3A5NC

Crystal structure of a dictyostelium p109a ca2+-actin in complex with human gelsolin segment 1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
359
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 117
structure length 359
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5nC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5nC03
3IFRA 1HKBA 4BRHA 5AQWA 4EAHD 3ZX0A 3ENHA 5AZJB 3O4WA 4K25A 4K42A 5LJWA 5FPDA 4RTFD 3D2EA 1GLCG 5BN9A 4BRIA 3UB5A 3ZETA 2P9UB 5AZIA 1QQNA 1GLLO 3I33A 4JAXA 4NB4A 5FPEA 2A41A 4BGBA 2VYPA 2DPNA 1MDUB 2E2OA 3OHRA 4L3QA 2CH6A 2CGJA 2GEMA 2QM1A 3ATUA 4IWVA 1RGIA 1GLJO 1R59O 4FL9A 3C7NA 2CGLA 4BR9A 4H5RA 4BC4A 2BUPA 2CGKA 5BN8A 4ISEA 1C0FA 2P9SA 3BUZB 5AQXA 3FE1A 1KAZA 3WXJA 3M1FA 1Y64A 3MN7A 4A61A 3H3OB 4BRCA 3CJ7A 4KBOA 1GLEG 5KPZA 1SQKA 4HTLA 3O1BA 5E84A 5EXWA 3TU5A 3HM8A 3CJCA 2FXUA 3VERA 1U6ZA 3HSCA 3ENOA 5BPNA 3VEWA 3QBXA 3QFPA 1HKGA 3GE1A 5JLHA 5ADXA 4HWIA 4A2AA 1XUPO 4BRMA 4FWKA 4CZKA 4PKIA 3CERA 5AQIA 4IJNA 1XC3A 3VF4A 3U8XA 2WUSA 3L4IA 4BG8A 1V4TA 4FPBA 3WUHA 3FZKA 5KPTA 2GWKA 1D4XA 5AQJA 4I6MB 5AQTA 4DQ8A 2Q2RA 3CETA 3IUCA 1LCUA 3ZEUA 1TUUA 5AQNA 2QWOA 3GBTA 4FWMA 5E26A 4BC3A 3H1QA 4CZFA 1NMDA 4YDUA 3A8YA 3IMXA 5AFUA 1ESVA 1NLVA 3H1VX 3J8AA 1ATRA 3FZLA 4BVOA 3GOIA 4BVPA 4E1JA 4CI6A 4WQ5C 2YJEA 2QWRA 4BC2A 3QDKA 3HBTA 3L6QA 5AQLA 3CJ9A 4NO7A 2E2QA 1BG3A 3H46O 1OKJA 4F9OA 4FWOA 5AQRA 3UKUB 4H0VB 1SZ2A 1XQSC 5AQPA 1YXQA 3WEEA 3FZHA 3BP8A 3VEOA 3CJ1A 3A5MC 4H5VA 2E8AA 1IJJA 3QICA 4JHDB 4MO5A 3I8BA 3VF6A 2UYTA 3KHYA 3QBWA 1MA9B 4AM6A 3WXIA 3JS6A 2P9PB 3TPQA 2FSJA 2I7NA 2NZTA 3LDPA 4CZMA 3EKSA 2P9KA 1YVNA 2GTDA 3MN9A 2I7PA 1BA0A 3AY9A 5B8HA 4IZ9A 5AQFA 5AQYA 3O08A 1NGAA 4PL7A 5ADXH 3ZX3A 4BR4A 3KVGA 3CI5A 3DAWA 3RSEB 4JD2B 2YHYA 3VOVA 3A5OC 2A42A 2E2PA 4BRFA 3H3NO 4IXCA 4BRGA 1GLBG 1NGGA 1TUYA 4WYBA 3R9PA 5AQVA 3D2FB 1QZ6A 3EO3A 4H0PA 5F0XA 1S3XA 4BR5A 1S22A 5AQUA 2E20A 5I9EB 4PKGA 4WQ4A 3L0QA 1BO5O 1NM1A 2P9IB 2FSNA 3DXKB 2D0OA 2IVPA 3DJCA 3VEVA 5EY4A 5TKYA 3U9DA 1NGHA 4CZLA 2Q36A 3HZ6A 3GL1A 2W41A 3LDNA 2NLXA 2QWNA 3UKRB 5BPLA 3DXMB 4BGAA 2E88A 3CJAA 4BRKA 2OANA 1YAGA 2W40A 5EOYA 5FPNA 1C0GA 4BRAA 3LM9A 1WUAA 3D2EB 1HX1A 1U2VA 4A62A 3ZETB 5AZIB 2D0PA 4BQLA 3H45C 4CD1A 1X3NA 1SAZA 1ZXOA 5KQ8A 4BC5A 1K8KA 1JCGA 3W0LA 1BDGA 1DKGD 5JICA 4Z94A 2GWJA 4B1VA 4YDUC 3C7NB 4H5WA 4EHUA 1NGCA 3HTVA 1QHAA 2QWMA 3VPZA 3LL3A 4FWNA 4CD3A 3MCPA 2P9SB 2GELA 2PBDA 2ITMA 1IG8A 3VGMA 3WQTA 3VGLA 4CZGA 3VESA 5ELZA 5FPMA 5AQMA 1JCEA 4JNEA 4O8KA 1NGJA 5AQGA 4M7XA 2NRHA 4B1UB 1QQOA 1BWFO 3D7EO 2HOEA 4H0TB 3VF2A 3ZX2A 2Q31A 4XH5A 5BRFA 2P9NA 2FSKA 4QS8A 1T6CA 3UKUA 5AQHA 2ASOA 4ISFA 4RCHA 2YHXA 3WT0A 1ZBSA 4QS7A 1HJOA 2D1KA 3F9MA 5EX5A 3W3DA 1QQMA 2V51B 1ATNA 3MN5A 2Q1NA 2E1YA 3IDHA 2AA4A 4B1YB 4B9QA 2P9PA 1J6ZA 3LDOA 3ZEUB 1DGKN 2QWLA 3CJBA 4IO8A 4CZEA 3VEYA 5LJVA 3GG4A 3P4IA 2ASMA 2A3ZA 2QW9A 4XH1A 4K41A 2J4RA 4K43A 2QWPA 4FO0A 1T6DA 3HI0A 2A6AA 3MN6A 4MLHA 3ULEA 4BRPA 2QWQA 5AQOA 4IJAA 1TYQA 3O80A 4FOIA 3LDQA 1KXPA 3WQUA 3QB0A 1WOQA 1Z6RA 2IVOA 2YI1A 4FWSA 3H6EA 1CZAN 5AZJA 3U4LA 1Z05A 2P9LB 3A5LC 3WEEB 2V7YA 3FR0A 3QMLA 4DHYA 3MMVA 3CIPA 5BRDA 4WQ4C 2P9UA 3B8AX 3ATVA 2FF6A 3FZMA 3R6MA 4AM7A 4C23A 5KQDA 3WXLA 1BA1A 1X3MA 1NGFA 3SMPA 3DWLA 5BRHA 1GLDG 1QZ5A 5EVZA 3EL2A 3FGUA 5BREA 2Q0RA 1BOTO 3CHWA 2P9KB 5AFUH 4A2BA 4DB3A 3UKRA 3A5NC 1X9JA 5F1XA 3S41A 4XH4A 4H03B 4BREA 1ATSA 4B1ZA 1KAYA 4MO4A 2V52B 2HF3A 3EKUA 4CBXA 4ISGA 3LM2A 3CQYA 1GLFO 4BR7A 5LY3A 2E2NA 1JCFA 3SJHA 3R8EA 2HMPA 3UE5A 1MWMA 2PAVA 3SLCA 5AQSA 2HF4A 3VEZA 4BRQA 4CJ7A 5BR9A 2IIRA 2AP1A 2EWSA 3AAQA 4BRDA 1KAXA 2YHWA 4DCHA 3BEXA 3M6GA 1NWKA 4BRLA 3O6WA 1V4SA 1HUXA 3GDQA 2ASPA 3VENA 4EFHA 4EIAA 4O5FA 4B1WB 3U9ZA 4LC9B 5JLFA 4H5TA 4I6MA 5AQZA 4M7YA 3SK3A 4FWRA 2ZWHA 4CZIA 3O8MA 3ID8A 4BR2A 2FF3B 3C0BA 4BROA 5CE3A 1BUPA 3KZBA 4GY2B 4QS9A 2YJFA 3AAPA 2Q97A 4EHTA 3FLCO 1LOTB 3O1WA 3CQXA 2F9WA 2H3GX 4CBWA 3FFKB 1U2VB 4XEIA 1RFQA 1T44A 3A0IX 4PKHA 4BQZA 3SMSA 4CZHA 2E1ZA 1K8KB 4H0XB 4BG9A 1HKCA 4H0YB 5KPRA 1E4GT 3MK6A 2ZGYA 4FWPA 3G25A 4JHDA 3LDLA 4H5NA 3MDQA 2YCHA 2ZF5O 3EN9A 5F2RA 2Q0UA 4BRNA 5BPMA 2FLOA 2BTFA 2VCPA 1RDWX 4B1XB 2IVNA 3FZFA 4Y0WA 4BR0A 4FPAA 2P9NB 2V7ZA 3BF3A 4JD2A 3RSEA 2P9LA 3WXKA 4RWTA 2VWBA 2A40A 1G99A 4WQ5A 4J8FA 3M3ZA 4GNIA 1EQYA 2CH5A 2ZGZA 3D2FA 1NGDA 5AQQA 1P8ZA 4CZJA 1HLUA 1NGIA 3O5BA 4FOEA 3QFUA 3AARA 5AQKA 4MLEA 2A5XA 4H0OA 3VGKA 1ZC6A 3VETA 1BU6O 4FWQA 2F9TA 2P9IA 3DXKA 1E4FT 1NGBA 3BF1A 4JN4A 1GLAG 5AR0A 3VEXA 1YUWA 4PL8A 3ULEB 3EZWA 2KHOA 2QXLA 2D4WA 4FSVA 1NGEA 4FWLA 1NBWA 1TYQB 1Q18A 1HPMA 1H1VA 2GUPA 1MWKA 5JMVA 3JXUA 4M63C 3DXMA 4CBUA 1DEJA
chains in the Genus database with same CATH superfamily
5LMUK 4BRHA 3ZX0A 4JRPA 3CD6N 5AZJB 3OYHA 1CZBA 3O4WA 4B3OA 3O9RA 3WNFA 3G4SN 1NK8A 5FPDA 3D2EA 3F73A 2DTUA 2A41A 2DPNA 4L3QA 3AV9A 2CGJA 2GEMA 3V1QA 4EZ6A 2F4VK 1S6PA 5J2MA 4KTQA 3LANA 4BR9A 4H5RA 5HRPA 2CGKA 3OYCA 3G71N 1C0FA 2P9SA 3BUZB 1X9WA 1KAZA 1KD1O 3M1FA 3CJ7A 4A5BA 5E84A 5EXWA 3HSCA 3OTOK 3QFPA 3CCEN 2PZSA 1XUPO 3CCVN 5E41A 3CERA 3AVJA 2GV9A 2DFEA 1XC3A 3O9SA 2QI2A 3VF4A 2XY5A 4FJMA 1JL1A 1V4TA 4IFYA 4QAGA 4DTSA 1K73O 2O8DA 3TSPA 4DQ8A 2Q2RA 3LZIA 1LWEA 3HO1A 3NF8A 4M3YA 4FW2A 3MXMA 3IKMA 3TANA 3SV3A 4B3MK 3IMXA 5AFUA 5MLCQ 1NLVA 3T1HK 2KW4A 2NRXA 4GKKK 4BVPA 5C42A 3SAHA 5C12A 4WQ5C 1NJIO 4HHTA 3QDKA 3L6QA 3SYZA 3CJ9A 4JI4K 3H46O 3DLBA 4HCBA 4F9OA 3MEEA 3UKUB 3TAEA 3J7YP 1XQSC 1BISA 4DSIA 3FZHA 3AVNA 4H5VA 3V4IA 3VQDA 3QINA 3AO2A 2XHBA 3SUOA 4MO5A 3QBWA 4JI2K 1RDDA 1MA9B 4FJHA 3S3MA 3JS6A 3TPQA 1DT9A 2FSJA 4RW4A 4CZMA 4B9LA 4CESA 2GTDA 2I7PA 5FROA 3AY9A 4ILJA 5B8HA 3QO9A 4LFBK 2R7YA 3TSQA 1IKXA 3KVGA 3CI5A 3EY1A 4N5SA 3NCIA 1U47A 4BECA 1KSPA 3VOVA 2WONA 3DRRA 1NGGA 1I39A 2W6LA 1U04A 3HJFA 1EX4A 3V6DA 3I8DA 4IOXA 3T1YK 1O1WA 4JKBA 3AVIA 3E9OA 3VQ9A 1S3XA 1LAWA 4CEFA 2UUCK 4CHOA 5AQUA 4H4OA 1FKOA 4E19A 3DYAA 2IVPA 3DJCA 2BE2A 5EY4A 3RRGA 2Q36A 3HZ6A 3GL1A 1T8EA 1XMQK 3J7AP 5M1FA 1S1VA 1B9FA 5AJ3K 3G0ZA 3AVKA 1NJWA 1RT3A 3CJAA 1S9EA 2BDPA 4BRKA 1I94K 4UY8O 2W40A 1C0GA 4PUOA 4CK1A 3OVNA 2IC3A 4FK2A 1ZBIA 5KQ8A 1YTUA 4DR1K 3J7ZO 4YY3K 1W97L 4KO0A 4Y1CA 4CVNE 5IWAK 2GWJA 2WC9A 3I0SA 4YDUC 4H5WA 3AVAA 1NGCA 3CYMA 1YTAA 3VPZA 3T1AA 4CD3A 2HW3A 2PBDA 1RNHA 3T69A 4DTXA 3VGMA 1L3TA 1YITN 3I55N 1JCEA 4O8KA 2VG5A 1NGJA 4LF8K 2G8IA 4OKKA 4B1UB 3NH2A 2WBNA 4C8OA 4XH5A 1E3MA 5BRFA 5I42A 2P9NA 2FSKA 4QS8A 4IO9L 2O8BA 3SQ2A 1JLGA 2ZE2A 2RF2A 4QS7A 1RILA 4I7FA 1T7PA 3THXB 2V51B 2C1GA 3HRGA 1ATNA 3QEVA 4L8RB 2QXFA 4B9QA 2P9PA 1J6ZA 2G8VA 3KK7A 4LSLA 2ZQBA 3GG4A 3P4IA 4KTWA 1YHQN 4FJIA 3QESA 2A3ZA 2OYQA 1VSEA 4DQPA 4K41A 4KB0A 3RWUA 1RTJA 2J4RA 2QWPA 3O9QA 3KD5E 4MLHA 4FZXC 4H4MA 1VQON 3HPHA 2G8WA 1ASUA 4CF1A 4DV6K 2YKNA 1TYQA 1KLNA 3KIOA 1KXPA 2ETJA 3HOTA 4FLYA 3WNGA 5C25A 1D9FA 4BE7B 5J1EA 3G6EN 5AZJA 2P9LB 2VWJA 3WEEB 3MMVA 3CIPA 3NGYA 3OYBA 3ATVA 5KQDA 4C23A 5C2DA 3QEIA 4CJLA 3DWLA 5BRHA 3V1RA 2EHGA 5EVZA 4YNQA 3NVMA 5BREA 3KWGA 4M3XA 1BOTO 4FZZA 2UU9K 2P9KB 5AFUH 4F3OA 2HVIA 3KK1A 4DUYK 4XH4A 3KK2A 3NDKA 1ATSA 3O4QA 1VSDA 3PSFA 2V52B 4CBXA 1UWBA 3LM2A 1GLFO 4BR7A 5LY3A 3SJHA 2HMPA 2VGNA 3IAYA 2HF4A 3DLGA 1TAUA 2IIRA 2EWSA 2VG7A 3L3UA 4FLXA 3VA0A 4U67L 1NWKA 4QCLA 5LMNK 4EIAA 4O5FA 4BY9C 1WAFA 2G8UA 4LC9B 1SKSA 4ILHA 3DLEA 3MXIA 2RN2A 3ID8A 1NOYA 2FF3B 3K9KA 2FC0A 3RMBA 4TSXA 4FLVA 3VQ6A 4GY2B 4QS9A 1OVYA 2YJFA 2Q97A 2NRWA 3RMDA 1JLAA 3BZKA 2H3GX 5JS1A 2GUIA 4CBWA 3FFKB 4GVEA 4XEIA 1N32K 3VTHA 4AHSA 3QNOA 4BDYA 4PKHA 4CZHA 1RDBA 1EO1A 4H0XB 4DU1A 2UXBK 3G25A 1KLMA 3KLGA 2IS3A 1N33K 3OA9A 1HNVA 3NF6A 4H5NA 3PIPL 3L2VA 3TTCA 1EKEA 2I5JA 2PYJA 1C1BA 3V9WA 4DQQA 2BTFA 4B8AB 1ZBLA 4ZTFA 1JL2A 1VSLA 4QOZB 4BR0A 4K0KK 3BF3A 2ZJRL 3MX5A 4K8XA 1FJGK 