9KB 1U2VB 3FZFA 4JK7A 3W3DA 3JS6A 4DB3A 1X3MA 3IDHA 3VEYA 5EOYA 5LJVA 5AZJB 4FL9A 4H0OA 2A6AA 5EX5A 4GNIA 2W41A 4BRDA 3KWIA 3H6EA 3CMAN 3ULEB 2P9SA 4CD1A 4B1XB 3H3OB 4H0XB 4JEPA 2Q0UA 4O8UA 4OO1J 4BRHA 2IVPA 5KPTA 3VESA 4JNEA 3QFPA 3DAWA 3VEVA 3HOTA 2NRVA 2A42A 2A40A 3UKRA 1JCGA 4A5AA 1E4GT 3EE9A 1Q86O 3MWPA 4JHDB 4HWIA 3MCPA 4YOUA 5GADP 5JVHL 4FWOA 5ADXA 4WQ4C 2D0OA 4BRGA 3L4IA 3CIPA 2ZJPL 2YHWA 5AQRA 3O5BA 4DKWA 4PKIA 1VQ7N 1NGIA 1O13A 5I9EB 4FVUA 1KD1O 2PBDA 4WQ5A 2NRWA 1ESVA 4B1WB 3R9PA 1K8AO 2P9UB 3SMSA 2NRRA 3ENHA 1ATNA 2Q2RA 3MN6A 3H1QA 3U8XA 5KPZA 1QZ6A 3QDKA 1NWKA 3FFKB 4ILHA 3DXKB 2YJFA 3O4WA 3O1WA 2ASOA 1TYQA 2WUSA 4H5WA 2QTDA 2CGLA 5KQDA 4ILGB 4XJXA 2NRHA 4JKHA 3NMUA 1CZAN 3H1VX 2EWSA 3P31A 2FSKA 3IMXA 5F2RA 5FPNA 2F9WA 3VEWA 4CZEA 1QZ5A 2IVNA 3KZBA 4IEIA 4YOYA 3G4SN 3CCUN 4BQZA 3IKMA 3SAHA 5H1SQ 1K8KA 3R3LA 2KLAA 1W97L 4GV6A 3QMLA 4FWRA 5AQUA 1BG3A 3EO3A 3ZEUA 4H0YB 3ENOA 2E1YA 4WCEL 1J6ZA 2NZTA 4LC9B 1NGDA 1SQKA 3A5LC 3AY9A 3D6RA 3ZETB 5GIOA 2E2NA 2D1KA 1QVGM 1Z6RA 1E4FT 5AQYA 1T6DA 4JKAA 2ASPA 1VQ4N 2HMPA 5BPLA 3RVCA 5JLFA 3QB0A 4XEIA 5FPMA 1GLFO 4PL7A 1GLEG 4IJNA 1NGAA 4XH4A 1OVYA 5AQFA 3RSEA 3E66A 3A5MC 3CCQN 4FPAA 2YI1A 1NGGA 4EIAA 3J7ZO 1IJJA 3G6EN 5F1XA 4BRLA 5AQZA 1MWKA 5AQJA 3TSQA 2JWLA 5CHIA 1YI2N 1W2BM 2P9IA 2QA4N 1HPMA 4RCHA 4BR7A 3CJ1A 2WBNA 3M1FA 2HBMA 1OKJA 3CC4N 4IO9L 2D0PA 3VF4A 3HRGA 1S72N 2F9TA 3T7ZA 2NRZA 4JD2B 1BUPA 4NLCA 4CI6A 3CCVN 4GVEA 3G25A 3CERA 4JKCA 4MDBA 1HX1A 1QVFM 2CGKA 2HF4A 4H03B 4IO8A 5AQNA 4CZLA 3CCRN 1T44A 4H5TA 2NLXA 4JK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2P A;  4H5N A;  5BN9 A;  1K8K B;  4FWM A;  1RGI A;  1GLB G;  2HF3 A;  4B1Y B;  3AAQ A;  4XH1 A;  3MMV A;  3MN5 A;  1GLL O;  3BF1 A;  5AQP A;  4CD3 A;  3OHR A;  4H0P A;  3DXM A;  2V7Y A;  4ISG A;  2P9P B;  1S22 A;  4CZI A;  3U9Z A;  1D4X A;  4BRC A;  3CJ7 A;  3CJ9 A;  3W0L A;  4GY2 B;  3LDQ A;  3ZX3 A;  5ADX H;  3GOI A;  1EQY A;  1TUY A;  3WXJ A;  4I6M A;  1R59 O;  1T6C A;  2UYT A;  3MDQ A;  4M63 C;  3UKU B;  3ATV A;  4DHY A;  2YHX A;  4QS7 A;  2VCP A;  3UE5 A;  3H46 O;  1GLD G;  2BTF A;  4BRA A;  1LOT B;  2Q31 A;  3VF6 A;  4CZK A;  1XUP O;  2DPN A;  2FSJ A;  3CQX A;  3FZM A;  4ISE A;  1SAZ A;  4ISF A;  2P9N A;  1NGJ A;  3GG4 A;  1P8Z A;  3TU5 A;  4M7Y A;  3VER A;  3MK6 A;  3DJC A;  3BF3 A;  4BR2 A;  2W40 A;  3U4L A;  1ZXO A;  5E84 A;  1LCU A;  2QWO A;  3JXU A;  4WYB A;  5JMV A;  2I7N A;  5LJW A;  5AZI A;  4CZJ A;  5AFU H;  4BRE A;  1V4S A;  2YHY A;  2QWL A;  2GEL A;  5AQI A;  5BRH A;  1QHA A;  3AAR A;  5FPD A;  2IVO A;  1JCE A;  3WXK A;  2KHO A;  5AQQ A;  5JLH A;  4B1V A;  4MLE A;  3BP8 A;  3FR0 A;  2QWM A;  5AQT A;  3ZX2 A;  3VGK A;  3EZW A;  3HI0 A;  1NGC A;  2GWK A;  4J8F A;  2A3Z A;  3SK3 A;  3R6M A;  2FLO A;  1NGH A;  2QM1 A;  1NGB A;  2P9S B;  4BRP A;  5BR9 A;  2V52 B;  2ASM A;  5AQK A;  3SMP A;  2A41 A;  3L6Q A;  4M7X A;  5F0X A;  3DWL A;  3FLC O;  3VEX A;  2YCH A;  3CJC A;  3UKR B;  2Q97 A;  1QQM A;  4BRM A;  1Q18 A;  4WQ4 A;  4BGA A;  3WEE A;  3GDQ A;  2CH6 A;  1ZBS A;  4IJA A;  2GWJ A;  5AZI B;  2Q36 A;  1SZ2 A;  4BR9 A;  4YDU C;  3CI5 A;  4H0V B;  3ID8 A;  2QW9 A;  3S41 A;  3J8A A;  4B1U B;  2ZWH A;  5BRE A;  4H5V A;  1KAX A;  1KAZ A;  2QWQ A;  4BR4 A;  3VGL A;  4K42 A;  1NBW A;  4FOE A;  2VWB A;  3A5N C;  2HOE A;  4BRK A;  1TYQ B;  2OAN A;  4BGB A;  4CJ7 A;  5BN8 A;  1GLA G;  2AP1 A;  3WQT A;  3TPQ A;  3FZH A;  3GE1 A;  1HKC A;  3D2F A;  1U2V A;  2QWR A;  5TKY A;  1QQN A;  1Y64 A;  3EL2 A;  3O8M A;  4MO4 A;  5AQH A;  1HKB A;  4A2A A;  1BA1 A;  5AZJ A;  5AQO A;  3VEO A;  1NGF A;  1X3N A;  4H0T B;  3SJH A;  4MLH A;  5BPM A;  1HKG A;  3FGU A;  1WOQ A;  1GLJ O;  3ULE A;  3WXI A;  3O80 A;  4BRN A;  3ZEU B;  3FE1 A;  2H3G X;  3A5O C;  1HJO A;  4RTF D;  4XH5 A;  3EKU A;  2V51 B;  2ZGZ A;  3SLC A;  5EVZ A;  3HZ6 A;  2GTD A;  3EKS A;  4PKG A;  4BQL A;  2P9L A;  2FF3 B;  2FXU A;  4NO7 A;  1BDG A;  2E20 A;  4JHD A;  5AQX A;  4YDU A;  1KXP A;  3RSE B;  3B8A X;  3MN9 A;  3D7E O;  1G99 A;  3CET A;  3VGM A;  3U9D A;  1BU6 O;  4K41 A;  1ZC6 A;  2ZGY A;  3IFR A;  4HTL A;  4A62 A;  2J4R A;  2GEM A;  2P9I B;  2P9U A;  4QS9 A;  4B1Z A;  1NMD A;  5ELZ A;  5JIC A;  3FZK A;  4CBX A;  1YXQ A;  5LY3 A;  4KBO A;  2E2Q A;  1WUA A;  3DXK A;  4EFH A;  2FF6 A;  4FPB A;  3WT0 A;  3D2F B;  3VEN A;  3C0B A;  3VET A;  4BC5 A;  1HLU A;  3LDN A;  2VYP A;  2E8A A;  3O1B A;  4CZF A;  4K43 A;  2Q0R A;  1V4T A;  3LDL A;  3L0Q A;  3LDP A;  2V7Z A;  3VPZ A;  3QBW A;  4FSV A;  4BC2 A;  3EN9 A;  2YJE A;  2CH5 A;  5B8H A;  4NB4 A;  2E1Z A;  5KPR A;  4CZG A;  5AQM A;  3R8E A;  4PKH A;  3DXM B;  4EHT A;  3ZET A;  4BRO A;  3MN7 A;  3IUC A;  3CJA A;  2PAV A;  2P9L B;  4BR5 A;  1C0G A;  4FO0 A;  3HBT A;  4I6M B;  3ATU A;  3HTV