3A5TA

Crystal structure of mafg-dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
HMGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Alternative DNA Recognition by Maf Transcription Factors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator/dna
molecule keywords Transcription factor MafG
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a5tA00
4LC1A 1T2KC 1DH3A 1JNMA 3NXSA 3A2AA 2XU6A 3OAKA 2P67A 2W6AA 1CZQA 2P7JA 2R32A 4HYTB 2IPPA 3M0DA 3HE5B 1CI6B 1S9KE 2E42A 1GU5A 1J2JB 3TNUB 2XV5A 4B86A 5AVVB 3M06A 2YO2A 1CSBA 2WTYA 1X8YA 3TYYA 3VMZA 5AVTB 5AVXB 5AW3B 2R5DA 1GU4A 3L37A 3UIAA 2H7HA 2W27A 3KDPB 2WPQA 3VTPC 3KQGA 2WT7B 1FAVA 1HWTC 1OXZA 1MUUA 1HUCA 3LIEA 4GKGA 5AVYB 5AVZB 3VMYA 5AW5B 3VN0A 5AVSB 1H8AA 5AW2B 2Q3IA 5APWA 3VMXA 4C7NB 2ZXEB 3NFQA 3P8MC 3L36A 5AW9B 1T2KD 1GD2E 1GZLA 5AW0B 5APVA 1KQLA 3IR9A 3M91A 4DZOA 5AW8B 3VYIA 3A5TA 1GK4A 3P32A 2YNYA 1SLQA 1JUNA 2KP8A 1CI6A 2JJLA 5AW6B 3MD0A 3NMDA 4AYCA 5AW1B 4C7NA 2QM7A 2C9LY 4AUWA 2E43A 2Q7CA 4AQRD 1A02J 3HTKA 5APTA 5APSA 5AVQB 3HE5A 3A3YB 1OWAA 3LIDA 5APQA 4I6MC 4M3LA 1H89A 1FOSF 4C46A 3M9HA 1A02F 3SWFA 3HE4B 4I2LC 2BASA 1SP4A 1YYCA 3M9BA 3A7OA 1FOSE 4JYBA 2ZFCA 5APUA 2R3CA 5AVWB 4KHXA 2P2UA 2QM8A 3V4WA 3HE4A 3TK1A 1IO4A 1MV8A 3V5BA 5APYA 3I5CA 4JYCA 3MGNA 5AW7B 5AVRB 3L35A 2N9BA 3B8EB 1MFZA 2Z5HA 3NTNA 1NWQA 2WPSA 5AVUB 4RESB 2YO3A 2WWWA 3V4QA 2R5BA 4XE5B 3TNUA 2WT7A 2XZRA 3M0AA 1HBWA 4EOTA 2Q5UA 1G2CB 5AW4B 4GT1A 2C9NY 1GK6A 3T97A 5CMZA 3P7KA 5APXA 1HJBA 3O8ZA 2VRSA 1NAFA 1S9KD 1GTWA 2Z5IA 2WPRA 1H88A
chains in the Genus database with same CATH superfamily
3E1IA 1YHQP 3B5NC 4LC1A 1YI2P 1DH3A 3WU2H 3A2AA 4ASWA 3CCQP 3P8CD 1OZHA 3K5BA 2W6AA 2R32A 2OARA 4EYYQ 5KTBA 1LTGC 3P8CE 2AXTH 1FZFA 1L0NK 2KI7B 1IK7A 2P58A 3OW2O 1BSHA 4WY4C 3GG2A 2FYZA 1L4AC 2AEJA 1KYOE 1LTAC 1VQ7P 1VQ6P 1L2PA 1JY3O 2E75C 5H2FH 2E42A 3SWYA 2M8RA 5EFWB 3RK2B 3B4SA 4EDFA 5KLIB 4H0LC 1KQGB 3V2QA 3G4SP 4PD4D 2CK3H 2Y0CA 1NU1D 1KN7A 2WSFJ 2YO2A 1L0LD 1T8ZA 1JCCA 1CSBA 1NHLA 2K88A 1P84I 3L75J 3HD7D 1Y9BA 3AEFC 3IFMA 3TYYA 3VMZA 1K9MQ 3H1LD 3KZIH 1FDMA 1WMKA 2B88A 5KLVE 2Y0DA 2JEEA 2KSEA 1VF5D 3AEGC 2JDIH 3EFFK 1EXIA 2XDJA 1QVFO 1DD4A 2QG4A 3L37A 2YIUB 1L4AD 1KB9H 1NTME 3UIAA 3H1JE 2H88C 2YXQB 2W27A 2H43A 3D6ZA 1M1JC 1N73C 3O6QB 3KQGA 4IL6H 4N6JA 1FAVA 2I1JA 2KNCA 2WT7B 3CD6P 1MUUA 2CPBA 3LIEA 5KLVK 3KXDA 5AW5B 3II6A 1RE4A 2YKOA 3E7KA 4EI2A 5AW2B 2IFNA 2Q3IA 2OYIA 3H32B 2Y0EA 2A45H 4LLHA 4C7NB 5GTHH 5KLIC 3P8MC 3L73J 4Y28J 5KKZC 3AECC 4L74A 1Y8AA 2M3BA 5AW0B 1SQQE 4DZOA 1KQLA 1BGYG 3AEEC 3M91A 1JY3N 1L0LJ 1P84H 1FC2C 2KK7A 1FDOA 1FZAA 3VYIA 4D6TG 5GTIH 2FYUE 1MKMA 2E75B 2YNYA 3L74J 1BE3E 3H1LJ 3LW5H 1J1EB 2PP6A 2I1KA 1CI6A 2OYIB 2YKQA 2D2CB 1H0TB 2K1AA 2J58A 2KYVA 2NPSA 3AEDC 3L75D 3NMDA 4H13C 5KAIE 1NU1J 3RK3B 4C7NA 2A45G 1KILB 4NPFX 3S9OA 4D6TJ 1RF1C 2V7QJ 1G2CA 1PPJG 3HTKA 1KV4A 1VL2A 2M5AA 1EZVG 1RQVA 2BEQD 1VDFA 2KIKA 2LR2A 3L73E 3S1KA 5APSA 5AVQB 1VQ9P 3GW6A 1JMMA 1D7MA 4N3YB 2OQQA 3HUSC 2WSEH 3B5ND 3CC2P 2ZT9B 3VOPA 1NH4A 4DJGA 2BCCE 4BRYA 4M3LA 3D71A 1H89A 2IFMA 1YIJP 2A06G 1FOSF 3RGUA 4C46A 2K3RA 1W2EA 3AE7C 3CXHE 1LWUC 4LGDE 2A06E 4L75A 2FFDC 1YYCA 2H89C 2QJKC 3M9BA 4TT3H 3H1JJ 1SFCC 1BGYE 3FGAD 1L4AA 1LJ2A 1T3JA 1FZEA 1N7SB 1NTZD 4JYBA 1BCCD 3V6IA 1WRGA 1KB9D 5APUA 2Y9ZA 3HD7B 1SQVK 1YJWP 2B87A 2C0WA 2QM8A 1J1EC 4U3FJ 1T6AA 3HE4A 2I8DA 1LGHB 4OH8B 4QMAA 1KYOD 1NTZG 2ZJSE 2WVRA 2GUSA 3D6YA 3QH9A 1SQQD 4RO0A 1FDIA 3O6QA 2P1JA 3C9IA 3MGNA 1ZR4A 5AVRB 3L35A 1EZVI 2FYNB 2LXCB 2IX7C 2Z5HA 3HRNA 3MUDC 3NTNA 2WPSA 1L0NJ 3H1HE 1LTIC 2PGDA 3CMAP 1HGVA 1KQFB 2YMKA 1ZLLA 1NTMG 1VQOP 2FYUJ 3L74E 5E79E 1FZBA 2PRRA 2WWWA 1SQVJ 3V4QA 5BVZA 2B9BA 1JY3P 2V7QH 4IL6X 2WSFH 1JM0A 3L72E 1IFDA 2Q5UA 3A0HH 3M0AA 4GT1A 2PAJA 2C9NY 1GK6A 1KYOI 3H1KD 3MIWA 1RE3C 1GDTA 1IK9A 4IFMA 3H1IG 5GTIE 1W5CE 2J59M 3QWOC 3LW5J 1M56D 5CJ0A 1SQBD 5M1BA 5CCHD 1XTGB 2QIWA 1VF5B 1IFPA 1NTZE 3EFGA 3NXSA 1M8OB 3B71A 4ZMDA 1YQ3C 1M1JB 1IFIA 4GOEA 1N73B 1ZMEC 1CZQA 2P7JA 1XTCC 3V2PA 1AVYA 1LTBC 1H0TA 4L76A 1N8RQ 2CPSA 1HVVA 2ZVOB 3L75E 1LT9A 4XFJA 1URQA 4UB6E 3WU2E 