2XY6A 3V9XA 2A40A 1G99A 1JLCA 4UQGA 1EQYA 1NGDA 4KH6A 3CCUN 1HLUA 1NGIA 3O5BA 3QFUA 5AQKA 1HNWK 2GBZA 2UXCK 3HL8A 3VGKA 3VETA 3OS2A 1L3SA 3LPUA 5FLXO 1BQNA 1N8RO 4Z4GA 3V9SA 4N56A 4FZYA 2P5GA 4O4GA 1GLAG 1LWCA 4PL8A 4DV0K 3EZWA 1NK7A 4FVUA 2FBVA 4FSVA 1NGEA 3FFIA 2BH1A 1NBWA 3C6UA 1Q18A 4WFNL 5JMVA 4LH4A 3QETA 4CBUA 1C1AA 1DEJA 3L2UA 4LF5K 3K5LA 4M3UA 3LDSA 3HPGA 4K25A 1YJWN 3HT3A 4HTUA 3WNHA 4R79A 2P9UB 3AVBA 1QQNA 4YOWA 1GLLO 4CHZA 2OTJN 2OA8A 2E2OA 4FLWA 4CFDA 2QM1A 4IWVA 4FM2A 1R59O 4FL9A 3OS1A 2CGLA 2BUPA 1W2BM 3S3NA 1J54A 3VMFB 5AQXA 4DWIA 4OKEA 1Y64A 1EWRA 4BRCA 3V9UA 4M45A 4HTLA 1WBBA 1EETA 2FXUA 4CJ4A 3VERA 5FRNA 4DR5K 3TAQA 4DSJA 2QK9A 3SAFA 2DFFA 1HKGA 4OGEA 1YIJN 1I3AA 3JYTA 1NK9A 2X74A 4A2AA 4CZKA 3CC4N 5AQIA 4IJNA 3U8XA 3SPZA 2WUSA 3L4IA 4CF2A 1W7AA 4X62K 1DLOA 4FPBA 3WUHA 1D8YA 3THXA 1XWLA 5M1PA 1D4XA 2HBKA 5CZ2A 3VN5A 3THYB 1QVFM 2QWOA 3DI6A 4CE9A 3GBTA 2A1SA 4BC3A 4O0IA 1NMDA 4FM1A 1EWQA 3A8YA 2YX6A 2VQFK 4CGFA 3FZLA 3OBYA 3GOIA 2P5OA 3MEDA 4CIFA 3ENBA 4OPKA 3CYGA 4BC2A 1WSHA 2UUBK 2IGIA 3HBTA 1Q8IA 2E2QA 1BG3A 4C8MA 1SZ2A 3WEEA 5KGXA 4B9NA 1RDUA 3VEOA 1BCOA 3A5MC 4BEBA 1KVBA 3R3LA 3F9KA 1JLBA 1IJJA 3KD1E 3I8BA 3VF6A 3KHYA 4AM6A 4OPHA 2P9PB 5CHIA 1WSFA 3U6FA 3EKSA 3KWIA 3CC2N 1WAJA 2P9KA 4Z4FA 4IOCL 1BA0A 4RW7A 5AQYA 1FK9A 4FXDA 3OW2M 1F21A 5ADXH 4PL7A 3ZX3A 2W6KA 5LL6Z 2YHYA 4CEEA 3VQ4A 3A5OC 2E2PA 4WFBL 4DTOA 3R9PA 5AQVA 4CF0A 2ITGA 1NKCA 2VQEK 3NE6A 3LP2A 4B9UA 4M3WA 4BR5A 5I9EB 4PKGA 3ZT4A 4JRQA 2E6LA 3VEVA 4GV6A 1NGHA 5HL7L 4IBNA 3O4NA 4ELUA 4MDAA 2W41A 1S1UA 3T7ZA 4FLUA 2QWNA 1ILYA 5BPLA 3RVCA 3SBGA 4M3ZA 5HRNA 3DXMB 3TAPA 1L3VA 4B9VA 1VSIA 3OYEA 4W5OA 1Q9YA 2HHVA 2OANA 5KRTA 4BRAA 4JKDA 4CJ3A 3V81A 4KI4A 4E7KA 5M1QA 1HX1A 2OPQA 3AA3A 4KKOA 5AZIB 4CJVA 2JWLA 1VSKA 1VQKN 3QEXA 3ZSZA 3BZCA 3BGRA 4OO1J 4DV7K 1OH7A 4CK3A 4B1VA 4DLGA 3C7NB 4EHUA 1HNXK 1QHAA 4EZ9A 4B9MA 4KREA 4LF7K 2Z1HA 4BE2A 2PYLA 2ITMA 5GADP 3WQTA 4CJRA 4CZGA 3RR8A 1S6QA 5CY4A 2ZJQL 2O4GA 2RE2A 3DLHA 3K5OA 2NRHA 3K0SA 1JXBA 4DS4A 1NK4A 4H0TB 4MDBA 4WFAL 4IFVA 4JKCA 1DTQA 3BDPA 1KRPA 1SL1A 3DOKA 5AQHA 2ASOA 4CHPA 4RCHA 2YHXA 3WT0A 4CJFA 1EXQA 2D5RA 1XNQK 4FLTA 4W5NA 5EX5A 4DV5K 1TV6A 1JLEA 4ID1A 3VQ8A 3NGIA 2E1YA 4IEEA 1RT5A 3ZEUB 1N5YA 5FRMA 4IO8A 4CZEA 4CGGA 3ISNC 3O9TA 1Z25A 1HPZA 1VRTA 4AHCA 4X66K 1J53A 1IKWA 3CXCM 4K43A 3VQ5A 5J2NA 4JI7K 2OPPA 4KHNA 1JJ2M 4NXNK 1WSGA 4BRPA 3LALA 4B3TK 4GKJK 3LDQA 3QB0A 4GV3A 4DSLA 1WOQA 3NH1A 1CZAN 3U4LA 1NKBA 2DFHA 4WCEL 4KPYA 2FBXA 4WQ4C 3VTIA 2P9UA 3M8SA 2ZJPL 5CR4A 1BA1A 1X3MA 3SMPA 2HVHA 1TKXA 3S5TA 3FGUA 4N76A 4DU4A 4CIEA 4A2BA 1Q86O 4DB3A 4OPAA 1GOAA 3A5NC 3TAFA 4FM0A 3TSUA 1X9JA 5F1XA 3S41A 1RT6A 4MQ3A 3S9HA 1KAYA 4FJ5A 4MO4A 1RTIA 1VAZA 4NCBA 3KLHA 2HF3A 2P51A 3EKUA 2WOMA 2ZD1A 4ISGA 5K14A 4DFMA 1HR0K 4BACA 1UA1A 4AHTA 2XY7A 2E2NA 3E9LA 3UE5A 3TABA 4CFCA 1S1XA 4OVLA 1VQ5N 1DTTA 4BRQA 1J5EK 3QIPA 3HM9A 3DLLL 1OVQA 2OCEA 3L4QA 2YHWA 4IG0A 3BEXA 4KHQA 3M6GA 1KCFA 4BRLA 4DR7K 4EFHA 3VENA 5JLFA 1XMOK 1QSYA 3NVKA 2O8CB 2B4JA 2QTDA 1QVGM 3P39A 3THYA 3SJJA 2JLEA 4M41A 3CFRA 2OPRA 4HVJA 3SCXA 3RRHA 2HBJA 4M3TA 4J2AA 3T19A 1SL0A 1RT7A 3L8BA 3DRSA 3PV8A 3C95A 4CEDA 3P38A 1XHZA 4BQZA 1NNEA 3MECA 3O3FA 1B9DA 1FXXA 2Z1GA 4BG9A 1HKCA 1K6YA 3KLFA 3QNNA 4FWPA 4YOUA 1JXEA 3TI0A 3OBWA 2O4IA 3AVLA 2YCHA 3AGKA 4CEQA 3MWTA 4E89A 4I2QA 4OJRA 5C24A 4BRNA 1NMNA 4NXMK 4JEPA 4ID5A 4DV3K 1RDWX 4CGIA 1O13A 2V7ZA 4IKFA 1ZBHA 3WXKA 4RWTA 4ELTA 5A2QO 1IG9A 4WQ5A 4F8RA 3NMUA 4O44A 4GNIA 4DTMA 5AQQA 1P8ZA 5JENA 4FOEA 1C0UA 1WB9A 4MLEA 2A5XA 5TKWA 4H0OA 4AHVA 3K59A 1BU6O 5CYQA 3I0RA 4ZTJA 4CJQA 1NG9A 1HNIA 1IKVA 3ZT3A 1JLQA 3NBPA 2XY8A 1LW0A 1L5UA 1SV5A 1NGBA 4JN4A 5AR0A 4WE1A 2KFZA 4KI6A 2D0AA 4LFCK 4E3SA 3CCLN 1ITGA 1VQ9N 4CEOA 1MWKA 4CIGA 1G15A 5DMRA 3DXMA 4CJ5A 3IFRA 1HKBA 5AQWA 4EAHD 3F5TA 3ENHA 3AA2A 4K42A 4C1NI 5LJWA 3ZSYA 4YHHK 1VQ8N 3DOLA 4RTFD 3MX2A 5BN9A 1TL1A 3UB5A 3SUNA 5AZIA 4LF6K 4JAXA 5FPEA 2KFNA 4DTPA 1X9SA 4BGBA 2VYPA 1MDUB 5GINA 2YKMA 5HP1A 2QKKA 1RGIA 3N4PA 4CEBA 1N34K 3B6OA 4GMJB 4DTNA 3C7NA 2HHTA 1SKRA 4BC4A 4DMNA 3Q7BA 1VQPN 3IS9A 1VQ7N 4X64K 3FE1A 3OYAA 3MN7A 3VQEA 3H3OB 4I9LA 4A61A 1RDAA 2YV0X 1SQKA 3TU5A 4DG1A 1U6ZA 1JKHA 4FJ8A 3QBXA 4DS5A 1YT3A 1S1WA 5ADXA 4DQSA 1D5AA 5DK5A 1ASWA 2W42A 4YFUA 3FZKA 2KLAA 1NJZA 2GWKA 3VQCA 2HBLA 2LSNA 2PY5A 4JK7A 1RBVA 3ULDA 1QE1A 3CETA 1LCUA 3ZEUA 5AQNA 1U49A 1C1CA 4FWMA 3OYJA 4CZFA 4YDUA 3HOSA 4AILC 1CXUA 3OJSA 4E1NA 3HVTA 3J8AA 4MFBA 3HSTB 3BY5A 4BDPA 4CI6A 2HHHK 1GOCA 1CZ9A 1BI4B 2YJEA 5GAGP 1QSLA 3HVRA 3ZSOA 4WF9L 5HRRA 3QIOA 1OKJA 4OKJA 4FWOA 5AQRA 2UXDK 4H0VB 4C8LA 4CJTA 4AH9A 3C94A 3J80O 2NRVA 3HXMA 5HBMA 2X78A 2KZZA 3ZSRA 1CLQA 3QICA 4JHDB 3JAMO 1ZBFA 2Y1JA 3WXIA 3LP1A 3HP6A 2I7NA 3AO3A 1VSFA 2F96A 3MN9A 1NKEA 4DR3K 4Q5VA 1WBDA 1KC8O 2NNWA 4KH4A 5AQFA 4H8KA 3CFPA 4LH5A 3DAWA 3E01A 3RSEB 4JD2B 1M90O 1HYVA 4Y1DA 4BRFA 5KRSA 1BHLA 3O9UA 4KHWA 4WYBA 1X9MA 2OZSA 4JI3K 3K9JA 3D2FB 1Z26A 3EO3A 4H0PA 1NK6A 1NJXA 3KTQA 1S22A 3AVMA 3D0PA 4FK4A 3KLIA 4PA1A 3DXKB 2D0OA 4CGDA 3K5NA 2HBMA 3K5MA 5TKYA 1Q81O 3OYNA 2F7TA 4CZLA 4E72A 1UA0A 4OGCA 2O8CA 1TKTA 5SZTA 4CGJA 1TKZA 3RTVA 4A57A 1KVCA 3KKSA 1A5VA 5FPNA 3OY9A 4KHYA 1N36K 3ZETB 4R5PA 3QEPA 3H45C 2YHBA 3ZSQA 1SL2A 1X3NA 4DU3A 1SAZA 2HNYA 2AJQA 2IAJA 3MAQA 2JGUA 4U7BA 4LY7A 3E66A 2GX9A 4J2BA 1BDGA 4JKFA 1L3UA 1DKGD 5HOOA 3AVFA 3HTVA 4DSEA 1VQLN 4JK8A 2GELA 4DF8A 3Q7CA 3PSIA 1WNSA 3VGLA 3VESA 1QS4A 5FPMA 2HHUA 3EEQA 5AQGA 3UIQA 3AA4A 5JS2A 3ZSWA 2O8FB 1RT2A 3ZLJA 1QSSA 2HOEA 1XHXA 4E7LA 3THWA 3ZX2A 4DKWA 1SUQA 5H1SQ 2Q31A 4JKEA 2YNGA 1T6CA 1J9AA 4ISFA 3K2PA 1QTMA 4FVMA 1ZBSA 4NLBA 1IO2A 4LFAK 2KZMA 1QQMA 4CEZA 4C8KA 4FJGA 3OS0A 1BIZA 2HB5A 3MN5A 3NFAA 1NOZA 4YOTA 3IDHA 4CJ7A 5HRSA 1DGKN 4KTZA 4I2PA 3HK2A 5SWMA 4I9QA 1U45A 4GV9A 3ALYA 1C0MA 3I56N 3TTDA 4F2RA 4CF9A 3K58A 4A5AA 2A6AA 4DV4K 1K9MO 3WNEA 2QWQA 3SPYA 1W0HA 4IJAA 3NAEA 4CHYA 2O8EB 4FOIA 1U48A 2BGGA 3WQUA 4BE1A 2ZM6K 4DFPA 2YI1A 3H6EA 4Q0BA 3PX0A 3IRXA 2V7YA 2KQ2A 3PIOL 3CMEN 4E7HA 3SBTA 1N6QA 3B8AX 4DTRA 2FF6A 2HHSA 4AM7A 1RBRA 1TK5A 1GLDG 4NYFA 4HCCA 1VK0A 2JWKA 2HNZA 3B6PA 1NJYA 2Q0RA 3R1XA 4X65K 3AVHA 3TARA 3C6TA 2D0BA 5C10A 3UKRA 3EE8A 3MWPA 1LWFA 3AA5X 4CCHA 4H03B 4BREA 4NCAA 3P83D 3VQQA 1HYSA 3PO4A 2QKBA 2YNIA 3O3GA 4XJXA 1VRUA 4DTUA 3R8EA 4YOVA 3N4QA 1VQ4N 2NRRA 4FJ7A 3V1OA 1VQNN 5BR9A 4IDHA 2C1IA 3AO1A 3AAQA 4CF8A 3KK3A 1C6VA 3O6WA 1V4SA 1HUXA 2ASPA 4B1WB 3OYIA 4ILGB 2G8KA 4E0DA 1SKWA 2NUBA 3ZCMA 1K8AO 2ZWHA 3O8MA 4NYNA 1QQCA 2B6AA 3AVCA 2Y1IA 4BR2A 4CJKA 3C0BA 4JI0K 4DSKA 3M8RA 3OYGA 5CE3A 4XIUA 4O8UA 3AAPA 3SUQA 1ASVA 4EHTA 1YJNN 1LOTB 3O1WA 3CPWM 1Q9XA 1U2VB 3P31A 4G1QA 4JV5K 1BI4A 1RFQA 1Q7YO 1T44A 3A0IX 1RBUA 4Z4CA 3SMSA 1OH5A 1K8KB 3LWMA 4H0YB 3L2WA 4CERA 5KPRA 1E4GT 1RT1A 4OPJA 3EZ5A 2BANA 1YF5L 3OYFA 2F8TA 4JHDA 3LDLA 2WTUA 3CM6A 3NH0A 4J2DA 3DLRA 4FCYA 4FW1A 4FYDA 4N47A 3TAMA 3EN9A 3U3YA 4F2SA 2X6SA 1HRHA 3EYZA 4B3SK 2FLOA 1RTHA 3FZFA 4Y0WA 3CCSN 5D3GA 4FPAA 4JYAK 3RSEA 4JD2A 3PUFA 4CHQA 4HUGA 4FJNA 2VWBA 5JVHL 3OJUA 4J8FA 3J81O 1Q82O 3D2FA 1OH6A 1NK0A 1WN7A 3C6AA 3ITHA 3MXJA 1R0AA 2RHKA 3SQ0A 4FWQA 2F9TA 4O55A 3O3HA 4HUFA 4AHRA 3ZT2A 3DXKA 2P1JA 1E4FT 4CJUA 3QEWA 3SV4A 4B8CA 2Q3SA 3BF1A 3CPEA 3VEXA 2E4LA 3ULEB 3SNNA 4BWJA 2QXLA 1VQMN 4FWLA 1HPMA 3VA3A 4E1MA 1TK8A 3JXUA 4CECA 2XO7A 5CZ1A 5GIPA 4Z4EA 4YOXA 4CJSA 4JK9A 5M1KA 1M1KO 1FKPA 1GLCG 2NRZA 4BRIA 3ZETA 3I33A 4NB4A 1ZYQA 3M8QA 4F4KA 4CK2A 1HYZA 2Z1IA 1NK5A 3SQ1A 1OH8A 3OHRA 2CH6A 4Z0UA 3ATUA 4GVMA 3QLHA 1GLJO 4CJWA 3PX6A 3L2QA 5BN8A 3THVA 4ISEA 2VG6A 5EU7A 4LD0A 2E6MA 3ZSVA 4V19S 3WXJA 4KHUA 4FK0A 3EE9A 4KBOA 3CCRN 1GLEG 5KPZA 3D45A 3O1BA 3HM8A 3CJCA 3ENOA 5BPNA 5IT9O 3TAGA 2O8FA 2F8SA 2YHAA 3VEWA 1HMVA 3GE1A 