3A6PC

Crystal structure of exportin-5:rangtp:pre-mirna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
b'PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-5
molecule tags Protein transport/nuclear protein/rna
source organism Homo sapiens
publication title A high-resolution structure of the pre-microRNA nuclear export machinery
pubmed doi rcsb
total genus 41
structure length 170
sequence length 170
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a6pC00
1PLKA 1ODFA 1COWA 1LV7A 4GDFA 3WNCA 5FPHA 1OH7A 2W6IA 1ZD9A 4DLZA 3BH0A 3GFOA 2YV5A 4NYMQ 4PSAA 2WOJA 3IBGA 5FTNA 1FUUA 1IXRC 3U7HB 1NP6A 2F43A 5FUWA 2WHXA 2QTFA 3SFVA 3LXRA 1N0VC 3EZ9A 4JLKA 2JDIA 1N5LA 1EFRD 1H8HD 3FKQA 4C0SA 4FIDA 4L16A 4PAMA 3I92A 3CBQA 2ZJYA 1B23P 1QHNA 4LHYA 2V1XA 3MJHA 4NCNA 4BWYA 2GXUA 3JZAA 2A9KA 4KVGA 5BYJA 2ZUBA 4MRNA 1NLZA 2ZPTX 3RRMA 2ZUDA 2QNRA 2ZAOA 1QVRA 3BH6A 2IXGA 1UEIA 2RAPA 4ON9A 3O8RA 3SQXA 1E0JA 1XEWX 1VG9B 4PANA 1W5TA 4LJYA 5JCPA 2F7SA 4CEIB 2IF0A 2RMKA 3FWYA 3ONWA 3S1AB 4WA7A 4LHWA 1FQKA 4JVMA 2IYLD 1NMZA 2P67A 2QN6A 2JLRA 4KFTA 5LPNA 3W3ZB 4KI0A 5TMPA 2QBYA 1SXJB 3UKDA 4H9GA 1OPXA 4AYXA 3CRVA 1E2MA 4PPGA 4W5WA 1KI6B 2AHOA 3LA6A 1KDRA 2REBA 4NU0A 3AP3A 4Q4JA 4ARZB 3FHOA 1R6BX 4PPNA 3IHLA 4QBFA 4CYMA 1C4OA 1GL6A 4ESHA 4IFBA 1NBMD 3H4MA 4G0NA 4MGKR 3FTQA 4A82A 2ZU0C 3GEHA 1BIFA 1D2NA 3OE7A 1NLFA 4AD8A 1VMAA 1PLLA 3X1XA 4BLOA 2TMKA 4AIIA 1GIAA 4X8OA 1P73A 5EE1A 1HY3A 1IJFA 2VHTA 2AKAB 2GWHA 3LD9A 1E0AA 2J7KA 4JLMA 4MGZR 3OE7D 4KSBA 4DT1A 4BZQA 1KJWA 4QJ3A 2RGCA 3L0SA 3RRNA 3U3MA 4DCSA 2NZ8A 4OI4A 3PUVA 1E69A 1XXHB 1XMSA 2H1LA 3D8BA 2R6FA 4G5GA 1EK0A 4PO1A 1KO4A 5FPKA 1FFHA 2H18A 1JEEA 1SULA 2FZ4A 4EPWA 2ZXUA 1BKDR 2XSZA 5EE3A 4FMDB 4U02A 5JEDA 1AQYA 4BFYA 3L0IB 3GLIB 4RZ3A 1OFUX 2IYYA 1Z63A 2GDJA 2WWWA 3A8TA 4MH0R 1S3SA 2X19A 1SVSA 2ZI9A 4HATA 3CB4A 4KBGA 3KQUA 1XJ0A 2C77A 2PX3A 3VTKA 4M1KA 5J5CA 1EX6A 1Q12A 4B71A 4AKIA 2OV2A 2OLJA 3MAAC 2J5XA 2OCBA 2OBMA 1KOFA 1L4UA 1WE2A 2HF8A 3EAQA 3W5IA 3KJEA 4DSOA 4Q4HB 2ODWA 4PX9A 1RRGA 1WRBA 5JRJA 2OXRA 5FBWB 1P3JA 1KKLA 3K1JA 4RD2A 2FSFA 2EFDB 3EWSA 1FP7A 2LCFA 2C9CA 3BJIC 3TNFA 1LS6A 1DAEA 1N25A 4JKIA 5DHAA 4XWKA 4QFMA 2FZLA 2KBEA 2G88A 4ACBA 1JXMA 3NC0C 5KNBA 4LJ9A 4P3YA 4PR0A 2GBLA 221PA 1CJVC 5G3ZA 4E22A 4HB3A 1ESNA 4CIDA 4M0LA 2CMKA 4JKYA 2I4IA 1NL3A 2CL7X 3A37A 4Q9JA 4BUJA 2BBWA 2CLDX 4Z8XA 4ZI2A 4JJKA 3IDQA 3TR5A 4B3FX 4V0LA 3LRPA 4YMTA 3LBHA 1GKUB 2VSXA 1ZMXA 2ZRJA 1OV4A 1YR9A 4O2LA 5KUTA 1Q1ZA 2G77B 2DHRA 1NI3A 2Q21A 4L9WA 4XVRA 5TV2A 4YLGA 2WTUA 1ZM3A 4RCZA 4B32A 4GOXA 