3A5TA

Crystal structure of mafg-dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
HMGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Alternative DNA Recognition by Maf Transcription Factors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator/dna
molecule keywords Transcription factor MafG
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a5tA00
4C46A 2R3CA 3LIEA 5AVQB 1GU5A 4JYCA 2WPSA 5APVA 5APWA 2XV5A 4C7NA 3A3YB 3TYYA 1OWAA 3MGNA 3IR9A 1T2KC 3NXSA 5AVVB 4GKGA 1HUCA 1CSBA 2IPPA 2Q7CA 3A7OA 3NTNA 5AW8B 1S9KE 1GU4A 5AVTB 2P2UA 1HJBA 1CI6B 3TNUA 2JJLA 3HTKA 5AVRB 2WWWA 3L37A 1H8AA 3A2AA 4JYBA 4RESB 1T2KD 4I2LC 3KQGA 1CI6A 3TNUB 3HE4A 1H88A 5AW4B 3B8EB 5APYA 2C9NY 1NAFA 3V4QA 5AW6B 4B86A 1HWTC 3P7KA 1MUUA 2XU6A 5AVSB 1FOSF 3OAKA 2R32A 1MFZA 1JNMA 3LIDA 1GK6A 3M06A 2BASA 4I6MC 1SLQA 2XZRA 1YYCA 2P7JA 1A02J 4C7NB 5AVXB 3M0AA 3M91A 5AW0B 1FOSE 3VYIA 4AUWA 1G2CB 2ZXEB 1MV8A 2YNYA 3V4WA 5AW7B 3KDPB 5APQA 1SP4A 2Q3IA 5AVUB 2WPQA 2Z5HA 4LC1A 3TK1A 3VMXA 4AYCA 3I5CA 2Z5IA 5AW2B 2W27A 4GT1A 3UIAA 2E43A 5AW3B 3VN0A 1GTWA 3HE4B 1GD2E 2VRSA 2W6AA 2WPRA 3L35A 4KHXA 5AW1B 2E42A 1GK4A 1JUNA 1J2JB 3HE5B 4XE5B 3VTPC 3L36A 3VMZA 5AVZB 1DH3A 1CZQA 2P67A 5APTA 2YO3A 2WTYA 1NWQA 5AW9B 2N9BA 4HYTB 3SWFA 1X8YA 2C9LY 3M0DA 2Q5UA 3V5BA 2H7HA 1GZLA 4DZOA 3P8MC 4EOTA 3A5TA 5AW5B 2QM7A 1S9KD 3M9HA 2ZFCA 3NMDA 1HBWA 2KP8A 2R5DA 3O8ZA 1A02F 3P32A 3HE5A 5APUA 1OXZA 2WT7B 3NFQA 3VMYA 1KQLA 5APXA 4M3LA 3MD0A 5APSA 2QM8A 5AVWB 1H89A 2R5BA 5CMZA 3M9BA 3T97A 5AVYB 4AQRD 2WT7A 2YO2A 1IO4A 1FAVA
chains in the Genus database with same CATH superfamily
1SS1A 2R3CA 1GL2B 3D6YA 3LIEA 2BEZF 1GU5A 2OYIA 1IFIA 5KTBA 3Q5RA 3VP9A 4UB6E 3CCUP 1VF5C 1OW7A 1YQ3C 4U3FG 5APVA 3EWKA 4OGQD 4EYYQ 2HPCB 1KYOH 1KFMA 2D2CC 3EFFK 1NU1E 1LGHB 3PHLA 4K35A 1IFNA 5APWA 1SQXJ 3AEGC 3L70D 1NTKG 3AE9C 2FFDC 1IFPA 5B5EE 3BATA 1KN7A 2BCCJ 2IZ1A 2N9YB 3H1HE 4GKGA 2OYHA 1JMMA 3H1IJ 1L0LE 2M3BA 2KYVA 2WPVB 3A7OA 4YXDC 4C7RA 1EQ7A 2K3RA 1EZVD 4WB4A 5AVTB 5KKZB 1PGPA 2FYUD 1LNQA 4PV1D 1USDA 2JJLA 1J1DB 3LW5J 5GTHH 2HR3A 2IX7C 3A2AA 2IBZG 1KB9I 2FYNC 2O1JA 4I2LC 3HTKB 1SFCA 1CI6A 3TGUE 3HE4A 1H88A 2QJYB 5AW4B 3B8EB 2WQYC 1T6AA 2WSEH 3KZIE 2E5YA 2QJPB 1KC8Q 1N86A 2A45H 1T8ZA 1BE3D 2IDBA 2NPSB 2KZIA 2LXCB 4RKUJ 1IFJA 1Q82Q 3JCUH 5AVSB 2A45I 3OAKA 1PZQA 2R32A 2Q3EA 1S1CX 1LTIC 2Y0EA 4OWFA 3LIDA 5KJ7D 3GG2A 2M5AA 2ZVNB 2BASA 4DJGA 1DEBA 1VL2A 3PRJA 4NPEA 1PGQA 1OVUA 1P84H 1ZP0C 4C7NB 1A02J 1ZN5A 3E7KA 1OW8A 1SQXE 5KJ7A 1HGZA 3SFDC 1NTKD 2OTLP 5KLIC 3AEEC 3L75G 1RF0A 4Y99C 2KXPB 1VQ4P 1AVYA 1SP4A 2Q3IA 1PGOA 4PJ0H 1N73A 1S5LE 1L0NG 4UB8E 2XNDH 1H0TA 4Y99B 4LC1A 4WY4B 1NAYA 4IOIH 1J1EB 1X9VA 1YTZT 3B5NC 3EFGA 3I5CA 4H13B 5CCHD 1NTMG 1FZCA 2W27A 3HUSC 4GT1A 1FDIA 3CC7P 1EZVE 2FFDA 5AW3B 1GTWA 2HODA 3VOPA 1JY2P 1JB0J 1RE3A 2WSCJ 2K37A 3N7NA 1JCDA 3H1IG 2WPRA 2E5TA 2H89C 4KHXA 4NPDA 1LP1B 2RMZA 1YTZI 1MKMA 2FYUG 3V6IA 2W83C 1P84E 3HE5B 5KAIH 2QA4P 1M57D 3VTPC 4EI2A 4LGDE 3L70E 1IZNB 1SQQG 1VQMP 1NTZK 1M7LA 3H1IE 3WUTA 3W67A 4MN4C 2HLOA 2KLUA 3FGAD 2FXMA 2YO3A 1AA0A 1T3JA 4HJGH 2JKVA 1KILC 1NWQA 2XKMA 5AW9B 3EQ2A 4I7ZC 2CPSA 5KLVD 2AEJA 3AEDC 1MFTA 2Q5UA 3S4RA 1LTJC 1FZFA 2H7HA 1DX7A 3H1JJ 4H0LD 4IL6X 4DZOA 4XFJA 3G9RA 1NTZD 2Q1KA 4IFMA 1IJDB 1PL5A 2RH0A 1OZHA 1ZOYC 5CHXA 3AE5C 3L73J 5C39A 2V4HA 2QM7A 2ZT9D 2RKLA 4WY4C 4ZKPA 1LTGC 1OVVA 3VP8A 2YMKA 1JY2N 3H1LG 1RE4A 1U7MA 3P32A 2KUBA 3HUSB 3L74J 3GHGC 5K5GB 2E75C 1CW5A 3L72D 3H1LD 4JBZA 2KS1A 3NFQA 2WT7B 4GIFA 2HYNA 1SQBE 2O01N 3MD0A 5TISE 1GW3A 1YIJP 5H2FE 1L4AB 1WRGA 3BRTB 1G1JA 2QM8A 3MP7B 1KD1Q 3F89A 3L71G 2WSSH 1OW6A 1L4AA 1SQPJ 5CCGA 1KYOD 5CJ0A 3G4SP 1FDMA 2IZ0A 1M1JA 3P8CE 3MHVA 1HJ0A 5AVYB 3SFEC 2BEQD 2KS1B 1KFNA 3L70J 4TT3H 2YO2A 3TGUJ 4CPGA 1OX3A 2WT7A 1IO4A 3V2NA 4XA4A 4ZNCA 1JEKA 3B71A 1PPJD 1NTKK 3BCCJ 5AVQB 2BCCD 2FYUE 1FS0E 3SWKA 4GODA 1EZVI 2WMMA 5EFWB 4U7JA 2WPSA 2KSEA 3AEAC 1RE4C 1L0LD 1SQQD 1N8RQ 3QWOC 1AVOA 2NZ2A 3A3YB 1IFDA 2K1AA 1PPJE 5TJHA 1AJYA 3CCEP 1NOHA 5KLIB 4TLFA 1DIPA 3PTZA 1T2KC 1QGKB 5AVVB 1L0ND 3P8CD 1YJWP 3B4SA 3TGUG 1NYHA 1CSBA 2W6JH 3HD7C 3NTNA 