5KLVJ 1Q2NA 2E76B 1NO4A 1ZOYC 3AE9C 1VF5C 3CXHI 1SQBJ 2B89A 3L74G 3M06A 5AVVB 5TISE 3RL0D 2WSCJ 3USSA 3L70E 1Q82Q 3EWKA 3RK2D 2K9JB 3GF7A 1GL2C 3AE1C 3RL0g 3AE8C 1X8YA 3VMAA 3CCUP 3BCCD 4IFDK 3L73G 3MZWB 1AQ5A 1VQPP 1Z56A 1KYOH 1P84D 1MFTA 1RY3A 2W6BA 2N1TD 5B66H 1L0LK 2O01H 2O3JA 1DD3A 2K37A 4O9BA 1K04A 2HODA 4H13B 2Q6QA 2W8ZA 2ZXXA 5CCHA 1OIPA 3FWLA 2O1KA 2QSIA 4GODA 1ZR2A 1VQLP 4IOIH 1L0ND 3C8VA 1RF1B 1SQPJ 1GTWA 1IFNA 2FYUG 1HTLC 1SVFA 1NVOA 3BCCJ 1KILA 1OXZA 1QX8A 1GL2D 1HUCA 2KZIA 4GKGA 3VMYA 4HB1A 3GMAA 3TGUD 3VN0A 1URQD 1U57A 3V2RA 1KB9E 2IZ1A 1Q90D 2O01N 2E76C 1NKNA 1PP9E 5APWA 5TJHA 1N2DC 5KLVD 2N1TB 1S5LX 1PFIA 1BE3J 1VQ8P 2A45I 3NFQA 4BRYB 1SQXD 2QJKB 3GF3A 3L36A 4W7YA 5AW9B 1GD2E 3AE6C 4BWNA 1NTZJ 1NTKG 4D6TE 2QA4P 3H1JD 1VQ5P 1NU1E 3IR9A 2OYHC 4U3FG 1N86A 2R3SA 5AW8B 5CBNA 1IFJA 1GK4A 3P32A 1SS1A 2AEMA 4H44B 1AFOA 3AE2C 1PPJE 4WBAA 1KD1Q 1RHZB 5AW6B 2MJZA 1KMIZ 3L72J 2QM7A 5AW1B 3W68A 4AUWA 4ZKUA 1EZVD 3H1IE 1A02J 4JQ0D 4DCKA 4WY4B 2BCCG 1RE3A 1LTSC 3G9RA 1PGQA 3ABVC 3Q1MA 3A3YB 1GW4A 1BDDA 5APQA 5KAFE 3R4YA 4H44C 1SQVG 2FYUD 1IJDB 2W90A 3A0BH 1EQ7A 1RH5B 4H0LB 1YITP 3G71P 4EIJA 2N1TC 4N78E 3HTKB 1SP4A 2K9JA 1N7SD 2C0XA 1S5LE 1SQBG 5CBOA 2E74B 1FZCA 1NU1G 2YXRB 1FOSE 2IBZI 3AE3C 4L73A 4HKZH 5B66E 2ZT9C 2KSJA 4KHXA 4Z1MH 2P2UA 3GHGB 1NJIQ 1L0LG 3V4WA 3SFEC 4U3FD 1X9VA 3E1RA 4GIFA 1IO4A 2GUVA 2Z4EA 1JY2O 1N7LA 3BRTB 3PJSK 3H1HG 4W80A 3MHVA 3U1AA 3G6EP 4JYCA 3RL0B 2E74C 1JOCA 1M1JA 2KS1B 3CX5D 3A0BE 3B8EB 4RJTA 1W2BO 5CJ4A 1S4XA 2A06D 3BATA 3I55P 1YJNP 3CXHD 1NWQA 4UB6H 5B5EH 2G8YA 3OJAB 3TGUG 3KZIE 1H88A 2NZ2A 3L71G 3CCVP 4RESB 1M1KQ 2JKVA 2N1TA 2NPSB 3KPEA 2IBZD 2J5UA 2HPCA 2FY8A 2BEZF 2XNDH 4XE5B 5KKZB 5KJ7D 3JC22 4H13D 5GTHE 1G2CB 2AEFA 5AW4B 3G3ZA 4WVZA 2IBZG 3HUSA 2D2CD 3C1LA 4OWFA 1IZNB 3GHGC 1NTKE 1SQPK 1T2KC 3H6PA 3RK3C 5K5GB 1JY2P 4MN4C 2XU6A 3OAKA 5B5EE 1PZQA 1PGPA 4HYTB 1GL2B 1VQ4P 1VQKP 3SWKA 3CCEP 4OGQD 1LT9C 2KUBA 3HUSB 3M9QA 3H32A 1DEEG 2FKWB 1S9KE 1PPJD 1J2JB 1LTJC 4B86A 3HD7A 3PHLA 2FFDB 4ASVA 5CCGD 3N4XA 3H1KG 4PV1C 3T97B 1EDJA 1QL1A 2YKPA 5TISH 1GMJA 1NAYA 1NTKK 1OW7A 2QJYB 1KB9I 2HFED 2JR8A 4IFFA 4ZNCA 2WTYA 1LT9B 1NU1K 1VQNP 1JB0J 4H44D 5AVTB 5AW3B 1KZUB 2R5DA 1GU4A 2W83C 3H1KJ 3CC4P 2NPSC 3W67A 1NTZK 2YMYA 2H7HA 2P10A 4TLFA 2OYOA 4H0LD 3CXHH 1LT1A 1FZCC 1KFMA 3CI9A 2ZVNB 2QJPB 1BE3G 5BU8B 4PD4E 5AVZB 5AVYB 2ITAA 2LKMA 5DJTB 3L75G 1JEKA 2L5GB 1YBKA 2JO1A 1BGYJ 1SFCD 2RN0A 3CPWO 2RMZA 1LTJB 4BXLA 3FXDA 3PLNA 4YTPC 2HPCB 2M0BA 1PGOA 1M7LA 5KAFH 2FXOA 3SSUA 4K3AA 4OGQB 1T2KD 1KC8Q 1R5LA 4PD4H 2QVAA 3H1IJ 5APVA 1FZGA 1VQMP 1FJKA 1JTHB 1URQC 1KTMA 3IN6A 3D70A 4UB8E 3Q5SA 4I7ZC 1P84E 2Y9YA 3OA7A 3PTZA 2JJLA 3CLQA 4AYCA 3CCSP 1BCCE 2DW3A 2IZ0A 1S3JA 1E79H 2KLUA 3CX5I 2C9LY 1J1DB 1GL2A 1X22A 4HJGH 2Q7CA 4AQRD 1RF0C 2G3AA 1PL5A 4W7ZA 2OYHB 2IBZE 4GOFA 1ZXGA 1MZ9A 1NOHA 3HE5A 3RBZA 3CCMP 1OWAA 2HG5D 4I7ZB 4PJ0E 1OVVA 3CCLP 4HH2A 3ITKA 2ZAEB 1A02F 3RBXA 3SWFA 4D6TD 2BASA 4Y99C 3V2NA 1K05A 1SQXE 1ZRTE 3IF4A 1FJPA 2HLOA 2NRGA 1N7SA 1T3UA 1LNQA 2ZFCA 2Q1KA 4PJ0H 1FS0E 2WZ7A 1S5LH 1EDIA 3L74D 2GA1A 1NKZB 3BCCG 5AVWB 1Y47A 1N73A 1ZW0A 1IC2A 2B87B 1SQPG 5CCGC 3VP9A 3WUTA 3TK1A 3S4RA 1ZN5A 1X0TA 1M57D 1RF0A 1JY2N 1WT6A 1FZCB 3L72D 3Q5RA 3I5CA 2XKMA 1EC5A 5KJ7C 2V4HA 1LP1A 1EDLA 1URQB 2N9BA 3L70J 3TGUE 1HH0A 1IFMA 3L72G 1G1IA 1FU1A 4PV1B 1VPCA 1NTKJ 2R44A 2WQYC 2MKVA 1JCDA 2R5BA 3CWBG 2WT7A 2XZRA 2E74D 2FFDA 2KS1A 1HBWA 2K9YA 5E79H 1EDKA 1AVOA 1RQUA 1AJYA 2WITA 3T97A 4IL6E 5CMZA 3N7NA 3A0HE 2E76D 3P7KA 1PIXA 1S2EA 3O8ZA 1YQ4C 2VRSA 1NAFA 5APXA 3F89A 2Z5IA 2WMMA 1OFCX 1RE4C 2WPRA 4KT0J 3RK3E 2QEXP 2OTJP 4U7JA 2OTKE 4YXWH 3CL3D 4JF7A 1Q81Q 1JNMA 2OYIC 1QEXA 2IYOA 3H1JG 3CX5E 1OW8A 1LTTC 4XA4A 1ZRTD 4GDOA 2P67A 2HYNA 1PP9J 2QJYC 1KILC 3L71D 1QLED 2IPPA 3M0DA 4U3FE 1KILE 3L71J 3HE5B 2RH0A 4WB4A 2WSCH 1HF9A 2BCCD 3MUDA 1CI6B 1YTZI 1KFNA 1PV3A 3JSVC 1GU5A 3TNUB 2XV5A 3F5HA 1ZV8A 3H1KE 1SQPE 4JBZA 4A7PA 1OVUA 3WUVA 1NTMJ 1EXJA 3FWNA 1QGKB 3TDKA 1LWUB 2FYUK 5KAIH 3Q3DA 4NPDA 2M3EA 1L0NG 3CC7P 2E5TA 1L0NE 3H1HJ 1E5WA 5AVXB 4UB8H 1JO5A 3AE4C 1NTKD 1USDA 4K35A 1BDCA 