2YOFA 3PFIA 1IQPA 4RVCA 2BV3A 4IRUB 1DG1G 1G3RA 2ZSEA 5GVSA 5DN6A 1A7JA 3ECCA 2J7PA 1CRQA 4JMPA 4PQRA 1WBBA 3EIHA 2EU8A 2IXEA 3EA0A 1U9IC 1QF9A 1TQ4A 3MLEA 5D3MA 3TQFA 2DYKA 1XB2A 5IF9A 1US8B 4URYR 4Q1BA 3QXXA 4LBVA 2GKSA 1UKZA 1MO5A 1OXSC 1ZYUA 3DVLA 2OFOA 3H0KA 4R7ZA 4ZDKA 1EFTA 4LSGA 4NZYA 5KNCA 1JQJC 1W0KA 2W2XA 1XTJA 5ANRB 1E6CA 3T5GA 4YMVA 2IHBA 4OK5A 5JMTA 1LF0A 4WXRA 1IN4A 1C1YA 5FR1A 1MV5A 2P2LA 3ETLA 4EIWA 1VECA 1Z08A 1TF7A 1YZNA 4DCNA 2J0UB 3QEJA 3EIEA 4NP6A 3U44A 4TL6A 1Z07A 1GKIA 2ODEA 3G0HA 3KFXA 4MRVA 2DWPA 2VH5R 2VLIA 4MGYR 3SNHA 2ZU6A 4GMDA 4BFVA 1XD9A 3SC3A 3MCAA 2QMOA 3BORA 3B9QA 3I73A 3K09C 3OEEA 1TMKA 1X8LA 3G5UA 3OAAA 4YDHB 4GFDA 4C0KA 1CR0A 4X8LA 3U5ZB 3NVAA 4R2HA 3ZZTA 1N3BA 3ZDQA 2OO7A 1SXJD 2VHQA 2YZ2A 2ZRMA 3RRYA 721PA 1II0A 4DLSA 3L8ZA 4JJZA 1Z8FA 1Z6TA 1IN6A 1I4DD 3LQQA 4O3MA 1OYYA 2ZRNA 3GMTA 4OHWA 4YQFA 4QKQA 4G3XA 3AEZA 1N6IA 5CYOA 4ILEA 3GPLA 4D80A 2CVFA 1DTSA 4A2QA 4LJ4A 1T0JB 4CEHB 5FL7A 5JJIA 1DELA 2C95A 4M22A 4NYJQ 3X2SA 4I1OA 2WMNB 4URXR 1E2NA 2NO7A 4NKRA 1F2TA 2QAGA 1KSGA 4LJ6A 4WOPA 3NH9A 4Q1DA 1XRJA 3B1YA 3OEHA 4HLQB 3QJYA 3KKQA 4KCGA 4TQUS 3I8SA 1YR8A 2ZJ8A 1JJ7A 5E95A 3IILA 3Q5EA 1OF1A 1P9RA 3TRFA 1AGPA 2ZYVX 1XZPA 2W6JA 3GJ5A 3AP1A 4Q66C 1ZIOA 3WP0A 1HYQA 1OSNA 2IUSA 3THYB 2WKRA 1OFTA 3NBXX 3P4YA 4ZDIA 3A6PC 3AM1A 2R65A 5JJKA 2IYWA 3KKOA 3C16C 4F7WA 3QBTA 2HJGA 3K0FA 1GILA 3MUFA 1E2QA 1M7GA 2H57A 4H1UA 1GSIA 3K0CA 1DEKA 3VU9A 1XPOA 4J0QA 1OJLA 1N5KA 2WAYA 3BB1A 3AVVA 2ZYTX 4YXWA 3RS7A 3UMFA 3WRYC 1KI2A 3R8CA 2DY1A 2REXB 1QBKC 1CBUA 1E79A 1FL9A 2XZLA 3CUEF 2DFKB 2F3TA 2OM2A 3KL4A 1G64A 2BMFA 4HUQB 1LY1A 3VR6A 1G6OA 5DN6D 4G5SA 3B1XA 1W49A 3P26A 2VSFA 1EWQA 3B1VA 4JL8A 4PZLA 2WWGA 2RHMA 3GJ7A 3V9PA 2ZREA 2B8TA 4KVAA 4PTLA 1YR7A 3B82A 5B2ZA 1X3SA 4RFVA 5GJVC 1DAGA 1G7CA 2PH1A 3K9NA 5FTJA 1G1MA 4NCHA 1KO1A 1IONA 3K09A 4LOAA 1F48A 1FMJA 4NH0A 4MYCA 3KKNA 5JLJA 3TAHA 2VP5A 4Q1AA 2AWOA 3CR8A 5IRCD 2AWNA 2JA1A 4MRRA 4C0JA 3GCGA 4MDEA 4TYPA 4E09A 1BOFA 2I3BA 3U3RA 1NJGA 3K8YA 1EFCA 2YWGA 5EXTA 5KYKA 3L2OB 1TQDA 3NBYC 4HLCA 4JLBA 4DUGD 2XZOA 2GEDA 1VYUA 4ZKDA 5EE0A 4A8JC 1G9XA 2GCPA 1A5TA 5BXQC 2FFAA 1KMQA 4H1VA 2FA9A 2A78A 5CDFA 1P75A 2BBTA 1SGWA 4TTQA 3A1UA 3P27A 4NCIA 2ZRDA 2CEAA 2WICA 121PA 3DHWC 2IBMA 2ZVPX 3E5HA 3OESA 4Q7JB 1CLUA 5DNYB 2REOA 2ZS9A 2QE7D 2ZEJA 3V4FA 2NPFA 5JJLA 4PO8A 3SDZA 1KO7A 4QG7A 1P2VA 2QENA 2D3WA 4BFXA 1CJTC 2XXAA 2LKCA 2GF9A 4L9SA 4ZPXA 2JLZA 4M1OA 4GSYA 4OQLA 2CL6X 2FJUA 2HF9A 1T4GA 1SVLA 2ZETA 2AR7A 3CNLA 3DO6A 2OCPA 1CR2A 1GL9B 1NMXA 4QGFA 4BZPA 3PEWA 2IYZA 