3A5TA

Crystal structure of mafg-dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
HMGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor MafG
publication title Structural Basis of Alternative DNA Recognition by Maf Transcription Factors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulator/dna
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a5tA00
3LIEA 4RESB 2C9LY 3V4WA 2ZFCA 2KP8A 2N9BA 2P7JA 2R3CA 4C46A 5AVQB 2XZRA 1OXZA 2C9NY 2YO3A 3VN0A 1X8YA 2BASA 3M0AA 2E42A 3HTKA 3VYIA 3HE5B 1A02F 3NXSA 1MFZA 5AVRB 3TNUB 1FOSF 3P8MC 1HBWA 3A3YB 1YYCA 1DH3A 2IPPA 1SLQA 2WT7A 3KQGA 1GK4A 5AVYB 5AW2B 3O8ZA 3VMXA 4I6MC 3L37A 4GKGA 5AVWB 1MUUA 3M06A 4JYCA 3HE4A 2H7HA 3NMDA 1GD2E 1CI6A 5APQA 1T2KC 3L36A 4HYTB 3UIAA 1GK6A 1MV8A 2Q5UA 1JNMA 1HWTC 5APXA 3NTNA 5AW4B 3SWFA 3VMYA 1KQLA 3LIDA 2WWWA 5APSA 3KDPB 2P67A 3MD0A 1H8AA 3M9HA 4AYCA 2WPQA 2Z5IA 4GT1A 3TK1A 1HUCA 2XU6A 1G2CB 1OWAA 5AVZB 4AQRD 2VRSA 2QM7A 1FOSE 2YO2A 1S9KD 2Q3IA 2P2UA 1HJBA 3HE5A 5APTA 1H88A 1GU5A 3L35A 3TNUA 2E43A 3P32A 4EOTA 4C7NB 1T2KD 5CMZA 5AW5B 3A2AA 3P7KA 3VTPC 2WPSA 3I5CA 2JJLA 1CZQA 5APVA 2WTYA 5AW3B 3A5TA 2WPRA 3T97A 5AVUB 4AUWA 2XV5A 3M9BA 4XE5B 5AW8B 1SP4A 5AVXB 3VMZA 4I2LC 5AVVB 2W6AA 5AW6B 5APUA 3OAKA 3M91A 4M3LA 1NAFA 3A7OA 2R5DA 5AVSB 2QM8A 3M0DA 3V5BA 1A02J 1H89A 1CSBA 4LC1A 5AW9B 5APWA 5AW1B 3IR9A 2W27A 1IO4A 2Z5HA 3V4QA 3B8EB 3MGNA 5APYA 4DZOA 1S9KE 2WT7B 5AW0B 3NFQA 4JYBA 3TYYA 2Q7CA 5AVTB 1JUNA 2ZXEB 2YNYA 1NWQA 4C7NA 4KHXA 1GTWA 3HE4B 1GU4A 1CI6B 2R32A 4B86A 1J2JB 1GZLA 1FAVA 5AW7B 2R5BA
chains in the Genus database with same CATH superfamily
1ZRTE 2B87A 2N9BA 4D6TE 2KOGA 2KZJA 1JY3P 1OVUA 2QJYB 1BGYD 2V4HA 5B66H 5CJ0A 2ZVNB 2WSCJ 4IL6X 1RQUA 1KZUB 1DH3A 2Z4EA 2OYIC 2FXMA 4ASVA 1NTMD 4OGQB 2ZT9B 3L74J 5KLVG 4LLHA 5CCGA 3K5BA 2HG5D 3CCLP 4BWNA 2W8ZA 3E7KA 1HGZA 4AYCA 2OYHA 2Y9ZA 2NPSB 1Y8AA 1KV4A 4EOTA 3CCSP 2D2CB 3B5NB 1BSHA 2KI7B 1FS0E 1PGOA 1YIJP 1SQQD 1HVVA 3T97A 1PGPA 4K35A 5AW8B 2AEFA 2AXTH 3CCMP 3L71D 2YKQA 1RF1A 3AEDC 3B8EB 4YXDC 4DZOA 4JYBA 1RF0C 3CWBG 3Q2YA 3HD7C 2R5BA 1OVRA 1YITP 3BCCE 5KLIB 4HB1A 1BCCG 4UB6E 3TNUB 1VDFA 2OYOA 1IK9A 1X0TA 3VMXA 2FYUK 4I6MC 1JM0A 5KAIH 3HE4A 2H7HA 1IK7A 1RH5B 4IL6H 1EZVD 3MUDA 2FFDC 1Q2NA 1OW6A 3GW6A 2QM7A 1YJNP 1FZEA 4R4LA 1L0LJ 1RY3A 4N3YB 1X79B 2JWDA 1FZAA 3L75E 1SQQK 3P7KA 3L72E 1SQVJ 1OMIA 4L76A 2FYZA 2WPRA 1FBMA 2E76B 3M0DC 3H1HG 1AJYA 1LWUC 3CCEP 4XFJA 3WMM0 5BU5A 3H1JE 4H13B 1K05A 3L73J 2WQYC 3H1LG 1LTSC 1VQ5P 1NKZB 2N1TA 1N73A 1GTWA 2FYUE 1HH0A 3RK2C 3TGUD 1ZN5A 2P1JA 2GUVA 1LTIC 1N7SB 1NTZK 1SQXD 3RGUA 1FDIA 3L70E 1Q82Q 1LGHB 4WWIA 3HD7D 1FDOA 1X9VA 1JB0J 3O6QB 1DX7A 3OW2O 1LTAC 3TDKA 1SQQE 3NMDA 1DD4A 1YBKA 1SQPJ 1PP9D 3VP8A 1P84D 3SWFA 3Q5PA 5B66E 1NU1G 1QEXA 3E1RA 1L0NJ 1LNQA 3HUSA 1J1DB 2RN0A 1NTKD 1QLED 2I1KA 3BATA 2E43A 3D6YA 2KLUA 1KYOH 2GM4A 3A2AA 1Y47A 1PPJE 3I56P 3PP5A 1R5SA 3KZIH 3G71P 1FZCC 2JO1A 3TF5A 1AVYA 1J1EB 2IDBA 1BSNA 3OAKA 4M3LA 1NTZE 1BE3J 4DJGA 1SFCA 2W6JH 1KILE 3BCCJ 1RE3C 1M1JB 2AXTE 2Y0CA 1GU4A 5KJ7A 5KLVE 4B86A 3EFFK 2BEQD 1HJBA 5E79H 1P84I 1EZVE 1AVOA 2BCCG 4NPEA 2E75D 2C9NY 2YKPA 1VQPP 1N86A 4WBAA 2AEMA 1Y9BA 4H44D 1ZOYC 2RH0A 3FWNA 3M06A 3RK2D 1E5WA 1HWTC 2C0WA 2K9YA 2P67A 2IBZD 1URQB 2OTJP 4IFDK 3L72J 2OARA 5CBOA 4OWFA 3D70A 2HLOA 5KAIE 2IZ0A 3CMEP 3N4XA 3CWBE 4IL6E 3LW5H 5CBNA 2JJLA 1ZRTD 1BGYJ 2Y0DA 1PZQA 4D6TD 3EQ2A 5AVXB 2PP6A 3QH9A 3EWKA 1BCCE 5AW6B 5APUA 3M91A 3A7OA 2R5DA 5APWA 2HFED 2NPSA 3RL0C 1FU1A 1JMBA 2WT7B 3VP9A 1IFMA 1KTMA 1ZMEC 2H88C 1NHLA 3B5NA 2YXRB 4GDOA 5K5GB 1OVVA 4R4MA 1JTHB 2IBZI 5B5EE 2CPSA 4WY4C 3AE8C 1KMIZ 1SQQJ 2JWAA 2M3BA 4U3FG 2A45H 2ZXXA 1S5LX 3L71J 3KQGA 1MUUA 4ZNCA 2KK7A 3H1HE 1HTLC 2PRRA 3G4SP 1IJDB 3CXHH 3MP7B 2IZ1A 3AEEC 2B9BA 2R3SA 1KB9H 3L4FA 3S1KA 2VRSA 2YO2A 5CCHA 1AFOA 3SWYA 2W83C 3TNUA 1GDTA 3IN6A 4EI2A 4GIFA 3II6A 1LTJB 1BGYG 3BCCD 1OIPA 1YTZI 5C39A 2YIUB 2QJKB 1MKMA 3R4YA 1ZR2A 2H43A 1NTMG 5AVSB 1S4XA 1KYOE 1U7MA 2M0BA 4IFMA 1FC2C 1KN7A 1FE6A 3V4QA 3KZIE 1S9KE 4YXWH 2ZXEB 2OYIB 3CXHD 3V2QA 1GL2C 3VN0A 1X8YA 4U7JA 1RQVA 3RL0D 2E42A 3AE9C 1T3JA 1AQTA 1NH4A 