4YPCA 1USEA 2KB7P 2UWJE 1OVRA 2AXTE 2WSEJ 2ZYGA 2OTLP 1KORA 4I1LA 3AE5C 3KDPB 4DT0A 3RL0C 2HR3A 1LWUA 2WPQA 3BASA 3VTPC 3L70D 3M0DC 1YJ9P 1UIXA 1HWTC 2WPVB 2N9YB 2W6JH 3CWBJ 1EZVE 2KZJA 2RKLA 4R4LA 1DX7A 1OW6A 3CCJP 2Q9IA 3Q2YA 3KYQA 1NTMD 2ZYAA 3EQ2A 3KHUA 2NPSD 2QRXA 5AVSB 2KXPB 3WMM0 2KLVA 1HGZA 3L70G 4RKUJ 5CCGA 1H8AA 2O1JA 1SQXK 1NTMK 1UIIA 1NYHA 1KILD 3VMXA 1AV1A 2LXBA 2ZXEB 3FXEA 2QJPC 2WSSH 1PGJA 3PRJA 4CPGA 1CW5A 3L71E 1GZLA 1QL2A 3GLMA 5C39A 4PD4I 3TGUJ 1KQSO 1R5SA 1GW3A 1PP9D 2M5AB 3A5TA 1SQBE 2QE7H 3JCUE 1QVGO 1SLQA 1LTJA 2FXPA 2KP8A 3ZDMA 4ZKPA 1JUNA 4R4MA 3CWBD 1BCCG 3MD0A 1SQXG 1AQTA 3AEBC 3CMEP 1OMIA 1SQQJ 2YIUC 4Y99B 2KNCB 1K8AQ 1L0LE 3CX5H 1R8EA 4DOJA 2H8PD 1BSNA 4JPZB 5APTA 3TSIA 4C7RA 1S72P 1JTHA 1JMBA 1RF1A 3FX0A 4N78D 1SFCB 1X79B 1SQXJ 1L4AB 3LIDA 1BE3D 1SQQG 2AXCA 4I6MC 3H1HD 2POHA 5L8RJ 2IYPA 1Q86Q 2D2CC 2PFXA 3B5NB 3M9HA 1J1DC 3HE4B 2JWAA 1FBMA 4I2LC 3JCUH 3VP8A 3BCCE 3U59A 1K73Q 1YTZT 3H25A 3H1ID 3A7OA 1NGMB 2E75D 4WWIA 5H2FE 5CHXA 1AA0A 1SFCA 1SQPD 1TU3F 1ZP0C 2BCCJ 2R3CA 2ZYDA 3AEAC 3BRVB 3CWBE 1SQQK 2FXMA 3GHGA 3MP7B 4PV1D 3SFDC 3CCRP 1DIPA 1OX3A 2GM4A 1U7JA 1PP9G 2OGUA 3B5NA 1BGYD 1Q7YQ 5DJUB 2XNXA 1MV8A 2JWDA 1SQVD 2FBWC 3V5BA 5APYA 5KJ7A 3BVHA 1G1JA 1SQBK 3L4FA 5AW7B 1SQVE 1MFZA 5KLVG 3R2PA 1N7SC 3PH0A 4WY4A 2O01J 5AVUB 2HODB 1HJ0A 2Q3EA 3HD7C 3WUUA 3RK3D 3RK2C 3IAOA 2KOGA 2YO3A 3H1LE 2ZT9D 5CCHC 3H1LG 2E5YA 2JP3A 4OGQC 3TNUA 1S1CX 3L73D 4WY4D 3U1CA 2E43A 1BCCJ 1LP1B 4EOTA 2OYHA 2SPZA 4OVNF 1M90Q 4NPEA 3TF5A 2IDBA 5BU5A 1DEBA 2FYNC 3PP5A 2L91A 3I56P 1HJBA 1S9KD 4YXDC 3MTUE 1FE6A 3Q5PA 4KJMA 1U7MA
chains in the Genus database with same CATH topology
3E1IA 3B5NC 4LC1A 1DH3A 3A2AA 3P8CD 2W6AA 2R32A 2OARA 5KTBA 1LTGC 3P8CE 1FZFA 1L0NK 4WY4C 2FYZA 1L4AC 1LTAC 1JY3O 2E42A 3SWYA 2M8RA 3RK2B 3V2QA 2YO2A 1JCCA 1CSBA 1NHLA 1T8ZA 3VMZA 3TYYA 3HD7D 3IFMA 1FDMA 2JEEA 2XDJA 3L37A 1L4AD 3UIAA 2W27A 2H43A 1M1JC 1N73C 3KQGA 4N6JA 2WT7B 1FAVA 2I1JA 1MUUA 2CPBA 3LIEA 5KLVK 5AW5B 3II6A 1RE4A 2YKOA 5AW2B 2IFNA 2Q3IA 2OYIA 3H32B 2A45H 4LLHA 4C7NB 3P8MC 2M3BA 5AW0B 4DZOA 1KQLA 3M91A 1JY3N 3VYIA 1FZAA 2YNYA 3LW5H 3RK2D 1J1EB 2PP6A 2I1KA 1CI6A 2OYIB 2YKQA 2J58A 2KYVA 2NPSA 3NMDA 4C7NA 3RK3B 2A45G 1KILB 1RF1C 1G2CA 3HTKA 1VDFA 5APSA 5AVQB 1JMMA 4N3YB 3HUSC 2WSEH 3B5ND 3VOPA 1NH4A 4M3LA 1H89A 2IFMA 1FOSF 4C46A 1W2EA 2FFDC 1LWUC 4LGDE 1YYCA 3M9BA 1SFCC 1L4AA 4JYBA 1T3JA 1FZEA 1N7SB 1WRGA 5APUA 3HD7B 1SQVK 2C0WA 2QM8A 1J1EC 3HE4A 4OH8B 1LGHB 2GUSA 2P1JA 3C9IA 3MGNA 1ZR4A 5AVRB 3L35A 3HRNA 2IX7C 2Z5HA 3NTNA 2WPSA 1LTIC 1HGVA 1ZLLA 5BVZA 1FZBA 2WWWA 3V4QA 1JY3P 2WSFH 3M0AA 1IFDA 2Q5UA 4GT1A 2PAJA 2C9NY 1GK6A 3MIWA 1RE3C 1GDTA 1IK9A 4IFMA 2J59M 5CJ0A 5CCHD 1XTGB 3EFGA 3NXSA 1M1JB 1IFIA 1N73B 1CZQA 2P7JA 1XTCC 3V2PA 1LTBC 2CPSA 1HVVA 1LT9A 1URQA 1NO4A 5AVVB 3M06A 3RL0D 1GL2C 4IFDK 1X8YA 1AQ5A 1Z56A 1RY3A 2W6BA 2N1TD 1L0LK 2O01H 4O9BA 2HODA 5CCHA 1DX7A 1ZR2A 2O1KA 1RF1B 1IFNA 1HTLC 1SVFA 1KILA 1OXZA 1GL2D 1HUCA 4GKGA 3VMYA 3VN0A 1URQD 3V2RA 1NKNA 5APWA 1N2DC 2N1TB 1PFIA 2A45I 3NFQA 3L36A 4W7YA 5AW9B 1GD2E 2OYHC 3IR9A 5AW8B 1N86A 1IFJA 1GK4A 3P32A 1AFOA 4WBAA 5AW6B 2MJZA 5AW1B 4AUWA 2QM7A 4ZKUA 1A02J 4WY4B 1RE3A 1LTSC 3A3YB 1GW4A 5APQA 1IJDB 1EQ7A 4EIJA 2N1TC 4N78E 3HTKB 1SP4A 1N7SD 2C0XA 1FZCA 1FOSE 2KSJA 4KHXA 2P2UA 3GHGB 3V4WA 1X9VA 4GIFA 1IO4A 2GUVA 2Z4EA 1JY2O 1N7LA 3BRTB 4W80A 3U1AA 4JYCA 3RL0B 1JOCA 1M1JA 1N73A 3B8EB 5CJ4A 3BATA 1NWQA 3OJAB 4RESB 2N1TA 2NPSB 3KPEA 2HPCA 4XE5B 5KJ7D 1G2CB 5AW4B 3G3ZA 3HUSA 3GHGC 1SQPK 1T2KC 3H6PA 3RK3C 1JY2P 2XU6A 3OAKA 4HYTB 1GL2B 1LT9C 3HUSB 3M9QA 3H32A 2FKWB 1S9KE 1J2JB 1LTJC 4B86A 3HD7A 2FFDB 5CCGD 3N4XA 1QL1A 2YKPA 1NTKK 2WTYA 2HFED 4IFFA 1LT9B 1NU1K 5AVTB 5AW3B 1KZUB 2R5DA 1GU4A 2NPSC 1NTZK 2YMYA 2H7HA 1FZCC 1KFMA 3CI9A 5BU8B 5AVZB 5AVYB 2LKMA 2L5GB 1SFCD 1LTJB 2HPCB 1M7LA 1T2KD 5APVA 1FZGA 1FJKA 1JTHB 1URQC 3OA7A 2JJLA 3CLQA 4AYCA 2C9LY 2E43A 1J1DB 1GL2A 2Q7CA 4AQRD 1RF0C 4W7ZA 2OYHB 1MZ9A 1NOHA 3HE5A 1OWAA 2HG5D 4HH2A 1A02F 3SWFA 2BASA 4Y99C 3V2NA 1FJPA 2HLOA 1N7SA 1T3UA 2ZFCA 2WZ7A 1NKZB 5AVWB 1IC2A 5CCGC 3VP9A 3TK1A 1ZN5A 