4DLTA 1XXHE 3WYAA 2KSQA 1EXMA 1SXJE 3SS8A 2XX3A 1D2MA 3EARA 3NDPA 5TXGA 4NPHA 4BFZA 1A2BA 2ZSFA 3QBVA 4P4UA 1VCIA 2ZQ5A 4Q7MB 1Z28A 1MRSA 1M1YE 5BWMA 4JBYA 3U6BA 2G0NA 2RGXA 4RCYA 2GBLC 2BHRA 2XJ9A 2KI5A 3D7MA 3HU3A 1JPJA 1P2UA 3P20A 2GEVA 1G291 3AF4A 4W5JA 4P31A 1HV8A 3A1TA 3F3YA 3OF5A 4N1AA 2PBRA 1OKKA 1W4AA 1D9XA 4D4KA 3E70C 2ZJ5A 1W4RA 4D4JA 2G6BA 3WHLA 3LLUA 2ORIA 3UXMA 4OHYA 3Q72A 4Z54A 4IHQA 1OHHD 2BIFA 1Q57A 4CT5A 4QNMA 1RKBA 2Q6TA 3LVRE 3F8TA 1X1SA 1B0UA 1G5RA 2PMDA 4B33A 3VNVA 1S8FA 3UWKA 2IHYA 4HB0A 4Z1MD 1X8KA 1LTQA 1G3MA 5FI0B 3ZQ6A 4ASUD 4F38A 5IK2D 4QM7A 3WMFA 4MKHA 3TUZC 2AFIE 2FE4A 4RKEA 3HU2A 3SBEA 2ZAMA 1RW4A 2QT1A 2PZEA 3V4RA 4NDZA 3CX7A 2Q3HA 3CM0A 2ANCA 3K53A 3OFNA 1JNYA 2JIZD 3NBZC 4G01B 3Q7QA 1FNNA 4DBLC 4LDJA 1Z6GA 2HXSA 1CKEA 5D3MB 4BPBA 3T5DA 5JWOA 1E2KA 5HCIA 3R7WB 4MKFA 3ZS8A 5JI3E 3KJIA 4UNSA 2OCYC 4Z1MA 3TVTA 1KNXA 2J46A 1CRPA 1UF9A 2CJWB 3PG5A 1KJYA 1HTWA 2HJVA 3QKUA 2PX0A 2RGNA 1OB5A 2DR3A 2WBLC 4FD2A 1E2PA 1XNJA 4IXMA 4AWXA 5ELXA 1G8GA 4QHYA 4DXAA 4HAYA 3CPJB 3SJAA 1AGRA 4A8JA 5DE3A 3CWZA 4Q4AA 2IS6A 3BH7A 4DEXA 3FFAA 2J0QA 1I2DA 3LLMA 2N46A 3F5FA 4HDQB 2Q3FA 1R0WA 4A2PA 1E9CA 1U99A 4AURA 2FFHA 1CJUC 5C4GB 1WB9A 1FX0B 1GNQA 1JBKA 1GG2A 4XSHA 2C78A 1HQCA 4IKEA 1IAQA 5AJVB 5F3WB 2JJ2A 1R0YA 5EUMA 4II7A 4A6XA 4TZ0A 3SJZA 4BE7B 1ZBDA 4C2UA 4Q00A 1JR3E 5KOYA 2IW3A 3T61A 1NMYA 3MGCA 3LFUA 2YINC 1DAHA 3ZGXA 2O0HA 2WJIA 4HAUA 4V03A 3X1WA 1G7SA 4URUR 2Z5FA 3ZVMA 1X86B 4OI2A 2FFQA 1W44A 1X1RA 3O47A 1TADA 3T06B 1H65A 2XXAB 1GOTA 4CRWB 1TQ2A 2PL3A 3D3QA 4JLDA 3U3OA 1QG4A 4B3GA 3GLIA 3VAAA 2HCBA 5DI3B 2LKDA 2ZYWX 3X1DA 3AV0B 1S4QA 4TMXA 1CIPA 3A1WA 1K5DA 1OH6A 4V0KA 1FPMA 1AS0A 2XB4A 3THXB 1OXUA 3RRZA 3K0AA 1G18A 3VKWA 2VHJA 1Q21A 1SHKA 4B3BA 4BEJA 4KFUA 3TK1A 3VFDA 4ERNA 1P72A 1J99A 4Q9LA 2P6NA 5C1BA 5GJBA 3BK7A 3KZ1E 1Q1QA 1P7CA 2Z6VA 1LW7A 3HR8A 3Q8XB 4KYUA 3SEAA 3D31A 5DSZA 4TSFD 2ZANA 1CP2A 2CXXA 4ITRC 1E9EA 3B85A 1XTKA 4DSTA 1WP9A 1QVAA 2OEPA 2FU5C 3N70A 4OHXA 1Z29A 5K8IA 3K9LA 3Q5DA 4YONB 2O52A 5FBRB 5IDVA 3EPHA 1EG7A 1E2EA 1NVWQ 3FGNA 2HXYA 1E9SA 5L3SA 4JBWA 5C2JB 1U8YA 3QXCA 4Q7LA 3HR7A 4PHGA 2RHDA 1KGDA 2IS2A 1F3OA 1FUKA 2EW1A 4Z51A 2JDID 3LQRA 1G5PA 1EFUA 3IPXA 4A6PA 3NG1A 2GETA 4M1WA 4C0LA 2C9YA 1XFAA 2VP4A 1XJQA 5KDDA 2QU8A 1E9DA 1US8A 2Z0MA 3NXSA 1GTVA 4LK2A 5CM8B 1KSFX 5LD2B 4TYQA 3UMSA 1KDOA 1BO6A 3FE2A 4GP7A 2IK8A 4F4CA 3KKMA 3R9WA 3AVXA 4X8MA 1G21E 2AX4A 1EGAA 3D6TB 1W4BA 4QBHA 4TL7A 8OHMA 4JZKA 4JLOA 2C03A 3BB3A 4MQBA 1IN7A 3PQCA 4B2IA 3FKSA 1OIXA 3MD0A 3EW9A 2VP9A 4FN5A 4V0MA 3QF4A 