1W2BO 1MFZA 3CX5H 4JBZA 3L75D 5E79E 1KILC 1SLQA 3CD6P 3L37A 1VQKP 2QVAA 3AE5C 4TLFA 4UB8H 1LT9C 5AW4B 4IFFA 4WY4D 2WWWA 4A7PA 1S5LH 3H1JD 4GT1A 5AVZB 1N7SA 3GF3A 1KQFB 2Q3IA 3TGUJ 1GU5A 1M7LA 2P58A 1JY2P 4Z1MH 1SQXJ 2FYUD 2KS1B 3H1KD 1T6AA 3W68A 5KAFH 1HF9A 3O6QA 4PD4I 1VQ7P 2Q9IA 4RO0A 1LP1B 3JC22 3H25A 3HD7B 3V2NA 3WU2H 1FDMA 3RK3E 3CCJP 1SQBK 3L70D 2WZ7A 2V7QH 2E74C 2LKMA 4H0LC 1PP9J 5AW1B 2PAJA 3ABVC 1GMJA 1JCDA 1JOCA 1FZBA 1M56D 2Q7CA 3U59A 1Q7YQ 2R32A 1NTKJ 3CCUP 1KQSO 2FYNC 2QRXA 1FJKA 2RKLA 3MTUE 2DW3A 3PHLA 4EIJA 3H1IE 2RMZA 3G6EP 1VQ6P 3Q5SA 2FFDB 1N2DC 1IC2A 2XNXA 1K04A 2IPPA 2QEXP 1PPJD 5AW2B 1HJ0A 1M1JA 3AEAC 3U1CA 1GL2D 1GD2E 4LGDE 4RKUJ 3UIAA 3NTNA 2W90A 2XNDH 1NTZD 3CLQA 3E1IA 3TK1A 1LWUB 2WSFH 3C8VA 1USDA 1SQBE 3GHGC 1KILD 1Z56A 1DD3A 5APTA 1PFIA 1YTZT 4Y99C 2E5TA 4C7NB 5KLVD 2G3AA 3CXHE 3L74G 4KT0J 1KB9E 2OQQA 4GOFA 3BASA 4BXLA 1S72P 3RK2B 1URQA 1IFDA 2B88A 3V2PA 3C9IA 1IO4A 2JEEA 1VQ4P 3D6ZA 2UWJE 1M57D 1EXIA 5GTHH 2LR2A 1M8OB 1L4AC 3LIEA 3PJSK 2E74D 2I1JA 3H6PA 2E75C 4H0LD 1BDDA 2H89C 5B5EH 3HE5B 3CWBD 1SVFA 3AEBC 4D6TJ 4TT3H 3A3YB 4H44C 3CCVP 2WT7A 3H1KE 4PV1C 1NO4A 1YJWP 2MJZA 4JYCA 1EZVI 2IFNA 1BCCD 3LIDA 5KKZC 3MD0A 1FZCB 3CX5E 1JTHA 3CC7P 2Z5IA 2O01N 2XDJA 5KLVK 4UB8E 1YQ3C 2PFXA 3AE2C 4ASWA 1S5LE 3G3ZA 1FJPA 2QE7H 2BEZF 2WSSH 2AEJA 3LW5J 3I55P 3CC2P 2R44A 5AVUB 2XV5A 1OW8A 2Y9YA 2YXQB 1EDJA 5AVVB 2NPSD 2MKVA 4NPFX 1K9MQ 3HTKB 4WB4A 1L0LG 5KAFE 1UIIA 3IR9A 2KSEA 3H1IJ 5KTBA 3B5ND 1R5LA 2QJPC 4GOEA 2IBZG 3WU2E 3H1HD 2IYPA 1SQVG 3JCUH 1FAVA 2JR8A 1G1JA 1LTJA 4EYYQ 2P7JA 3H1LD 1RE4A 4Y28J 5AVQB 3VOPA 3RK3C 3L73G 3KHUA 3NXSA 5AVRB 2J58A 1LTTC 1IFIA 1Q86Q 1DEBA 1IFJA 4N6JA 5AVYB 1L4AD 4JPZB 2FY8A 1NJIQ 2O01H 4JF7A 3S9OA 2FXPA 1SQBJ 2OYIA 1SS1A 1T2KC 1MZ9A 1XTCC 4W7YA 2OYHC 3VMYA 3KDPB 1M1KQ 1YJ9P 1KYOD 3PH0A 2B89A 2GUSA 2A06G 1S9KD 3CL3D 3U1AA 3H32B 1H88A 4PV1D 4I7ZC 2YMYA 3RL0B 2HYNA 2WPSA 1SQPG 2O3JA 3L75J 1L0NG 1RF1C 1IZNB 1QX8A 3VMZA 1NAFA 3A0BH 5H2FH 4OH8B 5AW9B 3AE4C 4WY4B 3W67A 3H1JJ 4YPCA 5AVTB 3BRVB 3VMAA 1BDCA 2WSEJ 2KSJA 2KS1A 1CI6B 1LTBC 3HRNA 1RF0A 1LP1A 2AXCA 2K1AA 3HD7A 2FYUJ 3G9RA 4KJMA 1KYOI 3H1KJ 3AE1C 1BE3G 2K9JB 3V6IA 5L8RJ 1ZR4A 3BCCG 5GTHE 2L91A 4GODA 3SFDC 4PJ0H 3KYQA 2I8DA 3L70J 1KQGB 3MUDC 2BCCD 2KNCB 1JNMA 3RK3D 2NZ2A 1QVFO 1HUCA 1T8ZA 1G2CB 3MIWA 1VQNP 3N7NA 1OX3A 2FFDA 2P2UA 5CCGD 3P32A 2IYOA 1NU1K 1T2KD 3Q1MA 3H1ID 2J59M 3B71A 3MZWB 4AUWA 1ZW0A 3H1LE 1YHQP 4I2LC 1VL2A 3L72G 3CPWO 1S2EA 2SPZA 1GL2B 3M0DA 1LWUA 1A02J 2N1TC 1N73C 2V7QJ 3OA7A 1KFNA 4PD4H 1NTZJ 1PIXA 4C7NA 4KHXA 2ZYAA 1KILB 3AE7C 2QSIA 4RESB 2ZFCA 5KLVJ 1LT9B 2R3CA 4C46A 1SQBD 2C0XA 2O1JA 3FGAD 2BASA 3M0AA 2OTKE 3JCUE 1HBWA 3TSIA 2WITA 1NOHA 1PGJA 1GK4A 1NU1E 1KB9D 4GKGA 1AV1A 3FXDA 4WVZA 4N78E 3HUSC 1MV8A 3CMAP 1KQLA 1L0LE 2JDIH 4I1LA 4U3FD 1SQQG 4QMAA 2JKVA 1OFCX 4CPGA 3GF7A 5GTIH 2WSFJ 3HE5A 3L71G 2E74B 1SQPK 4H0LB 1SQVE 3CCRP 1JCCA 3MHVA 3Q5RA 1VQMP 1L0NK 3CWBJ 4BRYB 3WUUA 2A45I 2FYNB 3L73E 1SFCC 1PPJG 1KD1Q 1FZCA 4K3AA 1WMKA 2Q1KA 3V5BA 3SSUA 1BCCJ 4OVNF 2QG4A 5KJ7C 5APYA 5AW0B 3CXHI 3CC4P 1WT6A 3KXDA 1NTZG 2JP3A 1VQOP 1KB9I 1S1CX 2BCCE 3PRJA 1GZLA 1RE3A 3A0BE 5H2FE 3V4WA 4HJGH 3CX5D 2GA1A 4L75A 2KP8A 1X22A 1VF5C 1KC8Q 1JY3N 1LTGC 2A06E 2N1TD 2ZYDA 1L2PA 3HTKA 2OGUA 1EZVG 3P8MC 2HODB 3GHGB 1JY2N 1SQPE 2K88A 3GMAA 4Y99B 2FBWC 1PL5A 1L0NE 5APQA 3C1LA 2Q5UA 3IAOA 1EDIA 2QJYC 3H1HJ 1RHZB 2YKOA 3F89A 4PJ0E 2CPBA 1E79H 2K3RA 5M1BA 2M3EA 2J5UA 3L35A 1LT1A 3H1LJ 1YI2P 4OGQC 1Q90D 2ZT9C 3SWKA 1K8AQ 1W5CE 5APVA 1HGVA 2KB7P 3CX5I 1H0TB 1BE3E 2ZAEB 3M9BA 1L4AB 2NPSC 4HKZH 1EC5A 3P8CE 3TGUG 1CSBA 2E75B 4ZKPA 2HR3A 2W27A 4L74A 3A0HE 2D2CC 3H32A 1SQXG 3B5NC 2HPCB 3AEFC 4DCKA 1S3JA 5BU8B 1JUNA 2M5AB 3F5HA 4H44B 1NTMK 1QL2A 4PV1B 1SFCD 1U7JA 4U3FE 2Y0EA 3JSVC 4MN4C 1YQ4C 1NU1J 4PD4E 5KKZB 1IFPA 1PP9G 5KJ7D 4O9BA 2WSCH 4WY4A 1ZLLA 2NRGA 4DT0A 3GLMA 2QIWA 1OW7A 1NTKG 5DJUB 1EDKA 2ZVOB 1CI6A 1VF5D 2O01J 5KLIC 4W7ZA 5APXA 3Q3DA 1OZHA 5CCHC 2ITAA 3M9HA 4YTPC 1OWAA 3CCQP 2K9JA 2FXOA 3AE6C 2ZYGA 1P84H 1BGYE 3PLNA 2OTLP 5CMZA 5AW5B 2K37A 5TISH 3VTPC 3PTZA 2QJPB 5CJ4A 2WTYA 