1RF0A 1JY2N 1WT6A 1FZCB 3I5CA 2XKMA 5KJ7C 1URQB 2N9BA 1HH0A 1IFMA 1G1IA 1FU1A 1VPCA 2R5BA 1JCDA 2WT7A 2XZRA 2FFDA 1HBWA 2WITA 3T97A 5CMZA 3N7NA 3P7KA 5APXA 3O8ZA 2VRSA 1NAFA 2Z5IA 2WPRA 1RE4C 3CL3D 4JF7A 1JNMA 2OYIC 4XA4A 1LTTC 2P67A 2HYNA 1KILC 2IPPA 3M0DA 4WB4A 3HE5B 2WSCH 3MUDA 1CI6B 1YTZI 1KFNA 1GU5A 3TNUB 2XV5A 1ZV8A 1LWUB 2FYUK 1E5WA 5AVXB 1JO5A 2KB7P 4I1LA 3KDPB 3RL0C 3BASA 1LWUA 2WPQA 3VTPC 3M0DC 1HWTC 2Q9IA 3KYQA 3EQ2A 2NPSD 5AVSB 5CCGA 3WMM0 2KLVA 1HGZA 1H8AA 2O1JA 1SQXK 1NTMK 1KILD 3VMXA 2ZXEB 1CW5A 1GZLA 1QL2A 1GW3A 3A5TA 1SLQA 1LTJA 1JUNA 2KP8A 4ZKPA 3MD0A 4Y99B 4DOJA 2H8PD 5APTA 3TSIA 4C7RA 1RF1A 1JTHA 4N78D 1SFCB 1X79B 1L4AB 3LIDA 4I6MC 2POHA 3B5NB 3M9HA 1J1DC 3HE4B 4I2LC 1FBMA 3VP8A 3U59A 1YTZT 3A7OA 5CHXA 1SFCA 3BRVB 2R3CA 3GHGA 1SQQK 2FXMA 2GM4A 3B5NA 2XNXA 1MV8A 3V5BA 5KJ7A 5APYA 3BVHA 3L4FA 1G1JA 1SQBK 5AW7B 1MFZA 3R2PA 1N7SC 4WY4A 5AVUB 2HODB 3HD7C 3RK3D 3RK2C 2KOGA 2YO3A 5CCHC 3U1CA 3TNUA 4WY4D 4EOTA 2OYHA 5BU5A 1DEBA 3PP5A 1HJBA 1S9KD 1GTWA 3MTUE 1H88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LC1 A;  1T2K C;  1DH3 A;  1JNM A;  3NXS A;  3A2A A;  2XU6 A;  3OAK A;  2P67 A;  2W6A A;  1CZQ A;  2P7J A;  2R32 A;  4HYT B;  2IPP A;  3M0D A;  3HE5 B;  1CI6 B;  1S9K E;  2E42 A;  1GU5 A;  1J2J B;  3TNU B;  2XV5 A;  4B86 A;  5AVV B;  3M06 A;  2YO2 A;  1CSB A;  2WTY A;  1X8Y A;  3TYY A;  3VMZ A;  5AVT B;  5AVX B;  5AW3 B;  2R5D A;  1GU4 A;  3L37 A;  3UIA A;  2H7H A;  2W27 A;  3KDP B;  2WPQ A;  3VTP C;  3KQG A;  2WT7 B;  1FAV A;  1HWT C;  1OXZ A;  1MUU A;  1HUC A;  3LIE A;  4GKG A;  5AVY B;  5AVZ B;  3VMY A;  5AW5 B;  3VN0 A;  5AVS B;  1H8A A;  5AW2 B;  2Q3I A;  5APW A;  3VMX A;  4C7N B;  2ZXE B;  3NFQ A;  3P8M C;  3L36 A;  5AW9 B;  1T2K D;  1GD2 E;  1GZL A;  5AW0 B;  5APV A;  1KQL A;  3IR9 A;  3M91 A;  4DZO A;  5AW8 B;  3VYI A;  3A5T A;  1GK4 A;  3P32 A;  2YNY A;  1SLQ A;  1JUN A;  2KP8 A;  1CI6 A;  2JJL A;  5AW6 B;  3MD0 A;  3NMD A;  4AYC A;  5AW1 B;  4C7N A;  2QM7 A;  2C9L Y;  4AUW A;  2E43 A;  2Q7C A;  4AQR D;  1A02 J;  3HTK A;  5APT A;  5APS A;  5AVQ B;  3HE5 A;  3A3Y B;  1OWA A;  3LID A;  5APQ A;  4I6M C;  4M3L A;  1H89 A;  1FOS F;  4C46 A;  3M9H A;  1A02 F;  3SWF A;  3HE4 B;  4I2L C;  2BAS A;  1SP4 A;  1YYC A;  3M9B A;  3A7O A;  1FOS E;  4JYB A;  2ZFC A;  5APU A;  2R3C A;  5AVW B;  4KHX A;  2P2U A;  2QM8 A;  3V4W A;  3HE4 A;  3TK1 A;  1IO4 A;  1MV8 A;  3V5B A;  5APY A;  3I5C A;  4JYC A;  3MGN A;  5AW7 B;  5AVR B;  3L35 A;  2N9B A;  3B8E B;  1MFZ A;  2Z5H A;  3NTN A;  1NWQ A;  2WPS A;  5AVU B;  4RES B;  2YO3 A;  2WWW A;  3V4Q A;  2R5B A;  4XE5 B;  3TNU A;  2WT7 A;  2XZR A;  3M0A A;  1HBW A;  4EOT A;  2Q5U A;  1G2C B;  5AW4 B;  4GT1 A;  2C9N Y;  1GK6 A;  3T97 A;  5CMZ A;  3P7K A;  5APX A;  1HJB A;  3O8Z A;  2VRS A;  1NAF A;  1S9K D;  1GTW A;  2Z5I A;  2WPR A;  1H88 A; 
#chains in the Genus database with same CATH topology
 3E1I A;  1YHQ P;  3B5N C;  4LC1 A;  1YI2 P;  1DH3 A;  3WU2 H;  3A2A A;  4ASW A;  3CCQ P;  3P8C D;  1OZH A;  3K5B A;  2W6A A;  2R32 A;  2OAR A;  4EYY Q;  5KTB A;  1LTG C;  3P8C E;  2AXT H;  1FZF A;  1L0N K;  2KI7 B;  1IK7 A;  2P58 A;  3OW2 O;  1BSH A;  4WY4 C;  3GG2 A;  2FYZ A;  1L4A C;  2AEJ A;  1KYO E;  1LTA C;  1VQ7 P;  1VQ6 P;  1L2P A;  1JY3 O;  2E75 C;  5H2F H;  2E42 A;  3SWY A;  2M8R A;  5EFW B;  3RK2 B;  3B4S A;  4EDF A;  5KLI B;  4H0L C;  1KQG B;  3V2Q A;  3G4S P;  4PD4 D;  2CK3 H;  2Y0C A;  1NU1 D;  1KN7 A;  2WSF J;  2YO2 A;  1L0L D;  1T8Z A;  1JCC A;  1CSB A;  1NHL A;  2K88 A;  1P84 I;  3L75 J;  3HD7 D;  1Y9B A;  3AEF C;  3IFM A;  3TYY A;  3VMZ A;  1K9M Q;  3H1L D;  3KZI H;  1FDM A;  1WMK A;  2B88 A;  5KLV E;  2Y0D A;  2JEE A;  2KSE A;  1VF5 D;  3AEG C;  2JDI H;  3EFF K;  1EXI A;  2XDJ A;  1QVF O;  1DD4 A;  2QG4 A;  3L37 A;  2YIU B;  1L4A D;  1KB9 H;  1NTM E;  3UIA A;  3H1J E;  2H88 C;  2YXQ B;  2W27 A;  2H43 A;  3D6Z A;  1M1J C;  1N73 C;  3O6Q B;  3KQG A;  4IL6 H;  4N6J A;  1FAV A;  2I1J A;  2KNC A;  2WT7 B;  3CD6 P;  1MUU A;  2CPB A;  3LIE A;  5KLV K;  3KXD A;  5AW5 B;  3II6 A;  1RE4 A;  2YKO A;  3E7K A;  4EI2 A;  5AW2 