A;  3O6W A;  1QQO A;  4BR0 A;  5E26 A;  4BRI A;  5BPN A;  1BO5 O;  3QFU A;  1XQS C;  5AQW A;  2QXL A;  3C7N A;  1NM1 A;  1C0F A;  1JCF A;  4Z94 A;  4JN4 A;  4BG8 A;  1DGK N;  4Y0W A;  3H3N O;  3LM9 A;  2FSN A;  4FWS A;  2P9N B;  1Z05 A;  3GBT A;  4L3Q A;  1YVN A;  1U6Z A;  3D2E A;  2ITM A;  3ZX0 A;  4F9O A;  3LDO A;  4JD2 A;  3CQY A;  4FWP A;  2BUP A;  3A0I X;  1NGE A;  5BRD A;  4PL8 A;  2CGJ A;  4H5R A;  4AM6 A;  4CZM A;  4O5F A;  4A61 A;  3P4I A;  2ZF5 O;  4B9Q A;  4FWL A;  3WQU A;  3M6G A;  2Q1N A;  3KHY A;  4BRF A;  5AFU A;  4BVP A;  4K25 A;  4IZ9 A;  1DEJ A;  5CE3 A;  3GL1 A;  3M3Z A;  4C23 A;  4CBU A;  4RWT A;  3FZL A;  2P9P A;  5EY4 A;  4FWN A;  2AA4 A;  2GUP A;  4IWV A;  5KQ8 A;  4AM7 A;  1YUW A;  1BA0 A;  1MWM A;  4EAH D;  1DKG D;  1S3X A;  4CBW A;  3WXL A;  2P9K A;  3UKU A;  4BC3 A;  3LM2 A;  2QWN A;  3F9M A;  3C7N B;  4BVO A;  3WUH A;  4FOI A;  3O08 A;  3BUZ B;  1BOT O;  3HSC A;  4A2B A;  4BC4 A;  1NLV A;  3BEX A;  5AQS A;  3KVG A;  2D4W A;  5AQL A;  3I33 A;  4FWQ A;  5FPE A;  3VEZ A;  1IG8 A;  3D2E B;  5AQG A;  5BRF A;  4MO5 A;  4O8K A;  5AR0 A;  1XC3 A;  3VF2 A;  1ATS A;  4BG9 A;  4BRQ A;  2E2O A;  1ATR A;  3HM8 A;  3AAP A;  4EHU A;  1H1V A;  3WEE B;  3QIC A;  2IIR A;  4CZH A;  1MA9 B;  3UB5 A;  4E1J A;  3CJB A;  3A8Y A;  4JAX A;  1X9J A;  1YAG A;  1HUX A;  4FWK A;  3I8B A;  3VOV A;  2A5X A;  2E88 A;  4IXC A;  3QBX A;  1KAY A;  1RFQ A;  1BWF O;  1TUU A;  2QWP A;  1MDU B;  4QS8 A;  4WQ5 C;  1GLC G;  5AQV A;  5EXW A;  3CHW A;  3LL3 A;  4DCH A;  2I7P A;  4DQ8 A;  3H45 C;  1RDW X;  2P9K B;  1U2V B;  3FZF A;  3W3D A;  4DB3 A;  3JS6 A;  1X3M A;  3IDH A;  3VEY A;  5EOY A;  5LJV A;  5AZJ B;  4FL9 A;  4H0O A;  2A6A A;  5EX5 A;  4GNI A;  2W41 A;  4BRD A;  3H6E A;  3ULE B;  2P9S A;  4CD1 A;  4B1X B;  3H3O B;  4H0X B;  2Q0U A;  4BRH A;  2IVP A;  5KPT A;  3VES A;  4JNE A;  3QFP A;  3DAW A;  3VEV A;  2A42 A;  2A40 A;  3UKR A;  1JCG A;  1E4G T;  4JHD B;  4HWI A;  3MCP A;  4FWO A;  5ADX A;  4WQ4 C;  2D0O A;  4BRG A;  3L4I A;  3CIP A;  2YHW A;  5AQR A;  3O5B A;  4PKI A;  1NGI A;  5I9E B;  2PBD A;  4WQ5 A;  4B1W B;  1ESV A;  3R9P A;  2P9U B;  3SMS A;  3ENH A;  1ATN A;  2Q2R A;  3MN6 A;  3H1Q A;  3U8X A;  5KPZ A;  1QZ6 A;  3QDK A;  1NWK A;  3FFK B;  3DXK B;  2YJF A;  3O4W A;  3O1W A;  2ASO A;  1TYQ A;  2WUS A;  4H5W A;  2CGL A;  5KQD A;  2NRH A;  1CZA N;  3H1V X;  2EWS A;  2FSK A;  3IMX A;  5F2R A;  5FPN A;  2F9W A;  3VEW A;  4CZE A;  1QZ5 A;  2IVN A;  3KZB A;  4BQZ A;  1K8K A;  3QML A;  4FWR A;  5AQU A;  1BG3 A;  3EO3 A;  3ZEU A;  4H0Y B;  3ENO A;  2E1Y A;  1J6Z A;  2NZT A;  4LC9 B;  1NGD A;  1SQK A;  3A5L C;  3AY9 A;  3ZET B;  2E2N A;  2D1K A;  1Z6R A;  1E4F T;  5AQY A;  1T6D A;  2ASP A;  2HMP A;  5BPL A;  5JLF A;  3QB0 A;  4XEI A;  5FPM A;  1GLF O;  4PL7 A;  1GLE G;  4IJN A;  1NGA A;  4XH4 A;  3RSE A;  5AQF A;  3A5M C;  4FPA A;  2YI1 A;  1NGG A;  4EIA A;  1IJJ A;  5F1X A;  4BRL A;  5AQZ A;  1MWK A;  5AQJ A;  2P9I A;  1HPM A;  4RCH A;  4BR7 A;  3CJ1 A;  3M1F A;  1OKJ A;  2D0P A;  3VF4 A;  2F9T A;  4CI6 A;  4JD2 B;  1BUP A;  3G25 A;  3CER A;  1HX1 A;  2CGK A;  2HF4 A;  4H03 B;  4IO8 A;  5AQN A;  4CZL A;  1T44 A;  4H5T A;  2NLX A; 
#chains in the Genus database with same CATH topology
 2YNG A;  4LFA K;  5GIN A;  3KTQ A;  5KGX A;  3OYB A;  4ELV A;  5HL7 L;  4DSK A;  1KC8 O;  1D4X A;  4BRC A;  4DMN A;  3CJ9 A;  4GY2 B;  3LDQ A;  3ZT1 A;  1U47 A;  1N34 K;  3ZX3 A;  4BE2 A;  3GOI A;  1TUY A;  1RTJ A;  3SUN A;  3ATV A;  3J80 O;  1RT7 A;  2YHX A;  2VCP A;  1X9S A;  4B3S K;  4KTQ A;  4BRA A;  1YTA A;  1T8E A;  2Q31 A;  3NGY A;  4CFB A;  2W42 A;  2FSJ A;  3FZM A;  3K57 A;  3LZJ A;  1OH6 A;  2PY5 A;  4ISF A;  1JLG A;  2P9N A;  1YTU A;  1NGJ A;  3GG4 A;  3VER A;  3AO4 A;  3M5R A;  3U4L A;  2QWO A;  3CM5 A;  4OGC A;  4E7L A;  2XHB A;  3HK2 A;  2UUA K;  3EEQ A;  5AFU H;  3S3N A;  1V4S A;  2YHY A;  2YNH A;  2ITG A;  5AQI A;  3DLB A;  3OYA A;  4DWI A;  1GOB A;  3F5T A;  1HNZ K;  1JCE A;  5J2P A;  4BWM A;  3QET A;  4BE1 A;  4IDH A;  1NK7 A;  4MLE A;  4Z4E A;  3U3G A;  1HJR A;  2ZJR L;  3EZW A;  1IKY A;  1VSK A;  4J8F A;  2O4G A;  3R6M A;  1JLA A;  1NGH A;  3SQ0 A;  3LAL A;  2KZZ A;  4YOT A;  4CEC A;  4OPA A;  4CJW A;  5LL6 Z;  1IKW A;  5C15 A;  4CJ4 A;  4NLB A;  2VGN A;  3L3U A;  3JYT A;  3K5L A;  4N41 A;  2A41 A;  2OA8 A;  4M7X A;  2HHV A;  2OZS A;  4E7J A;  1RT4 A;  1QQM A;  4BRM A;  3ZT3 A;  4DTP A;  1VRU A;  3GDQ A;  1ZBS A;  4PA1 A;  1YVU A;  2GWJ A;  3SQ2 A;  4RW6 A;  2RKI A;  2Q36 A;  3LAM A;  4G1Q A;  4B8C A;  1ZBF A;  4GVM A;  1T7P A;  4G9Z A;  4KRE A;  4BR9 A;  4YDU C;  3CI5 A;  1JL1 A;  5JEN A;  4N5S A;  1TL3 A;  3J8A A;  4CF2 A;  4B1U B;  1J5O A;  3Q7B A;  3LZI A;  4OKJ A;  1HR0 K;  1EXQ A;  3C95 A;  3SV4 A;  