2F1HA 4E5UA 2QP9X 4ESVA 3GFPA 3H86A 4EJSB 2FH5B 3QF4B 4JSYA 4DSNA 5F2EA 1E2DA 2C04A 1YHNA 1F2UA 2KJQA 2ZRAA 2OBLA 2WM9B 1MABB 1SVIA 1SKYB 1NF3A 2OBNA 1E2HA 5HZKA 1ZCBA 4C7OB 3DKVA 4MYTA 4Q9KA 4RFSA 4A1FA 1WQ1R 2FSGA 4QHTA 4IEEA 1YU9A 1W2GA 1ZC4A 3OEHD 4EPTA 3IEUA 1TF2A 1XD8A 4LYFA 4HEJA 2ASEA 1XEXA 1UBEA 2P65A 5FOUA 2QPTA 1FX0A 2JLUA 3VR3A 3ZLJA 1I4TD 2W6JD 4F4JA 3P1JA 2NTYC 1KAGA 2ZS7A 2YC4C 4Q4JB 3GEEA 2WIAA 1NLYA 3W6NA 4KITB 1W36C 4NYIQ 2RGBA 4G5OA 1PUIA 2AL7A 1E9BA 2F9MA 4JYCA 3C7KA 1S9DA 4WZBE 3TR0A 1HA3A 2IYUA 4GT1A 1JR3D 5EP1A 5BYKA 1KI9A 5FUVA 1E1RD 4Y0AA 3P4XA 1GM5A 5H1YA 4BFTA 4TLCA 5K8LA 2G3YA 2JAQA 4M9SA 4IFEA 2D2EA 4LWZA 4C0AC 2DFTA 1W1WA 2H17A 1EWRA 2NGRA 4IVRA 2N42A 3SQWA 1XJCA 1NKSA 1XF9A 4JL5A 1M74A 3JVVA 2FWRA 2ZRLA 3VKHA 5B30A 3QKSB 1U81A 2WJVA 3LV8A 3LX8A 3OIWA 4RY2A 2WWIA 5JWHA 4OYHA 2YHSA 2YWFA 3QXHA 5EP3A 5FOTA 4FXPA 4BRWA 3A4NA 5BN4A 1LNZA 4S2EA 4DLWA 4F93B 1NBME 2RGGA 3LW7A 3RWOA 4AK9A 3E1SA 2QGZA 4N0DA 3B13B 3KX2A 2G0TA 4JSTA 2O8EA 1YRAA 1DE0A 5JRZA 1W0KD 2UVQA 3BRWD 4P4TA 5AR1A 2NMVA 1KYIA 2J0VA 1VPLA 1XP8A 3B78A 2IYTA 1QHIA 4BEBA 2EQBA 2Q3MA 4RD3A 2GXAA 3IIMA 3TIFA 2HYIC 5KPJA 1MO3A 2ZTSA 1E2LA 3KUDA 2BOVA 3IUYA 5AUNB 5TARA 2D7DA 2FPLA 1E1QD 2J7PD 4NTZA 3EASA 1O87A 4CEHA 3OFND 2R62A 3QY0A 5E7MA 5GJCA 2AD5A 1UBGA 3ZJYA 1TEVA 2X77A 4C0QC 1E32A 5HKKA 2O8DA 3IKJA 1WCV1 1HURA 1WA5A 5DGXA 2ERXA 4PHFA 4LI0A 5TDHA 5LD2C 3MFYA 5EP2A 3PXGA 2Z83A 3E2IA 2EFGA 1PVOA 2JASA 4A92A 1U8ZA 3BERA 3LW8A 3EC1A 5J47A 3KTAB 2BMEA 3NWJA 2RGDA 2C9OA 4YMSA 4ZCIA 5AUOB 3WMEA 2CK3D 1E1QA 3K0CC 2V1UA 3VX4A 3TAUA 3DL0A 2F55A 3VX3A 2JLQA 4CEIA 4UXHA 4HDCA 2YOGA 4IDOA 1ZW6A 2OAP1 4MRPA 4W7SA 1G19A 1NN5A 2BJWA 3Q85A 2ZRIA 1PJRA 4FWTA 4OI0A 2VQSA 4LBYA 1DO0A 5DHFA 2BKEA 3ZVLA 1TQ6A 3FMOB 2V8OA 2O8FB 1XD2B 5AJYA 3UIEA 4TQ9A 3TH5A 3ND9A 1E9FA 4PZYA 1A2KC 1E2GA 3IQWA 4P32A 1GKYA 2QAGC 1DO2A 1KI1A 1XTIA 2R6AA 2O0JA 4DSUA 1GVNB 2ONJA 4A0HA 3B1ZA 2O8FA 4TYYA 5TVKA 1ZD8A 3KUCA 1U9IA 4P4SB 1ANKA 1T9HA 1UKEA 3W5JA 2HEIA 5KDLA 1L2TA 3SOPA 4HZUB 2WOOA 2F1JA 1U0LA 4WZAE 2ZE5A 5CM9C 3ZS9A 3H1TA 5HCNA 4CT4B 3R9IA 2OXCA 2Z43A 3C41J 3Q7PA 4HLUA 3NC1C 2B6HA 1G8HA 1JQLB 2PT5A 3ZIAA 1RIFA 5HR5A 1M34E 4ACAA 3T34A 2PJZA 2CLCX 1KK2A 2QAGB 5GADl 1GWNA 4N0EA 4JLNA 3L82B 1FOEB 3OAAD 2O5VA 2QEQA 1NBMA 1IXZA 1T5IA 2D62A 3QG1A 4URWR 3ZIAD 2V54A 2WJYA 4U00A 1AQUA 4Z8YA 2JLYA 4CEJB 2R44A 4QC2A 3MG9A 1VG0B 5EZ6B 5DH9A 3ICQB 1YZQA 3U2QA 4B73A 4EFMA 4E03A 2WWHA 3KKPA 3AVYA 3ZYCA 1JI0A 2AD1A 4URZR 5JSZA 4DDTA 4JVLA 1DS6A 1ZAKA 2GF0A 3GJ6A 3OIUA 3PEUA 2ERYA 1ZM7A 