B;  2IFN A;  2Q3I A;  2OYI A;  3H32 B;  2Y0E A;  2A45 H;  4LLH A;  4C7N B;  5GTH H;  5KLI C;  3P8M C;  3L73 J;  4Y28 J;  5KKZ C;  3AEC C;  4L74 A;  1Y8A A;  2M3B A;  5AW0 B;  1SQQ E;  4DZO A;  1KQL A;  1BGY G;  3AEE C;  3M91 A;  1JY3 N;  1L0L J;  1P84 H;  1FC2 C;  2KK7 A;  1FDO A;  1FZA A;  3VYI A;  4D6T G;  5GTI H;  2FYU E;  1MKM A;  2E75 B;  2YNY A;  3L74 J;  1BE3 E;  3H1L J;  3LW5 H;  1J1E B;  2PP6 A;  2I1K A;  1CI6 A;  2OYI B;  2YKQ A;  2D2C B;  1H0T B;  2K1A A;  2J58 A;  2KYV A;  2NPS A;  3AED C;  3L75 D;  3NMD A;  4H13 C;  5KAI E;  1NU1 J;  3RK3 B;  4C7N A;  2A45 G;  1KIL B;  4NPF X;  3S9O A;  4D6T J;  1RF1 C;  2V7Q J;  1G2C A;  1PPJ G;  3HTK A;  1KV4 A;  1VL2 A;  2M5A A;  1EZV G;  1RQV A;  2BEQ D;  1VDF A;  2KIK A;  2LR2 A;  3L73 E;  3S1K A;  5APS A;  5AVQ B;  1VQ9 P;  3GW6 A;  1JMM A;  1D7M A;  4N3Y B;  2OQQ A;  3HUS C;  2WSE H;  3B5N D;  3CC2 P;  2ZT9 B;  3VOP A;  1NH4 A;  4DJG A;  2BCC E;  4BRY A;  4M3L A;  3D71 A;  1H89 A;  2IFM A;  1YIJ P;  2A06 G;  1FOS F;  3RGU A;  4C46 A;  2K3R A;  1W2E A;  3AE7 C;  3CXH E;  1LWU C;  4LGD E;  2A06 E;  4L75 A;  2FFD C;  1YYC A;  2H89 C;  2QJK C;  3M9B A;  4TT3 H;  3H1J J;  1SFC C;  1BGY E;  3FGA D;  1L4A A;  1LJ2 A;  1T3J A;  1FZE A;  1N7S B;  1NTZ D;  4JYB A;  1BCC D;  3V6I A;  1WRG A;  1KB9 D;  5APU A;  2Y9Z A;  3HD7 B;  1SQV K;  1YJW P;  2B87 A;  2C0W A;  2QM8 A;  1J1E C;  4U3F J;  1T6A A;  3HE4 A;  2I8D A;  1LGH B;  4OH8 B;  4QMA A;  1KYO D;  1NTZ G;  2ZJS E;  2WVR A;  2GUS A;  3D6Y A;  3QH9 A;  1SQQ D;  4RO0 A;  1FDI A;  3O6Q A;  2P1J A;  3C9I A;  3MGN A;  1ZR4 A;  5AVR B;  3L35 A;  1EZV I;  2FYN B;  2LXC B;  2IX7 C;  2Z5H A;  3HRN A;  3MUD C;  3NTN A;  2WPS A;  1L0N J;  3H1H E;  1LTI C;  2PGD A;  3CMA P;  1HGV A;  1KQF B;  2YMK A;  1ZLL A;  1NTM G;  1VQO P;  2FYU J;  3L74 E;  5E79 E;  1FZB A;  2PRR A;  2WWW A;  1SQV J;  3V4Q A;  5BVZ A;  2B9B A;  1JY3 P;  2V7Q H;  4IL6 X;  2WSF H;  1JM0 A;  3L72 E;  1IFD A;  2Q5U A;  3A0H H;  3M0A A;  4GT1 A;  2PAJ A;  2C9N Y;  1GK6 A;  1KYO I;  3H1K D;  3MIW A;  1RE3 C;  1GDT A;  1IK9 A;  4IFM A;  3H1I G;  5GTI E;  1W5C E;  2J59 M;  3QWO C;  3LW5 J;  1M56 D;  5CJ0 A;  1SQB D;  5M1B A;  5CCH D;  1XTG B;  2QIW A;  1VF5 B;  1IFP A;  1NTZ E;  3EFG A;  3NXS A;  1M8O B;  3B71 A;  4ZMD A;  1YQ3 C;  1M1J B;  1IFI A;  4GOE A;  1N73 B;  1ZME C;  1CZQ A;  2P7J A;  1XTC C;  3V2P A;  1AVY A;  1LTB C;  1H0T A;  4L76 A;  1N8R Q;  2CPS A;  1HVV A;  2ZVO B;  3L75 E;  1LT9 A;  4XFJ A;  1URQ A;  4UB6 E;  3WU2 E;  5KLV J;  1Q2N A;  2E76 B;  1NO4 A;  1ZOY C;  3AE9 C;  1VF5 C;  3CXH I;  1SQB J;  2B89 A;  3L74 G;  3M06 A;  5AVV B;  5TIS E;  3RL0 D;  2WSC J;  3USS A;  3L70 E;  1Q82 Q;  3EWK A;  3RK2 D;  2K9J B;  3GF7 A;  1GL2 C;  3AE1 C;  3RL0 g;  3AE8 C;  1X8Y A;  3VMA A;  3CCU P;  3BCC D;  4IFD K;  3L73 G;  3MZW B;  1AQ5 A;  1VQP P;  1Z56 A;  1KYO H;  1P84 D;  1MFT A;  1RY3 A;  2W6B A;  2N1T D;  5B66 H;  1L0L K;  2O01 H;  2O3J A;  1DD3 A;  2K37 A;  4O9B A;  1K04 A;  2HOD A;  4H13 B;  2Q6Q A;  2W8Z A;  2ZXX A;  5CCH A;  1OIP A;  3FWL A;  2O1K A;  2QSI A;  4GOD A;  1ZR2 A;  1VQL P;  4IOI H;  1L0N D;  3C8V A;  1RF1 B;  1SQP J;  1GTW A;  1IFN A;  2FYU G;  1HTL C;  1SVF A;  1NVO A;  3BCC J;  1KIL A;  1OXZ A;  1QX8 A;  1GL2 D;  1HUC A;  2KZI A;  4GKG A;  3VMY A;  4HB1 A;  3GMA A;  3TGU D;  3VN0 A;  1URQ D;  1U57 A;  3V2R A;  1KB9 E;  2IZ1 A;  1Q90 D;  2O01 N;  2E76 C;  1NKN A;  1PP9 E;  5APW A;  5TJH A;  1N2D C;  5KLV D;  2N1T B;  1S5L X;  1PFI A;  1BE3 J;  1VQ8 P;  2A45 I;  3NFQ A;  4BRY B;  1SQX D;  2QJK B;  3GF3 A;  3L36 A;  4W7Y A;  5AW9 B;  1GD2 E;  3AE6 C;  4BWN A;  1NTZ J;  1NTK G;  4D6T E;  2QA4 P;  3H1J D;  1VQ5 P;  1NU1 E;  3IR9 A;  2OYH C;  4U3F G;  1N86 A;  2R3S A;  5AW8 B;  5CBN A;  1IFJ A;  1GK4 A;  3P32 A;  1SS1 A;  2AEM A;  4H44 B;  1AFO A;  3AE2 C;  1PPJ E;  4WBA A;  1KD1 Q;  1RHZ B;  5AW6 B;  2MJZ A;  1KMI Z;  3L72 J;  2QM7 A;  5AW1 B;  3W68 A;  4AUW A;  4ZKU A;  1EZV D;  3H1I E;  1A02 J;  4JQ0 D;  4DCK A;  4WY4 B;  2BCC G;  1RE3 A;  1LTS C;  3G9R A;  1PGQ A;  3ABV C;  3Q1M A;  3A3Y B;  