2O8E A;  1KAX A;  3NAE A;  3IRX A;  1GOC A;  3VGL A;  1NBW A;  4FOE A;  1TYQ B;  1TL1 A;  3FZH A;  4AQY K;  3HST B;  1U2V A;  1HNI A;  3SUP A;  2F4V K;  4UQG A;  4CJK A;  3SPY A;  3O9R A;  3O8M A;  3OJU A;  5AZJ A;  1NGF A;  5BPM A;  1HKG A;  3G0Z A;  2OZM A;  1EP4 A;  3FGU A;  3ULE A;  4Y1C A;  5M1K A;  1HYS A;  5C42 A;  4LF5 K;  4IBN A;  4XH5 A;  3BY5 A;  1KRP A;  3EKS A;  2O4I A;  4PKG A;  4BQL A;  3C94 A;  3KLH A;  2HBL A;  1BDG A;  2HVH A;  4IG0 A;  4FM2 A;  4B3R K;  3MN9 A;  4JK9 A;  1N32 K;  4FJH A;  4JI4 K;  4FLW A;  3PUF A;  1JXE A;  4JKG A;  3O9U A;  4QS9 A;  4B1Z A;  4W5N A;  5ELZ A;  5JIC A;  3FZK A;  4CBX A;  4HUG A;  4ZHR A;  3DXK A;  3MCA B;  4EFH A;  3D2F B;  2HNY A;  4BDP A;  1XHZ A;  1RT3 A;  4BC5 A;  3E9O A;  2P5O A;  3AV9 A;  1HNW K;  1HLU A;  1TK5 A;  4CJF A;  3LDN A;  3O1B A;  5HRN A;  4K43 A;  5JS2 A;  1V4T A;  3LDL A;  1RT6 A;  3RMB A;  3QBW A;  3MAQ A;  3L4Q A;  4J2A A;  2HHT A;  4KPY A;  2E1Z A;  4CW7 B;  1TAQ A;  5AQM A;  5HRP A;  3AA2 A;  1C1B A;  3KLE A;  3HBT A;  3ATU A;  3A2F A;  1NJZ A;  4Z0U A;  4BR0 A;  1BO5 O;  1XQS C;  5AQW A;  3BZC A;  1K6Y A;  4DQI A;  1JCF A;  4KB0 A;  1U4B A;  2DTU A;  3H3N O;  2P9N B;  1ZYQ A;  1U6Z A;  1ASW A;  2ITM A;  2BUP A;  4IOX A;  3KK2 A;  3A0I X;  1NJY A;  2UXD K;  3TI0 A;  4C1N K;  4LF7 K;  1FW6 A;  2EX3 A;  1YJ9 N;  4FWL A;  3WQU A;  1SL2 A;  2PYL A;  2DFF A;  3CYG A;  4IOA L;  5AFU A;  5J2N A;  1DEJ A;  3M3Z A;  3DLG A;  4C23 A;  4RWT A;  2XRI A;  4OGE A;  2F7T A;  5C2D A;  4LF6 K;  5DMR A;  1N36 K;  1TKZ A;  4IWV A;  1YUW A;  3C65 A;  3SYZ A;  2P9K A;  4IEE A;  1WAJ A;  4BC3 A;  3C7N B;  4JI0 K;  4FOI A;  4A59 A;  5C0Y A;  3HSC A;  3WXM B;  4CK3 A;  5AQS A;  1XI1 A;  1DTT A;  4WF9 L;  3KVG A;  1IBM K;  3VQ7 A;  4BY9 C;  3ISN C;  5FPE A;  3VEZ A;  3D2E B;  1N33 K;  4O8K A;  1NK8 A;  3OYG A;  1Y97 A;  4GW6 A;  1WLJ A;  2UU9 K;  4CJ5 A;  1TV6 A;  4DFK A;  2B4J A;  4CEO A;  3AVI A;  1CLQ A;  5JS1 A;  4JAX A;  2E88 A;  4BEC A;  3QBX A;  4RW9 A;  3ZSO A;  4HTU A;  3VMF B;  2E6M A;  1MDU B;  2O8E B;  4NYF A;  4WQ5 C;  1S1U A;  5IWA K;  3CHW A;  3LL3 A;  3PSI A;  4PY5 A;  2HNZ A;  1RDW X;  3H45 C;  1U2V B;  3W3D A;  2BGG A;  1X3M A;  3VEY A;  3V1O A;  1ITG A;  1Q8I A;  5AZJ B;  4FM0 A;  4I7F A;  3MED A;  2W41 A;  3H6E A;  4HUF A;  3ULE B;  4FJ8 A;  1S9E A;  3H3O B;  3OYH A;  4JEP A;  3TAE A;  3HPO A;  4BRH A;  3LAN A;  1X1P A;  1YT3 A;  3QFP A;  3DAW A;  4JI6 K;  1HNX K;  3THW A;  4F2R A;  1RBV A;  1MU2 A;  4KHY A;  4CJV A;  1Q86 O;  1CXQ A;  3MCP A;  3P1G A;  4DTU A;  3VQQ A;  1NNE A;  4DLE A;  3CIP A;  4Y1D A;  3O3F A;  3S9H A;  5I9E B;  1LW2 A;  2NRR A;  4HVJ A;  1ATN A;  3MN6 A;  3H1Q A;  3U8X A;  3QDK A;  1KLM A;  4ILH A;  3DXK B;  4JYA K;  3LPU A;  4Z4C A;  3RMA A;  3T1A A;  4JKH A;  3D0P A;  1TKD A;  3NMU A;  2EWS A;  1E3M A;  3IMX A;  1WSJ A;  3QEX A;  2PYJ A;  5H1S Q;  3R3L A;  2KLA A;  1W97 L;  1BG3 A;  3ULD A;  2AJQ A;  3F9K A;  4WCE L;  4LC9 B;  2NZT A;  5GIO A;  3L2W A;  4N47 A;  1WSE A;  4X64 K;  3T3F A;  4H8K A;  2D0A A;  2HHH K;  5BPL A;  5JLF A;  3QB0 A;  3DLK A;  1GLE G;  1KVB A;  2X6S A;  3RSE A;  1OVY A;  3QIN A;  3THX A;  2YI1 A;  4E3S A;  1NGG A;  3I0S A;  4CGJ A;  3TSQ A;  1S1V A;  2JWL A;  2Z1H A;  1JXB A;  2GUI A;  2P9I A;  4DTR A;  2QA4 N;  1HPM A;  4RCH A;  4BR7 A;  3HYF A;  4I9Q A;  1OKJ A;  3AVA A;  3V4I A;  3S3O A;  3VF4 A;  1S72 N;  4CI6 A;  2NRZ A;  2YV0 X;  4B08 A;  4DS4 A;  2PZS A;  3C6T A;  4GVE A;  1HX1 A;  1I3A A;  2CGK A;  4CEE A;  5AQN A;  3CCR N;  1VQN N;  2E2P A;  2OPS A;  5GAH P;  1U48 A;  4B9N A;  4H5N A;  4Z4I A;  5BN9 A;  1K8K B;  1GLB G;  3WNH A;  3AAQ A;  3MMV A;  1D5A A;  3MN5 A;  1GLL O;  4FM1 A;  2R7Y A;  2KW4 A;  1LWE A;  1XNR K;  1Q82 O;  1RT1 A;  3ZSZ A;  3U9Z A;  5T7B A;  4CCH A;  4CGD A;  4KH4 A;  1S1X A;  1EQY A;  2PFU A;  3DMJ A;  4KH5 A;  1R59 O;  1T6C A;  1W7A A;  4DHY A;  3UE5 A;  1EWR A;  3AA3 A;  3CCS N;  4FZZ A;  2OPR A;  1DT9 A;  4R5P A;  3ASM A;  1LOT B;  1ASV A;  1ZBI A;  4C8N A;  4CZK A;  4E7H A;  1XUP O;  3J7A P;  1SAZ A;  5GAG P;  4IOC L;  1KQS M;  2F96 A;  3TU5 A;  4M7Y A;  3DJC A;  2VG6 A;  3BF3 A;  5DM7 L;  3THV A;  1IBL K;  1HRH A;  4DUY K;  4OPJ A;  1ZXO A;  1D9F A;  3LP1 A;  3JXU A;  4KH6 A;  5JMV A;  2I7N A;  5KTQ A;  4KHU A;  5BRH A;  1C0T A;  3SUQ A;  4QCL A;  3AAR A;  2IVO A;  3WXK A;  5AQQ A;  1T05 A;  3PO4 A;  3ENB A;  3LAK A;  1EX4 A;  5HRR A;  4CGG A;  3ZSY A;  4KTW A;  1A5X A;  3ZX2 A;  2HW3 A;  3TSP A;  1N5Y A;  3LWM A;  3HI0 A;  1KSP A;  1NGC A;  4LSN A;  4HCC A;  4GKK K;  3SK3 A;  2QM1 A;  2BH1 A;  3I56 N;  1WB9 A;  1YF5 L;  4ELT A;  3OS2 A;  2O8B A;  2ETJ A;  1NJW A;  1RDU A;  2RN2 A;  3CJC A;  3THW B;  2Q97 A;  1S6P A;  4N56 A;  4WQ4 A;  4A57 A;  3CQ8 A;  4NXM