5JLHA 1RTDA 3AGRA 1T05A 4HWIA 4BRMA 4DTJA 4KH5A 4FWKA 1REVA 4PKIA 4GW6A 3VQPA 4HUEA 4JI6K 4JKGA 4BG8A 4DQIA 4E7IA 5J2PA 2RPIA 5KPTA 4IEIA 3CCQN 3KJVA 5AQJA 1IH7A 3ZT1A 4I6MB 1BQMA 5AQTA 4CFBA 2OPSA 2YNHA 3IUCA 3CF5L 5JVGL 1TUUA 4FJJA 4YOYA 3NGZA 2DY4A 5C0YA 5E26A 3H1QA 4RW6A 4CFAA 3K57A 1T03A 1ESVA 4DR6K 1D9DA 2OZMA 4DR2K 3H1VX 4IOAL 1ATRA 2A1RA 4BVOA 3S3OA 4B3RK 3L2RA 4FJLA 4E1JA 4FJXA 2O8EA 3C65A 1B92A 2VWKA 2QWRA 4KHPK 1KQSM 3SZ2A 4KAZA 5AQLA 4NO7A 3THWB 3ZT0A 5HLFA 3A2FA 1WSIA 3DMJA 5AQPA 1YXQA 4FJKA 1TAQA 1VSJA 3BP8A 4PHTX 3CJ1A 3OYKA 3NHGA 3SUPA 3E1YA 2E8AA 2FBTA 1Y97A 3H08A 3AO5A 1IV0A 1W9HA 2UYTA 3VQ7A 1VSMA 3LZJA 2NZTA 3LDPA 3AVGA 1YVNA 4BE0A 4JI1K 3CCMN 4IZ9A 1P90A 4KFBA 3O08A 1NGAA 3TWHA 2W00A 5CYMA 4BR4A 1UOCA 3LAKA 4KB1A 4CGHA 3C6HA 2A42A 1A5WA 3H3NO 4IXCA 4BRGA 4DQRA 4M42A 1GLBG 1TUYA 1TKDA 4LSNA 2G8HA 4F3TA 1QZ6A 4LF4K 5F0XA 1YI2N 3M5RA 4DF4A 2E20A 1HNZK 2HHXA 4WQ4A 3L0QA 1BO5O 1NM1A 1UAXA 4JKAA 2P9IB 2FSNA 1VQ6N 3G10A 3OYDA 3U9DA 3CCJN 1KVAA 3DRPA 1LV5A 3ZSXA 4W5TA 3LDNA 2ATQA 1RDCA 2NLXA 1NU0A 1S1TA 3UKRB 3D6RA 2EX3A 4DR4K 4BGAA 2E88A 1FW6A 4E7JA 1YAGA 3CFOA 5EOYA 3HYFA 1HJRA 4M3RA 3PLAA 3LM9A 4BWMA 1WUAA 3D2EB 2QA4N 1U2VA 4A62A 1ZBUA 4Z4HA 2D0PA 1U4BA 2OTLN 4BQLA 4CD1A 3MEGA 5DM6L 1ZXOA 4JKHA 1XNRK 4JLHA 3V9ZA 4BC5A 1K8KA 2IDOA 1JCGA 3W0LA 1RBSA 5JICA 4Z94A 1HQEA 1BCMA 1IBKK 3RMAA 1S9GA 2HHQA 2QWMA 1WSJA 4JI8K 3LL3A 4FWNA 3MCPA 3SI6A 2P9SB 1IG8A 4NCGA 3LWLA 1IBMK 5ELZA 5AQMA 4JNEA 3QERA 4PWDA 2IOCA 4AF1A 2KKZA 4DV2K 4M7XA 1VHXA 4CW7B 1QQOA 1BWFO 3D7EO 1BGXT 3VF2A 1MU2A 2X6NA 3UKUA 4IFEA 3HPOA 4DFKA 4JS5A 1HJOA 2D1KA 3F9MA 2E5LK 3W3DA 2O8DB 2PFUA 4RW8A 2Q1NA 2AA4A 4B1YB 4KHSA 3LDOA 4JI5K 2QWLA 3CJBA 3VEYA 5LJVA 3DM2A 1T3VA 1TL3A 2ASMA 4PY5A 3HP9A 2QW9A 4ICLA 3OYMA 4XH1A 1SS6A 4Z4IA 4FO0A 3CMAN 1T6DA 3HI0A 3MN6A 3ULEA 1TVRA 5GAHP 5AQOA 3O80A 4J2EA 3M8PA 4OLAA 3NF9A 4CJPA 4AQYK 2QEXN 1Z6RA 4FWSA 2IVOA 5KI6A 1YVUA 1KFSA 1Z05A 3A5LC 4LF9K 3FR0A 3QMLA 4DHYA 4B9TA 5BRDA 5T7BA 2KTQA 1X1PA 5I3UA 3R6MA 3FZMA 3LP3A 3WXLA 1RBTA 3ZYYX 1NGFA 3PX4A 3JSMA 1QZ5A 2YNFA 3EL2A 4C1NK 2HSTA 3F2KA 4DUZK 3CHWA 1HQUA 3SAGA 4W5QA 3LPTA 3DLKA 1BL3A 2VGMA 2NRTA 4CEAA 4FLZA 4IG3A 1JLFA 3AO4A 4K8ZA 4B1ZA 1S5JA 1TGOA 1VSHA 3ASMA 5FDLA 3CQYA 3PY8A 3SQ4A 3E9PA 3KKRA 1JCFA 3NF7A 1MWMA 2PAVA 3SLCA 1TK0A 3ID6A 5AQSA 3TR8A 3VEZA 4C8NA 2AP1A 4FJ9A 4BRDA 1KAXA 4DCHA 2D0CA 4B9SA 3VQAA 4JS4A 3L3VA 4OLBA 3GDQA 4N41A 1A5XA 2WFBA 3U9ZA 4H5TA 4I6MA 5AQZA 4M7YA 3SK3A 4BDZA 3P5JA 4FWRA 4CZIA 1WSEA 3CM5A 1KFDA 1QHTA 4DV1K 1IBLK 5KGWA 4BROA 4O5BA 3CQ8A 1RCHA 1BUPA 3KZBA 3RMCA 4NLCA 3P1GA 1LW2A 3FLCO 2F9WA 1GOBA 3CQXA 5KTQA 1WLJA 1XI1A 3KLEA 3IG1A 3WXMB 3T3FA 5DM7L 1YJ9N 2E1ZA 4CHNA 5GAEP 3TTFA 1XC9A 4JKGB 1CXQA 4ELVA 3MK6A 2ZGYA 3U3GA 5HROA 3LP0A 3MCAB 1J5OA 4AHUA 2UUAK 5M1OA 4O0JA 3CG7A 2HMIA 3MDQA 2XRIA 4KV8A 2ZF5O 4A59A 5F2RA 4B08A 2Q0UA 1EP4A 2B5JA 2Z1JA 4EP4A 5BR8K 5BPMA 4EP5A 4CJEA 4KRFA 1C0TA 2HNDA 2HHIA 2VCPA 4ZHRA 4B1XB 2IVNA 1RT4A 2P9NB 2O8BB 4PQUA 2P9LA 5GIOA 4IDKA 3M3ZA 2CH5A 5M1NA 2ZGZA 4DSFA 4CZJA 4DFJA 1IKYA 3VQBA 3AARA 4DLEA 1ZC6A 4W5RA 4G9ZA 3LAMA 2P9IA 5C15A 5C2FA 3PO5A 2HHWA 4RG8A 2FBYA 1YUWA 1BIUA 2KHOA 1KTQA 3OYLA 2G8FA 3CC7N 2RKIA 2D4WA 3RR7A 2GUPA 1TYQB 4RW9A 1H1VA 1S72N 4M63C 4YORA 1LAVA 5J2QA 4OX9K
chains in the Genus database with same CATH topology
3IFRA 1HKBA 4BRHA 5AQWA 4EAHD 3F5TA 3ZX0A 3ENHA 5AZJB 5GIPA 3O4WA 3CD6N 4K25A 1YJWN 4K42A 4C1NI 3O9RA 5LJWA 4YOXA 3G4SN 1VQ8N 5FPDA 4JK9A 4RTFD 5M1KA 3D2EA 1M1KO 1GLCG 3MX2A 5BN9A 2NRZA 4BRIA 4R79A 3UB5A 3ZETA 2P9UB 5AZIA 1QQNA 4YOWA 1GLLO 3I33A 4JAXA 4NB4A 5FPEA 1VQMN 2OTJN 2A41A 4BGBA 2VYPA 2DPNA 1MDUB 2E2OA 5GINA 3OHRA 4L3QA 2CH6A 2CGJA 2GEMA 2QM1A 3ATUA 4IWVA 1RGIA 3N4PA 1GLJO 1R59O 4FL9A 3C7NA 2CGLA 4BR9A 4H5RA 4BC4A 2BUPA 2CGKA 3Q7BA 5BN8A 3G71N 1VQPN 1W2BM 4ISEA 1C0FA 2P9SA 1VQ7N 3BUZB 3VMFB 5AQXA 3FE1A 1KAZA 3WXJA 1KD1O 3M1FA 1Y64A 3MN7A 4A61A 3H3OB 4BRCA 3EE9A 3CJ7A 4KBOA 4A5BA 1GLEG 5KPZA 3CCRN 1SQKA 4HTLA 3O1BA 5E84A 5EXWA 3TU5A 3HM8A 3CJCA 2FXUA 3VERA 1U6ZA 3HSCA 3ENOA 5BPNA 3VEWA 3QBXA 3SAFA 3QFPA 1HKGA 3GE1A 5JLHA 3AGRA 1YIJN 3CCEN 5ADXA 4HWIA 4A2AA 1XUPO 4BRMA 4KH5A 3CCVN 4FWKA 4CZKA 3CC4N 4PKIA 3CERA 5AQIA 4IJNA 1XC3A 3O9SA 2QI2A 3VF4A 4JKGA 3U8XA 2WUSA 3L4IA 4BG8A 1V4TA 4FPBA 3WUHA 3FZKA 2KLAA 4IEIA 5KPTA 1K73O 2GWKA 3CCQN 5M1PA 1D4XA 2HBLA 5AQJA 4JK7A 2HBKA 4I6MB 5AQTA 2Q2RA 3TSPA 4DQ8A 4B9QA 3CETA 3IUCA 1LCUA 3CF5L 3ZEUA 1TUUA 5JVGL 4YOYA 1QVFM 5AQNA 2QWOA 3GBTA 3IKMA 5C0YA 4FWMA 5E26A 4BC3A 3H1QA 4CZFA 1NMDA 4YDUA 3HOSA 3A8YA 3IMXA 5AFUA 1ESVA 2YX6A 5MLCQ 1NLVA 2NRXA 3H1VX 3J8AA 4IOAL 1ATRA 3FZLA 4BVOA 3OBYA 3GOIA 4BVPA 3SAHA 5C12A 4E1JA 4CI6A 4WQ5C 1NJIO 3ENBA 3C65A 2YJEA 2QWRA 5GAGP 4BC2A 1KQSM 3QDKA 3HBTA 3L6QA 5AQLA 3CJ9A 4NO7A 4WF9L 2E2QA 1BG3A 3H46O 1OKJA 4F9OA 4FWOA 5AQRA 3UKUB 4H0VB 1SZ2A 1XQSC 5AQPA 1YXQA 3WEEA 3FZHA 3BP8A 1RDUA 3VEOA 2NRVA 3CJ1A 4PHTX 3A5MC 4H5VA 4BEBA 3R3LA 3E1YA 2E8AA 1IJJA 3QICA 4JHDB 4MO5A 3I8BA 3VF6A 2UYTA 3KHYA 3QBWA 1MA9B 4AM6A 4OPHA 3WXIA 3JS6A 2P9PB 5CHIA 3TPQA 1DT9A 2FSJA 2I7NA 2NZTA 3LDPA 4CZMA 3EKSA 3KWIA 3CC2N 2P9KA 1YVNA 2GTDA 3MN9A 2I7PA 4IOCL 1BA0A 3AY9A 4ILJA 5B8HA 1KC8O 3CCMN 2NNWA 4IZ9A 4KH4A 3TSQA 1P90A 5AQFA 5AQYA 3OW2M 3O08A 1NGAA 4PL7A 5ADXH 2W00A 3ZX3A 4BR4A 3KVGA 3CI5A 3DAWA 3RSEB 4JD2B 2YHYA 1M90O 4BECA 3VOVA 3A5OC 3C6HA 2A42A 2E2PA 4BRFA 3H3NO 4IXCA 4BRGA 4WFBL 3O9UA 1GLBG 1NGGA 1TUYA 4WYBA 3R9PA 4IOXA 5AQVA 3K9JA 3D2FB 4JKBA 1QZ6A 3EO3A 3E9OA 4H0PA 5F0XA 1S3XA 1YI2N 3M5RA 4BR5A 1S22A 5AQUA 2E20A 5I9EB 4PKGA 4WQ4A 3L0QA 1BO5O 1NM1A 4JKAA 2P9IB 2FSNA 3DXKB 2D0OA 2IVPA 3DJCA 1VQ6N 2HBMA 3VEVA 5EY4A 5TKYA 4GV6A 3U9DA 1Q81O 3CCJN 1NGHA 2F7TA 4CZLA 2Q36A 3HZ6A 5HL7L 3GL1A 4MDAA 2W41A 3LDNA 3T7ZA 5M1FA 2NLXA 2QWNA 3UKRB 1ILYA 3D6RA 5BPLA 3RVCA 3SBGA 3DXMB 4A57A 4BGAA 2E88A 3CJAA 4BRKA 2OANA 4UY8O 1YAGA 2W40A 5EOYA 5FPNA 1C0GA 4BRAA 4JKDA 3PLAA 3LM9A 1WUAA 3D2EB 2QA4N 5M1QA 1HX1A 1U2VA 4A62A 3ZETB 5AZIB 2D0PA 2OTLN 4BQLA 3H45C 4CD1A 2JWLA 5DM6L 1X3NA 1SAZA 1ZXOA 4JKHA 1VQKN 5KQ8A 4U7BA 4BC5A 1K8KA 3E66A 2GX9A 3J7ZO 1JCGA 1W97L 3W0LA 1BDGA 4OO1J 4JKFA 1DKGD 5JICA 4Z94A 2GWJA 2WC9A 5HOOA 4B1VA 4YDUC 3C7NB 4H5WA 4EHUA 1NGCA 3HTVA 1QHAA 2QWMA 3VPZA 3LL3A 1VQLN 4FWNA 4JK8A 4CD3A 3MCPA 2P9SB 2GELA 2PBDA 2ITMA 3T69A 3Q7CA 1IG8A 3VGMA 5GADP 3WQTA 3VGLA 4CZGA 3VESA 1YITN 5ELZA 5FPMA 5AQMA 1JCEA 4JNEA 3I55N 4O8KA 2ZJQL 1NGJA 5AQGA 4AF1A 2RE2A 2KKZA 4M7XA 2NRHA 1Q82O 4B1UB 1QQOA 1BWFO 3D7EO 2HOEA 4H0TB 4MDBA 4WFAL 2WBNA 4JKCA 3VF2A 3ZX2A 4DKWA 5H1SQ 2Q31A 4XH5A 5BRFA 4JKEA 2P9NA 2FSKA 4QS8A 1T6CA 3UKUA 4IO9L 5AQHA 2ASOA 4IFEA 4ISFA 4RCHA 2YHXA 3WT0A 1ZBSA 4NLBA 4QS7A 1HJOA 2D1KA 3F9MA 5EX5A 3W3DA 2PFUA 1QQMA 2V51B 2C1GA 3HRGA 1ATNA 3MN5A 2Q1NA 2E1YA 4YOTA 3IDHA 2AA4A 4IEEA 4B1YB 2P9PA 1J6ZA 3LDOA 3ZEUB 1DGKN 2QWLA 3CJBA 3KK7A 4IO8A 3VEYA 4CZEA 3GG4A 3P4IA 1T3VA 5LJVA 2ASMA 3O9TA 1YHQN 2A3ZA 2QW9A 4XH1A 4GV9A 4K41A 1SS6A 3I56N 3CXCM 3TTDA 2J4RA 4K43A 2QWPA 4FO0A 3CMAN 3O9QA 1T6DA 3HI0A 4A5AA 2A6AA 3MN6A 1JJ2M 4MLHA 3ULEA 1K9MO 4BRPA 1VQON 2QWQA 5GAHP 5AQOA 4IJAA 1TYQA 3O80A 4FOIA 3LDQA 1KXPA 3HOTA 3WQUA 3QB0A 2QEXN 4BE7B 4GV3A 1WOQA 1Z6RA 2IVOA 2YI1A 4FWSA 3H6EA 1CZAN 5AZJA 3G6EN 3U4LA 1Z05A 2P9LB 3A5LC 3WEEB 2V7YA 3FR0A 3QMLA 4DHYA 3PIOL 3MMVA 3CMEN 3CIPA 5BRDA 4WCEL 4WQ4C 3SBTA 3VTIA 2P9UA 3B8AX 3ATVA 2FF6A 3FZMA 3R6MA 4AM7A 4C23A 5KQDA 3WXLA 5C2DA 2ZJPL 5CR4A 3ZYYX 1BA1A 1X3MA 1NGFA 3SMPA 3DWLA 5BRHA 1GLDG 1QZ5A 2JWKA 5EVZA 3NVMA 3EL2A 3FGUA 3KWGA 2Q0RA 5BREA 3R1XA 4C1NK 2HSTA 1BOTO 3F2KA 3CHWA 2P9KB 5AFUH 3SAGA 4A2BA 1Q86O 5C10A 4DB3A 4OPAA 3UKRA 3EE8A 3A5NC 3MWPA 2VGMA 2NRTA 1X9JA 3TSUA 5F1XA 3S41A 4XH4A 4H03B 4BREA 1ATSA 4B1ZA 1KAYA 4MO4A 