1GW4 A;  1BDD A;  5APQ A;  5KAF E;  3R4Y A;  4H44 C;  1SQV G;  2FYU D;  1IJD B;  2W90 A;  3A0B H;  1EQ7 A;  1RH5 B;  4H0L B;  1YIT P;  3G71 P;  4EIJ A;  2N1T C;  4N78 E;  3HTK B;  1SP4 A;  2K9J A;  1N7S D;  2C0X A;  1S5L E;  1SQB G;  5CBO A;  2E74 B;  1FZC A;  1NU1 G;  2YXR B;  1FOS E;  2IBZ I;  3AE3 C;  4L73 A;  4HKZ H;  5B66 E;  2ZT9 C;  2KSJ A;  4KHX A;  4Z1M H;  2P2U A;  3GHG B;  1NJI Q;  1L0L G;  3V4W A;  3SFE C;  4U3F D;  1X9V A;  3E1R A;  4GIF A;  1IO4 A;  2GUV A;  2Z4E A;  1JY2 O;  1N7L A;  3BRT B;  3PJS K;  3H1H G;  4W80 A;  3MHV A;  3U1A A;  3G6E P;  4JYC A;  3RL0 B;  2E74 C;  1JOC A;  1M1J A;  2KS1 B;  3CX5 D;  3A0B E;  3B8E B;  4RJT A;  1W2B O;  5CJ4 A;  1S4X A;  2A06 D;  3BAT A;  3I55 P;  1YJN P;  3CXH D;  1NWQ A;  4UB6 H;  5B5E H;  2G8Y A;  3OJA B;  3TGU G;  3KZI E;  1H88 A;  2NZ2 A;  3L71 G;  3CCV P;  4RES B;  1M1K Q;  2JKV A;  2N1T A;  2NPS B;  3KPE A;  2IBZ D;  2J5U A;  2HPC A;  2FY8 A;  2BEZ F;  2XND H;  4XE5 B;  5KKZ B;  5KJ7 D;  3JC2 2;  4H13 D;  5GTH E;  1G2C B;  2AEF A;  5AW4 B;  3G3Z A;  4WVZ A;  2IBZ G;  3HUS A;  2D2C D;  3C1L A;  4OWF A;  1IZN B;  3GHG C;  1NTK E;  1SQP K;  1T2K C;  3H6P A;  3RK3 C;  5K5G B;  1JY2 P;  4MN4 C;  2XU6 A;  3OAK A;  5B5E E;  1PZQ A;  1PGP A;  4HYT B;  1GL2 B;  1VQ4 P;  1VQK P;  3SWK A;  3CCE P;  4OGQ D;  1LT9 C;  2KUB A;  3HUS B;  3M9Q A;  3H32 A;  1DEE G;  2FKW B;  1S9K E;  1PPJ D;  1J2J B;  1LTJ C;  4B86 A;  3HD7 A;  3PHL A;  2FFD B;  4ASV A;  5CCG D;  3N4X A;  3H1K G;  4PV1 C;  3T97 B;  1EDJ A;  1QL1 A;  2YKP A;  5TIS H;  1GMJ A;  1NAY A;  1NTK K;  1OW7 A;  2QJY B;  1KB9 I;  2HFE D;  2JR8 A;  4IFF A;  4ZNC A;  2WTY A;  1LT9 B;  1NU1 K;  1VQN P;  1JB0 J;  4H44 D;  5AVT B;  5AW3 B;  1KZU B;  2R5D A;  1GU4 A;  2W83 C;  3H1K J;  3CC4 P;  2NPS C;  3W67 A;  1NTZ K;  2YMY A;  2H7H A;  2P10 A;  4TLF A;  2OYO A;  4H0L D;  3CXH H;  1LT1 A;  1FZC C;  1KFM A;  3CI9 A;  2ZVN B;  2QJP B;  1BE3 G;  5BU8 B;  4PD4 E;  5AVZ B;  5AVY B;  2ITA A;  2LKM A;  5DJT B;  3L75 G;  1JEK A;  2L5G B;  1YBK A;  2JO1 A;  1BGY J;  1SFC D;  2RN0 A;  3CPW O;  2RMZ A;  1LTJ B;  4BXL A;  3FXD A;  3PLN A;  4YTP C;  2HPC B;  2M0B A;  1PGO A;  1M7L A;  5KAF H;  2FXO A;  3SSU A;  4K3A A;  4OGQ B;  1T2K D;  1KC8 Q;  1R5L A;  4PD4 H;  2QVA A;  3H1I J;  5APV A;  1FZG A;  1VQM P;  1FJK A;  1JTH B;  1URQ C;  1KTM A;  3IN6 A;  3D70 A;  4UB8 E;  3Q5S A;  4I7Z C;  1P84 E;  2Y9Y A;  3OA7 A;  3PTZ A;  2JJL A;  3CLQ A;  4AYC A;  3CCS P;  1BCC E;  2DW3 A;  2IZ0 A;  1S3J A;  1E79 H;  2KLU A;  3CX5 I;  2C9L Y;  1J1D B;  1GL2 A;  1X22 A;  4HJG H;  2Q7C A;  4AQR D;  1RF0 C;  2G3A A;  1PL5 A;  4W7Z A;  2OYH B;  2IBZ E;  4GOF A;  1ZXG A;  1MZ9 A;  1NOH A;  3HE5 A;  3RBZ A;  3CCM P;  1OWA A;  2HG5 D;  4I7Z B;  4PJ0 E;  1OVV A;  3CCL P;  4HH2 A;  3ITK A;  2ZAE B;  1A02 F;  3RBX A;  3SWF A;  4D6T D;  2BAS A;  4Y99 C;  3V2N A;  1K05 A;  1SQX E;  1ZRT E;  3IF4 A;  1FJP A;  2HLO A;  2NRG A;  1N7S A;  1T3U A;  1LNQ A;  2ZFC A;  2Q1K A;  4PJ0 H;  1FS0 E;  2WZ7 A;  1S5L H;  1EDI A;  3L74 D;  2GA1 A;  1NKZ B;  3BCC G;  5AVW B;  1Y47 A;  1N73 A;  1ZW0 A;  1IC2 A;  2B87 B;  1SQP G;  5CCG C;  3VP9 A;  3WUT A;  3TK1 A;  3S4R A;  1ZN5 A;  1X0T A;  1M57 D;  1RF0 A;  1JY2 N;  1WT6 A;  1FZC B;  3L72 D;  3Q5R A;  3I5C A;  2XKM A;  1EC5 A;  5KJ7 C;  2V4H A;  1LP1 A;  1EDL A;  1URQ B;  2N9B A;  3L70 J;  3TGU E;  1HH0 A;  1IFM A;  3L72 G;  1G1I A;  1FU1 A;  4PV1 B;  1VPC A;  1NTK J;  2R44 A;  2WQY C;  2MKV A;  1JCD A;  2R5B A;  3CWB G;  2WT7 A;  2XZR A;  2E74 D;  2FFD A;  2KS1 A;  1HBW A;  2K9Y A;  5E79 H;  1EDK A;  1AVO A;  1RQU A;  1AJY A;  2WIT A;  3T97 A;  4IL6 E;  5CMZ A;  3N7N A;  3A0H E;  2E76 D;  3P7K A;  1PIX A;  1S2E A;  3O8Z A;  1YQ4 C;  2VRS A;  1NAF A;  5APX A;  3F89 A;  2Z5I A;  2WMM A;  1OFC X;  1RE4 C;  2WPR A;  4KT0 J;  3RK3 E;  2QEX P;  2OTJ P;  4U7J A;  2OTK E;  4YXW H;  3CL3 D;  4JF7 A;  1Q81 Q;  1JNM A;  2OYI C;  1QEX A;  2IYO A;  3H1J G;  3CX5 E;  1OW8 A;  1LTT C;  4XA4 A;  1ZRT D;  4GDO A;  2P67 A;  2HYN A;  1PP9 J;  2QJY C;  1KIL C;  3L71 D;  1QLE D;  2IPP A;  3M0D A;  