K;  3NBP A;  1RCH A;  4ZTJ A;  3O4N A;  5AZI B;  2UUB K;  1SZ2 A;  5HRO A;  4FLZ A;  1VSM A;  3J81 O;  1L3U A;  3ID8 A;  2QW9 A;  1RNH A;  4M3W A;  4H5V A;  2QWQ A;  2WFB A;  3D45 A;  4N76 A;  1JKH A;  2VWB A;  3A5N C;  4O0J A;  4IKF A;  1OVQ A;  5BN8 A;  2P51 A;  3TPQ A;  4B8A B;  2QWR A;  3D2F A;  2UXB K;  1QQN A;  3NH0 A;  3T1H K;  1HKB A;  4A2A A;  4DG1 A;  3K5O A;  3CPE A;  1X3N A;  3AO3 A;  3SJH A;  3LP0 A;  4WFA L;  2C1I A;  4FJ9 A;  3MXI A;  4DV6 K;  3CCM N;  1VQO N;  4WFB L;  1NMN A;  1BCM A;  1HJO A;  4JKF A;  2V51 B;  3KK7 A;  1YHQ N;  3SAF A;  2GTD A;  3OYF A;  5C2F A;  4QOZ B;  2FXU A;  4L8R B;  3IAY A;  4PQU A;  2E20 A;  3NVK A;  4YDU A;  3RSE B;  4JRQ A;  3CCL N;  3THX B;  3R1X A;  1RBS A;  1IH7 A;  3VGM A;  1J5E K;  1VSH A;  1BU6 O;  1LW0 A;  4K41 A;  1ZC6 A;  3IFR A;  4HTL A;  2W6L A;  2P9I B;  2DFE A;  1NOZ A;  3NH2 A;  3CCJ N;  4FW1 A;  1K73 O;  4FPB A;  4LH5 A;  2VQF K;  1VQL N;  3SBT A;  3OYM A;  4C1N I;  3OYJ A;  2G8F A;  4HCB A;  5FRO A;  3OYI A;  4XIU A;  3PY8 A;  2E8A A;  2QEX N;  4OX9 K;  3L0Q A;  3U3Y A;  3VPZ A;  5A2Q O;  4FSV A;  3EN9 A;  2CH5 A;  5B8H A;  4NB4 A;  4J2D A;  1VSL A;  1SKW A;  4IFV A;  3ZET A;  4JV5 K;  5KRS A;  1C0G A;  4K8Z A;  4DUZ K;  2RPI A;  1OH8 A;  4FLV A;  3KKR A;  3M8S A;  3QFU A;  4U67 L;  4MQ3 A;  3C7N A;  3TWH A;  4Z94 A;  3F73 A;  1EO1 A;  3LWL A;  4KB1 A;  4BG8 A;  1WBD A;  4FJM A;  3ITH A;  1DGK N;  4FZX C;  1TK0 A;  2A1R A;  3VQE A;  2Z1G A;  4FJJ A;  3NFA A;  3HP6 A;  3D2E A;  3ZX0 A;  4B9L A;  4F9O A;  1SS6 A;  1S1W A;  4JD2 A;  1YJW N;  3E1Y A;  4CGH A;  4UY8 O;  4KAZ A;  4A61 A;  3P4I A;  1K9M O;  4B9Q A;  3CYM A;  1BCO A;  3JSM A;  2I5J A;  2FBT A;  3NVM A;  2FBV A;  4DV7 K;  3KHY A;  4BRF A;  3SNN A;  4BVP A;  4IZ9 A;  3K58 A;  3GL1 A;  2VGM A;  4CBU A;  1N8R O;  1HYZ A;  2NRT A;  3LDS A;  3AVH A;  4FWN A;  4LY7 A;  3MX5 A;  5KQ8 A;  2D0C A;  4X65 K;  1BA0 A;  3ALY A;  3VQ6 A;  1S3X A;  4RW8 A;  4CEF A;  3UKU A;  3F9M A;  2ZJQ L;  1YIT N;  3O08 A;  4RW7 A;  4CK1 A;  1BGX T;  1NLV A;  5CZ1 A;  3ZSR A;  2D4W A;  3DRS A;  5AQL A;  4ZTF A;  3PO5 A;  4CF8 A;  4E0D A;  4FWQ A;  3VQ4 A;  1IG8 A;  3QEV A;  4DLG A;  4YY3 K;  2O8B B;  5AR0 A;  3L3V A;  3VF2 A;  3CC7 N;  2KQ2 A;  4FJG A;  4M3U A;  2QI2 A;  4EHU A;  3RRG A;  1J53 A;  5HOO A;  1RDB A;  2VQE K;  4CZH A;  1MA9 B;  2ATQ A;  4DSE A;  2VWJ A;  4IG3 A;  1RTH A;  5SZT A;  4CHY A;  4PHT X;  5C10 A;  3NF7 A;  1RFQ A;  1NJI O;  1L5U A;  2QWP A;  4QS8 A;  1GLC G;  2OTL N;  4DCH A;  1RTI A;  2I7P A;  4FCY A;  4PWD A;  4J2E A;  4DQ8 A;  4AHC A;  5EOY A;  5LJV A;  4DF4 A;  4H0O A;  3SZ2 A;  2A6A A;  3RR8 A;  3DOK A;  4KKO A;  2Y1J A;  1VSE A;  2X78 A;  1IV0 A;  3VA0 A;  3NF9 A;  2P9S A;  3KK1 A;  4LD0 A;  4CD1 A;  4ICL A;  3SV3 A;  2HHW A;  4H0X B;  2Q0U A;  2IVP A;  4AHV A;  3G10 A;  3KJV A;  3VQ9 A;  4FJ7 A;  3VEV A;  1RTD A;  1RIL A;  4FZY A;  1BI4 A;  4A5A A;  1E4G T;  2G8K A;  4E1M A;  4FLU A;  3ZCM A;  5JVH L;  3CFP A;  4O5B A;  4FWO A;  3L4I A;  4O44 A;  1L3T A;  2ZJP L;  2YHW A;  2HHU A;  1VQ7 N;  4RG8 A;  1KD1 O;  2PBD A;  4WQ5 A;  4W5Q A;  1ESV A;  1NKE A;  1K8A O;  4FJL A;  5LMU K;  1TKT A;  1QZ6 A;  1BHL A;  3FFK B;  4AHT A;  4CJ3 A;  2HMI A;  1DLO A;  2YJF A;  4CJQ A;  3HT3 A;  2QTD A;  3PX4 A;  1FXX A;  2NRH A;  4CIF A;  3P31 A;  5FPN A;  2F9W A;  1QZ5 A;  2FBX A;  2IVN A;  3G4S N;  4YOY A;  1VHX A;  1TVR A;  4BQZ A;  3SAH A;  1K8K A;  4GV6 A;  3QML A;  4M3R A;  3OS1 A;  4DTN A;  3ENO A;  2F8T A;  3ZET B;  1SQK A;  2E2N A;  5E41 A;  1QVG M;  2X6N A;  5AQY A;  4DV3 K;  2NUB A;  2ASP A;  1VSI A;  5FPM A;  1QS4 A;  4PL7 A;  3KK3 A;  3L2Q A;  3VQA A;  2IS3 A;  1HMV A;  4DTX A;  3G6E N;  2IC3 A;  2EHG A;  2HB5 A;  4BRL A;  5F1X A;  5AQJ A;  4DV4 K;  2D0B A;  2ZE2 A;  1W2B M;  1BIU A;  3BZK A;  4DTM A;  1W9H A;  4BDY A;  3T1Y K;  2HBM A;  4JD2 B;  3CCV N;  2ZD1 A;  2HF4 A;  3DLE A;  4CZL A;  4H5T A;  1TKX A;  3WNF A;  4BEB A;  4FWM A;  4OJR A;  2HF3 A;  4I2P A;  4CJS A;  4B1Y B;  4XH1 A;  4CES A;  3VTH A;  1RT2 A;  1U04 A;  3BF1 A;  4CD3 A;  3OHR A;  4H0P A;  4CIG A;  1NK9 A;  1XNQ K;  1GOA A;  2V7Y A;  1HQU A;  4ISG A;  1S22 A;  4CZI A;  2OPP A;  1M90 O;  3CJ7 A;  3DLL L;  4C8K A;  5ADX H;  5FRM A;  1RBR A;  4I6M A;  4M63 C;  4CEQ A;  3UKU B;  4QS7 A;  3WNE A;  4B9S A;  1T3V A;  1YJN N;  1GLD G;  2BTF A;  1VQK N;  1WN7 A;  4CJR A;  5J2M A;  5CYM A;  3CD6 N;  1TGO A;  2DPN A;  4ISE A;  3QNN A;  4DR4 K;  4CVN E;  2GX9 A;  4NCA A;  4OKK A;  3OTO K;  3MK6 A;  3O4Q A;  4CHO A;  4BR2 A;  2W40 A;  5K14 A;  3AGR A;  5E84 A;  3QEW A;  2P1J A;  1CZ9 A;  4JI1 K;  4BE7 B;  3SCX A;  1FJG K;  4WYB A;  4O4G A;  2OPQ A;  4BWJ A;  4AIL C;  3DI6 A;  1I39 A;  5AZI A;  3OJS A;  3TSU A;  3I8D A;  4EP4 A;  1EET