4HH2A 5AW8B 2KOGA 1LT1A 3BRVB 4BXLA 1S9KE 1GU4A 1NTMD 2P2UA 2LR2A 4H0LC 5B5EH 1BE3J 3FWNA 1CI6B 4U3FE 5KAIE 5KJ7C 3CX5E 2N1TA 1UIXA 2SPZA 2Y0CA 2NPSD 1SQVK 2WVRA 3GLMA 1FJKA 2OGUA 3KQGA 2KLVA 3CXHI 1HH0A 1YJNP 2AEFA 1LTSC 2W90A 2C9NY 1BGYE 3GHGA 2C0WA 1EXJA 3O6QB 1PP9D 3PH0A 4HB1A 3USSA 4B86A 2XU6A 1QVFO 1LTTC 1DD4A 1SFCC 4WY4A 3CLQA 2ZJSE 1H0TB 2OYOA 2IBZD 1X22A 2P58A 4I6MC 3WU2E 2QJPC 1N73B 1EDJA 3D71A 3W68A 1SVFA 1BE3G 3RGUA 2Q6QA 1BGYD 3M0AA 3M91A 5E79E 4AUWA 1MZ9A 1YI2P 4W80A 5CCHC 3RL0B 2ZXEB 2HPCA 1LT9C 2FYNB 2JWDA 4L76A 3AEBC 5APQA 1FE6A 1Q2NA 3RK2B 2YIUB 3G6EP 1L0LG 3AE8C 3Q1MA 1R8EA 1VQLP 2IFMA 1HVVA 2M5AB 3IAOA 3CD6P 3CX5D 3TK1A 2P1JA 1VF5B 1K04A 2N1TD 2K88A 3SWYA 1VQ6P 2Z5IA 1NTKE 1RQVA 2CK3H 1PFIA 4I1LA 4OVNF 1N7LA 1URQB 1NU1G 3V4WA 5KAFH 1OIPA 2MKVA 3L74G 3HE4B 3ZDMA 1S4XA 2VRSA 2W6AA 3FX0A 3L35A 3H1KE 5H2FH 1ZRTD 3V2QA 4ZMDA 2KZJA 4JPZB 2OYHB 1VQKP 1R5LA 2B88A 1JUNA 2A45G 1FZCC 4L75A 1IFMA 4PD4E 1JCCA 1Z56A 2JO1A 3VMZA 3H1JE 1CZQA 1EDIA 1LJ2A 1U7JA 1JMBA 3CWBE 3L71D 3CWBD 2LXBA 3Q2YA 3HD7A 3RBXA 1JO5A 2FY8A 1BCCE 2WTYA 2L91A 4OGQC 4W7ZA 1TU3F 2N9BA 3RK3C 2ZT9B 4PD4D 4W7YA 3TSIA 3BASA 2RN0A 2Y0DA 1RQUA 3H1LJ 1KYOE 1LWUB 3RBZA 3G71P 1FJPA 1SQVE 1GMJA 4EOTA 1AV1A 3A5TA 3HD7D 1K05A 4O9BA 5KLVG 1N7SC 1SQBD 2FBWC 2ZYGA 3K5BA 2E76C 1HBWA 2R5DA 1SQPE 2OYIB 1GL2A 4N78E 3FWLA 1NH4A 4D6TE 1WT6A 3ITKA 2O01J 5B66E 4RJTA 1Q90D 2FYZA 1PIXA 1Q7YQ 3VMYA 4R4LA 1KQLA 4UB6H 2M0BA 3CX5H 1N7SA 5APXA 4BWNA 2IYOA 3BCCE 4LLHA 1P84I 5APSA 5KLVE 5AVWB 1JOCA 1SQBK 2XDJA 5TISH 1H89A 1KTMA 1NTZG 2J58A 2QJKC 1FC2C 1SQQJ 1WMKA 3AE4C 3M9BA 5DJTB 1KB9E 3FXDA 4JQ0D 3T97A 2KK7A 1YJ9P 2FXPA 1JNMA 3CCRP 1HGVA 3CPWO 5E79H 1HJBA 4A7PA 4R4MA 3Q5PA 2H43A 2ZAEB 1Q86Q 2WSCH 3CWBG 1PV3A 4JYCA 3AE3C 1KQGB 3AE7C 3H1ID 3TF5A 1G2CA 1KB9H 4EIJA 3CCLP 1NTMJ 1D7MA 1RF1B 1J1DC 1SQQK 3L72J 1R5SA 1LWUA 2H88C 2E75D 1URQC 2KNCB 1ZV8A 4U3FJ 1OWAA 3KPEA 1DEEG 2FXOA 2A06D 1EC5A 2ITAA 3L73G 3NXSA 4Y28J 1HUCA 4IL6E 1KILA 1RHZB 4KJMA 3L75J 3VMAA 1YHQP 1XTGB 3JCUE 1M1JC 2Y9ZA 3V2PA 2L5GB 3GHGB 3BCCG 1GL2D 1NJIQ 2K9JB 3II6A 3RK2C 1GW4A 3M0DC 3FXEA 3OJAB 3RK2D 1JTHB 2ZVOB 3KZIH 2H8PD 3WMM0 1PP9G 2OYIC 3CCVP 1KQSO 2AXCA 5AVRB 1JY2O 2WWWA 4D6TG 3MUDA 4H44C 4ZKUA 1H8AA 2PGDA 1SQPG 1VQNP 2N1TB 1T2KD 1KILD 3L71J 1AQ5A 1LT9A 3TNUB 3KHUA 5APYA 1SQVJ 2KIKA 3R2PA 1NAFA 1URQA 1BE3E 2FYUJ 2CPBA 1HWTC 3P7KA 1VQ9P 3B5NA 3TDKA 1Y8AA 3SSUA 2POHA 1SQPK 1M90Q 2Z4EA 2JWAA 4PV1B 2HFED 2IBZI 2P10A 1SQBJ 2P7JA 2I1KA 1BGYG 2A06G 2NRGA 1W5CE 5AVXB 1KMIZ 1UIIA 3VYIA 2LKMA 5KLVK 4DCKA 2ZYDA 3CXHE 1VPCA 1MV8A 2YNYA 3MUDC 2E74B 3B5ND 1T3UA 2JR8A 1FDOA 4BRYB 5GTIE 3Q5SA 1EDLA 4H44B 2QSIA 1JM0A 3OW2O 1EXIA 1NHLA 1URQD 1FZGA 1OFCX 3H1KJ 1KB9D 3V2RA 3VMXA 4AYCA 1VQPP 4IFDK 3L74E 1M1JB 4H13D 2WSEJ 2J5UA 4ASVA 3O6QA 4OH8B 2WSFJ 3S9OA 1NKZB 2GUSA 5DJUB 3UIAA 3VN0A 5CJ4A 2I1JA 1NTMK 3CWBJ 3H1HD 1GD2E 2B9BA 2E42A 1NU1J 3CCSP 1BCCJ 1HTLC 5KLVJ 1W2BO 1P84D 1PPJG 1KILE 1L0NK 1J2JB 1W2EA 3HUSA 3IN6A 4XE5B 4UB8H 1S5LH 1NTKJ 3I55P 3L36A 3L72G 2AEMA 5AVZB 3CCJP 2B87A 4PD4H 1S2EA 1YITP 2P67A 5APTA 3IFMA 1NVOA 2JEEA 4ASWA 3PP5A 1RF1C 2OTJP 1VQ5P 2ZXXA 2K9YA 1BDDA 3H32A 1X8YA 2QG4A 1Y47A 1NGMB 2IYPA 3M0DA 2QJKB 4N78D 3H32B 4QMAA 2V7QJ 1GZLA 5CCGC 3C8VA 3L71E 5CBNA 1IC2A 1LTAC 2KSJA 3RL0g 1G1IA 1M8OB 2BCCG 5AW5B 4YXWH 1SQBG 1USEA 4YPCA 1ZXGA 1S9KD 3M9HA 2ZFCA 3CCMP 4RO0A 2BCCE 3RK3D 1A02F 1IK7A 3GF7A 3HE5A 1ZRTE 1KV4A 3CC2P 2O01H 3A0HE 2AXTH 2QIWA 3AE1C 3U59A 4M3LA 3D70A 2YXRB 2FFDB 3HRNA 3KXDA 1XTCC 1AQTA 1SQXK 2E76D 5CMZA 2OTKE 2QEXP 2M8RA 2OQQA 1SQVD 2G8YA 3L74D 5CCHA 1BGYJ 1FZBA 3L72E 4NPFX 1NTZJ 4OGQB 2W8ZA 1RF0C 3CCQP 1OMIA 1QEXA 4C46A 1Y9BA 3AECC 1RY3A 4GOFA 1FU1A 4PJ0E 3BVHA 2YKOA 3CI9A 4BRYA 1QL1A 3CC4P 1NU1K 3R4YA 3GMAA 1SQQE 2Q9IA 1JY3N 2R3SA 4WVZA 2XV5A 4C7NA 1YBKA 4N3YB 1AFOA 3N4XA 3TYYA 3TGUD 2OYHC 3MGNA 2PP6A 1OVRA 2HG5D 3IR9A 3RK3E 2J59M 3AE6C 3L73E 4L73A 3RL0C 3CX5I 1L0LK 2Y9YA 3WUVA 1FZAA 3QH9A 3CL3D 3H1KD 4D6TJ 2IPPA 4EDFA 1NU1D 2Q7CA 1QX8A 1BCCD 1PGJA 2E75B 4IL6H 2MJZA 4PV1C 2IFNA 4DT0A 5GTHE 2B87B 1ZW0A 1N2DC 2GA1A 3E1IA 1JY3O 1LT9B 3JSVC 1KQFB 