1NTME 1VQ9P 2B87B 2G8YA 3A5TA 2KNCA 3V2RA 5GTIE 1SP4A 2BCCJ 2XKMA 1G2CA 4OGQD 4LC1A 3RK3B 3L74D 1AQ5A 2ZT9D 3GG2A 4NPDA 3MGNA 3WUVA 3NFQA 3SFEC 2E76C 3AECC 3KPEA 2C9LY 1DEEG 3RL0g 1CW5A 4H13C 2KUBA 2WVRA 2OYHB 2WMMA 2D2CD 3L71E 1GL2A 1A02F 1IFNA 2QA4P 5TJHA 3USSA 3D71A 4I7ZB 2KXPB 1KILA 1QGKB 2O1KA 1EQ7A 3T97B 1GK6A 1N7SC 3FWLA 1RF1B 2ZJSE 1LT9A 2Q3EA 1JMMA 4AQRD 3WUTA 4JQ0D 4D6TG 1VPCA 1G1IA 5CCGC 4ZMDA 1N8RQ 5CHXA 3ITKA 4RJTA 1CZQA 1NKNA 5CCHD 2LXBA 5AW3B 1J1DC 1R8EA 3B4SA 1N7LA 1SQXK 4HH2A 2H8PD 1H89A 2Z5HA 1GW3A 1NU1D 4U3FJ 1XTGB 1GW4A 4N78D 3HE4B 2P10A 1FZGA 1J1EC 2KYVA 1EXJA 1L0LD 2WPVB 1PGQA 4BRYA 1U57A 2L5GB 1JEKA 2XZRA 3VYIA 3H1IG 1NTKK 1M1JC 1SQVD 1LJ2A 1YYCA 2E76D 5AVWB 2POHA 3L73D 4H13D 3IFMA 1D7MA 1JY3O 1QL1A 3BRTB 1MFTA 1PV3A 3TGUE 3RBZA 2WPQA 3ZDMA 1VQ8P 3QWOC 2XU6A 1SQXE 1AA0A 3L74E 1K73Q 1NTMJ 4ZKUA 5BVZA 1JY2O 2A45G 2HODA 2N1TB 3GHGA 1N73B 4EDFA 3OJAB 1SQBG 3CI9A 1N7SD 1KORA 1URQC 2A06D 4XE5B 1KFMA 1PP9E 1P84E 5DJTB 2PGDA 5TISE 1Q81Q 1TU3F 1SQPD 1NTKE 3TYYA 3A0HH 4C7RA 2YNYA 1NWQA 1L0ND 4UB6H 1ZXGA 3BVHA 1L0LK 5AW7B 1EDLA 3L75G 5EFWB 1ZP0C 1QVGO 4DOJA 1JO5A 1H0TA 3HUSB 4XA4A 1L4AA 1WRGA 1OXZA 3S4RA 2YO3A 1SQVK 1NVOA 2KIKA 1FOSF 3H1JG 2HPCA 3O8ZA 2Q6QA 2N9YB 2M5AA 3IF4A 1BE3D 3L36A 4HYTB 4W80A 2FYUG 3H1KG 5APSA 3P8CD 1VQLP 1H8AA 3AE3C 1ZV8A 2CK3H 1SFCB 2QJKC 1FOSE 1NYHA 2M8RA 2IFMA 3L70G 4L73A 2E5YA 1NAYA 2W6BA 2YMKA 3I5CA 2WSEH 1USEA 3M9QA 4PD4D 1W2EA 3EFGA 1UIXA 2W6AA 2FKWB 1VF5B 4IOIH 2QM8A 2IBZE 3RBXA 3FXEA 3AEGC 1FZFA 1M90Q 2LXCB 2KLVA 1DIPA 3R2PA 2KZIA 1LTJC 1URQD 2IX7C 1J2JB 3L72D 1T3UA 2YIUC 1RE4C 1NGMB 3FX0A
chains in the Genus database with same CATH topology
1G1JA 1SFCD 1LTJA 2N9BA 1JTHB 2P7JA 1RE4A 5AVQB 3VOPA 2CPSA 2KOGA 3RK3C 4WY4C 1JY3P 5KJ7D 4O9BA 2M3BA 2WSCH 3NXSA 5AVRB 5CJ0A 2J58A 4WY4A 1KZUB 1ZLLA 2A45H 1DH3A 1LTTC 2Z4EA 2OYIC 1IFIA 2FXMA 3KQGA 1DEBA 1IFJA 4N6JA 5AVYB 1L4AD 2O01H 4JF7A 1MUUA 2OYIA 1CI6A 1HTLC 1T2KC 1MZ9A 4W7ZA 1XTCC 5APXA 4LLHA 4W7YA 5CCGA 2OYHC 2HG5D 3VMYA 3KDPB 5CCHC 1IJDB 1HGZA 3M9HA 4AYCA 2OYHA 3L4FA 2GUSA 1OWAA 2VRSA 2NPSB 2YO2A 5CCHA 1AFOA 1S9KD 3CL3D 3U1AA 3H32B 1H88A 3SWYA 3TNUA 4EOTA 1GDTA 2YMYA 5CMZA 5AW5B 3RL0B 4GIFA 3B5NB 3VTPC 2HYNA 2WPSA 3II6A 5CJ4A 1LTJB 2WTYA 3A5TA 1HVVA 3T97A 1YTZI 3V2RA 1RF1C 5AW8B 1SP4A 3VMZA 1ZR2A 2YKQA 1NAFA 2H43A 5AVSB 1RF1A 2XKMA 4IFMA 1G2CA 4OH8B 4LC1A 5AW9B 3RK3B 4WY4B 1AQ5A 3V4QA 3B8EB 3MGNA 4DZOA 1S9KE 3NFQA 4JYBA 5AVTB 1RF0C 2ZXEB 3BRVB 2KSJA 2OYIB 1CI6B 3V2QA 3HD7C 1LTBC 3KPEA 2R5BA 2C9LY 3HRNA 1RF0A 1GL2C 1CW5A 3HD7A 2OYHB 3VN0A 1X8YA 3RL0D 2E42A 1GL2A 1T3JA 1A02F 1NH4A 1IFNA 1MFZA 1ZR4A 3TNUB 1VDFA 1IK9A 1KILC 1SLQA 3KYQA 3VMXA 2FYUK 4I6MC 3L37A 3HE4A 2H7HA 1KILA 2O1KA 1EQ7A 1GK6A 1JNMA 1LT9C 5AW4B 4IFFA 3RK3D 1N7SC 4WY4D 2WWWA 3MUDA 2FFDC 1RF1B 4GT1A 1LT9A 1HUCA 1T8ZA 1G2CB 1N7SA 1JMMA 5AVZB 4AQRD 2QM7A 3MIWA 1FZEA 1RY3A 3N7NA 2FFDA 2Q3IA 2P2UA 4N3YB 1VPCA 1X79B 1G1IA 5CCGC 5CCGD 1GU5A 1M7LA 1JY2P 3P32A 1NU1K 1FZAA 5CHXA 1T2KD 1SQQK 3P7KA 1CZQA 1NKNA 2J59M 5CCHD 2Q9IA 5AW3B 2FYZA 2WPRA 1FBMA 3HD7B 3M0DC 4AUWA 1J1DC 3V2NA 1LWUC 1FDMA 4I2LC 1N7LA 1GL2B 1SQBK 1SQXK 2WZ7A 3M0DA 3WMM0 5BU5A 4HH2A 1LWUA 1A02J 2LKMA 2H8PD 2N1TC 1H89A 5AW1B 1N73C 2PAJA 3OA7A 1KFNA 2Z5HA 1LTSC 1JCDA 1JOCA 1GW3A 1NKZB 1FZBA 1XTGB 1GW4A 2N1TA 2Q7CA 3U59A 4C7NA 4KHXA 1N73A 4N78D 1GTWA 3HE4B 1KILB 2R32A 1FJKA 1FZGA 3MTUE 4RESB 1J1EC 1HH0A 2KYVA 4EIJA 2ZFCA 3RK2C 1ZN5A 2L5GB 2P1JA 2GUVA 1LTIC 1LT9B 2R3CA 4C46A 2XZRA 2C0XA 2O1JA 1N7SB 1NTZK 2BASA 3M0AA 3VYIA 2FFDB 1N2DC 1IC2A 1NTKK 1M1JC 2XNXA 1HBWA 3TSIA 1LGHB 1YYCA 2WITA 2IPPA 1NOHA 3HD7D 1GK4A 1X9VA 5AW2B 1M1JA 4GKGA 5AVWB 3U1CA 1DX7A 2POHA 1LTAC 1GL2D 3NMDA 1GD2E 4LGDE 4N78E 3HUSC 3UIAA 1MV8A 3IFMA 3NTNA 3VP8A 3SWFA 1JY3O 1QL1A 1KQLA 3BRTB 3CLQA 3HUSA 4I1LA 2WPQA 3E1IA 1J1DB 3TK1A 1LWUB 2XU6A 2WSFH 3GHGC 1KILD 1Z56A 3HE5A 5APTA 4ZKUA 1PFIA 5BVZA 1YTZT 1JY2O 2I1KA 3BATA 4Y99C 2E43A 2A45G 1SQPK 2HODA 2N1TB 3GHGA 4C7NB 1N73B 1JCCA 3OJAB 2GM4A 3A2AA 1L0NK 3CI9A 1N7SD 3PP5A 1FZCC 1URQC 2A45I 4XE5B 3BASA 1SFCC 1KFMA 1J1EB 1FZCA 3OAKA 4M3LA 3RK2B 1URQA 