A;  2GEL A;  5KI6 A;  3SQ4 A;  1KTQ A;  3AA5 X;  4YHH K;  1QHA A;  4HUE A;  1CXU A;  3HO1 A;  4YFU A;  3CFR A;  2KHO A;  5JLH A;  2W00 A;  3FR0 A;  3PIP L;  4DR2 K;  1M1K O;  3QES A;  1XHX A;  1W0H A;  3TAR A;  2GWK A;  4YOW A;  3C6A A;  2FLO A;  2ZQB A;  4I2Q A;  4OVL A;  3K9J A;  3MX2 A;  3K5N A;  2D5R A;  2P9S B;  4BRP A;  4M45 A;  5BR9 A;  3TAG A;  4C8O A;  4E89 A;  3CC2 N;  3KWG A;  2HHX A;  3L6Q A;  3OA9 A;  3DWL A;  3VEX A;  4B9M A;  1BQM A;  2YCH A;  3MXJ A;  5MLC Q;  1BI4 B;  4WFN L;  2G8W A;  4CK2 A;  4BGA A;  3WEE A;  2CH6 A;  2QKK A;  3QER A;  4CHP A;  1VQ5 N;  2WC9 A;  1WSG A;  5IT9 O;  3MEC A;  4CIE A;  3S41 A;  5M1N A;  3QIO A;  1KAZ A;  3DOL A;  3PX0 A;  4BR4 A;  3SUO A;  5DM6 L;  5LMN K;  4FK2 A;  2HOE A;  4LF9 K;  4BGB A;  3WQT A;  3GE1 A;  1HKC A;  3OBY A;  5M1O A;  1Y64 A;  1F21 A;  5AQH A;  2BE2 A;  3SJJ A;  4CF1 A;  4MLH A;  4O0I A;  4C8M A;  3WXI A;  3O80 A;  3Q7C A;  4JKB A;  3A5O C;  1B9D A;  3AVG A;  4LF4 K;  4RTF D;  2Q3S A;  3RMC A;  1O1W A;  2ZGZ A;  5EVZ A;  4Q0B A;  4DS5 A;  2FF3 B;  2VG7 A;  4NO7 A;  3SAG A;  1C6V A;  2FC0 A;  2LSN A;  3NF6 A;  1LAW A;  1G15 A;  2O8F A;  3TAF A;  4FLY A;  3OYD A;  3HVR A;  1G99 A;  3AGK A;  3DYA A;  4AHR A;  2IDO A;  4M3Y A;  1ZBL A;  4A62 A;  3ZT4 A;  4H4M A;  4DF8 A;  4FJX A;  1BQN A;  1U45 A;  4DFP A;  4I9L A;  2QK9 A;  2E2Q A;  1X9W A;  4CJP A;  1S1T A;  2FF6 A;  3NH1 A;  3TTF A;  5KRT A;  3WT0 A;  4LFB K;  1EWQ A;  4DFM A;  3C0B A;  1VK0 A;  3SBG A;  2G8U A;  1REV A;  3IS9 A;  3VTI A;  3OYE A;  1LWC A;  4CZF A;  3AO1 A;  2YHB A;  2Q0R A;  3LDP A;  4M3X A;  1RBT A;  2YJE A;  3QEI A;  1WBB A;  1XMQ K;  4DR6 K;  3V9Z A;  5HLF A;  4EHT A;  1VQ9 N;  3QLH A;  4BRO A;  3MN7 A;  1VQM N;  1JJ2 M;  2PAV A;  2BDP A;  2P9L B;  4FO0 A;  5I3U A;  4I6M B;  5FDL A;  3CCE N;  4PUO A;  1HPZ A;  3TTD A;  3HXM A;  5BPN A;  2YNF A;  1VQ8 N;  3JAM O;  4Z4G A;  1C0F A;  4JN4 A;  2XY5 A;  1A5W A;  4Y0W A;  4JI7 K;  4M3Z A;  2FSN A;  4FWS A;  1Z05 A;  3THY A;  3GBT A;  4CFA A;  3NF8 A;  4L3Q A;  3IG1 A;  1FKP A;  3AVL A;  3N4Q A;  4B9T A;  4W5R A;  3L2U A;  2JGU A;  3CQY A;  5C12 A;  2CGJ A;  3OS0 A;  5HP1 A;  4O5F A;  3G71 N;  5D3G A;  3E9P A;  3VQ5 A;  3O9T A;  3M6G A;  2Q1N A;  3K5M A;  4K25 A;  1ILY A;  3FFI A;  4CJU A;  3PIO L;  1VSJ A;  3FZL A;  3ZSQ A;  5I42 A;  2DY4 A;  2P9P A;  5EY4 A;  1CZB A;  4OLA A;  1LWF A;  2AA4 A;  4FJN A;  1XWL A;  4AM7 A;  3P83 D;  4CBW A;  3WXL A;  1X9M A;  4BVO A;  2HBK A;  4AHU A;  3WUH A;  4DTJ A;  4TSX A;  3ZSV A;  4B3T K;  3M8R A;  4A2B A;  3K59 A;  2P5G A;  4OKE A;  4DR3 K;  5CY4 A;  2G8V A;  4DSJ A;  4MO5 A;  3I55 N;  4BRQ A;  1ATS A;  1N6Q A;  1UA0 A;  3ZYY X;  3AO5 A;  3CFO A;  3HM8 A;  2HHQ A;  3WEE B;  5GIP A;  5C24 A;  2JWK A;  3VQC A;  3UB5 A;  3O3G A;  3CJB A;  1HNV A;  1J9A A;  4YOR A;  2XY6 A;  4NXN K;  3QEP A;  4R79 A;  4FWK A;  3I8B A;  3LP3 A;  3EY1 A;  2A5X A;  4IXC A;  1NK6 A;  4NYN A;  1BWF O;  3K9K A;  1ASU A;  1TUU A;  1JLQ A;  3S5T A;  2NRX A;  3N4P A;  4DV5 K;  5TKW A;  2HVI A;  3V6D A;  5AQV A;  2DFH A;  1NK0 A;  3P38 A;  3P5J A;  1FKO A;  4DB3 A;  4B3M K;  1WSF A;  3IDH A;  3AVK A;  1S6Q A;  4FL9 A;  5CYQ A;  5EX5 A;  4X62 K;  4GNI A;  4BRD A;  4CJL A;  5HBM A;  1VSF A;  3DRR A;  1U49 A;  4DQS A;  4O8U A;  4H4O A;  4JNE A;  3AVM A;  3HOT A;  2A40 A;  3UKR A;  1JCG A;  1IO2 A;  3DRP A;  1WSI A;  4QAG A;  3MWP A;  4HWI A;  5GAD P;  2O8F B;  4KHS A;  4WQ4 C;  4BRG A;  3NHG A;  3HPG A;  5AQR A;  3O5B A;  3I0R A;  1NGI A;  4FVU A;  4FJ5 A;  1SKR A;  3R9P A;  3SMS A;  3OYK A;  1QHT A;  3J7Y P;  2F8S A;  4F3O A;  3O4W A;  1KCF A;  2ASO A;  3O1W A;  4H5W A;  4F4K A;  5KQD A;  1SL0 A;  4B9V A;  1KVC A;  4NCG A;  1NU0 A;  4K8X A;  3H1V X;  2FSK A;  5F2R A;  3VEW A;  4CZE A;  3KZB A;  4KTZ A;  4DTS A;  1UAX A;  4DV1 K;  1D8Y A;  4FWR A;  5AQU A;  3EO3 A;  3ZEU A;  4KV8 A;  4H0Y B;  1LAV A;  3NGZ A;  4Z4F A;  1NGD A;  1UOC A;  2D1K A;  3L2R A;  1E4F T;  1Q9X A;  4ELU A;  4JKA A;  3U6F A;  4FYD A;  3OVN A;  3MEG A;  3RVC A;  4XEI A;  1GLF O;  4DSL A;  4IJN A;  4XH4 A;  5AQF A;  3E66 A;  3CCQ N;  1QSS A;  4EIA A;  4YNQ A;  2XY8 A;  4X66 K;  4Z4H A;  5AQZ A;  1MWK A;  4LF8 K;  4O55 A;  1HYV A;  1YI2 N;  3DLR A;  1A5V A;  3THY B;  2WBN A;  3M1F A;  4JI3 K;  1UWB A;  4IO9 L;  3DM2 A;  3AVC A;  3HRG A;  4CEB A;  2F9T A;  2A1S A;  3T7Z A;  4KFB A;  5J2Q A;  4NLC A;  3G25 A;  4LH4 A;  4K0K K;  4H03 B;  3C6U A;  2JLE A;  2KTQ A;  2RF2 A;  1T44 A;  2NLX A;  4B9U A;  1RGI A;  1VSD A;  4MDA A;  3CM6 A;  4CEZ A;  5AQP A;  3LP2 A;  3NCI A;  2O8C A;  3DXM A;  2P9P B;  2IGI A;  4FJK A;  2C1G A;  3W0L A;  5BR8 K;  3WXJ A;  5AJ3 K;  1VQP N;  1Z25 A;  4KHN A;  3MDQ A;  2UYT A;  3ZT0 A;  1NK5 A;  3AVF A;  3H46 O;  3MEE A;  3VF6 