3TNUA 5BVZA 3HTKA 3LW5H 4I7ZB 1VQOP 2A06E 3L37A 3H1HJ 2R44A 3H1LE 4JYBA 2E74C 4RESB 1NO4A 1EDKA 1LP1A 1L0LJ 3L75E 2ZYAA 1SQXG 2WSFH 2HODB 2K9JA 2O1KA 1KORA 2PRRA 2YKPA 1FBMA 1ZMEC 3V4QA 1FZCB 2YIUC 2NPSC 2YKQA 3M9QA 1MUUA 1RH5B 1KILB 5AW6B 4WBAA 3WUUA 1FOSF 1E5WA 2KB7P 1ZLLA 3A0HH 1MFZA 3AE2C 3L75D 2QJYC 1GK6A 3JC22 4L74A 1LTBC 1SQPD 1U57A 3M06A 1SLQA 2XZRA 1YYCA 2KNCA 5CBOA 3CXHH 2YXQB 1X79B 4IFFA 5AW0B 1PP9E 1QVGO 1FOSE 2UWJE 2M3EA 1J1EC 1G2CB 1SQXD 4H13C 1E79H 2GUVA 2N1TC 3L70G 3BCCD 3KDPB 5AW7B 5L8RJ 2V7QH 3RL0D 3I56P 5KKZC 4JF7A 5AVUB 2WPQA 5GTIH 1KYOI 1S5LX 2Z5HA 4D6TD 4H0LB 2FKWB 3S1KA 2E74D 1VF5D 3B5NB 4GDOA 1EZVG 2NPSA 3CXHD 1LWUC 3MIWA 1KZUB 3OA7A 5AW2B 5BU5A 1BCCG 3CMEP 1NTME 3WU2H 3G3ZA 3H1JD 3MTUE 2XNXA 2E43A 1N7SD 1FZEA 4WY4D 1VDFA 3RK3B 3CMAP 1N7SB 1SFCB 3L73D 5AW1B 3U1CA 3GW6A 3H25A 1IK9A 1L0NE 1SFCD 1GK4A 1HF9A 1BDCA 5CCGD 1S72P 3A0BH 1DD3A 3KYQA 2JDIH 3PJSK 1JTHA 1DH3A 2JP3A 3H1KG 4U3FD 3F5HA 1QL2A 1K73Q 3ABVC 1YQ4C 4N6JA 1NTZE 1M1KQ 2D2CD 3Q3DA 3D6ZA 1X0TA 2D2CB 2KI7B 3MZWB 4HYTB 4Z1MH 4H44D 3C9IA 1L4AC 1BSHA 1L2PA 2C0XA 1M56D 2DW3A 2PAJA 2QE7H 3SWFA 2C9LY 1PP9J 2PFXA 4WWIA 5KAFE 3V5BA 5BU8B 1ZR2A 3E1RA 4DOJA 1S3JA 1GL2C 3P8MC 1RE3C 1K9MQ 3C1LA 3HD7B 1RF1A 1VQ7P 3L4FA 1QLED 3PLNA 1GDTA 3AEFC 3IF4A 3NMDA 2KP8A 3H6PA 1ZR4A 1L4AD 2IBZE 3O8ZA 3GF3A 2B89A 1SQVG 2G3AA 2QRXA 5APUA 5M1BA 1OXZA 3A0BE 2W6BA 2E76B 4HKZH 4K3AA 1VQ8P 1BSNA 3T97B 2YMYA 2O3JA 1K8AQ 1LTJA 1N73C 4KT0J 1JY3P 4YTPC 1L0NJ 3U1AA 1LTJB 2WZ7A 4GOEA 2R5BA 1NKNA 2QVAA 2WITA 3H1HG 2AXTE 1Q81Q 2ZT9C 5B66H 3H1JG 4AQRD 2I8DA 4PD4I 2OARA 2GM4A 1FAVA 2FYUK
chains in the Genus database with same CATH topology
2R3CA 1GL2B 3LIEA 1GU5A 2OYIA 1IFIA 5KTBA 3VP9A 5APVA 2HPCB 1KFMA 1LGHB 5APWA 1IFNA 2FFDC 3BATA 4GKGA 1JMMA 2M3BA 2KYVA 3A7OA 4C7RA 1EQ7A 4WB4A 5AVTB 2JJLA 1J1DB 2IX7C 3A2AA 2O1JA 4I2LC 3HTKB 1SFCA 1CI6A 1H88A 3HE4A 5AW4B 3B8EB 2WSEH 1N86A 2A45H 1T8ZA 2NPSB 1IFJA 5AVSB 2A45I 3OAKA 2R32A 1LTIC 5KJ7D 3LIDA 2BASA 1DEBA 1A02J 4C7NB 1ZN5A 5KJ7A 1HGZA 1RF0A 4Y99C 1SP4A 2Q3IA 1N73A 4Y99B 4LC1A 4WY4B 1J1EB 1X9VA 1YTZT 3B5NC 3EFGA 3I5CA 5CCHD 1FZCA 2W27A 3HUSC 4GT1A 2FFDA 5AW3B 1GTWA 2HODA 3VOPA 1JY2P 3N7NA 1RE3A 1JCDA 4KHXA 2WPRA 1YTZI 3HE5B 3VTPC 4LGDE 1NTZK 1M7LA 2HLOA 2FXMA 2YO3A 1T3JA 1KILC 1NWQA 2XKMA 5AW9B 3EQ2A 2CPSA 2Q5UA 1LTJC 1FZFA 2H7HA 1DX7A 4DZOA 4IFMA 1IJDB 5CHXA 2QM7A 4WY4C 4ZKPA 1LTGC 3VP8A 1JY2N 1RE4A 3P32A 3HUSB 1CW5A 3GHGC 2WT7B 3NFQA 4GIFA 2HYNA 3MD0A 1GW3A 1L4AB 1WRGA 3BRTB 1G1JA 2QM8A 1FDMA 1L4AA 5CCGA 5CJ0A 1M1JA 3P8CE 5AVYB 2WT7A 1KFNA 2YO2A 1IO4A 3V2NA 4XA4A 1NTKK 5AVQB 2WPSA 1RE4C 3A3YB 1IFDA 1NOHA 1T2KC 5AVVB 3P8CD 1CSBA 3HD7C 3NTNA 4HH2A 5AW8B 2KOGA 3BRVB 1S9KE 1GU4A 2P2UA 1CI6B 5KJ7C 2N1TA 2NPSD 1SQVK 1FJKA 3KQGA 2KLVA 1HH0A 1LTSC 2C9NY 3GHGA 2C0WA 4B86A 2XU6A 1LTTC 1SFCC 4WY4A 3CLQA 4I6MC 1N73B 1SVFA 3M0AA 3M91A 4AUWA 1MZ9A 2HPCA 4W80A 5CCHC 3RL0B 2ZXEB 1LT9C 5APQA 3RK2B 2IFMA 1HVVA 3TK1A 2P1JA 2N1TD 3SWYA 2Z5IA 1PFIA 4I1LA 1N7LA 1URQB 3HE4B 2VRSA 2W6AA 3L35A 2OYHB 3V2QA 1JUNA 2A45G 1FZCC 3VMZA 1IFMA 1JCCA 1Z56A 1CZQA 1JO5A 3HD7A 2WTYA 4W7ZA 2N9BA 3RK3C 4W7YA 3TSIA 3BASA 1LWUB 1FJPA 4EOTA 3A5TA 3HD7D 4O9BA 1N7SC 1HBWA 2R5DA 2OYIB 1GL2A 4N78E 1NH4A 1WT6A 2FYZA 3VMYA 2OYHA 1KQLA 5APXA 1N7SA 4LLHA 5APSA 5AVWB 1JOCA 1SQBK 2XDJA 1H89A 2J58A 3M9BA 3T97A 1JNMA 1HGVA 2H43A 2WSCH 4JYCA 1G2CA 4EIJA 1RF1B 1J1DC 1SQQK 1LWUA 1URQC 1ZV8A 1OWAA 3KPEA 3NXSA 1HUCA 1KILA 1XTGB 1M1JC 3V2PA 2L5GB 3GHGB 1GL2D 3II6A 3RK2C 1GW4A 3M0DC 3OJAB 3RK2D 3WMM0 1JTHB 2OYIC 2H8PD 5AVRB 1JY2O 2WWWA 3MUDA 4ZKUA 1H8AA 2N1TB 1T2KD 1KILD 1AQ5A 1LT9A 3TNUB 5APYA 3R2PA 1NAFA 1URQA 2CPBA 1HWTC 3P7KA 3B5NA 2POHA 1SQPK 2Z4EA 2HFED 2P7JA 2I1KA 5AVXB 3VYIA 2LKMA 5KLVK 1VPCA 1MV8A 2YNYA 3B5ND 1T3UA 1NHLA 1URQD 1FZGA 3V2RA 3VMXA 4AYCA 4IFDK 1M1JB 4OH8B 1NKZB 2GUSA 3UIAA 5CJ4A 3VN0A 2I1JA 1NTMK 1GD2E 2E42A 1HTLC 1L0NK 1J2JB 1W2EA 3HUSA 4XE5B 3L36A 5AVZB 2P67A 5APTA 3IFMA 2JEEA 3PP5A 1RF1C 3H32A 1X8YA 3M0DA 4N78D 3H32B 1GZLA 5CCGC 1IC2A 1LTAC 2KSJA 1G1IA 5AW5B 1S9KD 3M9HA 2ZFCA 3RK3D 1A02F 3HE5A 2O01H 3U59A 4M3LA 2FFDB 