3V5BA 1IFDA 1SFCA 3V2PA 3C9IA 1IO4A 2JEEA 5KJ7C 5APYA 5AW0B 3TYYA 1RE3C 1M1JB 1WT6A 4C7RA 2YNYA 1NWQA 1GU4A 3BVHA 5KJ7A 4B86A 1L0LK 1GZLA 5AW7B 1RE3A 1HJBA 1L4AC 3LIEA 4DOJA 3V4WA 1JO5A 2KP8A 3HUSB 4XA4A 1JY3N 1L4AA 1LTGC 1WRGA 2I1JA 2N1TD 3H6PA 1OXZA 2C9NY 2YO3A 1SQVK 3HTKA 2YKPA 3HE5B 1N86A 4WBAA 1SVFA 1FOSF 3P8MC 2HODB 3GHGB 3A3YB 2WT7A 2HPCA 1JY2N 3O8ZA 1NO4A 4Y99B 3M06A 2MJZA 3RK2D 4JYCA 5APQA 3L36A 2IFNA 4HYTB 1E5WA 2Q5UA 1HWTC 2C0WA 4W80A 3LIDA 5APSA 3MD0A 2P67A 3P8CD 1FZCB 1H8AA 2YKOA 1JTHA 1URQB 1ZV8A 2Z5IA 4IFDK 2CPBA 2OARA 1SFCB 1FOSE 2HLOA 2XDJA 5KLVK 2M8RA 3N4XA 2IFMA 3L35A 3G3ZA 3LW5H 1FJPA 2W6BA 3I5CA 2JJLA 2WSEH 5APVA 1HGVA 2KB7P 5AVUB 2XV5A 3M9BA 3M9QA 3EQ2A 1W2EA 1L4AB 3EFGA 2PP6A 5AVXB 5AVVB 2W6AA 2NPSC 2NPSD 5AW6B 5APUA 3M91A 3A7OA 3HTKB 3P8CE 2FKWB 2R5DA 4WB4A 2QM8A 1CSBA 5APWA 1FZFA 4ZKPA 2HFED 2NPSA 2W27A 3IR9A 2KLVA 3H32A 3RL0C 5KTBA 1FU1A 3B5NC 3B5ND 3R2PA 2WT7B 2HPCB 3VP9A 1IFMA 1LTJC 5BU8B 1JUNA 1NTMK 1URQD 2IX7C 3B5NA 1J2JB 1NHLA 1QL2A 1T3UA 1FAVA 1RE4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  4RES B;  2C9L Y;  3V4W A;  2ZFC A;  2KP8 A;  2N9B A;  2P7J A;  2R3C A;  4C46 A;  5AVQ B;  2XZR A;  1OXZ A;  2C9N Y;  2YO3 A;  3VN0 A;  1X8Y A;  2BAS A;  3M0A A;  2E42 A;  3HTK A;  3VYI A;  3HE5 B;  1A02 F;  3NXS A;  1MFZ A;  5AVR B;  3TNU B;  1FOS F;  3P8M C;  1HBW A;  3A3Y B;  1YYC A;  1DH3 A;  2IPP A;  1SLQ A;  2WT7 A;  3KQG A;  1GK4 A;  5AVY B;  5AW2 B;  3O8Z A;  3VMX A;  4I6M C;  3L37 A;  4GKG A;  5AVW B;  1MUU A;  3M06 A;  4JYC A;  3HE4 A;  2H7H A;  3NMD A;  1GD2 E;  1CI6 A;  5APQ A;  1T2K C;  3L36 A;  4HYT B;  3UIA A;  1GK6 A;  1MV8 A;  2Q5U A;  1JNM A;  1HWT C;  5APX A;  3NTN A;  5AW4 B;  3SWF A;  3VMY A;  1KQL A;  3LID A;  2WWW A;  5APS A;  3KDP B;  2P67 A;  3MD0 A;  1H8A A;  3M9H A;  4AYC A;  2WPQ A;  2Z5I A;  4GT1 A;  3TK1 A;  1HUC A;  2XU6 A;  1G2C B;  1OWA A;  5AVZ B;  4AQR D;  2VRS A;  2QM7 A;  1FOS E;  2YO2 A;  1S9K D;  2Q3I A;  2P2U A;  1HJB A;  3HE5 A;  5APT A;  1H88 A;  1GU5 A;  3L35 A;  3TNU A;  2E43 A;  3P32 A;  4EOT A;  4C7N B;  1T2K D;  5CMZ A;  5AW5 B;  3A2A A;  3P7K A;  3VTP C;  2WPS A;  3I5C A;  2JJL A;  1CZQ A;  5APV A;  2WTY A;  5AW3 B;  3A5T A;  2WPR A;  3T97 A;  5AVU B;  4AUW A;  2XV5 A;  3M9B A;  4XE5 B;  5AW8 B;  1SP4 A;  5AVX B;  3VMZ A;  4I2L C;  5AVV B;  2W6A A;  5AW6 B;  5APU A;  3OAK A;  3M91 A;  4M3L A;  1NAF A;  3A7O A;  2R5D A;  5AVS B;  2QM8 A;  3M0D A;  3V5B A;  1A02 J;  1H89 A;  1CSB A;  4LC1 A;  5AW9 B;  5APW A;  5AW1 B;  3IR9 A;  2W27 A;  1IO4 A;  2Z5H A;  3V4Q A;  3B8E B;  3MGN A;  5APY A;  4DZO A;  1S9K E;  2WT7 B;  5AW0 B;  3NFQ A;  4JYB A;  3TYY A;  2Q7C A;  5AVT B;  1JUN A;  2ZXE B;  2YNY A;  1NWQ A;  4C7N A;  4KHX A;  1GTW A;  3HE4 B;  1GU4 A;  1CI6 B;  2R32 A;  4B86 A;  1J2J B;  1GZL A;  1FAV A;  5AW7 B;  2R5B A; 
#chains in the Genus database with same CATH topology
 1ZRT E;  2B87 A;  2N9B A;  4D6T E;  2KOG A;  2KZJ A;  1JY3 P;  1OVU A;  2QJY B;  1BGY D;  2V4H A;  5B66 H;  5CJ0 A;  2ZVN B;  2WSC J;  4IL6 X;  1RQU A;  1KZU B;  1DH3 A;  2Z4E A;  2OYI C;  2FXM A;  4ASV A;  1NTM D;  4OGQ B;  2ZT9 B;  3L74 J;  5KLV G;  4LLH A;  5CCG A;  3K5B A;  2HG5 D;  3CCL P;  4BWN A;  2W8Z A;  3E7K A;  1HGZ A;  4AYC A;  2OYH A;  2Y9Z A;  2NPS B;  1Y8A A;  1KV4 A;  4EOT A;  3CCS P;  2D2C B;  3B5N B;  1BSH A;  2KI7 B;  1FS0 E;  1PGO A;  1YIJ P;  1SQQ D;  1HVV A;  3T97 A;  1PGP A;  4K35 A;  5AW8 B;  2AEF A;  2AXT H;  3CCM P;  3L71 D;  2YKQ A;  1RF1 A;  3AED C;  3B8E B;  4YXD C;  4DZO A;  4JYB A;  1RF0 C;  3CWB G;  3Q2Y A;  3HD7 C;  2R5B A;  1OVR A;  1YIT P;  3BCC E;  5KLI B;  4HB1 A;  1BCC G;  4UB6 E;  3TNU B;  1VDF A;  2OYO A;  1IK9 A;  1X0T A;  3VMX A;  2FYU K;  4I6M C;  1JM0 A;  5KAI H;  3HE4 A;  2H7H A;  1IK7 A;  1RH5 B;  4IL6 H;  1EZV D;  3MUD A;  2FFD C;  1Q2N A;  1OW6 A;  3GW6 A;  2QM7 A;  1YJN P;  1FZE A;  4R4L A;  1L0L J;  1RY3 A;  4N3Y B;  1X79 B;  2JWD A;  1FZA A;  3L75 E;  1SQQ K;  3P7K A;  3L72 E;  1SQV J;  1OMI A;  4L76 A;  2FYZ A;  2WPR A;  1FBM A;  2E76 B;  3M0D C;  3H1H G;  1AJY A;  1LWU C;  3CCE