A;  3BGR A;  2E5L K;  3CQX A;  3OBW A;  2UUC K;  1NG9 A;  2XY7 A;  4DR1 K;  1P8Z A;  2RHK A;  1ZBU A;  4CF0 A;  4YOX A;  5CZ2 A;  1VRT A;  4CJE A;  3NGI A;  1LCU A;  4M3T A;  3TR8 A;  3L2V A;  3MWT A;  4Q5V A;  3SI6 A;  4U7B A;  5LJW A;  4M42 A;  4JKE A;  4CZJ A;  2WOM A;  4BRE A;  3V9U A;  2QWL A;  3RTV A;  3AO2 A;  1BIZ A;  2QXF A;  2G8H A;  5FPD A;  4F8R A;  3TAN A;  4B1V A;  2E4L A;  3BP8 A;  2QWM A;  1WAF A;  5AQT A;  3V1R A;  5M1F A;  4BE0 A;  1VAZ A;  3VGK A;  4GV3 A;  4EZ9 A;  3V9S A;  4OPK A;  4HHT A;  4F2S A;  2A3Z A;  4DSI A;  3DLH A;  1JLE A;  4KO0 A;  3CG7 A;  3QIP A;  1QSL A;  5M1Q A;  1NGB A;  4W5O A;  3AA4 A;  1JLB A;  2V52 B;  4DQP A;  2ASM A;  5AQK A;  3SMP A;  2NNW A;  5F0X A;  3FLC O;  1Q81 O;  3E01 A;  2ZM6 K;  3VQ8 A;  3UKR B;  3KLF A;  1Q18 A;  3V1Q A;  2KFZ A;  4IJA A;  4DV2 K;  4JKD A;  4CJT A;  5FRN A;  4AF1 A;  4JI2 K;  4H0V B;  3TTC A;  1SL1 A;  3OW2 M;  1C0M A;  2ZWH A;  4F3T A;  5BRE A;  1C1A A;  4OLB A;  3HJF A;  3K0S A;  4K42 A;  4BRK A;  4FLX A;  4DQR A;  1NOY A;  4C8L A;  3O9Q A;  2OAN A;  4CJ7 A;  3PLA A;  1GLA G;  2AP1 A;  5TKY A;  2YNI A;  3EL2 A;  1YIJ N;  4MO4 A;  1KLN A;  3HM9 A;  1BA1 A;  1NJX A;  5AQO A;  3VEO A;  3O9S A;  4H0T B;  1R0A A;  4ILJ A;  3OYC A;  3TAP A;  1QTM A;  1WOQ A;  1GLJ O;  4BRN A;  1Q9Y A;  3HOS A;  3ZEU B;  2O8D A;  2YKN A;  3FE1 A;  2H3G X;  1C0U A;  1S5J A;  3KIO A;  1RDA A;  2OTJ N;  3EKU A;  3SLC A;  3HZ6 A;  4EZ6 A;  4FXD A;  3EZ5 A;  4CHN A;  2P9L A;  1TK8 A;  4JHD A;  5AQX A;  3OYL A;  1KXP A;  4CGF A;  3B8A X;  3D7E O;  3CET A;  3U9D A;  2WTU A;  2ZGY A;  3AVB A;  3TAQ A;  5JVG L;  4YOV A;  2KZM A;  2J4R A;  2GEM A;  2P9U A;  4DU4 A;  1NMD A;  2Y1I A;  1YXQ A;  5LY3 A;  4KBO A;  4WE1 A;  3VQB A;  1WUA A;  3H08 A;  4MFB A;  3NE6 A;  4FVM A;  1KFD A;  3SQ1 A;  1TAU A;  3VEN A;  3VET A;  4IFE A;  2HND A;  2VYP A;  3TAB A;  4CFC A;  2GBZ A;  4FLT A;  3E9L A;  2V7Z A;  4BC2 A;  4CHQ A;  3ZT2 A;  5KPR A;  3VQD A;  1JL2 A;  3R8E A;  1SV5 A;  4PKH A;  3DXM B;  4ID1 A;  4CZG A;  4DQQ A;  3CF5 L;  2O8C B;  4A5B A;  3IUC A;  3CJA A;  1QQC A;  4BR5 A;  3C6H A;  2KKZ A;  3V9X A;  3HTV A;  3O6W A;  2G8I A;  1QQO A;  5J1E A;  2RE2 A;  5E26 A;  4BRI A;  3NDK A;  1QSY A;  4FK0 A;  2HHS A;  2QXL A;  1NM1 A;  4JKG B;  4KHP K;  2Z1I A;  2HHI A;  2B6A A;  5M1P A;  3EE8 A;  4CEA A;  3LM9 A;  3PSF A;  1DTQ A;  3VA3 A;  1BIS A;  2XO7 A;  2B5J A;  1YVN A;  3AVN A;  3KD1 E;  5FLX O;  4BAC A;  3LDO A;  1RBU A;  4JK8 A;  4IDK A;  4FWP A;  2UXC K;  1NGE A;  1SUQ A;  5BRD A;  4PL8 A;  4CZM A;  4H5R A;  4AM6 A;  3B6P A;  3T19 A;  2ZF5 O;  1IG9 A;  2VWK A;  3WNG A;  1RDD A;  4B3O A;  1LV5 A;  4GV9 A;  3CXC M;  3SPZ A;  2KFN A;  3T69 A;  1IKV A;  2HBJ A;  1XC9 A;  4ID5 A;  5CE3 A;  4CE9 A;  2YX6 A;  3B6O A;  4AHS A;  3CPW M;  1B92 A;  1NKB A;  2GUP A;  1ZBH A;  3AVJ A;  4E72 A;  1MWM A;  4EAH D;  1DKG D;  3LM2 A;  2QWN A;  3QO9 A;  3OY9 A;  4EP5 A;  2OCE A;  4AH9 A;  4JRP A;  3BUZ B;  1BOT O;  4CF9 A;  4BC4 A;  4KI4 A;  2Z1J A;  3KLI A;  5EU7 A;  3O3H A;  3L8B A;  3BEX A;  3K2P A;  3P39 A;  3ZLJ A;  2IOC A;  2VG5 A;  3ZSX A;  3I33 A;  2YKM A;  1FK9 A;  5AQG A;  5BRF A;  3ZSW A;  1XC3 A;  4BG9 A;  3V81 A;  3RWU A;  2E2O A;  4JS5 A;  1ATR A;  1Q7Y O;  5CR4 A;  3CME N;  4LFC K;  3F2K A;  1C1C A;  2WON A;  3AAP A;  4CHZ A;  1H1V A;  2HST A;  2IIR A;  3QIC A;  4E1J A;  3A8Y A;  3KD5 E;  1X9J A;  1YAG A;  1HUX A;  4GMJ B;  4DU3 A;  4J2B A;  3VOV A;  4FW2 A;  3ID6 A;  1KAY A;  4OPH A;  4CER A;  1VQ6 N;  4E7I A;  4E7K A;  1Z26 A;  1NK4 A;  4M41 A;  5GAE P;  5EXW A;  1P90 A;  2FBY A;  4V19 S;  4RW4 A;  3PV8 A;  4KI6 A;  3FZF A;  2P9K B;  4JK7 A;  3JS6 A;  2YHA A;  4JI8 K;  2BAN A;  1QE1 A;  4E19 A;  4FK4 A;  4DR5 K;  3KWI A;  3TAM A;  3HP9 A;  3CMA N;  2O8D B;  4B1X B;  3M8Q A;  1T03 A;  4OO1 J;  1IBK K;  5KPT A;  3KKS A;  3VES A;  5C25 A;  2NRV A;  2A42 A;  5KGW A;  3EE9 A;  4JHD B;  3UIQ A;  4YOU A;  5ADX A;  2D0O A;  3M8P A;  3HL8 A;  1L3S A;  1KVA A;  1EKE A;  3KLG A;  4DKW A;  1OH7 A;  1RT5 A;  4PKI A;  4JI5 K;  1WNS A;  1O13 A;  4DV0 K;  3MXM A;  4B1W B;  2NRW A;  2P9U B;  3ENH A;  1L3V A;  1IKX A;  1S9G A;  1JLF A;  2Q2R A;  5KPZ A;  1NWK A;  3RR7 A;  3PX6 A;  1HQE A;  1KFS A;  4KHW A;  1BL3 A;  2X74 A;  5SWM A;  1TYQ A;  2WUS A;  2CGL A;  3V9W A;  4ILG B;  4XJX A;  4JLH A;  3OYN A;  1UA1 A;  3BDP A;  1CZA N;  4BDZ A;  1I94 K;  2W6K A;  4IEI A;  4GKJ K;  3CCU N;  4KRF A;  3IKM A;  4W5T A;  1NKC A;  1RDC A;  4E1N A;  2E6L A;  4DU1 A;  2E1Y A;  1J6Z A;  4FJI A;  3AY9 A;  3A5L C;  3D6R A;  1XMO K;  2GV9 A;  1Z6R A;  1OH5 A;  1T6D A;  1WSH A;  1VQ4 N;  2HMP A;  4CGI A;  5HRS A;  4DR7 K;  4IFY A;  2QKB A;  1NGA A;  2IAJ A;  3A5M C;  4FPA A;  3EYZ A;  3HPH A;  3RRH A;  3J7Z O;  1IJJ A;  4DSF A;  5CHI A;  1SKS A;  3HVT A;  1J54 A;  4CFD A;  4CED A;  3CJ1 A;  1JLC A;  3CC4 N;  2D0P A;  3RMD A;  2OYQ A;  4NCB A;  3S3M A;  1BUP A;  4JS4 A;  1D9D A;  3LPT A;  4JKC A;  3CER A;  4MDB A;  4DTO A;  4LSL A;  4KHQ A;  3VQP A;  1QVF M;  1B9F A;  4IO8 A;  5DK5 A;  4DFJ A;  3QNO A;  3VN5 A; 