3HRNA 1XTCC 1SQXK 5CMZA 2M8RA 5CCHA 1FZBA 1RF0C 4C46A 1RY3A 1FU1A 3BVHA 2YKOA 3CI9A 1QL1A 1NU1K 2Q9IA 1JY3N 2XV5A 4C7NA 4N3YB 1AFOA 3N4XA 3TYYA 2OYHC 3MGNA 2PP6A 2HG5D 3IR9A 2J59M 3RL0C 1L0LK 1FZAA 3CL3D 2IPPA 2Q7CA 2MJZA 2IFNA 1N2DC 1HJBA 3E1IA 1JY3O 1LT9B 3TNUA 5BVZA 3HTKA 3LW5H 3L37A 4JYBA 4RESB 1NO4A 2WSFH 2HODB 2O1KA 2YKPA 1FBMA 3V4QA 1FZCB 2YKQA 2NPSC 3M9QA 5AW6B 1MUUA 1KILB 4WBAA 1FOSF 1E5WA 2KB7P 1ZLLA 1MFZA 1GK6A 1LTBC 3M06A 1SLQA 2XZRA 1YYCA 1X79B 4IFFA 5AW0B 1FOSE 1J1EC 1G2CB 3V4WA 2GUVA 2N1TC 5AW7B 3KDPB 3RL0D 4JF7A 5AVUB 2WPQA 2Z5HA 2FKWB 3B5NB 2NPSA 5BU5A 1LWUC 3MIWA 1KZUB 3OA7A 5AW2B 2E43A 3G3ZA 3MTUE 2XNXA 1N7SD 1FZEA 4WY4D 1VDFA 3RK3B 1N7SB 1SFCB 3U1CA 5AW1B 1IK9A 1SFCD 1GK4A 5CCGD 3KYQA 1JTHA 1DH3A 1QL2A 4N6JA 4HYTB 3C9IA 1L4AC 2C0XA 2PAJA 3SWFA 2C9LY 1ZR2A 3V5BA 5BU8B 4DOJA 1GL2C 3P8MC 1RE3C 1RF1A 3HD7B 3L4FA 1GDTA 3NMDA 2KP8A 3H6PA 1ZR4A 1L4AD 3O8ZA 5APUA 1OXZA 2W6BA 2YMYA 1LTJA 1N73C 1JY3P 3U1AA 1LTJB 2WZ7A 2R5BA 1NKNA 2WITA 4AQRD 2OARA 2GM4A 1FAVA 2FYUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  2R3C A;  3LIE A;  5AVQ B;  1GU5 A;  4JYC A;  2WPS A;  5APV A;  5APW A;  2XV5 A;  4C7N A;  3A3Y B;  3TYY A;  1OWA A;  3MGN A;  3IR9 A;  1T2K C;  3NXS A;  5AVV B;  4GKG A;  1HUC A;  1CSB A;  2IPP A;  2Q7C A;  3A7O A;  3NTN A;  5AW8 B;  1S9K E;  1GU4 A;  5AVT B;  2P2U A;  1HJB A;  1CI6 B;  3TNU A;  2JJL A;  3HTK A;  5AVR B;  2WWW A;  3L37 A;  1H8A A;  3A2A A;  4JYB A;  4RES B;  1T2K D;  4I2L C;  3KQG A;  1CI6 A;  3TNU B;  3HE4 A;  1H88 A;  5AW4 B;  3B8E B;  5APY A;  2C9N Y;  1NAF A;  3V4Q A;  5AW6 B;  4B86 A;  1HWT C;  3P7K A;  1MUU A;  2XU6 A;  5AVS B;  1FOS F;  3OAK A;  2R32 A;  1MFZ A;  1JNM A;  3LID A;  1GK6 A;  3M06 A;  2BAS A;  4I6M C;  1SLQ A;  2XZR A;  1YYC A;  2P7J A;  1A02 J;  4C7N B;  5AVX B;  3M0A A;  3M91 A;  5AW0 B;  1FOS E;  3VYI A;  4AUW A;  1G2C B;  2ZXE B;  1MV8 A;  2YNY A;  3V4W A;  5AW7 B;  3KDP B;  5APQ A;  1SP4 A;  2Q3I A;  5AVU B;  2WPQ A;  2Z5H A;  4LC1 A;  3TK1 A;  3VMX A;  4AYC A;  3I5C A;  2Z5I A;  5AW2 B;  2W27 A;  4GT1 A;  3UIA A;  2E43 A;  5AW3 B;  3VN0 A;  1GTW A;  3HE4 B;  1GD2 E;  2VRS A;  2W6A A;  2WPR A;  3L35 A;  4KHX A;  5AW1 B;  2E42 A;  1GK4 A;  1JUN A;  1J2J B;  3HE5 B;  4XE5 B;  3VTP C;  3L36 A;  3VMZ A;  5AVZ B;  1DH3 A;  1CZQ A;  2P67 A;  5APT A;  2YO3 A;  2WTY A;  1NWQ A;  5AW9 B;  2N9B A;  4HYT B;  3SWF A;  1X8Y A;  2C9L Y;  3M0D A;  2Q5U A;  3V5B A;  2H7H A;  1GZL A;  4DZO A;  3P8M C;  4EOT A;  3A5T A;  5AW5 B;  2QM7 A;  1S9K D;  3M9H A;  2ZFC A;  3NMD A;  1HBW A;  2KP8 A;  2R5D A;  3O8Z A;  1A02 F;  3P32 A;  3HE5 A;  5APU A;  1OXZ A;  2WT7 B;  3NFQ A;  3VMY A;  1KQL A;  5APX A;  4M3L A;  3MD0 A;  5APS A;  2QM8 A;  5AVW B;  1H89 A;  2R5B A;  5CMZ A;  3M9B A;  3T97 A;  5AVY B;  4AQR D;  2WT7 A;  2YO2 A;  1IO4 A;  1FAV A; 
#chains in the Genus database with same CATH topology
 1SS1 A;  2R3C A;  1GL2 B;  3D6Y A;  3LIE A;  2BEZ F;  1GU5 A;  2OYI A;  1IFI A;  5KTB A;  3Q5R A;  3VP9 A;  4UB6 E;  3CCU P;  1VF5 C;  1OW7 A;  1YQ3 C;  4U3F G;  5APV A;  3EWK A;  4OGQ D;  4EYY Q;  2HPC B;  1KYO H;  1KFM A;  2D2C C;  3EFF K;  1NU1 E;  1LGH B;  3PHL A;  4K35 A;  1IFN A;  5APW A;  1SQX J;  3AEG C;  3L70 D;  1NTK G;  3AE9 C;  2FFD C;  1IFP A;  5B5E E;  3BAT A;  1KN7 A;  2BCC J;  2IZ1 A;  2N9Y B;  3H1H E;  4GKG A;  2OYH A;  1JMM A;  3H1I J;  1L0L E;  2M3B A;  2KYV A;  2WPV B;  3A7O A;  4YXD C;  4C7R A;  1EQ7 A;  2K3R A;  1EZV D;  4WB4 A;  5AVT B;  5KKZ B;  1PGP A;  2FYU D;  1LNQ A;  4PV1 D;  1USD A;  2JJL A;  1J1D B;  3LW5 J;  5GTH H;  2HR3 A;  2IX7 C;  3A2A A;  2IBZ G;  1KB9 I;  2FYN C;  2O1J A;  4I2L C;  3HTK B;  1SFC A;  1CI6 A;  3TGU E;  3HE4 A;  1H88 A;  2QJY B;  5AW4 B;  3B8E B;  2WQY C;  1T6A A;  2WSE H;  3KZI E;  2E5Y A;  2QJP B;  1KC8 Q;  1N86 A;  2A45 H;  1T8Z A;  1BE3 D;  2IDB A;  2NPS B;  2KZI A;  2LXC B;  4RKU J;  1IFJ A;  1Q82 Q;  3JCU H;  5AVS B;  2A45 I;  3OAK A;  1PZQ A;  2R32 A;  2Q3E A;  1S1C X;  1LTI C;  2Y0E A;  4OWF A;  3LID A;  5KJ7 D;  3GG2 A;  2M5A A;  2ZVN B;  2BAS A;  4DJG A;  1DEB A;  1VL2 