P;  4XFJ A;  3WMM 0;  5BU5 A;  3H1J E;  4H13 B;  1K05 A;  3L73 J;  2WQY C;  3H1L G;  1LTS C;  1VQ5 P;  1NKZ B;  2N1T A;  1N73 A;  1GTW A;  2FYU E;  1HH0 A;  3RK2 C;  3TGU D;  1ZN5 A;  2P1J A;  2GUV A;  1LTI C;  1N7S B;  1NTZ K;  1SQX D;  3RGU A;  1FDI A;  3L70 E;  1Q82 Q;  1LGH B;  4WWI A;  3HD7 D;  1FDO A;  1X9V A;  1JB0 J;  3O6Q B;  1DX7 A;  3OW2 O;  1LTA C;  3TDK A;  1SQQ E;  3NMD A;  1DD4 A;  1YBK A;  1SQP J;  1PP9 D;  3VP8 A;  1P84 D;  3SWF A;  3Q5P A;  5B66 E;  1NU1 G;  1QEX A;  3E1R A;  1L0N J;  1LNQ A;  3HUS A;  1J1D B;  2RN0 A;  1NTK D;  1QLE D;  2I1K A;  3BAT A;  2E43 A;  3D6Y A;  2KLU A;  1KYO H;  2GM4 A;  3A2A A;  1Y47 A;  1PPJ E;  3I56 P;  3PP5 A;  1R5S A;  3KZI H;  3G71 P;  1FZC C;  2JO1 A;  3TF5 A;  1AVY A;  1J1E B;  2IDB A;  1BSN A;  3OAK A;  4M3L A;  1NTZ E;  1BE3 J;  4DJG A;  1SFC A;  2W6J H;  1KIL E;  3BCC J;  1RE3 C;  1M1J B;  2AXT E;  2Y0C A;  1GU4 A;  5KJ7 A;  5KLV E;  4B86 A;  3EFF K;  2BEQ D;  1HJB A;  5E79 H;  1P84 I;  1EZV E;  1AVO A;  2BCC G;  4NPE A;  2E75 D;  2C9N Y;  2YKP A;  1VQP P;  1N86 A;  4WBA A;  2AEM A;  1Y9B A;  4H44 D;  1ZOY C;  2RH0 A;  3FWN A;  3M06 A;  3RK2 D;  1E5W A;  1HWT C;  2C0W A;  2K9Y A;  2P67 A;  2IBZ D;  1URQ B;  2OTJ P;  4IFD K;  3L72 J;  2OAR A;  5CBO A;  4OWF A;  3D70 A;  2HLO A;  5KAI E;  2IZ0 A;  3CME P;  3N4X A;  3CWB E;  4IL6 E;  3LW5 H;  5CBN A;  2JJL A;  1ZRT D;  1BGY J;  2Y0D A;  1PZQ A;  4D6T D;  3EQ2 A;  5AVX B;  2PP6 A;  3QH9 A;  3EWK A;  1BCC E;  5AW6 B;  5APU A;  3M91 A;  3A7O A;  2R5D A;  5APW A;  2HFE D;  2NPS A;  3RL0 C;  1FU1 A;  1JMB A;  2WT7 B;  3VP9 A;  1IFM A;  1KTM A;  1ZME C;  2H88 C;  1NHL A;  3B5N A;  2YXR B;  4GDO A;  5K5G B;  1OVV A;  4R4M A;  1JTH B;  2IBZ I;  5B5E E;  2CPS A;  4WY4 C;  3AE8 C;  1KMI Z;  1SQQ J;  2JWA A;  2M3B A;  4U3F G;  2A45 H;  2ZXX A;  1S5L X;  3L71 J;  3KQG A;  1MUU A;  4ZNC A;  2KK7 A;  3H1H E;  1HTL C;  2PRR A;  3G4S P;  1IJD B;  3CXH H;  3MP7 B;  2IZ1 A;  3AEE C;  2B9B A;  2R3S A;  1KB9 H;  3L4F A;  3S1K A;  2VRS A;  2YO2 A;  5CCH A;  1AFO A;  3SWY A;  2W83 C;  3TNU A;  1GDT A;  3IN6 A;  4EI2 A;  4GIF A;  3II6 A;  1LTJ B;  1BGY G;  3BCC D;  1OIP A;  1YTZ I;  5C39 A;  2YIU B;  2QJK B;  1MKM A;  3R4Y A;  1ZR2 A;  2H43 A;  1NTM G;  5AVS B;  1S4X A;  1KYO E;  1U7M A;  2M0B A;  4IFM A;  1FC2 C;  1KN7 A;  1FE6 A;  3V4Q A;  3KZI E;  1S9K E;  4YXW H;  2ZXE B;  2OYI B;  3CXH D;  3V2Q A;  1GL2 C;  3VN0 A;  1X8Y A;  4U7J A;  1RQV A;  3RL0 D;  2E42 A;  3AE9 C;  1T3J A;  1AQT A;  1NH4 A;  1W2B O;  1MFZ A;  3CX5 H;  4JBZ A;  3L75 D;  5E79 E;  1KIL C;  1SLQ A;  3CD6 P;  3L37 A;  1VQK P;  2QVA A;  3AE5 C;  4TLF A;  4UB8 H;  1LT9 C;  5AW4 B;  4IFF A;  4WY4 D;  2WWW A;  4A7P A;  1S5L H;  3H1J D;  4GT1 A;  5AVZ B;  1N7S A;  3GF3 A;  1KQF B;  2Q3I A;  3TGU J;  1GU5 A;  1M7L A;  2P58 A;  1JY2 P;  4Z1M H;  1SQX J;  2FYU D;  2KS1 B;  3H1K D;  1T6A A;  3W68 A;  5KAF H;  1HF9 A;  3O6Q A;  4PD4 I;  1VQ7 P;  2Q9I A;  4RO0 A;  1LP1 B;  3JC2 2;  3H25 A;  3HD7 B;  3V2N A;  3WU2 H;  1FDM A;  3RK3 E;  3CCJ P;  1SQB K;  3L70 D;  2WZ7 A;  2V7Q H;  2E74 C;  2LKM A;  4H0L C;  1PP9 J;  5AW1 B;  2PAJ A;  3ABV C;  1GMJ A;  1JCD A;  1JOC A;  1FZB A;  1M56 D;  2Q7C A;  3U59 A;  1Q7Y Q;  2R32 A;  1NTK J;  3CCU P;  1KQS O;  2FYN C;  2QRX A;  1FJK A;  2RKL A;  3MTU E;  2DW3 A;  3PHL A;  4EIJ A;  3H1I E;  2RMZ A;  3G6E P;  1VQ6 P;  3Q5S A;  2FFD B;  1N2D C;  1IC2 A;  2XNX A;  1K04 A;  2IPP A;  2QEX P;  1PPJ D;  5AW2 B;  1HJ0 A;  1M1J A;  3AEA C;  3U1C A;  1GL2 D;  1GD2 E;  4LGD E;  4RKU J;  3UIA A;  3NTN A;  2W90 A;  2XND H;  1NTZ D;  3CLQ A;  3E1I A;  3TK1 A;  1LWU B;  2WSF H;  3C8V A;  1USD A;  1SQB E;  3GHG C;  1KIL D;  1Z56 A;  1DD3 A;  5APT A;  1PFI A;  1YTZ T;  4Y99 C;  2E5T A;  4C7N B;  5KLV D;  2G3A A;  3CXH E;  3L74 G;  4KT0 J;  1KB9 E;  2OQQ A;  4GOF A;  3BAS A;  4BXL A;  1S72 P;  3RK2 B;  1URQ A;  1IFD A;  2B88 A;  3V2P A;  3C9I A;  1IO4 A;  2JEE A;  1VQ4 P;  3D6Z A;  2UWJ E;  1M57 D;  1EXI A;  5GTH H;  2LR2 A;  1M8O B;  1L4A C;  3LIE A;  3PJS K;  2E74 D;  2I1J A;  3H6P A;  2E75 C;  4H0L D;  