1VAZA 2V52B 2HF3A 3EKUA 4CBXA 4ISGA 3LM2A 3CQYA 1GLFO 3E9PA 4BR7A 5LY3A 4XJXA 2E2NA 1JCFA 3SJHA 3R8EA 3E9LA 2HMPA 2VGNA 3UE5A 1MWMA 2PAVA 4YOVA 3SLCA 3N4QA 3ID6A 1VQ4N 5AQSA 2HF4A 3VEZA 4BRQA 4CJ7A 2NRRA 1VQ5N 3DLLL 1VQNN 5BR9A 2IIRA 2AP1A 3L4QA 4IDHA 2C1IA 2EWSA 3AAQA 4BRDA 1KAXA 2YHWA 4DCHA 4U67L 3BEXA 3M6GA 1NWKA 4BRLA 3O6WA 1V4SA 1HUXA 3GDQA 2ASPA 3VENA 4EFHA 4EIAA 4O5FA 4B1WB 4ILGB 4BY9C 2WFBA 3U9ZA 4LC9B 5JLFA 4H5TA 4ILHA 4I6MA 5AQZA 3NVKA 4M7YA 3SK3A 4FWRA 1K8AO 2ZWHA 2QTDA 4CZIA 1QVGM 3O8MA 3ID8A 3P39A 4BR2A 2FF3B 3K9KA 3C0BA 4BROA 5CE3A 2HBJA 1BUPA 3KZBA 4GY2B 4O8UA 4QS9A 1OVYA 2YJFA 3AAPA 2Q97A 4NLCA 4EHTA 3FLCO 1YJNN 2NRWA 1LOTB 3O1WA 2F9WA 3CQXA 2H3GX 3CPWM 4CBWA 3FFKB 4GVEA 1U2VB 3P31A 4XEIA 3VTHA 1RFQA 1Q7YO 3P38A 3WXMB 1T44A 3A0IX 4PKHA 4BQZA 3SMSA 4CZHA 5DM7L 1YJ9N 2E1ZA 1K8KB 1EO1A 4H0XB 4BG9A 5GAEP 1HKCA 3TTFA 4H0YB 4JKGB 5KPRA 1E4GT 3MK6A 2ZGYA 4FWPA 3MCAB 1YF5L 3G25A 4JHDA 4YOUA 5M1OA 3LDLA 3OBWA 3OA9A 4H5NA 3MDQA 2YCHA 3AGKA 3MWTA 2ZF5O 3PIPL 3EN9A 4A59A 5F2RA 2Q0UA 3TTCA 4BRNA 5BPMA 4JEPA 2FLOA 2BTFA 2VCPA 1RDWX 4B1XB 2IVNA 3FZFA 4Y0WA 3CCSN 4BR0A 4FPAA 1O13A 2P9NB 2V7ZA 3BF3A 4JD2A 3RSEA 2ZJRL 3MX5A 2P9LA 3WXKA 4RWTA 2VWBA 5JVHL 5GIOA 2A40A 1G99A 4WQ5A 4J8FA 3NMUA 3M3ZA 4GNIA 1EQYA 2CH5A 5M1NA 2ZGZA 3D2FA 1NGDA 5AQQA 1P8ZA 4KH6A 4CZJA 1HLUA 1NGIA 3O5BA 3CCUN 4FOEA 3QFUA 3AARA 5AQKA 4MLEA 2A5XA 5TKWA 4H0OA 3C6AA 2RHKA 3VGKA 1ZC6A 3VETA 1BU6O 4G9ZA 1N8RO 4FWQA 2F9TA 2P9IA 3DXKA 5C15A 1E4FT 5C2FA 1NGBA 3BF1A 4JN4A 3CPEA 1GLAG 5AR0A 3VEXA 1YUWA 4PL8A 3ULEB 3EZWA 2KHOA 3CC7N 2QXLA 3CCLN 4FVUA 2D4WA 4FSVA 1NGEA 2BH1A 4FWLA 1NBWA 1TYQB 1Q18A 1HPMA 1H1VA 2GUPA 1MWKA 5JMVA 4WFNL 1S72N 1VQ9N 3JXUA 4M63C 4YORA 3DXMA 4CBUA 1DEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFR A;  1HKB A;  4BRH A;  5AQW A;  4EAH D;  3ZX0 A;  3ENH A;  5AZJ B;  3O4W A;  4K25 A;  4K42 A;  5LJW A;  5FPD A;  4RTF D;  3D2E A;  1GLC G;  5BN9 A;  4BRI A;  3UB5 A;  3ZET A;  2P9U B;  5AZI A;  1QQN A;  1GLL O;  3I33 A;  4JAX A;  4NB4 A;  5FPE A;  2A41 A;  4BGB A;  2VYP A;  2DPN A;  1MDU B;  2E2O A;  3OHR A;  4L3Q A;  2CH6 A;  2CGJ A;  2GEM A;  2QM1 A;  3ATU A;  4IWV A;  1RGI A;  1GLJ O;  1R59 O;  4FL9 A;  3C7N A;  2CGL A;  4BR9 A;  4H5R A;  4BC4 A;  2BUP A;  2CGK A;  5BN8 A;  4ISE A;  1C0F A;  2P9S A;  3BUZ B;  5AQX A;  3FE1 A;  1KAZ A;  3WXJ A;  3M1F A;  1Y64 A;  3MN7 A;  4A61 A;  3H3O B;  4BRC A;  3CJ7 A;  4KBO A;  1GLE G;  5KPZ A;  1SQK A;  4HTL A;  3O1B A;  5E84 A;  5EXW A;  3TU5 A;  3HM8 A;  3CJC A;  2FXU A;  3VER A;  1U6Z A;  3HSC A;  3ENO A;  5BPN A;  3VEW A;  3QBX A;  3QFP A;  1HKG A;  3GE1 A;  5JLH A;  5ADX A;  4HWI A;  4A2A A;  1XUP O;  4BRM A;  4FWK A;  4CZK A;  4PKI A;  3CER A;  5AQI A;  4IJN A;  1XC3 A;  3VF4 A;  3U8X A;  2WUS A;  3L4I A;  4BG8 A;  1V4T A;  4FPB A;  3WUH A;  3FZK A;  5KPT A;  2GWK A;  1D4X A;  5AQJ A;  4I6M B;  5AQT A;  4DQ8 A;  2Q2R A;  3CET A;  3IUC A;  1LCU A;  3ZEU A;  1TUU A;  5AQN A;  2QWO A;  3GBT A;  4FWM A;  5E26 A;  4BC3 A;  3H1Q A;  4CZF A;  1NMD A;  4YDU A;  3A8Y A;  3IMX A;  5AFU A;  1ESV A;  1NLV A;  3H1V X;  3J8A A;  1ATR A;  3FZL A;  4BVO A;  3GOI A;  4BVP A;  4E1J A;  4CI6 A;  4WQ5 C;  2YJE A;  2QWR A;  4BC2 A;  3QDK A;  3HBT A;  3L6Q A;  5AQL A;  3CJ9 A;  4NO7 A;  2E2Q A;  1BG3 A;  3H46 O;  1OKJ A;  4F9O A;  4FWO A;  5AQR A;  3UKU B;  4H0V B;  1SZ2 A;  1XQS C;  5AQP A;  1YXQ A;  3WEE A;  3FZH A;  3BP8 A;  3VEO A;  3CJ1 A;  3A5M C;  4H5V A;  2E8A A;  1IJJ A;  3QIC A;  4JHD B;  4MO5 A;  3I8B A;  3VF6 A;  2UYT A;  3KHY A;  3QBW A;  1MA9 B;  4AM6 A;  3WXI A;  3JS6 A;  2P9P B;  3TPQ A;  2FSJ A;  2I7N A;  2NZT A;  3LDP A;  4CZM A;  3EKS A;  2P9K A;  1YVN A;  2GTD A;  3MN9 A;  2I7P A;  1BA0 A;  3AY9 A;  5B8H A;  4IZ9 A;  5AQF A;  5AQY A;  3O08 A;  1NGA A;  4PL7 A;  5ADX H;  3ZX3 A;  4BR4 A;  3KVG A;  3CI5 A;  3DAW A;  3RSE B;  4JD2 B;  2YHY A;  3VOV A;  3A5O C;  2A42 A;  2E2P A;  4BRF A;  3H3N O;  4IXC A;  4BRG A;  1GLB G;  1NGG A;  1TUY A;  4WYB A;  3R9P A;  5AQV A;  3D2F B;  1QZ6 A;  3EO3 A;  4H0P A;  5F0X A;  1S3X A;  4BR5 A;  1S22 A;  5AQU A;  2E20 A;  5I9E B;  4PKG A;  4WQ4 A;  3L0Q A;  1BO5 O;  1NM1 A;  2P9I B;  2FSN A;  3DXK B;  2D0O A;  2IVP A;  3DJC A;  3VEV A;  5EY4 A;  5TKY A;  3U9D A;  1NGH A;  4CZL A;  2Q36 A;  3HZ6 A;  3GL1 A;  2W41 A;  3LDN A;  2NLX A;  2QWN A;  3UKR B;  5BPL A;  3DXM B;  4BGA A;  2E88 A;  3CJA A;  4BRK A;  2OAN A;  1YAG A;  2W40 A;  5EOY A;  5FPN A;  1C0G A;  4BRA A;  3LM9 A;  1WUA A;  3D2E B;  1HX1 A;  1U2V A;  4A62 A;  3ZET B;  5AZI B;  2D0P A;  4BQL A;  3H45 C;  4CD1 A;  1X3N A;  1SAZ A;  1ZXO A;  5KQ8 A;  4BC5 A;  1K8K A;  1JCG A;  3W0L A;  1BDG A;  1DKG D;  5JIC A;  4Z94 A;  2GWJ A;  4B1V A;  4YDU C;  3C7N B;  4H5W A;  4EHU A;  1NGC A;  3HTV A;  1QHA A;  2QWM A;  3VPZ A;  3LL3 A;  4FWN A;  4CD3 A;  3MCP A;  2P9S B;  2GEL A;  2PBD A;  2ITM A;  1IG8 A;  3VGM A;  3WQT A;  3VGL A;  4CZG A;  3VES A;  5ELZ A;  5FPM A;  5AQM A;  1JCE A;  4JNE A;  4O8K A;  1NGJ A;  5AQG A;  4M7X A;  2NRH A;  4B1U B;  1QQO A;  1BWF O;  3D7E O;  2HOE A;  4H0T B;  3VF2 A;  3ZX2 A;  2Q31 A;  4XH5 A;  5BRF A;  2P9N A;  2FSK A;  4QS8 A;  1T6C A;  3UKU A;  5AQH A;  2ASO A;  4ISF A;  4RCH A;  2YHX A;  3WT0 A;  1ZBS A;  4QS7 A;  1HJO A;  2D1K A;  3F9M A;  5EX5 A;  3W3D A;  1QQM A;  2V51 B;  1ATN A;  3MN5 A;  2Q1N A;  2E1Y A;  3IDH A;  2AA4 A;  4B1Y B;  4B9Q A;  2P9P A;  1J6Z A;  3LDO A;  3ZEU B;  1DGK N;  2QWL A;  3CJB A;  4IO8 A;  4CZE A;  3VEY A;  5LJV A;  3GG4 A;  3P4I A;  2ASM A;  2A3Z A;  2QW9 A;  4XH1 A;  4K41 A;  2J4R A;  4K43 A;  2QWP A;  4FO0 A;  1T6D A;  3HI0 A;  2A6A A;  3MN6 A;  4MLH A;  3ULE A;  4BRP A;  2QWQ A;  5AQO A;  4IJA A;  1TYQ A;  3O80 A;  4FOI A;  3LDQ A;  1KXP A;  3WQU A;  3QB0 A;  1WOQ A;  1Z6R A;  2IVO A;  2YI1 A;  4FWS A;  3H6E A;  1CZA N;  5AZJ A;  3U4L A;  1Z05 A;  2P9L B;  3A5L C;  3WEE B;  2V7Y A;  3FR0 A;  3QML A;  4DHY A;  3MMV A;  3CIP A;  5BRD A;  4WQ4 C;  2P9U A;  3B8A X;  3ATV A;  2FF6 A;  3FZM A;  3R6M A;  4AM7 A;  4C23 A;  5KQD A;  3WXL A;  1BA1 A;  1X3M A;  1NGF A;  3SMP A;  3DWL A;  5BRH A;  1GLD G;  1QZ5 A;  5EVZ A;  3EL2 A;  3FGU A;  5BRE A;  2Q0R A;  1BOT O;  3CHW A;  2P9K B;  5AFU H;  4A2B A;  4DB3 A;  3UKR A;  3A5N C;  1X9J A;  5F1X A;  3S41 A;  4XH4 A;  4H03 B;  4BRE A;  1ATS A;  4B1Z A;  1KAY A;  4MO4 A;  2V52 B;  2HF3 A;  3EKU A;  4CBX A;  4ISG A;  3LM2 A;  3CQY A;  1GLF O;  4BR7 A;  5LY3 A;  2E2N A;  1JCF A;  3SJH A;  3R8E A;  2HMP A;  3UE5 A;  1MWM A;  2PAV A;  3SLC A;  5AQS A;  2HF4 A;  3VEZ A;  4BRQ A;  4CJ7 A;  5BR9 A;  2IIR A;  2AP1 A;  2EWS A;  3AAQ A;  4BRD A;  1KAX A;  2YHW A;  4DCH A;  3BEX A;  3M6G A;  1NWK A;  4BRL A;  3O6W A;  1V4S A;  1HUX A;  3GDQ A;  2ASP A;  3VEN A;  4EFH A;  4EIA A;  4O5F A;  4B1W B;  3U9Z A;  4LC9 B;  5JLF A;  4H5T A;  4I6M A;  5AQZ A;  4M7Y A;  3SK3 A;  4FWR A;  2ZWH A;  4CZI A;  3O8M A;  3ID8 A;  4BR2 A;  2FF3 B;  3C0B A;  4BRO A;  5CE3 A;  1BUP A;  3KZB A;  4GY2 B;  4QS9 A;  2YJF A;  3AAP A;  2Q97 A;  4EHT A;  3FLC O;  1LOT B;  3O1W A;  3CQX A;  2F9W A;  2H3G X;  4CBW A;  3FFK B;  1U2V B;  4XEI A;  1RFQ A;  1T44 A;  3A0I X;  4PKH A;  4BQZ A;  3SMS A;  4CZH A;  2E1Z A;  1K8K B;  4H0X B;  4BG9 A;  1HKC A;  4H0Y B;  5KPR A;  1E4G T;  3MK6 A;  2ZGY A;  4FWP A;  3G25 A;  4JHD A;  3LDL A;  4H5N A;  3MDQ A;  2YCH A;  2ZF5 O;  3EN9 A;  5F2R A;  2Q0U A;  4BRN A;  5BPM A;  2FLO A;  2BTF A;  2VCP A;  1RDW X;  4B1X B;  2IVN A;  3FZF A;  4Y0W A;  4BR0 A;  4FPA A;  2P9N B;  2V7Z A;  3BF3 A;  4JD2 A;  3RSE A;  2P9L A;  3WXK A;  4RWT A;  2VWB A;  2A40 A;  1G99 A;  4WQ5 A;  4J8F A;  3M3Z A;  4GNI A;  1EQY A;  2CH5 A;  2ZGZ A;  3D2F A;  1NGD A;  5AQQ A;  1P8Z A;  4CZJ A;  1HLU A;  1NGI A;  3O5B A;  4FOE A;  3QFU A;  3AAR A;  5AQK A;  4MLE A;  2A5X A;  4H0O A;  3VGK A;  1ZC6 A;  3VET A;  1BU6 O;  4FWQ A;  2F9T A;  2P9I A;  3DXK A;  1E4F T;  1NGB A;  3BF1 A;  4JN4 A;  1GLA G;  5AR0 A;  3VEX A;  1YUW A;  4PL8 A;  3ULE B;  3EZW A;  2KHO A;  2QXL A;  2D4W A;  4FSV A;  1NGE A;  4FWL A;  1NBW A;  1TYQ B;  1Q18 A;  1HPM A;  1H1V A;  2GUP A;  1MWK A;  5JMV A;  3JXU A;  4M63 C;  3DXM A;  4CBU A;  1DEJ A; 