A;  3PRJ A;  4NPE A;  1PGQ A;  1OVU A;  1P84 H;  1ZP0 C;  4C7N B;  1A02 J;  1ZN5 A;  3E7K A;  1OW8 A;  1SQX E;  5KJ7 A;  1HGZ A;  3SFD C;  1NTK D;  2OTL P;  5KLI C;  3AEE C;  3L75 G;  1RF0 A;  4Y99 C;  2KXP B;  1VQ4 P;  1AVY A;  1SP4 A;  2Q3I A;  1PGO A;  4PJ0 H;  1N73 A;  1S5L E;  1L0N G;  4UB8 E;  2XND H;  1H0T A;  4Y99 B;  4LC1 A;  4WY4 B;  1NAY A;  4IOI H;  1J1E B;  1X9V A;  1YTZ T;  3B5N C;  3EFG A;  3I5C A;  4H13 B;  5CCH D;  1NTM G;  1FZC A;  2W27 A;  3HUS C;  4GT1 A;  1FDI A;  3CC7 P;  1EZV E;  2FFD A;  5AW3 B;  1GTW A;  2HOD A;  3VOP A;  1JY2 P;  1JB0 J;  1RE3 A;  2WSC J;  2K37 A;  3N7N A;  1JCD A;  3H1I G;  2WPR A;  2E5T A;  2H89 C;  4KHX A;  4NPD A;  1LP1 B;  2RMZ A;  1YTZ I;  1MKM A;  2FYU G;  3V6I A;  2W83 C;  1P84 E;  3HE5 B;  5KAI H;  2QA4 P;  1M57 D;  3VTP C;  4EI2 A;  4LGD E;  3L70 E;  1IZN B;  1SQQ G;  1VQM P;  1NTZ K;  1M7L A;  3H1I E;  3WUT A;  3W67 A;  4MN4 C;  2HLO A;  2KLU A;  3FGA D;  2FXM A;  2YO3 A;  1AA0 A;  1T3J A;  4HJG H;  2JKV A;  1KIL C;  1NWQ A;  2XKM A;  5AW9 B;  3EQ2 A;  4I7Z C;  2CPS A;  5KLV D;  2AEJ A;  3AED C;  1MFT A;  2Q5U A;  3S4R A;  1LTJ C;  1FZF A;  2H7H A;  1DX7 A;  3H1J J;  4H0L D;  4IL6 X;  4DZO A;  4XFJ A;  3G9R A;  1NTZ D;  2Q1K A;  4IFM A;  1IJD B;  1PL5 A;  2RH0 A;  1OZH A;  1ZOY C;  5CHX A;  3AE5 C;  3L73 J;  5C39 A;  2V4H A;  2QM7 A;  2ZT9 D;  2RKL A;  4WY4 C;  4ZKP A;  1LTG C;  1OVV A;  3VP8 A;  2YMK A;  1JY2 N;  3H1L G;  1RE4 A;  1U7M A;  3P32 A;  2KUB A;  3HUS B;  3L74 J;  3GHG C;  5K5G B;  2E75 C;  1CW5 A;  3L72 D;  3H1L D;  4JBZ A;  2KS1 A;  3NFQ A;  2WT7 B;  4GIF A;  2HYN A;  1SQB E;  2O01 N;  3MD0 A;  5TIS E;  1GW3 A;  1YIJ P;  5H2F E;  1L4A B;  1WRG A;  3BRT B;  1G1J A;  2QM8 A;  3MP7 B;  1KD1 Q;  3F89 A;  3L71 G;  2WSS H;  1OW6 A;  1L4A A;  1SQP J;  5CCG A;  1KYO D;  5CJ0 A;  3G4S P;  1FDM A;  2IZ0 A;  1M1J A;  3P8C E;  3MHV A;  1HJ0 A;  5AVY B;  3SFE C;  2BEQ D;  2KS1 B;  1KFN A;  3L70 J;  4TT3 H;  2YO2 A;  3TGU J;  4CPG A;  1OX3 A;  2WT7 A;  1IO4 A;  3V2N A;  4XA4 A;  4ZNC A;  1JEK A;  3B71 A;  1PPJ D;  1NTK K;  3BCC J;  5AVQ B;  2BCC D;  2FYU E;  1FS0 E;  3SWK A;  4GOD A;  1EZV I;  2WMM A;  5EFW B;  4U7J A;  2WPS A;  2KSE A;  3AEA C;  1RE4 C;  1L0L D;  1SQQ D;  1N8R Q;  3QWO C;  1AVO A;  2NZ2 A;  3A3Y B;  1IFD A;  2K1A A;  1PPJ E;  5TJH A;  1AJY A;  3CCE P;  1NOH A;  5KLI B;  4TLF A;  1DIP A;  3PTZ A;  1T2K C;  1QGK B;  5AVV B;  1L0N D;  3P8C D;  1YJW P;  3B4S A;  3TGU G;  1NYH A;  1CSB A;  2W6J H;  3HD7 C;  3NTN A;  4HH2 A;  5AW8 B;  2KOG A;  1LT1 A;  3BRV B;  4BXL A;  1S9K E;  1GU4 A;  1NTM D;  2P2U A;  2LR2 A;  4H0L C;  5B5E H;  1BE3 J;  3FWN A;  1CI6 B;  4U3F E;  5KAI E;  5KJ7 C;  3CX5 E;  2N1T A;  1UIX A;  2SPZ A;  2Y0C A;  2NPS D;  1SQV K;  2WVR A;  3GLM A;  1FJK A;  2OGU A;  3KQG A;  2KLV A;  3CXH I;  1HH0 A;  1YJN P;  2AEF A;  1LTS C;  2W90 A;  2C9N Y;  1BGY E;  3GHG A;  2C0W A;  1EXJ A;  3O6Q B;  1PP9 D;  3PH0 A;  4HB1 A;  3USS A;  4B86 A;  2XU6 A;  1QVF O;  1LTT C;  1DD4 A;  1SFC C;  4WY4 A;  3CLQ A;  2ZJS E;  1H0T B;  2OYO A;  2IBZ D;  1X22 A;  2P58 A;  4I6M C;  3WU2 E;  2QJP C;  1N73 B;  1EDJ A;  3D71 A;  3W68 A;  1SVF A;  1BE3 G;  3RGU A;  2Q6Q A;  1BGY D;  3M0A A;  3M91 A;  5E79 E;  4AUW A;  1MZ9 A;  1YI2 P;  4W80 A;  5CCH C;  3RL0 B;  2ZXE B;  2HPC A;  1LT9 C;  2FYN B;  2JWD A;  4L76 A;  3AEB C;  5APQ A;  1FE6 A;  1Q2N A;  3RK2 B;  2YIU B;  3G6E P;  1L0L G;  3AE8 C;  3Q1M A;  1R8E A;  1VQL P;  2IFM A;  1HVV A;  2M5A B;  3IAO A;  3CD6 P;  3CX5 D;  3TK1 A;  2P1J A;  1VF5 B;  1K04 A;  2N1T D;  2K88 A;  3SWY A;  1VQ6 P;  2Z5I A;  1NTK E;  1RQV A;  2CK3 H;  1PFI A;  4I1L A;  4OVN F;  1N7L A;  1URQ B;  1NU1 G;  3V4W A;  5KAF H;  1OIP A;  2MKV A;  3L74 G;  3HE4 B;  3ZDM A;  1S4X A;  2VRS A;  2W6A A;  3FX0 A;  3L35 A;  3H1K E;  5H2F H;  1ZRT D;  3V2Q A;  4ZMD A;  2KZJ A;  4JPZ B;  2OYH B;  1VQK P;  1R5L A;  2B88 A;  1JUN A;  2A45 G;  1FZC C;  4L75 A;  1IFM A;  4PD4 E;  1JCC A;  1Z56 A;  2JO1 A;  3VMZ A;  3H1J E;  1CZQ A;  1EDI A;  1LJ2 A;  1U7J A;  1JMB A;  3CWB E;  3L71 D;  3CWB D;  2LXB A;  3Q2Y