4KFSA 4M2LA 2H16A 2G1KA 1Z2CA 5FPYA 3SU8A 3VQTA 3K9GA 4RD4A 4DKXA 1IHUA 4FINA 1M6NA 1ELOA 4EPRA 1YZGA 1XBTA 1E99A 5KSPA 3LVQE 3FHTA 2ZSDA 2Q9BA 1QHSA 5FOVA 2X2EA 1S0UA 4X8HA 2O8CA 3FPAA 4AKGA 4DHEA 1M7BA 3VU9B 1UFQA 2HDNB 3HYRA 4FWIB 4EKDA 2O8BA 2P6UA 2WV9A 1DG3A 2BBSA 4G5RA 4QBGB 1OIWA 4DUGA 2V3CC 3IO5A 4BGDA 1G4AE 3SI7A 5JHHB 4RJLA 1VHLA 1SVWA 2JATA 1U8AA 1CULC 2CLSA 2JIZA 3CRQA 4YDSA 3THXA 1MOZA 2ZSAA 3BE4A 1N5JA 2C8VA 1YZUA 2G9NA 1BYUA 3T12A 4M1MA 3THWB 1I4LD 3C4JA 1VKJA 2GCNA 1GFIA 1DPFA 2FN4A 1NIPA 3FKSD 5E7IA 1G17A 3AGPA 4ARZA 2IEZA 1FQJA 3K9HA 2JLVA 1ZM9A 4LYHA 4NHOA 3F0TA 3K70D 4C4PA 1ZU5A 4BFWA 4QL3A 4UXIA 3B1WA 4JVSB 3RS4A 2FPKA 4DCTA 1E79D 2N1BA 5J4KA 2ZRGA 2O8BB 4NL4H 1XCGB 3PENA 3W6OA 2ATVA 2F1IA 5J4VA 4UNPA 2AN9A 2H8KA 1G16A 3J81k 2AFHE 1Z6AA 2ZJOA 3WBJA 1E9RA 4A0FA 3DMNA 1E9AA 3PUZA 5AUQA 1P60A 1UPTA 4FW9A 4XH9B 4D4LA 1HE1C 5LDDC 2AK2A 4XD7D 4F4IA 5FUXA 4URVR 4QJ5A 3GFTA 4I99A 1JXOA 1ZU4A 3WYFA 4Q19A 4WAUA 3LBIA 5K8UA 3REFA 3QEOA 3CX6A 1KO8A 1CEEA 4LV5B 2A2ZA 1TAGA 3SBDA 4U5XA 3KDSE 4I81A 2B8WA 4LPKA 1M2OB 4R9UC 4TTRA 4WIAA 2DBYA 1SVKA 2B92A 3TQCA 3DOEA 3W8RA 4AYWA 4OQNA 5EUQB 1XEXB 2QORA 1JJVA 2KWIA 4UNRA 5CK5A 4D26A 1P9NA 2ZSBA 5EQTA 4TL8A 2ZROA 4KFRA 3O8CA 5FBQB 2XTMA 2QRNA 2QSZA 2VRWA 4FMCB 1VTKA 4UNQA 5EE5B 2XITA 5UKDA 4RKFA 2GNOA 4R2IA 4CW7A 3U4QA 2X8AA 1R0XA 3B2EA 4FMBB 4XOIA 4A36A 3WXMA 1NSTA 4CVNA 4IJMA 1W5SA 5CJPA 2O8CB 4FCVA 1JR6A 3TJZA 1IBRA 5M04A 1Z2AA 4M1YA 2IL1A 4IDQA 1W46A 3SR0A 2P0EA 3C5HA 2BMJA 5CJ2A 1SKQA 3GLFE 3OEED 2B7CA 4XVQA 4B2PA 3LXXA 1GRQA 1YZTA 5EE9A 2IT1A 2R6DA 5JWRA 5KSZA 4QGHA 1G6HA 2WSMA 3I5YA 1W36B 1XMJA 1IY2A 4B35A 4B44A 3GLFB 3UK6A 4V02A 3ADCA 3DKPA 4Q02A 4MDFA 4CF7A 2JCSA 4EUNA 3U7GA 3A4MA 2W00A 2ZI3A 1CTQA 2W58A 5BW8A 4WXPA 3AKYA 2FMXA 1O3YA 4FI3C 1F6BA 2BMDA 1XCMA 1Z0DA 5JSZB 3ZQJA 1AKEA 1R5NA 4OHZA 1JECA 1W2HA 2A30A 2O8EB 1UBCA 1TF5A 4NCKA 1ZP6A 3EZ6A 3QE0A 1OH8A 1Q1EA 2A5DA 5CDFE 4P0TA 1L7VC 3TUIC 1IN5A 2B7BA 4DIEA 4B43A 2RGNC 1NY6A 2OFXA 2NQ2C 2YOHA 2GZHA 3BGWA 1ZD1A 4EDHA 2ZRFA 1KI7A 1EFRA 1H8HA 1Q1BA 3RSLA 3CRRA 2VL7A 3SHWA 1D2EA 2OLKA 3IIJA 3THYA 5F9FA 3C15C 3GLGA 1KSHA 1WBDA 4AY2A 3PVSA 1EX7A 4AKHA 1MABA 4DJTA 3ADBA 5HZHA 1WF3A 2CL0X 1RRPA 1V43A 3K70C 4NONA 4MITA 5KTYA 1R10A 2R6GA 2ODBA 4RFSB 4RZ2A 4DLVA 1ESMA 1AS3A 2ZR9A 5JBQA 1XU4A 4Q9HA 3RVBA 2GAOA 1II8A 2ZJBA 4DC9A 1N6LA 1S96A 2GVDC 2BDTA 2YYZA 5SZIA 1F2UB 4OK6A 3KTAA 5L3RA 2D7CA 1DAMA 1ZNWA 4OKSA 5P21A 4B3CA 1II8B 1E98A 3TSOA 2GHIA 1E3MA 1E0KA 1Q3TA 2GAAA 5B57C 1KK0A 1U98A 4R71A 5C18A 1L4YA 4NYJR 4EPVA 1AA9A 