#chains in the Genus database with same CATH homology
 2E2P A;  5GAH P;  4H5N A;  5BN9 A;  1K8K B;  4BEB A;  4FWM A;  1RGI A;  1GLB G;  2HF3 A;  5GIN A;  4B1Y B;  3AAQ A;  4XH1 A;  4MDA A;  3VTH A;  3MMV A;  3MN5 A;  1GLL O;  3BF1 A;  5AQP A;  4CD3 A;  3OHR A;  4H0P A;  3DXM A;  5HL7 L;  2V7Y A;  4ISG A;  2P9P B;  1S22 A;  4CZI A;  1Q82 O;  3U9Z A;  1D4X A;  4BRC A;  1KC8 O;  4KH4 A;  1M90 O;  3CJ7 A;  3DLL L;  2C1G A;  3CJ9 A;  3W0L A;  4GY2 B;  3LDQ A;  3ZX3 A;  5ADX H;  3GOI A;  1EQY A;  1TUY A;  2PFU A;  3WXJ A;  4KH5 A;  1VQP N;  4I6M A;  1R59 O;  1T6C A;  2UYT A;  3MDQ A;  4M63 C;  3UKU B;  3ATV A;  4DHY A;  2YHX A;  4QS7 A;  2VCP A;  3UE5 A;  3CCS N;  3H46 O;  1T3V A;  1YJN N;  1DT9 A;  1GLD G;  5KQ8 A;  2BTF A;  1VQK N;  4BRA A;  1LOT B;  2Q31 A;  3VF6 A;  4CZK A;  3CD6 N;  1XUP O;  2DPN A;  2FSJ A;  3CQX A;  3FZM A;  4ISE A;  3OBW A;  1SAZ A;  4ISF A;  5GAG P;  2P9N A;  4IOC L;  1NGJ A;  1KQS M;  3GG4 A;  2GX9 A;  1P8Z A;  3TU5 A;  2RHK A;  4M7Y A;  3VER A;  3MK6 A;  3DJC A;  3M5R A;  3BF3 A;  4BR2 A;  4YOX A;  5DM7 L;  2W40 A;  3U4L A;  1ZXO A;  3AGR A;  5E84 A;  1LCU A;  2QWO A;  4BE7 B;  3MWT A;  3JXU A;  4WYB A;  4KH6 A;  5JMV A;  4U7B A;  2I7N A;  5LJW A;  5AZI A;  4JKE A;  4CZJ A;  5AFU H;  3TSU A;  4BRE A;  1V4S A;  2YHY A;  2QWL A;  2GEL A;  5AQI A;  5BRH A;  1VQN N;  1QHA A;  3AAR A;  5FPD A;  2IVO A;  3F5T A;  1JCE A;  3WXK A;  2KHO A;  5AQQ A;  5JLH A;  4IDH A;  4B1V A;  3ENB A;  2W00 A;  4MLE A;  3BP8 A;  3FR0 A;  2QWM A;  5AQT A;  5M1F A;  3PIP L;  3ZX2 A;  1M1K O;  1VAZ A;  3TSP A;  3VGK A;  3EZW A;  2ZJR L;  4GV3 A;  3HI0 A;  1NGC A;  2GWK A;  4J8F A;  2A3Z A;  3SK3 A;  4YOW A;  3C6A A;  3R6M A;  2FLO A;  1NGH A;  3K9J A;  3MX2 A;  5M1Q A;  2QM1 A;  1NGB A;  2BH1 A;  2P9S B;  4BRP A;  5BR9 A;  2V52 B;  3I56 N;  4YOT A;  4OPA A;  5C15 A;  2ASM A;  4NLB A;  2VGN A;  3KWG A;  2NNW A;  5AQK A;  3SMP A;  3CC2 N;  1YF5 L;  2A41 A;  3L6Q A;  3OA9 A;  4M7X A;  5F0X A;  3DWL A;  3FLC O;  3VEX A;  1Q81 O;  1RDU A;  2YCH A;  3CJC A;  3UKR B;  5MLC Q;  4WFN L;  2Q97 A;  1QQM A;  4BRM A;  1Q18 A;  4WQ4 A;  4BGA A;  4A57 A;  3WEE A;  3GDQ A;  2CH6 A;  1ZBS A;  4IJA A;  4JKD A;  2GWJ A;  5AZI B;  4AF1 A;  2Q36 A;  1SZ2 A;  1VQ5 N;  4G9Z A;  2WC9 A;  4BR9 A;  4YDU C;  3CI5 A;  4H0V B;  3TTC A;  3ID8 A;  3OW2 M;  2QW9 A;  3S41 A;  3J8A A;  4B1U B;  2ZWH A;  3Q7B A;  5M1N A;  5BRE A;  4H5V A;  1KAX A;  1KAZ A;  2QWQ A;  2WFB A;  4BR4 A;  5DM6 L;  3VGL A;  4K42 A;  1NBW A;  4FOE A;  2VWB A;  3A5N C;  2HOE A;  4BRK A;  1TYQ B;  3O9Q A;  2OAN A;  4BGB A;  4CJ7 A;  5BN8 A;  3PLA A;  1GLA G;  2AP1 A;  3WQT A;  3TPQ A;  3FZH A;  3GE1 A;  1HKC A;  2QWR A;  1U2V A;  3D2F A;  3OBY A;  5M1O A;  1QQN A;  5TKY A;  1Y64 A;  3EL2 A;  3O9R A;  3O8M A;  1YIJ N;  4MO4 A;  5AQH A;  1HKB A;  4A2A A;  1BA1 A;  5AZJ A;  3CPE A;  5AQO A;  3VEO A;  1NGF A;  1X3N A;  3O9S A;  4H0T B;  4ILJ A;  3SJH A;  4MLH A;  5BPM A;  1HKG A;  4WFA L;  2C1I A;  3FGU A;  1WOQ A;  1GLJ O;  3ULE A;  3WXI A;  3O80 A;  4BRN A;  3Q7C A;  3HOS A;  5M1K A;  4WFB L;  3ZEU B;  3CCM N;  1VQO N;  3FE1 A;  4JKB A;  2H3G X;  3A5O C;  1HJO A;  4RTF D;  4JKF A;  2OTJ N;  4XH5 A;  3EKU A;  2V51 B;  3KK7 A;  2ZGZ A;  1YHQ N;  3SLC A;  5EVZ A;  3SAF A;  3HZ6 A;  2GTD A;  3EKS A;  4PKG A;  4BQL A;  2P9L A;  2FF3 B;  5C2F A;  2FXU A;  2HBL A;  4NO7 A;  1BDG A;  3SAG A;  2E20 A;  4JHD A;  5AQX A;  3NVK A;  4YDU A;  1KXP A;  3RSE B;  3B8A X;  3CCL N;  3MN9 A;  3D7E O;  3R1X A;  1G99 A;  3CET A;  3VGM A;  3U9D A;  3AGK A;  4JKG A;  1BU6 O;  4K41 A;  1ZC6 A;  2ZGY A;  3IFR A;  3O9U A;  4HTL A;  5JVG L;  4YOV A;  4A62 A;  2J4R A;  2GEM A;  2P9I B;  2P9U A;  4QS9 A;  4B1Z A;  1NMD A;  5ELZ A;  5JIC A;  3FZK A;  4CBX A;  3CCJ N;  1YXQ A;  5LY3 A;  4KBO A;  2E2Q A;  1WUA A;  3DXK A;  3MCA B;  4EFH A;  2FF6 A;  1K73 O;  4FPB A;  3TTF A;  3WT0 A;  3D2F B;  3VEN A;  3C0B A;  3VET A;  3SBG A;  1VQL N;  3SBT A;  4C1N I;  4BC5 A;  3E9O A;  4IFE A;  1HLU A;  3VTI A;  3LDN A;  2VYP A;  2E8A A;  3O1B A;  4CZF A;  2QEX N;  4K43 A;  2Q0R A;  1V4T A;  3LDL A;  3L0Q A;  3LDP A;  3E9L A;  2V7Z A;  3VPZ A;  3QBW A;  4FSV A;  4BC2 A;  3EN9 A;  3L4Q A;  2YJE A;  2CH5 A;  5B8H A;  4NB4 A;  2E1Z A;  5KPR A;  4CZG A;  5AQM A;  3R8E A;  4PKH A;  3DXM B;  4EHT A;  3CF5 L;  1VQ9 N;  3ZET A;  4A5B A;  4BRO A;  3MN7 A;  3IUC A;  1VQM N;  1JJ2 M;  3CJA A;  2PAV A;  2P9L B;  4BR5 A;  1C0G