A;  3HD7 A;  3RBX A;  1JO5 A;  2FY8 A;  1BCC E;  2WTY A;  2L91 A;  4OGQ C;  4W7Z A;  1TU3 F;  2N9B A;  3RK3 C;  2ZT9 B;  4PD4 D;  4W7Y A;  3TSI A;  3BAS A;  2RN0 A;  2Y0D A;  1RQU A;  3H1L J;  1KYO E;  1LWU B;  3RBZ A;  3G71 P;  1FJP A;  1SQV E;  1GMJ A;  4EOT A;  1AV1 A;  3A5T A;  3HD7 D;  1K05 A;  4O9B A;  5KLV G;  1N7S C;  1SQB D;  2FBW C;  2ZYG A;  3K5B A;  2E76 C;  1HBW A;  2R5D A;  1SQP E;  2OYI B;  1GL2 A;  4N78 E;  3FWL A;  1NH4 A;  4D6T E;  1WT6 A;  3ITK A;  2O01 J;  5B66 E;  4RJT A;  1Q90 D;  2FYZ A;  1PIX A;  1Q7Y Q;  3VMY A;  4R4L A;  1KQL A;  4UB6 H;  2M0B A;  3CX5 H;  1N7S A;  5APX A;  4BWN A;  2IYO A;  3BCC E;  4LLH A;  1P84 I;  5APS A;  5KLV E;  5AVW B;  1JOC A;  1SQB K;  2XDJ A;  5TIS H;  1H89 A;  1KTM A;  1NTZ G;  2J58 A;  2QJK C;  1FC2 C;  1SQQ J;  1WMK A;  3AE4 C;  3M9B A;  5DJT B;  1KB9 E;  3FXD A;  4JQ0 D;  3T97 A;  2KK7 A;  1YJ9 P;  2FXP A;  1JNM A;  3CCR P;  1HGV A;  3CPW O;  5E79 H;  1HJB A;  4A7P A;  4R4M A;  3Q5P A;  2H43 A;  2ZAE B;  1Q86 Q;  2WSC H;  3CWB G;  1PV3 A;  4JYC A;  3AE3 C;  1KQG B;  3AE7 C;  3H1I D;  3TF5 A;  1G2C A;  1KB9 H;  4EIJ A;  3CCL P;  1NTM J;  1D7M A;  1RF1 B;  1J1D C;  1SQQ K;  3L72 J;  1R5S A;  1LWU A;  2H88 C;  2E75 D;  1URQ C;  2KNC B;  1ZV8 A;  4U3F J;  1OWA A;  3KPE A;  1DEE G;  2FXO A;  2A06 D;  1EC5 A;  2ITA A;  3L73 G;  3NXS A;  4Y28 J;  1HUC A;  4IL6 E;  1KIL A;  1RHZ B;  4KJM A;  3L75 J;  3VMA A;  1YHQ P;  1XTG B;  3JCU E;  1M1J C;  2Y9Z A;  3V2P A;  2L5G B;  3GHG B;  3BCC G;  1GL2 D;  1NJI Q;  2K9J B;  3II6 A;  3RK2 C;  1GW4 A;  3M0D C;  3FXE A;  3OJA B;  3RK2 D;  1JTH B;  2ZVO B;  3KZI H;  2H8P D;  3WMM 0;  1PP9 G;  2OYI C;  3CCV P;  1KQS O;  2AXC A;  5AVR B;  1JY2 O;  2WWW A;  4D6T G;  3MUD A;  4H44 C;  4ZKU A;  1H8A A;  2PGD A;  1SQP G;  1VQN P;  2N1T B;  1T2K D;  1KIL D;  3L71 J;  1AQ5 A;  1LT9 A;  3TNU B;  3KHU A;  5APY A;  1SQV J;  2KIK A;  3R2P A;  1NAF A;  1URQ A;  1BE3 E;  2FYU J;  2CPB A;  1HWT C;  3P7K A;  1VQ9 P;  3B5N A;  3TDK A;  1Y8A A;  3SSU A;  2POH A;  1SQP K;  1M90 Q;  2Z4E A;  2JWA A;  4PV1 B;  2HFE D;  2IBZ I;  2P10 A;  1SQB J;  2P7J A;  2I1K A;  1BGY G;  2A06 G;  2NRG A;  1W5C E;  5AVX B;  1KMI Z;  1UII A;  3VYI A;  2LKM A;  5KLV K;  4DCK A;  2ZYD A;  3CXH E;  1VPC A;  1MV8 A;  2YNY A;  3MUD C;  2E74 B;  3B5N D;  1T3U A;  2JR8 A;  1FDO A;  4BRY B;  5GTI E;  3Q5S A;  1EDL A;  4H44 B;  2QSI A;  1JM0 A;  3OW2 O;  1EXI A;  1NHL A;  1URQ D;  1FZG A;  1OFC X;  3H1K J;  1KB9 D;  3V2R A;  3VMX A;  4AYC A;  1VQP P;  4IFD K;  3L74 E;  1M1J B;  4H13 D;  2WSE J;  2J5U A;  4ASV A;  3O6Q A;  4OH8 B;  2WSF J;  3S9O A;  1NKZ B;  2GUS A;  5DJU B;  3UIA A;  3VN0 A;  5CJ4 A;  2I1J A;  1NTM K;  3CWB J;  3H1H D;  1GD2 E;  2B9B A;  2E42 A;  1NU1 J;  3CCS P;  1BCC J;  1HTL C;  5KLV J;  1W2B O;  1P84 D;  1PPJ G;  1KIL E;  1L0N K;  1J2J B;  1W2E A;  3HUS A;  3IN6 A;  4XE5 B;  4UB8 H;  1S5L H;  1NTK J;  3I55 P;  3L36 A;  3L72 G;  2AEM A;  5AVZ B;  3CCJ P;  2B87 A;  4PD4 H;  1S2E A;  1YIT P;  2P67 A;  5APT A;  3IFM A;  1NVO A;  2JEE A;  4ASW A;  3PP5 A;  1RF1 C;  2OTJ P;  1VQ5 P;  2ZXX A;  2K9Y A;  1BDD A;  3H32 A;  1X8Y A;  2QG4 A;  1Y47 A;  1NGM B;  2IYP A;  3M0D A;  2QJK B;  4N78 D;  3H32 B;  4QMA A;  2V7Q J;  1GZL A;  5CCG C;  3C8V A;  3L71 E;  5CBN A;  1IC2 A;  1LTA C;  2KSJ A;  3RL0 g;  1G1I A;  1M8O B;  2BCC G;  5AW5 B;  4YXW H;  1SQB G;  1USE A;  4YPC A;  1ZXG A;  1S9K D;  3M9H A;  2ZFC A;  3CCM P;  4RO0 A;  2BCC E;  3RK3 D;  1A02 F;  1IK7 A;  3GF7 A;  3HE5 A;  1ZRT E;  1KV4 A;  3CC2 P;  2O01 H;  3A0H E;  2AXT H;  2QIW A;  3AE1 C;  3U59 A;  4M3L A;  3D70 A;  2YXR B;  2FFD B;  3HRN A;  3KXD A;  1XTC C;  1AQT A;  1SQX K;  2E76 D;  5CMZ A;  2OTK E;  2QEX P;  2M8R A;  2OQQ A;  1SQV D;  2G8Y A;  3L74 D;  5CCH A;  1BGY J;  1FZB A;  3L72 E;  4NPF X;  1NTZ J;  4OGQ B;  2W8Z A;  1RF0 C;  3CCQ P;  1OMI A;  1QEX A;  4C46 A;  1Y9B A;  3AEC C;  1RY3 A;  4GOF A;  1FU1 A;  4PJ0 E;  3BVH A;  2YKO A;  3CI9 A;  4BRY A;  1QL1 A;  3CC4 P;  1NU1 K;  3R4Y A;  3GMA A;  1SQQ E;  2Q9I A;  1JY3 N;  2R3S A;  4WVZ A;  2XV5 A;  