#chains in the Genus database with same CATH topology
 5LMU K;  4BRH A;  3ZX0 A;  4JRP A;  3CD6 N;  5AZJ B;  3OYH A;  1CZB A;  3O4W A;  4B3O A;  3O9R A;  3WNF A;  3G4S N;  1NK8 A;  5FPD A;  3D2E A;  3F73 A;  2DTU A;  2A41 A;  2DPN A;  4L3Q A;  3AV9 A;  2CGJ A;  2GEM A;  3V1Q A;  4EZ6 A;  2F4V K;  1S6P A;  5J2M A;  4KTQ A;  3LAN A;  4BR9 A;  4H5R A;  5HRP A;  2CGK A;  3OYC A;  3G71 N;  1C0F A;  2P9S A;  3BUZ B;  1X9W A;  1KAZ A;  1KD1 O;  3M1F A;  3CJ7 A;  4A5B A;  5E84 A;  5EXW A;  3HSC A;  3OTO K;  3QFP A;  3CCE N;  2PZS A;  1XUP O;  3CCV N;  5E41 A;  3CER A;  3AVJ A;  2GV9 A;  2DFE A;  1XC3 A;  3O9S A;  2QI2 A;  3VF4 A;  2XY5 A;  4FJM A;  1JL1 A;  1V4T A;  4IFY A;  4QAG A;  4DTS A;  1K73 O;  2O8D A;  3TSP A;  4DQ8 A;  2Q2R A;  3LZI A;  1LWE A;  3HO1 A;  3NF8 A;  4M3Y A;  4FW2 A;  3MXM A;  3IKM A;  3TAN A;  3SV3 A;  4B3M K;  3IMX A;  5AFU A;  5MLC Q;  1NLV A;  3T1H K;  2KW4 A;  2NRX A;  4GKK K;  4BVP A;  5C42 A;  3SAH A;  5C12 A;  4WQ5 C;  1NJI O;  4HHT A;  3QDK A;  3L6Q A;  3SYZ A;  3CJ9 A;  4JI4 K;  3H46 O;  3DLB A;  4HCB A;  4F9O A;  3MEE A;  3UKU B;  3TAE A;  3J7Y P;  1XQS C;  1BIS A;  4DSI A;  3FZH A;  3AVN A;  4H5V A;  3V4I A;  3VQD A;  3QIN A;  3AO2 A;  2XHB A;  3SUO A;  4MO5 A;  3QBW A;  4JI2 K;  1RDD A;  1MA9 B;  4FJH A;  3S3M A;  3JS6 A;  3TPQ A;  1DT9 A;  2FSJ A;  4RW4 A;  4CZM A;  4B9L A;  4CES A;  2GTD A;  2I7P A;  5FRO A;  3AY9 A;  4ILJ A;  5B8H A;  3QO9 A;  4LFB K;  2R7Y A;  3TSQ A;  1IKX A;  3KVG A;  3CI5 A;  3EY1 A;  4N5S A;  3NCI A;  1U47 A;  4BEC A;  1KSP A;  3VOV A;  2WON A;  3DRR A;  1NGG A;  1I39 A;  2W6L A;  1U04 A;  3HJF A;  1EX4 A;  3V6D A;  3I8D A;  4IOX A;  3T1Y K;  1O1W A;  4JKB A;  3AVI A;  3E9O A;  3VQ9 A;  1S3X A;  1LAW A;  4CEF A;  2UUC K;  4CHO A;  5AQU A;  4H4O A;  1FKO A;  4E19 A;  3DYA A;  2IVP A;  3DJC A;  2BE2 A;  5EY4 A;  3RRG A;  2Q36 A;  3HZ6 A;  3GL1 A;  1T8E A;  1XMQ K;  3J7A P;  5M1F A;  1S1V A;  1B9F A;  5AJ3 K;  3G0Z A;  3AVK A;  1NJW A;  1RT3 A;  3CJA A;  1S9E A;  2BDP A;  4BRK A;  1I94 K;  4UY8 O;  2W40 A;  1C0G A;  4PUO A;  4CK1 A;  3OVN A;  2IC3 A;  4FK2 A;  1ZBI A;  5KQ8 A;  1YTU A;  4DR1 K;  3J7Z O;  4YY3 K;  1W97 L;  4KO0 A;  4Y1C A;  4CVN E;  5IWA K;  2GWJ A;  2WC9 A;  3I0S A;  4YDU C;  4H5W A;  3AVA A;  1NGC A;  3CYM A;  1YTA A;  3VPZ A;  3T1A A;  4CD3 A;  2HW3 A;  2PBD A;  1RNH A;  3T69 A;  4DTX A;  3VGM A;  1L3T A;  1YIT N;  3I55 N;  1JCE A;  4O8K A;  2VG5 A;  1NGJ A;  4LF8 K;  2G8I A;  4OKK A;  4B1U B;  3NH2 A;  2WBN A;  4C8O A;  4XH5 A;  1E3M A;  5BRF A;  5I42 A;  2P9N A;  2FSK A;  4QS8 A;  4IO9 L;  2O8B A;  3SQ2 A;  1JLG A;  2ZE2 A;  2RF2 A;  4QS7 A;  1RIL A;  4I7F A;  1T7P A;  3THX B;  2V51 B;  2C1G A;  3HRG A;  1ATN A;  3QEV A;  4L8R B;  2QXF A;  4B9Q A;  2P9P A;  1J6Z A;  2G8V A;  3KK7 A;  4LSL A;  2ZQB A;  3GG4 A;  3P4I A;  4KTW A;  1YHQ N;  4FJI A;  3QES A;  2A3Z A;  2OYQ A;  1VSE A;  4DQP A;  4K41 A;  4KB0 A;  3RWU A;  1RTJ A;  2J4R A;  2QWP A;  3O9Q A;  3KD5 E;  4MLH A;  4FZX C;  4H4M A;  1VQO N;  3HPH A;  2G8W A;  1ASU A;  4CF1 A;  4DV6 K;  2YKN A;  1TYQ A;  1KLN A;  3KIO A;  1KXP A;  2ETJ A;  3HOT A;  4FLY A;  3WNG A;  5C25 A;  1D9F A;  4BE7 B;  5J1E A;  3G6E N;  5AZJ A;  2P9L B;  2VWJ A;  3WEE B;  3MMV A;  3CIP A;  3NGY A;  3OYB A;  3ATV A;  5KQD A;  4C23 A;  5C2D A;  3QEI A;  4CJL A;  3DWL A;  5BRH A;  3V1R A;  2EHG A;  5EVZ A;  4YNQ A;  3NVM A;  5BRE A;  3KWG A;  4M3X A;  1BOT O;  4FZZ A;  2UU9 K;  2P9K B;  5AFU H;  4F3O A;  2HVI A;  3KK1 A;  4DUY K;  4XH4 A;  3KK2 A;  3NDK A;  1ATS A;  3O4Q A;  1VSD A;  3PSF A;  2V52 B;  4CBX A;  1UWB A;  3LM2 A;  1GLF O;  4BR7 A;  5LY3 A;  3SJH A;  2HMP A;  2VGN A;  3IAY A;  2HF4 A;  3DLG A;  1TAU A;  2IIR A;  2EWS A;  2VG7 A;  3L3U A;  4FLX A;  3VA0 A;  4U67 L;  1NWK A;  4QCL A;  5LMN K;  4EIA A;  4O5F A;  4BY9 C;  1WAF A;  2G8U A;  4LC9 B;  1SKS A;  4ILH A;  3DLE A;  3MXI A;  2RN2 A;  3ID8 A;  1NOY A;  2FF3 B;  3K9K A;  2FC0 A;  3RMB A;  4TSX A;  4FLV A;  3VQ6 A;  4GY2 B;  4QS9 A;  1OVY A;  2YJF A;  2Q97 A;  2NRW A;  3RMD A;  1JLA A;  3BZK A;  2H3G X;  5JS1 A;  2GUI A;  4CBW A;  3FFK B;  4GVE A;  4XEI A;  1N32 K;  3VTH A;  4AHS A;  3QNO A;  4BDY A;  4PKH A;  4CZH A;  1RDB A;  1EO1 A;  4H0X B;  4DU1 A;  2UXB K;  3G25 A;  1KLM A;  3KLG A;  2IS3 A;  1N33 K;  3OA9 A;  1HNV A;  3NF6 A;  4H5N A;  3PIP L;  3L2V A;  3TTC A;  1EKE A;  2I5J A;  2PYJ A;  1C1B A;  3V9W A;  4DQQ A;  2BTF A;  4B8A B;  1ZBL A;  4ZTF A;  1JL2 A;  1VSL A;  4QOZ B;  4BR0 A;  4K0K K;  3BF3 A;  2ZJR L;  3MX5 A;  4K8X A;  1FJG K;  2XY6 A;  3V9X A;  2A40 A;  1G99 A;  1JLC A;  4UQG A;  1EQY A;  1NGD A;  4KH6 A;  3CCU N;  1HLU A;  1NGI A;  3O5B A;  3QFU A;  5AQK A;  1HNW K;  2GBZ A;  2UXC K;  3HL8 A;  3VGK A;  3VET A;  3OS2 A;  1L3S A;  3LPU A;  5FLX O;  1BQN A;  1N8R O;  4Z4G A;  3V9S A;  4N56 A;  4FZY A;  2P5G A;  4O4G A;  1GLA G;  1LWC A;  4PL8 A;  4DV0 K;  3EZW A;  1NK7 A;  4FVU A;  2FBV A;  4FSV A;  1NGE A;  3FFI A;  2BH1 A;  1NBW A;  3C6U A;  1Q18 A;  4WFN L;  5JMV A;  4LH4 A;  3QET A;  4CBU A;  1C1A A;  1DEJ A;  3L2U A;  4LF5 K;  3K5L A;  4M3U A;  3LDS A;  3HPG A;  4K25 A;  1YJW N;  3HT3 A;  4HTU A;  3WNH A;  4R79 A;  2P9U B;  3AVB A;  1QQN A;  4YOW A;  1GLL O;  4CHZ A;  2OTJ N;  2OA8 A;  2E2O A;  4FLW A;  4CFD A;  2QM1 A;  4IWV A;  4FM2 A;  1R59 O;  4FL9 A;  3OS1 A;  2CGL A;  2BUP A;  1W2B M;  3S3N A;  1J54 A;  3VMF B;  5AQX A;  4DWI A;  4OKE A;  1Y64 A;  1EWR A;  4BRC A;  3V9U A;  4M45 A;  4HTL A;  1WBB A;  1EET A;  2FXU A;  4CJ4 A;  3VER A;  5FRN A;  4DR5 K;  3TAQ A;  4DSJ A;  2QK9 A;  3SAF A;  2DFF A;  1HKG A;  4OGE A;  1YIJ N;  1I3A A;  3JYT A;  1NK9 A;  2X74 A;  4A2A A;  4CZK A;  3CC4 N;  5AQI A;  4IJN A;  3U8X A;  3SPZ A;  2WUS A;  3L4I A;  4CF2 A;  1W7A A;  4X62 K;  1DLO A;  4FPB A;  3WUH A;  1D8Y A;  3THX A;  1XWL A;  5M1P A;  1D4X A;  2HBK A;  5CZ2 A;  3VN5 A;  3THY B;  1QVF M;  2QWO A;  3DI6 A;  4CE9 A;  3GBT A;  2A1S A;  4BC3 A;  4O0I A;  1NMD A;  4FM1 A;  1EWQ A;  3A8Y A;  2YX6 A;  2VQF K;  4CGF A;  3FZL A;  3OBY A;  3GOI A;  2P5O A;  3MED A;  4CIF A;  3ENB A;  4OPK A;  3CYG A;  4BC2 A;  1WSH A;  2UUB K;  2IGI A;  3HBT A;  1Q8I A;  2E2Q A;  1BG3 A;  4C8M A;  1SZ2 A;  3WEE A;  5KGX A;  4B9N A;  1RDU A;  3VEO A;  1BCO A;  3A5M C;  4BEB A;  1KVB A;  3R3L A;  3F9K A;  1JLB A;  1IJJ A;  3KD1 E;  3I8B A;  3VF6 A;  3KHY A;  4AM6 A;  4OPH A;  2P9P B;  5CHI A;  1WSF A;  3U6F A;  3EKS A;  3KWI A;  3CC2 N;  1WAJ A;  2P9K A;  4Z4F A;  4IOC L;  1BA0 A;  4RW7 A;  5AQY A;  1FK9 A;  4FXD A;  3OW2 M;  1F21 A;  5ADX H;  4PL7 A;  3ZX3 A;  2W6K A;  5LL6 Z;  2YHY A;  4CEE A;  3VQ4 A;  3A5O C;  2E2P A;  4WFB L;  4DTO A;  3R9P A;  5AQV A;  4CF0 A;  2ITG A;  1NKC A;  2VQE K;  3NE6 A;  3LP2 A;  4B9U A;  4M3W A;  4BR5 A;  5I9E B;  4PKG A;  3ZT4 A;  4JRQ A;  2E6L A;  3VEV A;  4GV6 A;  1NGH A;  5HL7 L;  4IBN A;  3O4N A;  4ELU A;  4MDA A;  2W41 A;  1S1U A;  3T7Z A;  4FLU A;  2QWN A;  1ILY A;  5BPL A;  3RVC A;  3SBG A;  4M3Z A;  5HRN A;  3DXM B;  3TAP A;  1L3V A;  4B9V A;  1VSI A;  3OYE A;  4W5O A;  1Q9Y A;  2HHV A;  2OAN A;  5KRT A;  4BRA A;  4JKD A;  4CJ3 A;  3V81 A;  4KI4 A;  4E7K A;  5M1Q A;  1HX1 A;  2OPQ A;  3AA3 A;  