2VP2A 3MWJA 1XTSA 4Q4AB 1IY0A 2Q9CA 2JJ1A 2FGKA 4LHXA 4M53A 4BECA 3I72A 3GLGB 5HPYB 3BBPA 1RRFA 3Q3JB 4HUQA 1NY5A 1R5OA 3W34A 4EPXA 3AF3A 3T1OA 3AVPA 3W3AA 3QQ5A 5AJXA 3CH5A 1XEWY 2J0UA 4KODA 5HE9A 4ZDJA 4LY6A 2PZFA 2XJ4A 4DVGA 4TQAA 3WBKA 1GRRA 1R2QA 4PQYA 2JLSA 3SYLA 3MMPA 1SZPA 1SXJA 2CDNA 2Q0HA 1RZ3A 4PC1A 1P5ZB 4HZUA 5DISB 3I3SR 3DEFA 2FEMA 2YJTD 4RZUA 3LO5A 3SE0A 1KI6A 3CF0A 1E1RA 3DOFA 4LYJA 4LZZA 1P9WA 1KNQA 3OIVA 5EZ5A 5J4LA 2P6RA 4CEJA 4B3DA 1E96A 2DFLA 3KJGA 3K0FB 5AUPB 1J70A 1ZINA 4TMZA 3ADKA 4XWOA 1FP6A 4M1TA 2B21A 4Q47A 4PZZA 2NO1A 3M6AA 3PCRB 4HAXA 4ABYA 1D6JA 1GDDA 3GJ3A 1GZSA 2OFWA 3RS0A 3H2YA 3I62A 3U7EB 4MRSA 2F43B 4HAWA 2F3RA 1DAFA 2CCKA 4QGAA 1OFHA 2EFEB 2ZRCA 4D6PA 4BLPA 4GI7A 1F2TB 4KV9A 1UBFA 4TT3A 1X8JA 4PAQA 1R5BA 4B74A 1GRNA 3KQLA 1ZNZA 1G8YA 3LAWA 1RC8A 4PPFA 5DO9A 2Z4RA 4IVQA 1S3GA 1VG8A 3ZZUA 2ZVQX 3H84A 5CYPA 3GLGE 4D81A 3KQHA 1A82A 3CX8A 4GNKA 3PJRA 3ZD6A 3AGQA 3PUYA 4JLVA 3RYTC 1XWIA 1PUJA 3GQBA 1RJ9B 5DIFA 1TTTA 5LBIA 2RGEA 1T3SA 4V0OA 1D9ZA 1MRNA 2ZI6A 3IEVA 3TMKA 4OQFA 2FSHA 4LX0A 4RD0A 3QI2A 2GTPA 4DDVA 2QBYB 5JI2E 2JEOA 2XTZA 3U3JA 2X2FA 4QGGA 3M1IA 4US2R 3PUWA 4LRWA 1G4UR 2WWFA 1W0JD 2D74A 4M1SA 3TGPA 2ZE8A 4QNRA 4XTCS 2W0MA 1OXVA 3GLIE 3QPWA 3K0SA 4A8JB 1Y63A 3KJHA 2CE7A 3TLXA 3JVUA 4ZKEA 1V5WA 3UANA 1JAHA 3AVWA 2ZI5A 5EXXA 2CK3A 2RCNA 4AKEA 4Q4HA 4A2WA 1OHHA 1A1VA 3LWNA 2DB3A 2XNSA 2XOKA 2BBOA 1IM2A 2AXNA 3AVTA 1FW6A 2FX3A 3O8BA 3UG6A 1S9HA 3DPUA 2IYXA 4ASUA 4UXJA 3T1QA 3PEYA 4GL2A 2BCJQ 3FMFA 3BC1A 3GJXC 1UM8A 3UG7A 3CO5A 3AB3A 3GEIA 1QDEA 3NKVA 2BM1A 2GXQA 2KBFA 4DLYA 2C96A 1U0JA 3U4QB 5G41A 3BIFA 4BQSA 3RABA 1DADA 3QOFA 4Q1CA 4OI1A 4IOLA 2CHVA 2RGAA 2VSOA 2VF8A 1EFHA 3W90A 2IC5A 4IDHA 3PR1A 1MKYA 4BLTA 4Q21A 4PO9A 5KSYA 1KK1A 3SHFA 3MJRA 1QRAA 4Q48A 4A0RA 2ZRBA 3DZDA 4JLAA 5G53C 2DCUA 3TBKA 3ZVRA 2DWOA 3LNCA 1AJEA 4PQFA 2QRZA 4JYBA 1CS4C 2R9VA 1W36D 3BOSA 5BQ5A 4C2TA 4HAZA 4BRUA 3ADDA 5JFGA 1DAKA 3CZPA 3AKCA 1X6VA 4TWZA 3BD9A 3FMPB 1J8YF 2XSZD 1G3QA 4MA4A 3G82C 1ETUA 3ZZ0A 4B75A 2ORVA 4QXAA 2GRJA 3PEVA 4I1VA 3GLHA 2CBZA 4BLRA 3BFVA 1R0ZA 2VA8A 4B34A 2QGNA 1BS1A 5FI1B 5SZJA 3REGA 3VHXA 4WZ6A 1H8EA 4B48A 4DCUA 3TKLA 1ZUIA 1T3HA 2GXSA 3FMIA 4OK3A 4AG6A 4GP6A 4XTRA 2PCJA 1GNRA 2VP0A 5TY0A 1VCOA 3HPQA 2QE7A 3QPUA 1AIPA 5DYGA 1YQTA 3GJ8A 4LC1A 3M0EA 4TYNA 1XCPA 4F91B 2IS4A 1XMIA 4TL9A 3AF0A 4OJQA 4EQ6A 2V7QD 4JS0A 2GCOB 3MSXA 1NNEA 2ATXA 1KKMA 3LY5A 1EESA 1N6HA 3A1SA 3LBNA 3R9XA 4B6FA 1AN0A 3KXIA 3EX7C 3GD7A 1G41A 3QVUA 3U3KA 2L0XA 2GCOA 1Q44A 2YWEA 1N2CE 3KXLA 3QPVA 1YKSA 5E4FA 3DMDA 