4C7N A;  1YBK A;  4N3Y B;  1AFO A;  3N4X A;  3TYY A;  3TGU D;  2OYH C;  3MGN A;  2PP6 A;  1OVR A;  2HG5 D;  3IR9 A;  3RK3 E;  2J59 M;  3AE6 C;  3L73 E;  4L73 A;  3RL0 C;  3CX5 I;  1L0L K;  2Y9Y A;  3WUV A;  1FZA A;  3QH9 A;  3CL3 D;  3H1K D;  4D6T J;  2IPP A;  4EDF A;  1NU1 D;  2Q7C A;  1QX8 A;  1BCC D;  1PGJ A;  2E75 B;  4IL6 H;  2MJZ A;  4PV1 C;  2IFN A;  4DT0 A;  5GTH E;  2B87 B;  1ZW0 A;  1N2D C;  2GA1 A;  3E1I A;  1JY3 O;  1LT9 B;  3JSV C;  1KQF B;  3TNU A;  5BVZ A;  3HTK A;  3LW5 H;  4I7Z B;  1VQO P;  2A06 E;  3L37 A;  3H1H J;  2R44 A;  3H1L E;  4JYB A;  2E74 C;  4RES B;  1NO4 A;  1EDK A;  1LP1 A;  1L0L J;  3L75 E;  2ZYA A;  1SQX G;  2WSF H;  2HOD B;  2K9J A;  2O1K A;  1KOR A;  2PRR A;  2YKP A;  1FBM A;  1ZME C;  3V4Q A;  1FZC B;  2YIU C;  2NPS C;  2YKQ A;  3M9Q A;  1MUU A;  1RH5 B;  1KIL B;  5AW6 B;  4WBA A;  3WUU A;  1FOS F;  1E5W A;  2KB7 P;  1ZLL A;  3A0H H;  1MFZ A;  3AE2 C;  3L75 D;  2QJY C;  1GK6 A;  3JC2 2;  4L74 A;  1LTB C;  1SQP D;  1U57 A;  3M06 A;  1SLQ A;  2XZR A;  1YYC A;  2KNC A;  5CBO A;  3CXH H;  2YXQ B;  1X79 B;  4IFF A;  5AW0 B;  1PP9 E;  1QVG O;  1FOS E;  2UWJ E;  2M3E A;  1J1E C;  1G2C B;  1SQX D;  4H13 C;  1E79 H;  2GUV A;  2N1T C;  3L70 G;  3BCC D;  3KDP B;  5AW7 B;  5L8R J;  2V7Q H;  3RL0 D;  3I56 P;  5KKZ C;  4JF7 A;  5AVU B;  2WPQ A;  5GTI H;  1KYO I;  1S5L X;  2Z5H A;  4D6T D;  4H0L B;  2FKW B;  3S1K A;  2E74 D;  1VF5 D;  3B5N B;  4GDO A;  1EZV G;  2NPS A;  3CXH D;  1LWU C;  3MIW A;  1KZU B;  3OA7 A;  5AW2 B;  5BU5 A;  1BCC G;  3CME P;  1NTM E;  3WU2 H;  3G3Z A;  3H1J D;  3MTU E;  2XNX A;  2E43 A;  1N7S D;  1FZE A;  4WY4 D;  1VDF A;  3RK3 B;  3CMA P;  1N7S B;  1SFC B;  3L73 D;  5AW1 B;  3U1C A;  3GW6 A;  3H25 A;  1IK9 A;  1L0N E;  1SFC D;  1GK4 A;  1HF9 A;  1BDC A;  5CCG D;  1S72 P;  3A0B H;  1DD3 A;  3KYQ A;  2JDI H;  3PJS K;  1JTH A;  1DH3 A;  2JP3 A;  3H1K G;  4U3F D;  3F5H A;  1QL2 A;  1K73 Q;  3ABV C;  1YQ4 C;  4N6J A;  1NTZ E;  1M1K Q;  2D2C D;  3Q3D A;  3D6Z A;  1X0T A;  2D2C B;  2KI7 B;  3MZW B;  4HYT B;  4Z1M H;  4H44 D;  3C9I A;  1L4A C;  1BSH A;  1L2P A;  2C0X A;  1M56 D;  2DW3 A;  2PAJ A;  2QE7 H;  3SWF A;  2C9L Y;  1PP9 J;  2PFX A;  4WWI A;  5KAF E;  3V5B A;  5BU8 B;  1ZR2 A;  3E1R A;  4DOJ A;  1S3J A;  1GL2 C;  3P8M C;  1RE3 C;  1K9M Q;  3C1L A;  3HD7 B;  1RF1 A;  1VQ7 P;  3L4F A;  1QLE D;  3PLN A;  1GDT A;  3AEF C;  3IF4 A;  3NMD A;  2KP8 A;  3H6P A;  1ZR4 A;  1L4A D;  2IBZ E;  3O8Z A;  3GF3 A;  2B89 A;  1SQV G;  2G3A A;  2QRX A;  5APU A;  5M1B A;  1OXZ A;  3A0B E;  2W6B A;  2E76 B;  4HKZ H;  4K3A A;  1VQ8 P;  1BSN A;  3T97 B;  2YMY A;  2O3J A;  1K8A Q;  1LTJ A;  1N73 C;  4KT0 J;  1JY3 P;  4YTP C;  1L0N J;  3U1A A;  1LTJ B;  2WZ7 A;  4GOE A;  2R5B A;  1NKN A;  2QVA A;  2WIT A;  3H1H G;  2AXT E;  1Q81 Q;  2ZT9 C;  5B66 H;  3H1J G;  4AQR D;  2I8D A;  4PD4 I;  2OAR A;  2GM4 A;  1FAV A;  2FYU K; 
#chains in the Genus database with same CATH homology
 2R3C A;  1GL2 B;  3LIE A;  1GU5 A;  2OYI A;  1IFI A;  5KTB A;  3VP9 A;  5APV A;  2HPC B;  1KFM A;  1LGH B;  5APW A;  1IFN A;  2FFD C;  3BAT A;  4GKG A;  1JMM A;  2M3B A;  2KYV A;  3A7O A;  4C7R A;  1EQ7 A;  4WB4 A;  5AVT B;  2JJL A;  1J1D B;  2IX7 C;  3A2A A;  2O1J A;  4I2L C;  3HTK B;  1SFC A;  1CI6 A;  1H88 A;  3HE4 A;  5AW4 B;  3B8E B;  2WSE H;  1N86 A;  2A45 H;  1T8Z A;  2NPS B;  1IFJ A;  5AVS B;  2A45 I;  3OAK A;  2R32 A;  1LTI C;  5KJ7 D;  3LID A;  2BAS A;  1DEB A;  1A02 J;  4C7N B;  1ZN5 A;  5KJ7 A;  1HGZ A;  1RF0 A;  4Y99 C;  1SP4 A;  2Q3I A;  1N73 A;  4Y99 B;  4LC1 A;  4WY4 B;  1J1E B;  1X9V A;  1YTZ T;  3B5N C;  3EFG A;  3I5C A;  5CCH D;  1FZC A;  2W27 A;  3HUS C;  4GT1 A;  2FFD A;  5AW3 B;  1GTW A;  2HOD A;  3VOP A;  1JY2 P;  3N7N A;  1RE3 A;  1JCD A;  4KHX A;  2WPR A;  1YTZ I;  3HE5 B;  3VTP C;  4LGD E;  1NTZ K;  1M7L A;  2HLO A;  2FXM A;  2YO3 A;  1T3J A;  1KIL C;  1NWQ A;  2XKM A;  5AW9 B;  3EQ2 A;  2CPS A;  2Q5U A;  1LTJ C;  1FZF A;  2H7H A;  1DX7 A;  4DZO A;  4IFM A;  1IJD B;  5CHX A;  2QM7 A;  4WY4 C;  4ZKP A;  1LTG C;  3VP8 A;  1JY2 N;  1RE4 A;  3P32 A;  3HUS B;  