4KKO A;  5AZI B;  4CJV A;  2JWL A;  1VSK A;  1VQK N;  3QEX A;  3ZSZ A;  3BZC A;  3BGR A;  4OO1 J;  4DV7 K;  1OH7 A;  4CK3 A;  4B1V A;  4DLG A;  3C7N B;  4EHU A;  1HNX K;  1QHA A;  4EZ9 A;  4B9M A;  4KRE A;  4LF7 K;  2Z1H A;  4BE2 A;  2PYL A;  2ITM A;  5GAD P;  3WQT A;  4CJR A;  4CZG A;  3RR8 A;  1S6Q A;  5CY4 A;  2ZJQ L;  2O4G A;  2RE2 A;  3DLH A;  3K5O A;  2NRH A;  3K0S A;  1JXB A;  4DS4 A;  1NK4 A;  4H0T B;  4MDB A;  4WFA L;  4IFV A;  4JKC A;  1DTQ A;  3BDP A;  1KRP A;  1SL1 A;  3DOK A;  5AQH A;  2ASO A;  4CHP A;  4RCH A;  2YHX A;  3WT0 A;  4CJF A;  1EXQ A;  2D5R A;  1XNQ K;  4FLT A;  4W5N A;  5EX5 A;  4DV5 K;  1TV6 A;  1JLE A;  4ID1 A;  3VQ8 A;  3NGI A;  2E1Y A;  4IEE A;  1RT5 A;  3ZEU B;  1N5Y A;  5FRM A;  4IO8 A;  4CZE A;  4CGG A;  3ISN C;  3O9T A;  1Z25 A;  1HPZ A;  1VRT A;  4AHC A;  4X66 K;  1J53 A;  1IKW A;  3CXC M;  4K43 A;  3VQ5 A;  5J2N A;  4JI7 K;  2OPP A;  4KHN A;  1JJ2 M;  4NXN K;  1WSG A;  4BRP A;  3LAL A;  4B3T K;  4GKJ K;  3LDQ A;  3QB0 A;  4GV3 A;  4DSL A;  1WOQ A;  3NH1 A;  1CZA N;  3U4L A;  1NKB A;  2DFH A;  4WCE L;  4KPY A;  2FBX A;  4WQ4 C;  3VTI A;  2P9U A;  3M8S A;  2ZJP L;  5CR4 A;  1BA1 A;  1X3M A;  3SMP A;  2HVH A;  1TKX A;  3S5T A;  3FGU A;  4N76 A;  4DU4 A;  4CIE A;  4A2B A;  1Q86 O;  4DB3 A;  4OPA A;  1GOA A;  3A5N C;  3TAF A;  4FM0 A;  3TSU A;  1X9J A;  5F1X A;  3S41 A;  1RT6 A;  4MQ3 A;  3S9H A;  1KAY A;  4FJ5 A;  4MO4 A;  1RTI A;  1VAZ A;  4NCB A;  3KLH A;  2HF3 A;  2P51 A;  3EKU A;  2WOM A;  2ZD1 A;  4ISG A;  5K14 A;  4DFM A;  1HR0 K;  4BAC A;  1UA1 A;  4AHT A;  2XY7 A;  2E2N A;  3E9L A;  3UE5 A;  3TAB A;  4CFC A;  1S1X A;  4OVL A;  1VQ5 N;  1DTT A;  4BRQ A;  1J5E K;  3QIP A;  3HM9 A;  3DLL L;  1OVQ A;  2OCE A;  3L4Q A;  2YHW A;  4IG0 A;  3BEX A;  4KHQ A;  3M6G A;  1KCF A;  4BRL A;  4DR7 K;  4EFH A;  3VEN A;  5JLF A;  1XMO K;  1QSY A;  3NVK A;  2O8C B;  2B4J A;  2QTD A;  1QVG M;  3P39 A;  3THY A;  3SJJ A;  2JLE A;  4M41 A;  3CFR A;  2OPR A;  4HVJ A;  3SCX A;  3RRH A;  2HBJ A;  4M3T A;  4J2A A;  3T19 A;  1SL0 A;  1RT7 A;  3L8B A;  3DRS A;  3PV8 A;  3C95 A;  4CED A;  3P38 A;  1XHZ A;  4BQZ A;  1NNE A;  3MEC A;  3O3F A;  1B9D A;  1FXX A;  2Z1G A;  4BG9 A;  1HKC A;  1K6Y A;  3KLF A;  3QNN A;  4FWP A;  4YOU A;  1JXE A;  3TI0 A;  3OBW A;  2O4I A;  3AVL A;  2YCH A;  3AGK A;  4CEQ A;  3MWT A;  4E89 A;  4I2Q A;  4OJR A;  5C24 A;  4BRN A;  1NMN A;  4NXM K;  4JEP A;  4ID5 A;  4DV3 K;  1RDW X;  4CGI A;  1O13 A;  2V7Z A;  4IKF A;  1ZBH A;  3WXK A;  4RWT A;  4ELT A;  5A2Q O;  1IG9 A;  4WQ5 A;  4F8R A;  3NMU A;  4O44 A;  4GNI A;  4DTM A;  5AQQ A;  1P8Z A;  5JEN A;  4FOE A;  1C0U A;  1WB9 A;  4MLE A;  2A5X A;  5TKW A;  4H0O A;  4AHV A;  3K59 A;  1BU6 O;  5CYQ A;  3I0R A;  4ZTJ A;  4CJQ A;  1NG9 A;  1HNI A;  1IKV A;  3ZT3 A;  1JLQ A;  3NBP A;  2XY8 A;  1LW0 A;  1L5U A;  1SV5 A;  1NGB A;  4JN4 A;  5AR0 A;  4WE1 A;  2KFZ A;  4KI6 A;  2D0A A;  4LFC K;  4E3S A;  3CCL N;  1ITG A;  1VQ9 N;  4CEO A;  1MWK A;  4CIG A;  1G15 A;  5DMR A;  3DXM A;  4CJ5 A;  3IFR A;  1HKB A;  5AQW A;  4EAH D;  3F5T A;  3ENH A;  3AA2 A;  4K42 A;  4C1N I;  5LJW A;  3ZSY A;  4YHH K;  1VQ8 N;  3DOL A;  4RTF D;  3MX2 A;  5BN9 A;  1TL1 A;  3UB5 A;  3SUN A;  5AZI A;  4LF6 K;  4JAX A;  5FPE A;  2KFN A;  4DTP A;  1X9S A;  4BGB A;  2VYP A;  1MDU B;  5GIN A;  2YKM A;  5HP1 A;  2QKK A;  1RGI A;  3N4P A;  4CEB A;  1N34 K;  3B6O A;  4GMJ B;  4DTN A;  3C7N A;  2HHT A;  1SKR A;  4BC4 A;  4DMN A;  3Q7B A;  1VQP N;  3IS9 A;  1VQ7 N;  4X64 K;  3FE1 A;  3OYA A;  3MN7 A;  3VQE A;  3H3O B;  4I9L A;  4A61 A;  1RDA A;  2YV0 X;  1SQK A;  3TU5 A;  4DG1 A;  1U6Z A;  1JKH A;  4FJ8 A;  3QBX A;  4DS5 A;  1YT3 A;  1S1W A;  5ADX A;  4DQS A;  1D5A A;  5DK5 A;  1ASW A;  2W42 A;  4YFU A;  3FZK A;  2KLA A;  1NJZ A;  2GWK A;  3VQC A;  2HBL A;  2LSN A;  2PY5 A;  4JK7 A;  1RBV A;  3ULD A;  1QE1 A;  3CET A;  1LCU A;  3ZEU A;  5AQN A;  1U49 A;  1C1C A;  4FWM A;  3OYJ A;  4CZF A;  4YDU A;  3HOS A;  4AIL C;  1CXU A;  3OJS A;  4E1N A;  3HVT A;  3J8A A;  4MFB A;  3HST B;  3BY5 A;  4BDP A;  4CI6 A;  2HHH K;  1GOC A;  1CZ9 A;  1BI4 B;  2YJE A;  5GAG P;  1QSL A;  3HVR A;  3ZSO A;  4WF9 L;  5HRR A;  3QIO A;  1OKJ A;  4OKJ A;  4FWO A;  5AQR A;  2UXD K;  4H0V B;  4C8L A;  4CJT A;  4AH9 A;  3C94 A;  3J80 O;  2NRV A;  3HXM A;  5HBM A;  2X78 A;  2KZZ A;  3ZSR A;  1CLQ A;  3QIC A;  4JHD B;  3JAM O;  1ZBF A;  2Y1J A;  3WXI A;  3LP1 A;  3HP6 A;  2I7N A;  3AO3 A;  1VSF A;  2F96 A;  3MN9 A;  1NKE A;  4DR3 K;  4Q5V A;  1WBD A;  1KC8 O;  2NNW A;  4KH4 A;  5AQF A;  4H8K A;  3CFP A;  4LH5 A;  3DAW A;  3E01 A;  3RSE B;  4JD2 B;  1M90 O;  1HYV A;  4Y1D A;  4BRF A;  5KRS A;  1BHL A;  3O9U A;  4KHW A;  4WYB A;  1X9M A;  2OZS A;  4JI3 K;  3K9J A;  3D2F B;  1Z26 A;  3EO3 A;  4H0P A;  1NK6 A;  1NJX A;  3KTQ A;  1S22 A;  3AVM A;  3D0P A;  4FK4 A;  3KLI A;  4PA1 A;  3DXK B;  2D0O A;  4CGD A;  3K5N A;  2HBM A;  3K5M A;  5TKY A;  1Q81 O;  3OYN A;  2F7T A;  4CZL A;  4E72 A;  1UA0 A;  4OGC A;  2O8C A;  1TKT A;  5SZT A;  4CGJ A;  1TKZ A;  3RTV A;  4A57 A;  1KVC A;  3KKS A;  1A5V A;  5FPN A;  3OY9 A;  4KHY A;  1N36 K;  3ZET B;  4R5P A;  3QEP A;  3H45 C;  2YHB A;  3ZSQ A;  1SL2 A;  1X3N A;  4DU3 A;  1SAZ A;  2HNY A;  2AJQ A;  2IAJ A;  3MAQ A;  2JGU A;  4U7B A;  4LY7 A;  3E66 A;  2GX9 A;  4J2B A;  1BDG A;  4JKF A;  1L3U A;  1DKG D;  5HOO A;  3AVF A;  3HTV A;  4DSE A;  1VQL N;  4JK8 A;  2GEL A;  4DF8 A;  3Q7C A;  3PSI A;  1WNS A;  3VGL A;  3VES A;  1QS4 A;  5FPM A;  2HHU A;  3EEQ A;  5AQG A;  3UIQ A;  3AA4 A;  5JS2 A;  3ZSW A;  2O8F B;  1RT2 A;  3ZLJ A;  1QSS A;  2HOE A;  1XHX A;  4E7L A;  3THW A;  3ZX2 A;  4DKW A;  1SUQ A;  5H1S Q;  2Q31 A;  4JKE A;  2YNG A;  1T6C A;  1J9A A;  4ISF A;  3K2P A;  1QTM A;  4FVM A;  1ZBS A;  4NLB A;  1IO2 A;  4LFA K;  2KZM A;  1QQM A;  4CEZ A;  4C8K A;  4FJG A;  3OS0 A;  1BIZ A;  2HB5 A;  3MN5 A;  3NFA A;  1NOZ A;  4YOT A;  3IDH A;  4CJ7 A;  5HRS A;  1DGK N;  4KTZ A;  4I2P A;  3HK2 A;  5SWM A;  4I9Q A;  1U45 A;  4GV9 A;  3ALY A;  1C0M A;  3I56 N;  3TTD A;  4F2R A;  4CF9 A;  3K58 A;  4A5A A;  2A6A A;  4DV4 K;  1K9M O;  3WNE A;  2QWQ A;  3SPY A;  1W0H A;  4IJA A;  3NAE A;  4CHY A;  2O8E B;  4FOI A;  1U48 A;  2BGG A;  3WQU A;  4BE1 A;  2ZM6 K;  4DFP A;  2YI1 A;  3H6E A;  4Q0B A;  3PX0 A;  3IRX A;  2V7Y A;  2KQ2 A;  3PIO L;  3CME N;  4E7H A;  3SBT A;  1N6Q A;  3B8A X;  4DTR A;  2FF6 A;  2HHS A;  4AM7 A;  1RBR A;  1TK5 A;  1GLD G;  4NYF A;  4HCC A;  1VK0 A;  2JWK A;  2HNZ A;  3B6P A;  1NJY A;  2Q0R A;  3R1X A;  4X65 K;  3AVH A;  3TAR A;  3C6T A;  2D0B A;  5C10 A;  3UKR A;  3EE8 A;  3MWP A;  1LWF A;  3AA5 X;  4CCH A;  4H03 B;  4BRE A;  4NCA A;  3P83 D;  3VQQ A;  1HYS A;  3PO4 A;  2QKB A;  2YNI A;  3O3G A;  4XJX A;  1VRU A;  4DTU A;  3R8E A;  4YOV A;  3N4Q A;  1VQ4 N;  2NRR A;  4FJ7 A;  3V1O A;  1VQN N;  5BR9 A;  4IDH A;  2C1I A;  3AO1 A;  3AAQ A;  4CF8 A;  3KK3 A;  1C6V A;  3O6W A;  1V4S A;  1HUX A;  2ASP A;  4B1W B;  3OYI A;  4ILG B;  2G8K A;  4E0D A;  1SKW A;  2NUB A;  3ZCM A;  1K8A O;  2ZWH A;  3O8M A;  4NYN A;  1QQC A;  2B6A A;  3AVC A;  2Y1I A;  4BR2 A;  4CJK A;  3C0B A;  4JI0 K;  4DSK A;  3M8R A;  3OYG A;  5CE3 A;  4XIU A;  4O8U A;  3AAP A;  3SUQ A;  1ASV A;  4EHT A;  1YJN N;  1LOT B;  3O1W A;  3CPW M;  1Q9X A;  1U2V B;  3P31 A;  4G1Q A;  4JV5 K;  1BI4 A;  1RFQ A;  1Q7Y O;  1T44 A;  3A0I X;  1RBU A;  4Z4C A;  3SMS A;  1OH5 A;  1K8K B;  3LWM A;  4H0Y B;  3L2W A;  4CER A;  5KPR A;  1E4G T;  1RT1 A;  4OPJ A;  3EZ5 A;  2BAN A;  1YF5 L;  3OYF A;  2F8T A;  4JHD A;  3LDL A;  2WTU A;  3CM6 A;  3NH0 A;  4J2D A;  3DLR A;  4FCY A;  4FW1 A;  4FYD A;  4N47 A;  3TAM A;  3EN9 A;  3U3Y A;  4F2S A;  2X6S A;  1HRH A;  