3QKTA 1HE8B 2IUUA 1IY1A 1KDTA 2PEYA 3QVVA 3Q9LA 2O0KA 5A4JA 4KLNA 3THWA 2WWYA 1CXZA 3EC2A 5FOSA 1UAAA 1RRCA 2KB0A 2PLRA 4U7DA 1HH4A 1KZGB 1UDWA 1ZJ6A 5JHGB 2EVWX 3CKLA 5FBVB 2BKUA 3MWYW 3L43A 1M8PA 2ORWA 1NJFA 2A5FA 2GZDA 2ZJ2A 2QPOA 4JT4A 3VNUA 3B60A 2HUPA 1RVDA 3QKRB 1T91A 3CW2A 1N6OA 1DARA 4XVUA 1G3IA 3EZ7A 1YR6A 1OXXK 4KHZA 5AJZA 2IWHA 4V0ME 3WHKA 5H68A 2PEZA 2R6CA 4PXAA 1Q20A 1KO5A 3VKGA 2XNDD 4K46A 1VCNA 4MGIR 3IIKA 4PC7A 1Z06A 1OIVA 2GJKA 4MKGA 3I5XA 4A4DA 2VO1A 4RD1A 3VR4A 1JALA 4D82A 2P5TB 1OXTA 2F1RA 4PFSA 3HU1A 2YC2C 4DZZA 1COWD 4TLBA 2FFBA 5AK0A 2XZPA 1DVRA 5EXSA 2GEUA 1GL7A 2H5EA 1W0JA 4I4LA 5TB5A 1K8RA 4A15A 2XNDA 5DLQC 2D4HA 3CR7A 4HB4A 5SZHB 1ZNXA 2RKOA 2W6ID 1QHHA 4R98A 4DB4A 3RC8A 4DB2A 1U94A 1KK3A 1T5LA 2IA5A 2A5JA 2KE5A 3R7WA 3RHFA 4TYWA 1KDPA 4DCVA 3S1AA 1AZSC 3EA5A 1E0SA 4EAQA 2HLDD 1J7KA 2GJSA 2QUZA 3KQNA 2F9LA 5KO2A 1QHHB 3R8FA 5FOXA 1OKKD 2GK7A 1E2JA 2QM8A 3PUXA 3N2EA 1G20E 2C99A 4BASA 2OHFA 2CCJA 4L4UA 3NBFA 1VCMA 2O8DB 4YC7A 3LH5A 3T15A 1YE8A 3EZFA 3AKEA 4JLPA 1XPRA 1UJ2A 3W6PA 2WWXA 2NZJA 4LUCA 3TE6A 5LB4A 1KAOA 4JT2A 4B3XA 3HPRA 5JZVA 4LCBA 4TTPA 4I1UA 3RLFA 1KY3A 3GJ0A 4PAOA 2BEKA 1ZC3A 3U44B 4KYIB 2QL6A 1AZTA 4C9BA 4DT1B 4RD6A 4C7OA 3L0PA 4HDOB 4IW3B 1FNMA 1OYWA 3SZRA 2WAXA 3K0AB 3T1VA 5CB8A 2W2VA 4NCJA 3CF6R 2A7QA 2V7QA 1SVOA 2WPDD 2PT7A 1S2MA 3K0EA 1J90A 1RE0A 2WJHA 4JVNA 5E3HA 3UATA 1WDTA 1GNPA 2XTNA 1Z47A 3QENA 4KXFB 4XSGA 521PA 3HYTA 3KB2A 4DDUA 2GK6A 2CHGA 4W9MC 1E4YA 2GJ9A 2HCJB 1T8UA 2NO9A 4W5HA 1XXHA 3AVOA 2J1LA 4Q1EA 3I61A 4D0NA 1GUAA 4QOSA 2JJ1D 1SXJC 2C5LA 5L3SB 1R7RA 1W47A 5FL3A 3HP1A 2BVNA 1N5IA 4KLZA 3SN6A 2ZR7A 4DLUA 2WKPA 2Q9AA 5EXPA 4Q01A 4Q7KA 1C9KA 2FNAA 2A3RA 5C46F 1K5GA 2W83A 1Z0JA 1XX6A 5KDOA 2JGNA 2UKDA 2YWHA 2CE2X 4TMVA 4IDPA 2FEOA 3V00A 3RANA 4A9AA 2LWIA 2ZI7A 2BJVA 2YNMA 1RJ9A 2E87A 1JPNA 3HJNA 2X1VA 1TNDA 4YMUA 2HLDA 1E2IA 1KMHA 3EIQA 2QAJA 3CIOA 3FDIA 2OZEA 4HZIA 2J41A 2ZUCA 3EG5A 3RS3A 4EFNA 2QPAA 1NG9A 1DOAA 1XZQA 2P3SA 3DM5A 2OSBA 1XEFA 4O25A 4EJSC 1TUIA 5J40A 3NHBA 3TSWA 2IS1A 2FGJA 4TLDA 3CLVA 4LJ5A 1XTRA 3QXJA 2QMUA 1W7AA 3KB1A 5JCZA 4OHVA 2ZRPA 2YVUA 4G1UC 2QP3A 3UMRA 1NN3A 3T1TA 1Z5ZA 2QMHA 2GESA 3M4YA 3QKSA 4DRZA 5JECA 3WRXC 3U61B 4FCWA 3WP1B 4IDNA 2IEYA 1TX4B 4LC0A 2ECKA 5E7JA 2PCLA 1M7HA 2HYDA 4BLQA 1TU3A 1WMSA 4DEYA 2PZGA 4XWAA 4HUTA 4FCTA 4XIGS 4GOKA 5CIQA 1P62B 4DLXA 4DIDA 3NIBA 5IHPA 1OB2A 5HTKA 3I32A 1S1MA 3GJ4A 2ZM5A 2MSCB 1NVVR 3VR2A 5J4HA 4TZ6A 3BS4A 2MSDB 3NDBB 4CZ2A 1NKTA 2CHQA 3CF2A 1I2MA 1L8QA 4AI6A 3NH6A 4M4SA 4CGZA 1VIYA 3L0OA 1LFDB 1W48A 