1BDD A;  2H89 C;  5B5E H;  3HE5 B;  3CWB D;  1SVF A;  3AEB C;  4D6T J;  4TT3 H;  3A3Y B;  4H44 C;  3CCV P;  2WT7 A;  3H1K E;  4PV1 C;  1NO4 A;  1YJW P;  2MJZ A;  4JYC A;  1EZV I;  2IFN A;  1BCC D;  3LID A;  5KKZ C;  3MD0 A;  1FZC B;  3CX5 E;  1JTH A;  3CC7 P;  2Z5I A;  2O01 N;  2XDJ A;  5KLV K;  4UB8 E;  1YQ3 C;  2PFX A;  3AE2 C;  4ASW A;  1S5L E;  3G3Z A;  1FJP A;  2QE7 H;  2BEZ F;  2WSS H;  2AEJ A;  3LW5 J;  3I55 P;  3CC2 P;  2R44 A;  5AVU B;  2XV5 A;  1OW8 A;  2Y9Y A;  2YXQ B;  1EDJ A;  5AVV B;  2NPS D;  2MKV A;  4NPF X;  1K9M Q;  3HTK B;  4WB4 A;  1L0L G;  5KAF E;  1UII A;  3IR9 A;  2KSE A;  3H1I J;  5KTB A;  3B5N D;  1R5L A;  2QJP C;  4GOE A;  2IBZ G;  3WU2 E;  3H1H D;  2IYP A;  1SQV G;  3JCU H;  1FAV A;  2JR8 A;  1G1J A;  1LTJ A;  4EYY Q;  2P7J A;  3H1L D;  1RE4 A;  4Y28 J;  5AVQ B;  3VOP A;  3RK3 C;  3L73 G;  3KHU A;  3NXS A;  5AVR B;  2J58 A;  1LTT C;  1IFI A;  1Q86 Q;  1DEB A;  1IFJ A;  4N6J A;  5AVY B;  1L4A D;  4JPZ B;  2FY8 A;  1NJI Q;  2O01 H;  4JF7 A;  3S9O A;  2FXP A;  1SQB J;  2OYI A;  1SS1 A;  1T2K C;  1MZ9 A;  1XTC C;  4W7Y A;  2OYH C;  3VMY A;  3KDP B;  1M1K Q;  1YJ9 P;  1KYO D;  3PH0 A;  2B89 A;  2GUS A;  2A06 G;  1S9K D;  3CL3 D;  3U1A A;  3H32 B;  1H88 A;  4PV1 D;  4I7Z C;  2YMY A;  3RL0 B;  2HYN A;  2WPS A;  1SQP G;  2O3J A;  3L75 J;  1L0N G;  1RF1 C;  1IZN B;  1QX8 A;  3VMZ A;  1NAF A;  3A0B H;  5H2F H;  4OH8 B;  5AW9 B;  3AE4 C;  4WY4 B;  3W67 A;  3H1J J;  4YPC A;  5AVT B;  3BRV B;  3VMA A;  1BDC A;  2WSE J;  2KSJ A;  2KS1 A;  1CI6 B;  1LTB C;  3HRN A;  1RF0 A;  1LP1 A;  2AXC A;  2K1A A;  3HD7 A;  2FYU J;  3G9R A;  4KJM A;  1KYO I;  3H1K J;  3AE1 C;  1BE3 G;  2K9J B;  3V6I A;  5L8R J;  1ZR4 A;  3BCC G;  5GTH E;  2L91 A;  4GOD A;  3SFD C;  4PJ0 H;  3KYQ A;  2I8D A;  3L70 J;  1KQG B;  3MUD C;  2BCC D;  2KNC B;  1JNM A;  3RK3 D;  2NZ2 A;  1QVF O;  1HUC A;  1T8Z A;  1G2C B;  3MIW A;  1VQN P;  3N7N A;  1OX3 A;  2FFD A;  2P2U A;  5CCG D;  3P32 A;  2IYO A;  1NU1 K;  1T2K D;  3Q1M A;  3H1I D;  2J59 M;  3B71 A;  3MZW B;  4AUW A;  1ZW0 A;  3H1L E;  1YHQ P;  4I2L C;  1VL2 A;  3L72 G;  3CPW O;  1S2E A;  2SPZ A;  1GL2 B;  3M0D A;  1LWU A;  1A02 J;  2N1T C;  1N73 C;  2V7Q J;  3OA7 A;  1KFN A;  4PD4 H;  1NTZ J;  1PIX A;  4C7N A;  4KHX A;  2ZYA A;  1KIL B;  3AE7 C;  2QSI A;  4RES B;  2ZFC A;  5KLV J;  1LT9 B;  2R3C A;  4C46 A;  1SQB D;  2C0X A;  2O1J A;  3FGA D;  2BAS A;  3M0A A;  2OTK E;  3JCU E;  1HBW A;  3TSI A;  2WIT A;  1NOH A;  1PGJ A;  1GK4 A;  1NU1 E;  1KB9 D;  4GKG A;  1AV1 A;  3FXD A;  4WVZ A;  4N78 E;  3HUS C;  1MV8 A;  3CMA P;  1KQL A;  1L0L E;  2JDI H;  4I1L A;  4U3F D;  1SQQ G;  4QMA A;  2JKV A;  1OFC X;  4CPG A;  3GF7 A;  5GTI H;  2WSF J;  3HE5 A;  3L71 G;  2E74 B;  1SQP K;  4H0L B;  1SQV E;  3CCR P;  1JCC A;  3MHV A;  3Q5R A;  1VQM P;  1L0N K;  3CWB J;  4BRY B;  3WUU A;  2A45 I;  2FYN B;  3L73 E;  1SFC C;  1PPJ G;  1KD1 Q;  1FZC A;  4K3A A;  1WMK A;  2Q1K A;  3V5B A;  3SSU A;  1BCC J;  4OVN F;  2QG4 A;  5KJ7 C;  5APY A;  5AW0 B;  3CXH I;  3CC4 P;  1WT6 A;  3KXD A;  1NTZ G;  2JP3 A;  1VQO P;  1KB9 I;  1S1C X;  2BCC E;  3PRJ A;  1GZL A;  1RE3 A;  3A0B E;  5H2F E;  3V4W A;  4HJG H;  3CX5 D;  2GA1 A;  4L75 A;  2KP8 A;  1X22 A;  1VF5 C;  1KC8 Q;  1JY3 N;  1LTG C;  2A06 E;  2N1T D;  2ZYD A;  1L2P A;  3HTK A;  2OGU A;  1EZV G;  3P8M C;  2HOD B;  3GHG B;  1JY2 N;  1SQP E;  2K88 A;  3GMA A;  4Y99 B;  2FBW C;  1PL5 A;  1L0N E;  5APQ A;  3C1L A;  2Q5U A;  3IAO A;  1EDI A;  2QJY C;  3H1H J;  1RHZ B;  2YKO A;  3F89 A;  4PJ0 E;  2CPB A;  1E79 H;  2K3R A;  5M1B A;  2M3E A;  2J5U A;  3L35 A;  1LT1 A;  3H1L J;  1YI2 P;  4OGQ C;  1Q90 D;  2ZT9 C;  3SWK A;  1K8A Q;  1W5C E;  5APV A;  1HGV A;  2KB7 P;  3CX5 I;  1H0T B;  1BE3 E;  2ZAE B;  3M9B A;  1L4A B;  2NPS C;  4HKZ H;  1EC5 A;  3P8C E;  3TGU G;  1CSB A;  2E75 B;  4ZKP A;  2HR3 A;  2W27 A;  4L74 A;  3A0H E;  2D2C C;  3H32 A;  1SQX G;  3B5N C;  2HPC B;  3AEF C;  4DCK A;  1S3J A;  5BU8 B;  1JUN A;  2M5A B;  3F5H A;  4H44 B;  1NTM K;  1QL2 A;  4PV1 B;  1SFC D;  1U7J A;  4U3F E;  2Y0E A;  3JSV C;  4MN4 C;  1YQ4 C;  