A;  4FO0 A;  3C6H A;  3HBT A;  2KKZ A;  3ATU A;  4I6M B;  3HTV A;  3O6W A;  3CCE N;  1QQO A;  4BR0 A;  3TTD A;  2RE2 A;  5E26 A;  4BRI A;  1BO5 O;  5BPN A;  3QFU A;  4U67 L;  1XQS C;  5AQW A;  1VQ8 N;  2QXL A;  1NM1 A;  3C7N A;  4JKG B;  1C0F A;  1JCF A;  4Z94 A;  1EO1 A;  4JN4 A;  5M1P A;  4BG8 A;  3EE8 A;  1DGK N;  4Y0W A;  3H3N O;  3LM9 A;  2FSN A;  4FWS A;  2P9N B;  1Z05 A;  3GBT A;  4L3Q A;  1YVN A;  1U6Z A;  3D2E A;  3N4Q A;  2ITM A;  3ZX0 A;  4F9O A;  3LDO A;  1SS6 A;  4JD2 A;  3CQY A;  4JK8 A;  4FWP A;  2BUP A;  4IOX A;  3E1Y A;  3A0I X;  5C12 A;  1NGE A;  5BRD A;  1YJW N;  4PL8 A;  2CGJ A;  4H5R A;  4AM6 A;  4CZM A;  4UY8 O;  4C1N K;  4O5F A;  4A61 A;  3P4I A;  3G71 N;  3E9P A;  1K9M O;  2ZF5 O;  4B9Q A;  1YJ9 N;  4FWL A;  3WQU A;  3O9T A;  4GV9 A;  3M6G A;  3NVM A;  3CXC M;  3T69 A;  2Q1N A;  2HBJ A;  3KHY A;  4BRF A;  4IOA L;  5AFU A;  4BVP A;  4K25 A;  4IZ9 A;  1DEJ A;  2YX6 A;  5CE3 A;  1ILY A;  3GL1 A;  3M3Z A;  2VGM A;  3PIO L;  4C23 A;  4CBU A;  4RWT A;  3FZL A;  2NRT A;  1N8R O;  2P9P A;  5C2D A;  3CPW M;  2F7T A;  5EY4 A;  4FWN A;  2AA4 A;  2GUP A;  3MX5 A;  4IWV A;  4AM7 A;  1YUW A;  1BA0 A;  1MWM A;  3C65 A;  4EAH D;  1DKG D;  1S3X A;  4CBW A;  3WXL A;  2P9K A;  4IEE A;  3UKU A;  4BC3 A;  3LM2 A;  2QWN A;  3F9M A;  3C7N B;  4BVO A;  2HBK A;  2ZJQ L;  3WUH A;  4FOI A;  4A59 A;  1YIT N;  5C0Y A;  3O08 A;  3BUZ B;  1BOT O;  3HSC A;  4A2B A;  4BC4 A;  1NLV A;  3WXM B;  3BEX A;  3P39 A;  5AQS A;  4WF9 L;  3KVG A;  2D4W A;  5AQL A;  4BY9 C;  3I33 A;  4FWQ A;  5FPE A;  3VEZ A;  1IG8 A;  3D2E B;  5AQG A;  5BRF A;  4MO5 A;  4O8K A;  3I55 N;  5AR0 A;  1XC3 A;  3VF2 A;  1ATS A;  4BG9 A;  4BRQ A;  3CC7 N;  3ZYY X;  2E2O A;  1ATR A;  1Q7Y O;  5CR4 A;  3CME N;  3HM8 A;  2QI2 A;  3F2K A;  3AAP A;  4EHU A;  1H1V A;  3WEE B;  5GIP A;  2HST A;  2IIR A;  3QIC A;  1MA9 B;  2JWK A;  4CZH A;  5HOO A;  3UB5 A;  4E1J A;  3CJB A;  3A8Y A;  4YOR A;  4JAX A;  1X9J A;  1YAG A;  1HUX A;  4R79 A;  4FWK A;  3I8B A;  3VOV A;  4PHT X;  2A5X A;  5C10 A;  3ID6 A;  2E88 A;  4IXC A;  4BEC A;  3QBX A;  1KAY A;  1RFQ A;  4OPH A;  3VMF B;  1NJI O;  1BWF O;  3K9K A;  1TUU A;  2QWP A;  1VQ6 N;  1MDU B;  4QS8 A;  2NRX A;  3N4P A;  5TKW A;  4WQ5 C;  5GAE P;  1GLC G;  5AQV A;  2OTL N;  5EXW A;  1P90 A;  3CHW A;  3LL3 A;  4DCH A;  2I7P A;  3P38 A;  4DQ8 A;  3H45 C;  1RDW X;  2P9K B;  1U2V B;  3FZF A;  4JK7 A;  3W3D A;  3JS6 A;  4DB3 A;  1X3M A;  3IDH A;  3VEY A;  5EOY A;  5LJV A;  5AZJ B;  4FL9 A;  4H0O A;  2A6A A;  5EX5 A;  4GNI A;  2W41 A;  4BRD A;  3KWI A;  3H6E A;  3CMA N;  3ULE B;  2P9S A;  4CD1 A;  4B1X B;  3H3O B;  4H0X B;  4JEP A;  2Q0U A;  4O8U A;  4OO1 J;  4BRH A;  2IVP A;  5KPT A;  3VES A;  4JNE A;  3QFP A;  3DAW A;  3VEV A;  3HOT A;  2NRV A;  2A42 A;  2A40 A;  3UKR A;  1JCG A;  4A5A A;  1E4G T;  3EE9 A;  1Q86 O;  3MWP A;  4JHD B;  4HWI A;  3MCP A;  4YOU A;  5GAD P;  5JVH L;  4FWO A;  5ADX A;  4WQ4 C;  2D0O A;  4BRG A;  3L4I A;  3CIP A;  2ZJP L;  2YHW A;  5AQR A;  3O5B A;  4DKW A;  4PKI A;  1VQ7 N;  1NGI A;  1O13 A;  5I9E B;  4FVU A;  1KD1 O;  2PBD A;  4WQ5 A;  2NRW A;  1ESV A;  4B1W B;  3R9P A;  1K8A O;  2P9U B;  3SMS A;  2NRR A;  3ENH A;  1ATN A;  2Q2R A;  3MN6 A;  3H1Q A;  3U8X A;  5KPZ A;  1QZ6 A;  3QDK A;  1NWK A;  3FFK B;  4ILH A;  3DXK B;  2YJF A;  3O4W A;  3O1W A;  2ASO A;  1TYQ A;  2WUS A;  4H5W A;  2QTD A;  2CGL A;  5KQD A;  4ILG B;  4XJX A;  2NRH A;  4JKH A;  3NMU A;  1CZA N;  3H1V X;  2EWS A;  3P31 A;  2FSK A;  3IMX A;  5F2R A;  5FPN A;  2F9W A;  3VEW A;  4CZE A;  1QZ5 A;  2IVN A;  3KZB A;  4IEI A;  4YOY A;  3G4S N;  3CCU N;  4BQZ A;  3IKM A;  3SAH A;  5H1S Q;  1K8K A;  3R3L A;  2KLA A;  1W97 L;  4GV6 A;  3QML A;  4FWR A;  5AQU A;  1BG3 A;  3EO3 A;  3ZEU A;  4H0Y B;  3ENO A;  2E1Y A;  4WCE L;  1J6Z A;  2NZT A;  4LC9 B;  1NGD A;  1SQK A;  3A5L C;  3AY9 A;  3D6R A;  3ZET B;  5GIO A;  2E2N A;  2D1K A;  1QVG M;  1Z6R A;  1E4F T;  5AQY A;  1T6D A;  4JKA A;  2ASP A;  1VQ4 N;  2HMP A;  5BPL A;  3RVC A;  5JLF A;  3QB0 A;  4XEI A;  5FPM A;  1GLF O;  4PL7 A;  1GLE G;  4IJN A;  1NGA A;  4XH4 A;  1OVY A;  5AQF A;  3RSE A;  3E66 A;  3A5M C;  3CCQ N;  4FPA A;  2YI1 A;  1NGG A;  4EIA A;  3J7Z O;  1IJJ A;  3G6E N;  5F1X A;  4BRL A;  5AQZ A;  1MWK A;  5AQJ A;  3TSQ A;  2JWL A;  5CHI A;  1YI2 N;  1W2B M;  2P9I A;  2QA4 N;  1HPM A;  4RCH A;  4BR7 A;  3CJ1 A;  2WBN A;  3M1F A;  2HBM A;  1OKJ A;  3CC4 N;  4IO9 L;  2D0P A;  3VF4 A;  3HRG A;  1S72 N;  2F9T A;  3T7Z A;  2NRZ A;  4JD2 B;  1BUP A;  4NLC A;  4CI6 A;  3CCV N;  4GVE A;  3G25 A;  3CER A;  4JKC A;  4MDB A;  1HX1 A;  1QVF M;  2CGK A;  2HF4 A;  4H03 B;  4IO8 A;  5AQN A;  4CZL A;  3CCR N;  1T44 A;  4H5T A;  2NLX A;  4JK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...