3EYZ A;  4B3S K;  2FLO A;  1RTH A;  3FZF A;  4Y0W A;  3CCS N;  5D3G A;  4FPA A;  4JYA K;  3RSE A;  4JD2 A;  3PUF A;  4CHQ A;  4HUG A;  4FJN A;  2VWB A;  5JVH L;  3OJU A;  4J8F A;  3J81 O;  1Q82 O;  3D2F A;  1OH6 A;  1NK0 A;  1WN7 A;  3C6A A;  3ITH A;  3MXJ A;  1R0A A;  2RHK A;  3SQ0 A;  4FWQ A;  2F9T A;  4O55 A;  3O3H A;  4HUF A;  4AHR A;  3ZT2 A;  3DXK A;  2P1J A;  1E4F T;  4CJU A;  3QEW A;  3SV4 A;  4B8C A;  2Q3S A;  3BF1 A;  3CPE A;  3VEX A;  2E4L A;  3ULE B;  3SNN A;  4BWJ A;  2QXL A;  1VQM N;  4FWL A;  1HPM A;  3VA3 A;  4E1M A;  1TK8 A;  3JXU A;  4CEC A;  2XO7 A;  5CZ1 A;  5GIP A;  4Z4E A;  4YOX A;  4CJS A;  4JK9 A;  5M1K A;  1M1K O;  1FKP A;  1GLC G;  2NRZ A;  4BRI A;  3ZET A;  3I33 A;  4NB4 A;  1ZYQ A;  3M8Q A;  4F4K A;  4CK2 A;  1HYZ A;  2Z1I A;  1NK5 A;  3SQ1 A;  1OH8 A;  3OHR A;  2CH6 A;  4Z0U A;  3ATU A;  4GVM A;  3QLH A;  1GLJ O;  4CJW A;  3PX6 A;  3L2Q A;  5BN8 A;  3THV A;  4ISE A;  2VG6 A;  5EU7 A;  4LD0 A;  2E6M A;  3ZSV A;  4V19 S;  3WXJ A;  4KHU A;  4FK0 A;  3EE9 A;  4KBO A;  3CCR N;  1GLE G;  5KPZ A;  3D45 A;  3O1B A;  3HM8 A;  3CJC A;  3ENO A;  5BPN A;  5IT9 O;  3TAG A;  2O8F A;  2F8S A;  2YHA A;  3VEW A;  1HMV A;  3GE1 A;  5JLH A;  1RTD A;  3AGR A;  1T05 A;  4HWI A;  4BRM A;  4DTJ A;  4KH5 A;  4FWK A;  1REV A;  4PKI A;  4GW6 A;  3VQP A;  4HUE A;  4JI6 K;  4JKG A;  4BG8 A;  4DQI A;  4E7I A;  5J2P A;  2RPI A;  5KPT A;  4IEI A;  3CCQ N;  3KJV A;  5AQJ A;  1IH7 A;  3ZT1 A;  4I6M B;  1BQM A;  5AQT A;  4CFB A;  2OPS A;  2YNH A;  3IUC A;  3CF5 L;  5JVG L;  1TUU A;  4FJJ A;  4YOY A;  3NGZ A;  2DY4 A;  5C0Y A;  5E26 A;  3H1Q A;  4RW6 A;  4CFA A;  3K57 A;  1T03 A;  1ESV A;  4DR6 K;  1D9D A;  2OZM A;  4DR2 K;  3H1V X;  4IOA L;  1ATR A;  2A1R A;  4BVO A;  3S3O A;  4B3R K;  3L2R A;  4FJL A;  4E1J A;  4FJX A;  2O8E A;  3C65 A;  1B92 A;  2VWK A;  2QWR A;  4KHP K;  1KQS M;  3SZ2 A;  4KAZ A;  5AQL A;  4NO7 A;  3THW B;  3ZT0 A;  5HLF A;  3A2F A;  1WSI A;  3DMJ A;  5AQP A;  1YXQ A;  4FJK A;  1TAQ A;  1VSJ A;  3BP8 A;  4PHT X;  3CJ1 A;  3OYK A;  3NHG A;  3SUP A;  3E1Y A;  2E8A A;  2FBT A;  1Y97 A;  3H08 A;  3AO5 A;  1IV0 A;  1W9H A;  2UYT A;  3VQ7 A;  1VSM A;  3LZJ A;  2NZT A;  3LDP A;  3AVG A;  1YVN A;  4BE0 A;  4JI1 K;  3CCM N;  4IZ9 A;  1P90 A;  4KFB A;  3O08 A;  1NGA A;  3TWH A;  2W00 A;  5CYM A;  4BR4 A;  1UOC A;  3LAK A;  4KB1 A;  4CGH A;  3C6H A;  2A42 A;  1A5W A;  3H3N O;  4IXC A;  4BRG A;  4DQR A;  4M42 A;  1GLB G;  1TUY A;  1TKD A;  4LSN A;  2G8H A;  4F3T A;  1QZ6 A;  4LF4 K;  5F0X A;  1YI2 N;  3M5R A;  4DF4 A;  2E20 A;  1HNZ K;  2HHX A;  4WQ4 A;  3L0Q A;  1BO5 O;  1NM1 A;  1UAX A;  4JKA A;  2P9I B;  2FSN A;  1VQ6 N;  3G10 A;  3OYD A;  3U9D A;  3CCJ N;  1KVA A;  3DRP A;  1LV5 A;  3ZSX A;  4W5T A;  3LDN A;  2ATQ A;  1RDC A;  2NLX A;  1NU0 A;  1S1T A;  3UKR B;  3D6R A;  2EX3 A;  4DR4 K;  4BGA A;  2E88 A;  1FW6 A;  4E7J A;  1YAG A;  3CFO A;  5EOY A;  3HYF A;  1HJR A;  4M3R A;  3PLA A;  3LM9 A;  4BWM A;  1WUA A;  3D2E B;  2QA4 N;  1U2V A;  4A62 A;  1ZBU A;  4Z4H A;  2D0P A;  1U4B A;  2OTL N;  4BQL A;  4CD1 A;  3MEG A;  5DM6 L;  1ZXO A;  4JKH A;  1XNR K;  4JLH A;  3V9Z A;  4BC5 A;  1K8K A;  2IDO A;  1JCG A;  3W0L A;  1RBS A;  5JIC A;  4Z94 A;  1HQE A;  1BCM A;  1IBK K;  3RMA A;  1S9G A;  2HHQ A;  2QWM A;  1WSJ A;  4JI8 K;  3LL3 A;  4FWN A;  3MCP A;  3SI6 A;  2P9S B;  1IG8 A;  4NCG A;  3LWL A;  1IBM K;  5ELZ A;  5AQM A;  4JNE A;  3QER A;  4PWD A;  2IOC A;  4AF1 A;  2KKZ A;  4DV2 K;  4M7X A;  1VHX A;  4CW7 B;  1QQO A;  1BWF O;  3D7E O;  1BGX T;  3VF2 A;  1MU2 A;  2X6N A;  3UKU A;  4IFE A;  3HPO A;  4DFK A;  4JS5 A;  1HJO A;  2D1K A;  3F9M A;  2E5L K;  3W3D A;  2O8D B;  2PFU A;  4RW8 A;  2Q1N A;  2AA4 A;  4B1Y B;  4KHS A;  3LDO A;  4JI5 K;  2QWL A;  3CJB A;  3VEY A;  5LJV A;  3DM2 A;  1T3V A;  1TL3 A;  2ASM A;  4PY5 A;  3HP9 A;  2QW9 A;  4ICL A;  3OYM A;  4XH1 A;  1SS6 A;  4Z4I A;  4FO0 A;  3CMA N;  1T6D A;  3HI0 A;  3MN6 A;  3ULE A;  1TVR A;  5GAH P;  5AQO A;  3O80 A;  4J2E A;  3M8P A;  4OLA A;  3NF9 A;  4CJP A;  4AQY K;  2QEX N;  1Z6R A;  4FWS A;  2IVO A;  5KI6 A;  1YVU A;  1KFS A;  1Z05 A;  3A5L C;  4LF9 K;  3FR0 A;  3QML A;  4DHY A;  4B9T A;  5BRD A;  5T7B A;  2KTQ A;  1X1P A;  5I3U A;  3R6M A;  3FZM A;  3LP3 A;  3WXL A;  1RBT A;  3ZYY X;  1NGF A;  3PX4 A;  3JSM A;  1QZ5 A;  2YNF A;  3EL2 A;  4C1N K;  2HST A;  3F2K A;  4DUZ K;  3CHW A;  1HQU A;  3SAG A;  4W5Q A;  3LPT A;  3DLK A;  1BL3 A;  2VGM A;  2NRT A;  4CEA A;  4FLZ A;  4IG3 A;  1JLF A;  3AO4 A;  4K8Z A;  4B1Z A;  1S5J A;  1TGO A;  1VSH A;  3ASM A;  5FDL A;  3CQY A;  3PY8 A;  3SQ4 A;  3E9P A;  3KKR A;  1JCF A;  3NF7 A;  1MWM A;  2PAV A;  3SLC A;  1TK0 A;  3ID6 A;  5AQS A;  3TR8 A;  3VEZ A;  4C8N A;  2AP1 A;  4FJ9 A;  4BRD A;  1KAX A;  4DCH A;  2D0C A;  4B9S A;  3VQA A;  4JS4 A;  3L3V A;  4OLB A;  3GDQ A;  4N41 A;  1A5X A;  2WFB A;  3U9Z A;  4H5T A;  4I6M A;  5AQZ A;  4M7Y A;  3SK3 A;  4BDZ A;  3P5J A;  4FWR A;  4CZI A;  1WSE A;  3CM5 A;  1KFD A;  1QHT A;  4DV1 K;  1IBL K;  5KGW A;  4BRO A;  4O5B A;  3CQ8 A;  1RCH A;  1BUP A;  3KZB A;  3RMC A;  4NLC A;  3P1G A;  1LW2 A;  3FLC O;  2F9W A;  1GOB A;  3CQX A;  5KTQ A;  1WLJ A;  1XI1 A;  3KLE A;  3IG1 A;  3WXM B;  3T3F A;  5DM7 L;  1YJ9 N;  2E1Z A;  4CHN A;  5GAE P;  3TTF A;  1XC9 A;  4JKG B;  1CXQ A;  4ELV A;  3MK6 A;  2ZGY A;  3U3G A;  5HRO A;  3LP0 A;  3MCA B;  1J5O A;  4AHU A;  2UUA K;  5M1O A;  4O0J A;  3CG7 A;  2HMI A;  3MDQ A;  2XRI A;  4KV8 A;  2ZF5 O;  4A59 A;  5F2R A;  4B08 A;  2Q0U A;  1EP4 A;  2B5J A;  2Z1J A;  4EP4 A;  5BR8 K;  5BPM A;  4EP5 A;  4CJE A;  4KRF A;  1C0T A;  2HND A;  2HHI A;  2VCP A;  4ZHR A;  4B1X B;  2IVN A;  1RT4 A;  2P9N B;  2O8B B;  4PQU A;  2P9L A;  5GIO A;  4IDK A;  3M3Z A;  2CH5 A;  5M1N A;  2ZGZ A;  4DSF A;  4CZJ A;  4DFJ A;  1IKY A;  3VQB A;  3AAR A;  4DLE A;  1ZC6 A;  4W5R A;  4G9Z A;  3LAM A;  2P9I A;  5C15 A;  5C2F A;  3PO5 A;  2HHW A;  4RG8 A;  2FBY A;  1YUW A;  1BIU A;  2KHO A;  1KTQ A;  3OYL A;  2G8F A;  3CC7 N;  2RKI A;  2D4W A;  3RR7 A;  2GUP A;  1TYQ B;  4RW9 A;  1H1V A;  1S72 N;  4M63 C;  4YOR A;  1LAV A;  5J2Q A;  4OX9 K; 
#chains in the Genus database with same CATH homology
 3IFR A;  1HKB A;  4BRH A;  5AQW A;  4EAH D;  3F5T A;  3ZX0 A;  3ENH A;  5AZJ B;  5GIP A;  3O4W A;  3CD6 N;  4K25 A;  1YJW N;  4K42 A;  4C1N I;  3O9R A;  5LJW A;  4YOX A;  3G4S N;  1VQ8 N;  5FPD A;  4JK9 A;  4RTF D;  5M1K A;  3D2E A;  1M1K O;  1GLC G;  3MX2 A;  5BN9 A;  2NRZ A;  4BRI A;  4R79 A;  3UB5 A;  3ZET A;  2P9U B;  5AZI A;  1QQN A;  4YOW A;  1GLL O;  3I33 A;  4JAX A;  4NB4 A;  5FPE A;  1VQM N;  2OTJ N;  2A41 A;  4BGB A;  2VYP A;  2DPN A;  1MDU B;  2E2O A;  5GIN A;  3OHR A;  4L3Q A;  2CH6 A;  2CGJ A;  2GEM A;  2QM1 A;  3ATU A;  4IWV A;  1RGI A;  3N4P A;  1GLJ O;  1R59 O;  4FL9 A;  3C7N A;  2CGL A;  4BR9 A;  4H5R A;  4BC4 A;  2BUP A;  2CGK A;  3Q7B A;  5BN8 A;  3G71 N;  1VQP N;  1W2B M;  4ISE A;  1C0F A;  2P9S A;  1VQ7 N;  3BUZ B;  3VMF B;  5AQX A;  3FE1 A;  1KAZ A;  3WXJ A;  1KD1 O;  3M1F A;  1Y64 A;  3MN7 A;  4A61 A;  3H3O B;  4BRC A;  3EE9 A;  3CJ7 A;  4KBO A;  4A5B A;  1GLE G;  5KPZ A;  3CCR N;  1SQK A;  4HTL A;  3O1B A;  5E84 A;  5EXW A;  3TU5 A;  3HM8 A;  3CJC A;  2FXU A;  3VER A;  1U6Z A;  3HSC A;  3ENO A;  5BPN A;  3VEW A;  3QBX A;  3SAF A;  3QFP A;  1HKG A;  3GE1 A;  5JLH A;  3AGR A;  1YIJ N;  3CCE N;  5ADX A;  4HWI A;  4A2A A;  1XUP O;  4BRM A;  4KH5 A;  3CCV N;  4FWK A;  4CZK A;  3CC4 N;  4PKI A;  3CER A;  5AQI A;  4IJN A;  1XC3 A;  3O9S A;  2QI2 A;  3VF4 A;  4JKG A;  3U8X A;  2WUS A;  3L4I A;  4BG8 A;  1V4T A;  4FPB A;  3WUH A;  3FZK A;  2KLA A;  4IEI A;  5KPT A;  1K73 O;  2GWK A;  3CCQ N;  5M1P