1NU1 J;  4PD4 E;  5KKZ B;  1IFP A;  1PP9 G;  5KJ7 D;  4O9B A;  2WSC H;  4WY4 A;  1ZLL A;  2NRG A;  4DT0 A;  3GLM A;  2QIW A;  1OW7 A;  1NTK G;  5DJU B;  1EDK A;  2ZVO B;  1CI6 A;  1VF5 D;  2O01 J;  5KLI C;  4W7Z A;  5APX A;  3Q3D A;  1OZH A;  5CCH C;  2ITA A;  3M9H A;  4YTP C;  1OWA A;  3CCQ P;  2K9J A;  2FXO A;  3AE6 C;  2ZYG A;  1P84 H;  1BGY E;  3PLN A;  2OTL P;  5CMZ A;  5AW5 B;  2K37 A;  5TIS H;  3VTP C;  3PTZ A;  2QJP B;  5CJ4 A;  2WTY A;  1NTM E;  1VQ9 P;  2B87 B;  2G8Y A;  3A5T A;  2KNC A;  3V2R A;  5GTI E;  1SP4 A;  2BCC J;  2XKM A;  1G2C A;  4OGQ D;  4LC1 A;  3RK3 B;  3L74 D;  1AQ5 A;  2ZT9 D;  3GG2 A;  4NPD A;  3MGN A;  3WUV A;  3NFQ A;  3SFE C;  2E76 C;  3AEC C;  3KPE A;  2C9L Y;  1DEE G;  3RL0 g;  1CW5 A;  4H13 C;  2KUB A;  2WVR A;  2OYH B;  2WMM A;  2D2C D;  3L71 E;  1GL2 A;  1A02 F;  1IFN A;  2QA4 P;  5TJH A;  3USS A;  3D71 A;  4I7Z B;  2KXP B;  1KIL A;  1QGK B;  2O1K A;  1EQ7 A;  3T97 B;  1GK6 A;  1N7S C;  3FWL A;  1RF1 B;  2ZJS E;  1LT9 A;  2Q3E A;  1JMM A;  4AQR D;  3WUT A;  4JQ0 D;  4D6T G;  1VPC A;  1G1I A;  5CCG C;  4ZMD A;  1N8R Q;  5CHX A;  3ITK A;  4RJT A;  1CZQ A;  1NKN A;  5CCH D;  2LXB A;  5AW3 B;  1J1D C;  1R8E A;  3B4S A;  1N7L A;  1SQX K;  4HH2 A;  2H8P D;  1H89 A;  2Z5H A;  1GW3 A;  1NU1 D;  4U3F J;  1XTG B;  1GW4 A;  4N78 D;  3HE4 B;  2P10 A;  1FZG A;  1J1E C;  2KYV A;  1EXJ A;  1L0L D;  2WPV B;  1PGQ A;  4BRY A;  1U57 A;  2L5G B;  1JEK A;  2XZR A;  3VYI A;  3H1I G;  1NTK K;  1M1J C;  1SQV D;  1LJ2 A;  1YYC A;  2E76 D;  5AVW B;  2POH A;  3L73 D;  4H13 D;  3IFM A;  1D7M A;  1JY3 O;  1QL1 A;  3BRT B;  1MFT A;  1PV3 A;  3TGU E;  3RBZ A;  2WPQ A;  3ZDM A;  1VQ8 P;  3QWO C;  2XU6 A;  1SQX E;  1AA0 A;  3L74 E;  1K73 Q;  1NTM J;  4ZKU A;  5BVZ A;  1JY2 O;  2A45 G;  2HOD A;  2N1T B;  3GHG A;  1N73 B;  4EDF A;  3OJA B;  1SQB G;  3CI9 A;  1N7S D;  1KOR A;  1URQ C;  2A06 D;  4XE5 B;  1KFM A;  1PP9 E;  1P84 E;  5DJT B;  2PGD A;  5TIS E;  1Q81 Q;  1TU3 F;  1SQP D;  1NTK E;  3TYY A;  3A0H H;  4C7R A;  2YNY A;  1NWQ A;  1L0N D;  4UB6 H;  1ZXG A;  3BVH A;  1L0L K;  5AW7 B;  1EDL A;  3L75 G;  5EFW B;  1ZP0 C;  1QVG O;  4DOJ A;  1JO5 A;  1H0T A;  3HUS B;  4XA4 A;  1L4A A;  1WRG A;  1OXZ A;  3S4R A;  2YO3 A;  1SQV K;  1NVO A;  2KIK A;  1FOS F;  3H1J G;  2HPC A;  3O8Z A;  2Q6Q A;  2N9Y B;  2M5A A;  3IF4 A;  1BE3 D;  3L36 A;  4HYT B;  4W80 A;  2FYU G;  3H1K G;  5APS A;  3P8C D;  1VQL P;  1H8A A;  3AE3 C;  1ZV8 A;  2CK3 H;  1SFC B;  2QJK C;  1FOS E;  1NYH A;  2M8R A;  2IFM A;  3L70 G;  4L73 A;  2E5Y A;  1NAY A;  2W6B A;  2YMK A;  3I5C A;  2WSE H;  1USE A;  3M9Q A;  4PD4 D;  1W2E A;  3EFG A;  1UIX A;  2W6A A;  2FKW B;  1VF5 B;  4IOI H;  2QM8 A;  2IBZ E;  3RBX A;  3FXE A;  3AEG C;  1FZF A;  1M90 Q;  2LXC B;  2KLV A;  1DIP A;  3R2P A;  2KZI A;  1LTJ C;  1URQ D;  2IX7 C;  1J2J B;  3L72 D;  1T3U A;  2YIU C;  1RE4 C;  1NGM B;  3FX0 A; 
#chains in the Genus database with same CATH homology
 1G1J A;  1SFC D;  1LTJ A;  2N9B A;  1JTH B;  2P7J A;  1RE4 A;  5AVQ B;  3VOP A;  2CPS A;  2KOG A;  3RK3 C;  4WY4 C;  1JY3 P;  5KJ7 D;  4O9B A;  2M3B A;  2WSC H;  3NXS A;  5AVR B;  5CJ0 A;  2J58 A;  4WY4 A;  1KZU B;  1ZLL A;  2A45 H;  1DH3 A;  1LTT C;  2Z4E A;  2OYI C;  1IFI A;  2FXM A;  3KQG A;  1DEB A;  1IFJ A;  4N6J A;  5AVY B;  1L4A D;  2O01 H;  4JF7 A;  1MUU A;  2OYI A;  1CI6 A;  1HTL C;  1T2K C;  1MZ9 A;  4W7Z A;  1XTC C;  5APX A;  4LLH A;  4W7Y A;  5CCG A;  2OYH C;  2HG5 D;  3VMY A;  3KDP B;  5CCH C;  1IJD B;  1HGZ A;  3M9H A;  4AYC A;  2OYH A;  3L4F A;  2GUS A;  1OWA A;  2VRS A;  2NPS B;  2YO2 A;  5CCH A;  1AFO A;  1S9K D;  3CL3 D;  3U1A A;  3H32 B;  1H88 A;  3SWY A;  3TNU A;  4EOT A;  1GDT A;  2YMY A;  5CMZ A;  5AW5 B;  3RL0 B;  4GIF A;  3B5N B;  3VTP C;  2HYN A;  2WPS A;  3II6 A;  5CJ4 A;  1LTJ B;  2WTY A;  3A5T A;  1HVV A;  3T97 A;  1YTZ I;  3V2R A;  1RF1 C;  5AW8 B;  1SP4 A;  3VMZ A;  1ZR2 A;  2YKQ A;  1NAF A;  2H43 A;  5AVS B;  1RF1 A;  2XKM A;  4IFM A;  1G2C A;  4OH8 B;  4LC1 A;  5AW9 B;  3RK3 B;  4WY4 B;  1AQ5 A;  3V4Q A;  3B8E B;  3MGN A;  4DZO A;  1S9K E;  3NFQ A;  