4U3F E;  1KIL E;  3L71 J;  3HE5 B;  2RH0 A;  4WB4 A;  2WSC H;  1HF9 A;  2BCC D;  3MUD A;  1CI6 B;  1YTZ I;  1KFN A;  1PV3 A;  3JSV C;  1GU5 A;  3TNU B;  2XV5 A;  3F5H A;  1ZV8 A;  3H1K E;  1SQP E;  4JBZ A;  4A7P A;  1OVU A;  3WUV A;  1NTM J;  1EXJ A;  3FWN A;  1QGK B;  3TDK A;  1LWU B;  2FYU K;  5KAI H;  3Q3D A;  4NPD A;  2M3E A;  1L0N G;  3CC7 P;  2E5T A;  1L0N E;  3H1H J;  1E5W A;  5AVX B;  4UB8 H;  1JO5 A;  3AE4 C;  1NTK D;  1USD A;  4K35 A;  1BDC A;  4YPC A;  1USE A;  2KB7 P;  2UWJ E;  1OVR A;  2AXT E;  2WSE J;  2ZYG A;  2OTL P;  1KOR A;  4I1L A;  3AE5 C;  3KDP B;  4DT0 A;  3RL0 C;  2HR3 A;  1LWU A;  2WPQ A;  3BAS A;  3VTP C;  3L70 D;  3M0D C;  1YJ9 P;  1UIX A;  1HWT C;  2WPV B;  2N9Y B;  2W6J H;  3CWB J;  1EZV E;  2KZJ A;  2RKL A;  4R4L A;  1DX7 A;  1OW6 A;  3CCJ P;  2Q9I A;  3Q2Y A;  3KYQ A;  1NTM D;  2ZYA A;  3EQ2 A;  3KHU A;  2NPS D;  2QRX A;  5AVS B;  2KXP B;  3WMM 0;  2KLV A;  1HGZ A;  3L70 G;  4RKU J;  5CCG A;  1H8A A;  2O1J A;  1SQX K;  1NTM K;  1UII A;  1NYH A;  1KIL D;  3VMX A;  1AV1 A;  2LXB A;  2ZXE B;  3FXE A;  2QJP C;  2WSS H;  1PGJ A;  3PRJ A;  4CPG A;  1CW5 A;  3L71 E;  1GZL A;  1QL2 A;  3GLM A;  5C39 A;  4PD4 I;  3TGU J;  1KQS O;  1R5S A;  1GW3 A;  1PP9 D;  2M5A B;  3A5T A;  1SQB E;  2QE7 H;  3JCU E;  1QVG O;  1SLQ A;  1LTJ A;  2FXP A;  2KP8 A;  3ZDM A;  4ZKP A;  1JUN A;  4R4M A;  3CWB D;  1BCC G;  3MD0 A;  1SQX G;  1AQT A;  3AEB C;  3CME P;  1OMI A;  1SQQ J;  2YIU C;  4Y99 B;  2KNC B;  1K8A Q;  1L0L E;  3CX5 H;  1R8E A;  4DOJ A;  2H8P D;  1BSN A;  4JPZ B;  5APT A;  3TSI A;  4C7R A;  1S72 P;  1JTH A;  1JMB A;  1RF1 A;  3FX0 A;  4N78 D;  1SFC B;  1X79 B;  1SQX J;  1L4A B;  3LID A;  1BE3 D;  1SQQ G;  2AXC A;  4I6M C;  3H1H D;  2POH A;  5L8R J;  2IYP A;  1Q86 Q;  2D2C C;  2PFX A;  3B5N B;  3M9H A;  1J1D C;  3HE4 B;  2JWA A;  1FBM A;  4I2L C;  3JCU H;  3VP8 A;  3BCC E;  3U59 A;  1K73 Q;  1YTZ T;  3H25 A;  3H1I D;  3A7O A;  1NGM B;  2E75 D;  4WWI A;  5H2F E;  5CHX A;  1AA0 A;  1SFC A;  1SQP D;  1TU3 F;  1ZP0 C;  2BCC J;  2R3C A;  2ZYD A;  3AEA C;  3BRV B;  3CWB E;  1SQQ K;  2FXM A;  3GHG A;  3MP7 B;  4PV1 D;  3SFD C;  3CCR P;  1DIP A;  1OX3 A;  2GM4 A;  1U7J A;  1PP9 G;  2OGU A;  3B5N A;  1BGY D;  1Q7Y Q;  5DJU B;  2XNX A;  1MV8 A;  2JWD A;  1SQV D;  2FBW C;  3V5B A;  5APY A;  5KJ7 A;  3BVH A;  1G1J A;  1SQB K;  3L4F A;  5AW7 B;  1SQV E;  1MFZ A;  5KLV G;  3R2P A;  1N7S C;  3PH0 A;  4WY4 A;  2O01 J;  5AVU B;  2HOD B;  1HJ0 A;  2Q3E A;  3HD7 C;  3WUU A;  3RK3 D;  3RK2 C;  3IAO A;  2KOG A;  2YO3 A;  3H1L E;  2ZT9 D;  5CCH C;  3H1L G;  2E5Y A;  2JP3 A;  4OGQ C;  3TNU A;  1S1C X;  3L73 D;  4WY4 D;  3U1C A;  2E43 A;  1BCC J;  1LP1 B;  4EOT A;  2OYH A;  2SPZ A;  4OVN F;  1M90 Q;  4NPE A;  3TF5 A;  2IDB A;  5BU5 A;  1DEB A;  2FYN C;  3PP5 A;  2L91 A;  3I56 P;  1HJB A;  1S9K D;  4YXD C;  3MTU E;  1FE6 A;  3Q5P A;  4KJM A;  1U7M A; 
#chains in the Genus database with same CATH homology
 3E1I A;  3B5N C;  4LC1 A;  1DH3 A;  3A2A A;  3P8C D;  2W6A A;  2R32 A;  2OAR A;  5KTB A;  1LTG C;  3P8C E;  1FZF A;  1L0N K;  4WY4 C;  2FYZ A;  1L4A C;  1LTA C;  1JY3 O;  2E42 A;  3SWY A;  2M8R A;  3RK2 B;  3V2Q A;  2YO2 A;  1JCC A;  1CSB A;  1NHL A;  1T8Z A;  3VMZ A;  3TYY A;  3HD7 D;  3IFM A;  1FDM A;  2JEE A;  2XDJ A;  3L37 A;  1L4A D;  3UIA A;  2W27 A;  2H43 A;  1M1J C;  1N73 C;  3KQG A;  4N6J A;  2WT7 B;  1FAV A;  2I1J A;  1MUU A;  2CPB A;  3LIE A;  5KLV K;  5AW5 B;  3II6 A;  1RE4 A;  2YKO A;  5AW2 B;  2IFN A;  2Q3I A;  2OYI A;  3H32 B;  2A45 H;  4LLH A;  4C7N B;  3P8M C;  2M3B A;  5AW0 B;  4DZO A;  1KQL A;  3M91 A;  1JY3 N;  3VYI A;  1FZA A;  2YNY A;  3LW5 H;  3RK2 D;  1J1E B;  2PP6 A;  2I1K A;  1CI6 A;  2OYI B;  2YKQ A;  2J58 A;  2KYV A;  2NPS A;  3NMD A;  4C7N A;  3RK3 B;  2A45 G;  1KIL B;  1RF1 C;  1G2C A;  3HTK A;  1VDF A;  5APS A;  5AVQ B;  1JMM A;  4N3Y B;  3HUS C;  2WSE H;  3B5N D;  3VOP A;  1NH4 A;  4M3L A;  1H89 A;  2IFM A;  1FOS F;  4C46 A;  1W2E A;  2FFD C;  1LWU C;  4LGD E;  1YYC A;  3M9B A;  1SFC C;  1L4A A;  4JYB A;  1T3J A;  1FZE A;  1N7S B;  1WRG A;  5APU A;  