1CW5 A;  3GHG C;  2WT7 B;  3NFQ A;  4GIF A;  2HYN A;  3MD0 A;  1GW3 A;  1L4A B;  1WRG A;  3BRT B;  1G1J A;  2QM8 A;  1FDM A;  1L4A A;  5CCG A;  5CJ0 A;  1M1J A;  3P8C E;  5AVY B;  2WT7 A;  1KFN A;  2YO2 A;  1IO4 A;  3V2N A;  4XA4 A;  1NTK K;  5AVQ B;  2WPS A;  1RE4 C;  3A3Y B;  1IFD A;  1NOH A;  1T2K C;  5AVV B;  3P8C D;  1CSB A;  3HD7 C;  3NTN A;  4HH2 A;  5AW8 B;  2KOG A;  3BRV B;  1S9K E;  1GU4 A;  2P2U A;  1CI6 B;  5KJ7 C;  2N1T A;  2NPS D;  1SQV K;  1FJK A;  3KQG A;  2KLV A;  1HH0 A;  1LTS C;  2C9N Y;  3GHG A;  2C0W A;  4B86 A;  2XU6 A;  1LTT C;  1SFC C;  4WY4 A;  3CLQ A;  4I6M C;  1N73 B;  1SVF A;  3M0A A;  3M91 A;  4AUW A;  1MZ9 A;  2HPC A;  4W80 A;  5CCH C;  3RL0 B;  2ZXE B;  1LT9 C;  5APQ A;  3RK2 B;  2IFM A;  1HVV A;  3TK1 A;  2P1J A;  2N1T D;  3SWY A;  2Z5I A;  1PFI A;  4I1L A;  1N7L A;  1URQ B;  3HE4 B;  2VRS A;  2W6A A;  3L35 A;  2OYH B;  3V2Q A;  1JUN A;  2A45 G;  1FZC C;  3VMZ A;  1IFM A;  1JCC A;  1Z56 A;  1CZQ A;  1JO5 A;  3HD7 A;  2WTY A;  4W7Z A;  2N9B A;  3RK3 C;  4W7Y A;  3TSI A;  3BAS A;  1LWU B;  1FJP A;  4EOT A;  3A5T A;  3HD7 D;  4O9B A;  1N7S C;  1HBW A;  2R5D A;  2OYI B;  1GL2 A;  4N78 E;  1NH4 A;  1WT6 A;  2FYZ A;  3VMY A;  2OYH A;  1KQL A;  5APX A;  1N7S A;  4LLH A;  5APS A;  5AVW B;  1JOC A;  1SQB K;  2XDJ A;  1H89 A;  2J58 A;  3M9B A;  3T97 A;  1JNM A;  1HGV A;  2H43 A;  2WSC H;  4JYC A;  1G2C A;  4EIJ A;  1RF1 B;  1J1D C;  1SQQ K;  1LWU A;  1URQ C;  1ZV8 A;  1OWA A;  3KPE A;  3NXS A;  1HUC A;  1KIL A;  1XTG B;  1M1J C;  3V2P A;  2L5G B;  3GHG B;  1GL2 D;  3II6 A;  3RK2 C;  1GW4 A;  3M0D C;  3OJA B;  3RK2 D;  3WMM 0;  1JTH B;  2OYI C;  2H8P D;  5AVR B;  1JY2 O;  2WWW A;  3MUD A;  4ZKU A;  1H8A A;  2N1T B;  1T2K D;  1KIL D;  1AQ5 A;  1LT9 A;  3TNU B;  5APY A;  3R2P A;  1NAF A;  1URQ A;  2CPB A;  1HWT C;  3P7K A;  3B5N A;  2POH A;  1SQP K;  2Z4E A;  2HFE D;  2P7J A;  2I1K A;  5AVX B;  3VYI A;  2LKM A;  5KLV K;  1VPC A;  1MV8 A;  2YNY A;  3B5N D;  1T3U A;  1NHL A;  1URQ D;  1FZG A;  3V2R A;  3VMX A;  4AYC A;  4IFD K;  1M1J B;  4OH8 B;  1NKZ B;  2GUS A;  3UIA A;  5CJ4 A;  3VN0 A;  2I1J A;  1NTM K;  1GD2 E;  2E42 A;  1HTL C;  1L0N K;  1J2J B;  1W2E A;  3HUS A;  4XE5 B;  3L36 A;  5AVZ B;  2P67 A;  5APT A;  3IFM A;  2JEE A;  3PP5 A;  1RF1 C;  3H32 A;  1X8Y A;  3M0D A;  4N78 D;  3H32 B;  1GZL A;  5CCG C;  1IC2 A;  1LTA C;  2KSJ A;  1G1I A;  5AW5 B;  1S9K D;  3M9H A;  2ZFC A;  3RK3 D;  1A02 F;  3HE5 A;  2O01 H;  3U59 A;  4M3L A;  2FFD B;  3HRN A;  1XTC C;  1SQX K;  5CMZ A;  2M8R A;  5CCH A;  1FZB A;  1RF0 C;  4C46 A;  1RY3 A;  1FU1 A;  3BVH A;  2YKO A;  3CI9 A;  1QL1 A;  1NU1 K;  2Q9I A;  1JY3 N;  2XV5 A;  4C7N A;  4N3Y B;  1AFO A;  3N4X A;  3TYY A;  2OYH C;  3MGN A;  2PP6 A;  2HG5 D;  3IR9 A;  2J59 M;  3RL0 C;  1L0L K;  1FZA A;  3CL3 D;  2IPP A;  2Q7C A;  2MJZ A;  2IFN A;  1N2D C;  1HJB A;  3E1I A;  1JY3 O;  1LT9 B;  3TNU A;  5BVZ A;  3HTK A;  3LW5 H;  3L37 A;  4JYB A;  4RES B;  1NO4 A;  2WSF H;  2HOD B;  2O1K A;  2YKP A;  1FBM A;  3V4Q A;  1FZC B;  2YKQ A;  2NPS C;  3M9Q A;  5AW6 B;  1MUU A;  1KIL B;  4WBA A;  1FOS F;  1E5W A;  2KB7 P;  1ZLL A;  1MFZ A;  1GK6 A;  1LTB C;  3M06 A;  1SLQ A;  2XZR A;  1YYC A;  1X79 B;  4IFF A;  5AW0 B;  1FOS E;  1J1E C;  1G2C B;  3V4W A;  2GUV A;  2N1T C;  5AW7 B;  3KDP B;  3RL0 D;  4JF7 A;  5AVU B;  2WPQ A;  2Z5H A;  2FKW B;  3B5N B;  2NPS A;  5BU5 A;  1LWU C;  3MIW A;  1KZU B;  3OA7 A;  5AW2 B;  2E43 A;  3G3Z A;  3MTU E;  2XNX A;  1N7S D;  1FZE A;  4WY4 D;  1VDF A;  3RK3 B;  1N7S B;  1SFC B;  3U1C A;  5AW1 B;  1IK9 A;  1SFC D;  1GK4 A;  5CCG D;  3KYQ A;  1JTH A;  1DH3 A;  1QL2 A;  4N6J A;  4HYT B;  3C9I A;  1L4A C;  2C0X A;  2PAJ A;  3SWF A;  2C9L Y;  1ZR2 A;  3V5B A;  5BU8 B;  4DOJ A;  1GL2 C;  3P8M C;  1RE3 C;  1RF1 A;  3HD7 B;  3L4F A;  1GDT A;  3NMD A;  2KP8 A;  3H6P A;  1ZR4 A;  1L4A D;  3O8Z A;  5APU A;  1OXZ A;  2W6B A;  2YMY A;  1LTJ A;  1N73 C;  1JY3 P;  3U1A A;  1LTJ B;  2WZ7 A;  2R5B A;  1NKN A;  2WIT A;  4AQR D;  2OAR A;  2GM4 A;  1FAV A;  2FYU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...