A;  1D4X A;  2HBL A;  5AQJ A;  4JK7 A;  2HBK A;  4I6M B;  5AQT A;  2Q2R A;  3TSP A;  4DQ8 A;  4B9Q A;  3CET A;  3IUC A;  1LCU A;  3CF5 L;  3ZEU A;  1TUU A;  5JVG L;  4YOY A;  1QVF M;  5AQN A;  2QWO A;  3GBT A;  3IKM A;  5C0Y A;  4FWM A;  5E26 A;  4BC3 A;  3H1Q A;  4CZF A;  1NMD A;  4YDU A;  3HOS A;  3A8Y A;  3IMX A;  5AFU A;  1ESV A;  2YX6 A;  5MLC Q;  1NLV A;  2NRX A;  3H1V X;  3J8A A;  4IOA L;  1ATR A;  3FZL A;  4BVO A;  3OBY A;  3GOI A;  4BVP A;  3SAH A;  5C12 A;  4E1J A;  4CI6 A;  4WQ5 C;  1NJI O;  3ENB A;  3C65 A;  2YJE A;  2QWR A;  5GAG P;  4BC2 A;  1KQS M;  3QDK A;  3HBT A;  3L6Q A;  5AQL A;  3CJ9 A;  4NO7 A;  4WF9 L;  2E2Q A;  1BG3 A;  3H46 O;  1OKJ A;  4F9O A;  4FWO A;  5AQR A;  3UKU B;  4H0V B;  1SZ2 A;  1XQS C;  5AQP A;  1YXQ A;  3WEE A;  3FZH A;  3BP8 A;  1RDU A;  3VEO A;  2NRV A;  3CJ1 A;  4PHT X;  3A5M C;  4H5V A;  4BEB A;  3R3L A;  3E1Y A;  2E8A A;  1IJJ A;  3QIC A;  4JHD B;  4MO5 A;  3I8B A;  3VF6 A;  2UYT A;  3KHY A;  3QBW A;  1MA9 B;  4AM6 A;  4OPH A;  3WXI A;  3JS6 A;  2P9P B;  5CHI A;  3TPQ A;  1DT9 A;  2FSJ A;  2I7N A;  2NZT A;  3LDP A;  4CZM A;  3EKS A;  3KWI A;  3CC2 N;  2P9K A;  1YVN A;  2GTD A;  3MN9 A;  2I7P A;  4IOC L;  1BA0 A;  3AY9 A;  4ILJ A;  5B8H A;  1KC8 O;  3CCM N;  2NNW A;  4IZ9 A;  4KH4 A;  3TSQ A;  1P90 A;  5AQF A;  5AQY A;  3OW2 M;  3O08 A;  1NGA A;  4PL7 A;  5ADX H;  2W00 A;  3ZX3 A;  4BR4 A;  3KVG A;  3CI5 A;  3DAW A;  3RSE B;  4JD2 B;  2YHY A;  1M90 O;  4BEC A;  3VOV A;  3A5O C;  3C6H A;  2A42 A;  2E2P A;  4BRF A;  3H3N O;  4IXC A;  4BRG A;  4WFB L;  3O9U A;  1GLB G;  1NGG A;  1TUY A;  4WYB A;  3R9P A;  4IOX A;  5AQV A;  3K9J A;  3D2F B;  4JKB A;  1QZ6 A;  3EO3 A;  3E9O A;  4H0P A;  5F0X A;  1S3X A;  1YI2 N;  3M5R A;  4BR5 A;  1S22 A;  5AQU A;  2E20 A;  5I9E B;  4PKG A;  4WQ4 A;  3L0Q A;  1BO5 O;  1NM1 A;  4JKA A;  2P9I B;  2FSN A;  3DXK B;  2D0O A;  2IVP A;  3DJC A;  1VQ6 N;  2HBM A;  3VEV A;  5EY4 A;  5TKY A;  4GV6 A;  3U9D A;  1Q81 O;  3CCJ N;  1NGH A;  2F7T A;  4CZL A;  2Q36 A;  3HZ6 A;  5HL7 L;  3GL1 A;  4MDA A;  2W41 A;  3LDN A;  3T7Z A;  5M1F A;  2NLX A;  2QWN A;  3UKR B;  1ILY A;  3D6R A;  5BPL A;  3RVC A;  3SBG A;  3DXM B;  4A57 A;  4BGA A;  2E88 A;  3CJA A;  4BRK A;  2OAN A;  4UY8 O;  1YAG A;  2W40 A;  5EOY A;  5FPN A;  1C0G A;  4BRA A;  4JKD A;  3PLA A;  3LM9 A;  1WUA A;  3D2E B;  2QA4 N;  5M1Q A;  1HX1 A;  1U2V A;  4A62 A;  3ZET B;  5AZI B;  2D0P A;  2OTL N;  4BQL A;  3H45 C;  4CD1 A;  2JWL A;  5DM6 L;  1X3N A;  1SAZ A;  1ZXO A;  4JKH A;  1VQK N;  5KQ8 A;  4U7B A;  4BC5 A;  1K8K A;  3E66 A;  2GX9 A;  3J7Z O;  1JCG A;  1W97 L;  3W0L A;  1BDG A;  4OO1 J;  4JKF A;  1DKG D;  5JIC A;  4Z94 A;  2GWJ A;  2WC9 A;  5HOO A;  4B1V A;  4YDU C;  3C7N B;  4H5W A;  4EHU A;  1NGC A;  3HTV A;  1QHA A;  2QWM A;  3VPZ A;  3LL3 A;  1VQL N;  4FWN A;  4JK8 A;  4CD3 A;  3MCP A;  2P9S B;  2GEL A;  2PBD A;  2ITM A;  3T69 A;  3Q7C A;  1IG8 A;  3VGM A;  5GAD P;  3WQT A;  3VGL A;  4CZG A;  3VES A;  1YIT N;  5ELZ A;  5FPM A;  5AQM A;  1JCE A;  4JNE A;  3I55 N;  4O8K A;  2ZJQ L;  1NGJ A;  5AQG A;  4AF1 A;  2RE2 A;  2KKZ A;  4M7X A;  2NRH A;  1Q82 O;  4B1U B;  1QQO A;  1BWF O;  3D7E O;  2HOE A;  4H0T B;  4MDB A;  4WFA L;  2WBN A;  4JKC A;  3VF2 A;  3ZX2 A;  4DKW A;  5H1S Q;  2Q31 A;  4XH5 A;  5BRF A;  4JKE A;  2P9N A;  2FSK A;  4QS8 A;  1T6C A;  3UKU A;  4IO9 L;  5AQH A;  2ASO A;  4IFE A;  4ISF A;  4RCH A;  2YHX A;  3WT0 A;  1ZBS A;  4NLB A;  4QS7 A;  1HJO A;  2D1K A;  3F9M A;  5EX5 A;  3W3D A;  2PFU A;  1QQM A;  2V51 B;  2C1G A;  3HRG A;  1ATN A;  3MN5 A;  2Q1N A;  2E1Y A;  4YOT A;  3IDH A;  2AA4 A;  4IEE A;  4B1Y B;  2P9P A;  1J6Z A;  3LDO A;  3ZEU B;  1DGK N;  2QWL A;  3CJB A;  3KK7 A;  4IO8 A;  3VEY A;  4CZE A;  3GG4 A;  3P4I A;  1T3V A;  5LJV A;  2ASM A;  3O9T A;  1YHQ N;  2A3Z A;  2QW9 A;  4XH1 A;  4GV9 A;  4K41 A;  1SS6 A;  3I56 N;  3CXC M;  3TTD A;  2J4R A;  4K43 A;  2QWP A;  4FO0 A;  3CMA N;  3O9Q A;  1T6D A;  3HI0 A;  4A5A A;  2A6A A;  3MN6 A;  1JJ2 M;  4MLH A;  3ULE A;  1K9M O;  4BRP A;  1VQO N;  2QWQ A;  5GAH P;  5AQO A;  4IJA A;  1TYQ A;  3O80 A;  4FOI A;  3LDQ A;  1KXP A;  3HOT A;  3WQU A;  3QB0 A;  2QEX N;  4BE7 B;  4GV3 A;  1WOQ A;  1Z6R A;  2IVO A;  2YI1 A;  4FWS A;  3H6E A;  1CZA N;  5AZJ A;  3G6E N;  3U4L A;  1Z05 A;  2P9L B;  3A5L C;  3WEE B;  2V7Y A;  3FR0 A;  3QML A;  4DHY A;  3PIO L;  3MMV A;  3CME N;  3CIP A;  5BRD A;  4WCE L;  4WQ4 C;  3SBT A;  3VTI A;  2P9U A;  3B8A X;  3ATV A;  2FF6 A;  3FZM A;  3R6M A;  4AM7 A;  4C23 A;  5KQD A;  3WXL A;  5C2D A;  2ZJP L;  5CR4 A;  3ZYY X;  1BA1 A;  1X3M A;  1NGF A;  3SMP A;  3DWL A;  5BRH A;  1GLD G;  1QZ5 A;  2JWK A;  5EVZ A;  3NVM A;  3EL2 A;  3FGU A;  3KWG A;  2Q0R A;  5BRE A;  3R1X A;  4C1N K;  2HST A;  1BOT O;  3F2K A;  3CHW A;  2P9K B;  5AFU H;  3SAG A;  4A2B A;  1Q86 O;  5C10 A;  4DB3 A;  4OPA A;  3UKR A;  3EE8 A;  3A5N C;  3MWP A;  2VGM A;  2NRT A;  1X9J A;  3TSU A;  5F1X A;  3S41 A;  4XH4 A;  4H03 B;  4BRE A;  1ATS A;  4B1Z A;  1KAY A;  4MO4 A;  1VAZ A;  2V52 B;  2HF3 A;  3EKU A;  4CBX A;  4ISG A;  3LM2 A;  3CQY A;  1GLF O;  3E9P A;  4BR7 A;  5LY3 A;  4XJX A;  2E2N A;  1JCF A;  3SJH A;  3R8E A;  3E9L A;  2HMP A;  2VGN A;  3UE5 A;  1MWM A;  2PAV A;  4YOV A;  3SLC A;  3N4Q A;  3ID6 A;  1VQ4 N;  5AQS A;  2HF4 A;  3VEZ A;  4BRQ A;  4CJ7 A;  2NRR A;  1VQ5 N;  3DLL L;  1VQN N;  5BR9 A;  2IIR A;  2AP1 A;  3L4Q A;  4IDH A;  2C1I A;  2EWS A;  3AAQ A;  4BRD A;  1KAX A;  2YHW A;  4DCH A;  4U67 L;  3BEX A;  3M6G A;  1NWK A;  4BRL A;  3O6W A;  1V4S A;  1HUX A;  3GDQ A;  2ASP A;  3VEN A;  4EFH A;  4EIA A;  4O5F A;  4B1W B;  4ILG B;  4BY9 C;  2WFB A;  3U9Z A;  4LC9 B;  5JLF A;  4H5T A;  4ILH A;  4I6M A;  5AQZ A;  3NVK A;  4M7Y A;  3SK3 A;  4FWR A;  1K8A O;  2ZWH A;  2QTD A;  4CZI A;  1QVG M;  3O8M A;  3ID8 A;  3P39 A;  4BR2 A;  2FF3 B;  3K9K A;  3C0B A;  4BRO A;  5CE3 A;  2HBJ A;  1BUP A;  3KZB A;  4GY2 B;  4O8U A;  4QS9 A;  1OVY A;  2YJF A;  3AAP A;  2Q97 A;  4NLC A;  4EHT A;  3FLC O;  1YJN N;  2NRW A;  1LOT B;  3O1W A;  2F9W A;  3CQX A;  2H3G X;  3CPW M;  4CBW A;  3FFK B;  4GVE A;  1U2V B;  3P31 A;  4XEI A;  3VTH A;  1RFQ A;  1Q7Y O;  3P38 A;  3WXM B;  1T44 A;  3A0I X;  4PKH A;  4BQZ A;  3SMS A;  4CZH A;  5DM7 L;  1YJ9 N;  2E1Z A;  1K8K B;  1EO1 A;  4H0X B;  4BG9 A;  5GAE P;  1HKC A;  3TTF A;  4H0Y B;  4JKG B;  5KPR A;  1E4G T;  3MK6 A;  2ZGY A;  4FWP A;  3MCA B;  1YF5 L;  3G25 A;  4JHD A;  4YOU A;  5M1O A;  3LDL A;  3OBW A;  3OA9 A;  4H5N A;  3MDQ A;  2YCH A;  3AGK A;  3MWT A;  2ZF5 O;  3PIP L;  3EN9 A;  4A59 A;  5F2R A;  2Q0U A;  3TTC A;  4BRN A;  5BPM A;  4JEP A;  2FLO A;  2BTF A;  2VCP A;  1RDW X;  4B1X B;  2IVN A;  3FZF A;  4Y0W A;  3CCS N;  4BR0 A;  4FPA A;  1O13 A;  2P9N B;  2V7Z A;  3BF3 A;  4JD2 A;  3RSE A;  2ZJR L;  3MX5 A;  2P9L A;  3WXK A;  4RWT A;  2VWB A;  5JVH L;  5GIO A;  2A40 A;  1G99 A;  4WQ5 A;  4J8F A;  3NMU A;  3M3Z A;  4GNI A;  1EQY A;  2CH5 A;  5M1N A;  2ZGZ A;  3D2F A;  1NGD A;  5AQQ A;  1P8Z A;  4KH6 A;  4CZJ A;  1HLU A;  1NGI A;  3O5B A;  3CCU N;  4FOE A;  3QFU A;  3AAR A;  5AQK A;  4MLE A;  2A5X A;  5TKW A;  4H0O A;  3C6A A;  2RHK A;  3VGK A;  1ZC6 A;  3VET A;  1BU6 O;  4G9Z A;  1N8R O;  4FWQ A;  2F9T A;  2P9I A;  3DXK A;  5C15 A;  1E4F T;  5C2F A;  1NGB A;  3BF1 A;  4JN4 A;  3CPE A;  1GLA G;  5AR0 A;  3VEX A;  1YUW A;  4PL8 A;  3ULE B;  3EZW A;  2KHO A;  3CC7 N;  2QXL A;  3CCL N;  4FVU A;  2D4W A;  4FSV A;  1NGE A;  2BH1 A;  4FWL A;  1NBW A;  1TYQ B;  1Q18 A;  1HPM A;  1H1V A;  2GUP A;  1MWK A;  5JMV A;  4WFN L;  1S72 N;  1VQ9 N;  3JXU A;  4M63 C;  4YOR A;  3DXM A;  4CBU A;  1DEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...