4JYB A;  5AVT B;  1RF0 C;  2ZXE B;  3BRV B;  2KSJ A;  2OYI B;  1CI6 B;  3V2Q A;  3HD7 C;  1LTB C;  3KPE A;  2R5B A;  2C9L Y;  3HRN A;  1RF0 A;  1GL2 C;  1CW5 A;  3HD7 A;  2OYH B;  3VN0 A;  1X8Y A;  3RL0 D;  2E42 A;  1GL2 A;  1T3J A;  1A02 F;  1NH4 A;  1IFN A;  1MFZ A;  1ZR4 A;  3TNU B;  1VDF A;  1IK9 A;  1KIL C;  1SLQ A;  3KYQ A;  3VMX A;  2FYU K;  4I6M C;  3L37 A;  3HE4 A;  2H7H A;  1KIL A;  2O1K A;  1EQ7 A;  1GK6 A;  1JNM A;  1LT9 C;  5AW4 B;  4IFF A;  3RK3 D;  1N7S C;  4WY4 D;  2WWW A;  3MUD A;  2FFD C;  1RF1 B;  4GT1 A;  1LT9 A;  1HUC A;  1T8Z A;  1G2C B;  1N7S A;  1JMM A;  5AVZ B;  4AQR D;  2QM7 A;  3MIW A;  1FZE A;  1RY3 A;  3N7N A;  2FFD A;  2Q3I A;  2P2U A;  4N3Y B;  1VPC A;  1X79 B;  1G1I A;  5CCG C;  5CCG D;  1GU5 A;  1M7L A;  1JY2 P;  3P32 A;  1NU1 K;  1FZA A;  5CHX A;  1T2K D;  1SQQ K;  3P7K A;  1CZQ A;  1NKN A;  2J59 M;  5CCH D;  2Q9I A;  5AW3 B;  2FYZ A;  2WPR A;  1FBM A;  3HD7 B;  3M0D C;  4AUW A;  1J1D C;  3V2N A;  1LWU C;  1FDM A;  4I2L C;  1N7L A;  1GL2 B;  1SQB K;  1SQX K;  2WZ7 A;  3M0D A;  3WMM 0;  5BU5 A;  4HH2 A;  1LWU A;  1A02 J;  2LKM A;  2H8P D;  2N1T C;  1H89 A;  5AW1 B;  1N73 C;  2PAJ A;  3OA7 A;  1KFN A;  2Z5H A;  1LTS C;  1JCD A;  1JOC A;  1GW3 A;  1NKZ B;  1FZB A;  1XTG B;  1GW4 A;  2N1T A;  2Q7C A;  3U59 A;  4C7N A;  4KHX A;  1N73 A;  4N78 D;  1GTW A;  3HE4 B;  1KIL B;  2R32 A;  1FJK A;  1FZG A;  3MTU E;  4RES B;  1J1E C;  1HH0 A;  2KYV A;  4EIJ A;  2ZFC A;  3RK2 C;  1ZN5 A;  2L5G B;  2P1J A;  2GUV A;  1LTI C;  1LT9 B;  2R3C A;  4C46 A;  2XZR A;  2C0X A;  2O1J A;  1N7S B;  1NTZ K;  2BAS A;  3M0A A;  3VYI A;  2FFD B;  1N2D C;  1IC2 A;  1NTK K;  1M1J C;  2XNX A;  1HBW A;  3TSI A;  1LGH B;  1YYC A;  2WIT A;  2IPP A;  1NOH A;  3HD7 D;  1GK4 A;  1X9V A;  5AW2 B;  1M1J A;  4GKG A;  5AVW B;  3U1C A;  1DX7 A;  2POH A;  1LTA C;  1GL2 D;  3NMD A;  1GD2 E;  4LGD E;  4N78 E;  3HUS C;  3UIA A;  1MV8 A;  3IFM A;  3NTN A;  3VP8 A;  3SWF A;  1JY3 O;  1QL1 A;  1KQL A;  3BRT B;  3CLQ A;  3HUS A;  4I1L A;  2WPQ A;  3E1I A;  1J1D B;  3TK1 A;  1LWU B;  2XU6 A;  2WSF H;  3GHG C;  1KIL D;  1Z56 A;  3HE5 A;  5APT A;  4ZKU A;  1PFI A;  5BVZ A;  1YTZ T;  1JY2 O;  2I1K A;  3BAT A;  4Y99 C;  2E43 A;  2A45 G;  1SQP K;  2HOD A;  2N1T B;  3GHG A;  4C7N B;  1N73 B;  1JCC A;  3OJA B;  2GM4 A;  3A2A A;  1L0N K;  3CI9 A;  1N7S D;  3PP5 A;  1FZC C;  1URQ C;  2A45 I;  4XE5 B;  3BAS A;  1SFC C;  1KFM A;  1J1E B;  1FZC A;  3OAK A;  4M3L A;  3RK2 B;  1URQ A;  3V5B A;  1IFD A;  1SFC A;  3V2P A;  3C9I A;  1IO4 A;  2JEE A;  5KJ7 C;  5APY A;  5AW0 B;  3TYY A;  1RE3 C;  1M1J B;  1WT6 A;  4C7R A;  2YNY A;  1NWQ A;  1GU4 A;  3BVH A;  5KJ7 A;  4B86 A;  1L0L K;  1GZL A;  5AW7 B;  1RE3 A;  1HJB A;  1L4A C;  3LIE A;  4DOJ A;  3V4W A;  1JO5 A;  2KP8 A;  3HUS B;  4XA4 A;  1JY3 N;  1L4A A;  1LTG C;  1WRG A;  2I1J A;  2N1T D;  3H6P A;  1OXZ A;  2C9N Y;  2YO3 A;  1SQV K;  3HTK A;  2YKP A;  3HE5 B;  1N86 A;  4WBA A;  1SVF A;  1FOS F;  3P8M C;  2HOD B;  3GHG B;  3A3Y B;  2WT7 A;  2HPC A;  1JY2 N;  3O8Z A;  1NO4 A;  4Y99 B;  3M06 A;  2MJZ A;  3RK2 D;  4JYC A;  5APQ A;  3L36 A;  2IFN A;  4HYT B;  1E5W A;  2Q5U A;  1HWT C;  2C0W A;  4W80 A;  3LID A;  5APS A;  3MD0 A;  2P67 A;  3P8C D;  1FZC B;  1H8A A;  2YKO A;  1JTH A;  1URQ B;  1ZV8 A;  2Z5I A;  4IFD K;  2CPB A;  2OAR A;  1SFC B;  1FOS E;  2HLO A;  2XDJ A;  5KLV K;  2M8R A;  3N4X A;  2IFM A;  3L35 A;  3G3Z A;  3LW5 H;  1FJP A;  2W6B A;  3I5C A;  2JJL A;  2WSE H;  5APV A;  1HGV A;  2KB7 P;  5AVU B;  2XV5 A;  3M9B A;  3M9Q A;  3EQ2 A;  1W2E A;  1L4A B;  3EFG A;  2PP6 A;  5AVX B;  5AVV B;  2W6A A;  2NPS C;  2NPS D;  5AW6 B;  5APU A;  3M91 A;  3A7O A;  3HTK B;  3P8C E;  2FKW B;  2R5D A;  4WB4 A;  2QM8 A;  1CSB A;  5APW A;  1FZF A;  4ZKP A;  2HFE D;  2NPS A;  2W27 A;  3IR9 A;  2KLV A;  3H32 A;  3RL0 C;  5KTB A;  1FU1 A;  3B5N C;  3B5N D;  3R2P A;  2WT7 B;  2HPC B;  3VP9 A;  1IFM A;  1LTJ C;  5BU8 B;  1JUN A;  1NTM K;  1URQ D;  2IX7 C;  3B5N A;  1J2J B;  1NHL A;  1QL2 A;  1T3U A;  1FAV A;  1RE4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...