3HD7 B;  1SQV K;  2C0W A;  2QM8 A;  1J1E C;  3HE4 A;  4OH8 B;  1LGH B;  2GUS A;  2P1J A;  3C9I A;  3MGN A;  1ZR4 A;  5AVR B;  3L35 A;  3HRN A;  2IX7 C;  2Z5H A;  3NTN A;  2WPS A;  1LTI C;  1HGV A;  1ZLL A;  5BVZ A;  1FZB A;  2WWW A;  3V4Q A;  1JY3 P;  2WSF H;  3M0A A;  1IFD A;  2Q5U A;  4GT1 A;  2PAJ A;  2C9N Y;  1GK6 A;  3MIW A;  1RE3 C;  1GDT A;  1IK9 A;  4IFM A;  2J59 M;  5CJ0 A;  5CCH D;  1XTG B;  3EFG A;  3NXS A;  1M1J B;  1IFI A;  1N73 B;  1CZQ A;  2P7J A;  1XTC C;  3V2P A;  1LTB C;  2CPS A;  1HVV A;  1LT9 A;  1URQ A;  1NO4 A;  5AVV B;  3M06 A;  3RL0 D;  1GL2 C;  4IFD K;  1X8Y A;  1AQ5 A;  1Z56 A;  1RY3 A;  2W6B A;  2N1T D;  1L0L K;  2O01 H;  4O9B A;  2HOD A;  5CCH A;  1DX7 A;  1ZR2 A;  2O1K A;  1RF1 B;  1IFN A;  1HTL C;  1SVF A;  1KIL A;  1OXZ A;  1GL2 D;  1HUC A;  4GKG A;  3VMY A;  3VN0 A;  1URQ D;  3V2R A;  1NKN A;  5APW A;  1N2D C;  2N1T B;  1PFI A;  2A45 I;  3NFQ A;  3L36 A;  4W7Y A;  5AW9 B;  1GD2 E;  2OYH C;  3IR9 A;  5AW8 B;  1N86 A;  1IFJ A;  1GK4 A;  3P32 A;  1AFO A;  4WBA A;  5AW6 B;  2MJZ A;  5AW1 B;  4AUW A;  2QM7 A;  4ZKU A;  1A02 J;  4WY4 B;  1RE3 A;  1LTS C;  3A3Y B;  1GW4 A;  5APQ A;  1IJD B;  1EQ7 A;  4EIJ A;  2N1T C;  4N78 E;  3HTK B;  1SP4 A;  1N7S D;  2C0X A;  1FZC A;  1FOS E;  2KSJ A;  4KHX A;  2P2U A;  3GHG B;  3V4W A;  1X9V A;  4GIF A;  1IO4 A;  2GUV A;  2Z4E A;  1JY2 O;  1N7L A;  3BRT B;  4W80 A;  3U1A A;  4JYC A;  3RL0 B;  1JOC A;  1M1J A;  1N73 A;  3B8E B;  5CJ4 A;  3BAT A;  1NWQ A;  3OJA B;  4RES B;  2N1T A;  2NPS B;  3KPE A;  2HPC A;  4XE5 B;  5KJ7 D;  1G2C B;  5AW4 B;  3G3Z A;  3HUS A;  3GHG C;  1SQP K;  1T2K C;  3H6P A;  3RK3 C;  1JY2 P;  2XU6 A;  3OAK A;  4HYT B;  1GL2 B;  1LT9 C;  3HUS B;  3M9Q A;  3H32 A;  2FKW B;  1S9K E;  1J2J B;  1LTJ C;  4B86 A;  3HD7 A;  2FFD B;  5CCG D;  3N4X A;  1QL1 A;  2YKP A;  1NTK K;  2WTY A;  2HFE D;  4IFF A;  1LT9 B;  1NU1 K;  5AVT B;  5AW3 B;  1KZU B;  2R5D A;  1GU4 A;  2NPS C;  1NTZ K;  2YMY A;  2H7H A;  1FZC C;  1KFM A;  3CI9 A;  5BU8 B;  5AVZ B;  5AVY B;  2LKM A;  2L5G B;  1SFC D;  1LTJ B;  2HPC B;  1M7L A;  1T2K D;  5APV A;  1FZG A;  1FJK A;  1JTH B;  1URQ C;  3OA7 A;  2JJL A;  3CLQ A;  4AYC A;  2C9L Y;  2E43 A;  1J1D B;  1GL2 A;  2Q7C A;  4AQR D;  1RF0 C;  4W7Z A;  2OYH B;  1MZ9 A;  1NOH A;  3HE5 A;  1OWA A;  2HG5 D;  4HH2 A;  1A02 F;  3SWF A;  2BAS A;  4Y99 C;  3V2N A;  1FJP A;  2HLO A;  1N7S A;  1T3U A;  2ZFC A;  2WZ7 A;  1NKZ B;  5AVW B;  1IC2 A;  5CCG C;  3VP9 A;  3TK1 A;  1ZN5 A;  1RF0 A;  1JY2 N;  1WT6 A;  1FZC B;  3I5C A;  2XKM A;  5KJ7 C;  1URQ B;  2N9B A;  1HH0 A;  1IFM A;  1G1I A;  1FU1 A;  1VPC A;  2R5B A;  1JCD A;  2WT7 A;  2XZR A;  2FFD A;  1HBW A;  2WIT A;  3T97 A;  5CMZ A;  3N7N A;  3P7K A;  5APX A;  3O8Z A;  2VRS A;  1NAF A;  2Z5I A;  2WPR A;  1RE4 C;  3CL3 D;  4JF7 A;  1JNM A;  2OYI C;  4XA4 A;  1LTT C;  2P67 A;  2HYN A;  1KIL C;  2IPP A;  3M0D A;  4WB4 A;  3HE5 B;  2WSC H;  3MUD A;  1CI6 B;  1YTZ I;  1KFN A;  1GU5 A;  3TNU B;  2XV5 A;  1ZV8 A;  1LWU B;  2FYU K;  1E5W A;  5AVX B;  1JO5 A;  2KB7 P;  4I1L A;  3KDP B;  3RL0 C;  3BAS A;  1LWU A;  2WPQ A;  3VTP C;  3M0D C;  1HWT C;  2Q9I A;  3KYQ A;  3EQ2 A;  2NPS D;  5AVS B;  5CCG A;  3WMM 0;  2KLV A;  1HGZ A;  1H8A A;  2O1J A;  1SQX K;  1NTM K;  1KIL D;  3VMX A;  2ZXE B;  1CW5 A;  1GZL A;  1QL2 A;  1GW3 A;  3A5T A;  1SLQ A;  1LTJ A;  1JUN A;  2KP8 A;  4ZKP A;  3MD0 A;  4Y99 B;  4DOJ A;  2H8P D;  5APT A;  3TSI A;  4C7R A;  1RF1 A;  1JTH A;  4N78 D;  1SFC B;  1X79 B;  1L4A B;  3LID A;  4I6M C;  2POH A;  3B5N B;  3M9H A;  1J1D C;  3HE4 B;  4I2L C;  1FBM A;  3VP8 A;  3U59 A;  1YTZ T;  3A7O A;  5CHX A;  1SFC A;  3BRV B;  2R3C A;  3GHG A;  1SQQ K;  2FXM A;  2GM4 A;  3B5N A;  2XNX A;  1MV8 A;  3V5B A;  5KJ7 A;  5APY A;  3BVH A;  3L4F A;  1G1J A;  1SQB K;  5AW7 B;  1MFZ A;  3R2P A;  1N7S C;  4WY4 A;  5AVU B;  2HOD B;  3HD7 C;  3RK3 D;  3RK2 C;  2KOG A;  2YO3 A;  5CCH C;  3U1C A;  3TNU A;  4WY4 D;  4EOT A;  2OYH A;  5BU5 A;  1DEB A;  3PP5 A;  1HJB A;  1S9K D;  1GTW A;  3MTU E;  1H88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...