4P33A 1QZXA 2IWRA 1ZIPA 2CJWA 5FFMA 2BWJA 4JBXA 4KSCA 1N6KA 5FTKA 2D2FA 3RS2A 2F6RA 4C0HA 4WBSA 3EPLA 1KI4A 3RSOA 2CNWA 4GMXA 1BYIA 4HYYA 2ZJAA 1KJZA 2H7VA 1KIMA 3QIAA 4Q1FA 4I1SA 3GLHE 4M9XA 3PIRA 3U6KA 3ASYA 4D2IA 2J87A 1E4VA 4BZXA 4N3NA 1R4AA 5CLQA 4BLSA 2EYUA 4C0BA 1II9A 4LV8B 2JLXA 5GVRA 1U90A 1G7RA 2QZ4A 4PC3A 2R8RA 3TUJC 2VF7A 3OIYA 2GJAA 3RC3A 1VDZA 2VPPA 5DI9A 1KI3A 3N2IA 4JIMA 4BFSA 4FMCF 1D8TA 3FOZA 2CNWD 1T8TA 1ZM2A 1FMLA 2EWWA 5FTMA 3QNUA 2IYSA 2FF7A 1P2TA 4NBSA 1P2SA 3U7FB 1NVUQ 2C98A 4C30A 3X1YA 2XGJA 4ZDWA 3A1VA 2QY9A 2QI9C 1G8FA 1NSFA 4OQMA 4PHTA 2OESA 3CWQA 3LX5A 1Z6XA 4EPYA 4IOJA 4D4MA 1GAJA 1RYFA 3VR5A 1Z6YA 1SQ5A 1K6MA 3I4LA 621PA 5DI3A 4TLEA 1CR1A 1Z83A 2J9RA 3IBYA 2ZIAA 2ZE6A 3B9PA 2J59A 3CRMA 2OUKA 2EWVA 4K81B 4UQOA 4OL0A 1OT3A 1BMFD 1T6NA 1Z0AA 5CLLA 1PV4A 2OAQ1 4IOMA 4XD7A 5H8WA 2ZRKA 5SZKB 1DBSA 2P5SA 1AS2A 2NO0A 3WY9A 5FH9A 1NRJB 3JZMA 4JLJA 3EPJA 1FTNA 4LHZA 1HT1E 4MKIA 2V6JA 1E94E 2E9SA 4Q9IA 4YMWA 2PJRA 1N0WA 2GILA 2JJ8A 1ONBA 2NIPA 3T35A 5CITA 1ZUNB 2WMOB 1LVGA 1OLOA 2XOKD 3FFBA 3NHAA 4TMTA 4ZIRB 4L8GA 1NN1A 1W4CA 2QQ0A 1OE0A 3HDTA 3WNBA 4CDGA 5F9HA 5A5GA 5G40A 1HEIA 3ND8A 4HAVA 1ZCAA 2OILA 1VYTA 5G3YA 3SJCA 5IT5A 4ZIRA 1R8SA 2EFCB 4TN1A 1J2JA 2VEDA 2DPXA 3A4LA 1VHTA 1KSJA 4PC2A 3OZXA 1IN8A 5FBLB 3ZD7A 2HT1A 4M9QA 2OCAA 3WYGA 5IK2A 2QM7A 3C14C 4M21A 3NEYA 3BAFA 4DDWA 3HWSA 5EP4A 5K8TA 4NYIR 4EJSA 1DAIA 1G7TA 4HLUC 2QROA 2WVJA 1CU1A 2V6IA 3UPUA 2WJGA 4TT3D 2IX3A 5F98A 5AWFC 2RB4A 3ASZA 3TSZA 4FMDF 3RDPA 1G5TA 3R20A 1BMFA 4QM6A 1Q22A 1ZNYA 1RYHA 4Q18A 2AKYA 4AYTA 4UKDA 5B64A 4QRHA 4XJXA 1AK2A 2XEXA 2QQEA 3KFVA 1AKYA 4ZO4A 3WMGA 4YXWD 1PLJA 3IO3A 2VYFA 5EJEA 1CR4A 5L3QA 4O2RA 4HB2A 1UADA 5KSOA 4KBFA 4OBEA 1NN0A 4IVPA 4GRAA 2OG2A 2A5GA 4B6EA 3EWAA 4V0NA 2ONKA 2EFHB 5JS7A 2WIBA 4GZLA 1GITA 1NVXQ 1N6RA 3I1FA 3PV0A 1UDXA 2A5YB 2VBCA 3BWDD 2ZI4A 1LB1B 1Z0IA 5CB6A 4A0GA 4MUBA 2ZS8A 4KAXA 4PPQA 1XTQA 2J45A 2UZIR 4POAA 3W9YA 5KHOC 3NTUA 2R2AA 2IXFA 5FPSA 4WW0A 2WSSA 1P61B 2VHUA 1KMHB 1N0UA 1G8PA 5D3QA 2ZJZA 1HQYE 1Z22A 2BCGY 3IHWA 3FB4A 3VMFA 3CRW1 2FSIA 1VYVA 2PLFA 1P6XA 4HLDA 1Q0UA 1ZVQA 4LGMA 1XDBA 1NG1A 4LJAA 4LYAA 4TMWA 5CK4A 4B2LA 2D06A 1KZ7B 4LPSA 4OQXA 3B7GA 2BM0A 4PHHA 4ZV4A 5FUYA 2WSSD 3TVDA 2WPDA 1JR3A 1YRBA 2ANBA 4MUAA 5L3QB 3TW4A 1TEXA 1KY2A 3LDAA 4GPTA 3QXSA 2OT3B 1XPUA 2DWQA 1NIJA 1UKYA 3THOA 2CVHA 1OFIA 2ZITA 1MO6A 3I8XA 1YJ5A 1S1CA 2QTHA 2XAUA 3IGFA 4L15A 3FVQA 3PITA 3AF2A 4LV6A 5KNDA 2JLWA 4US1R 4KO8A 1IJEA 1P4SA 4MYUA 4LBZA 4S35A 3BFKA 2W0SA 1TL7C 4G5QA 2K5UA 3AUXA 5L3VA 3GLHB 3EPKA 4NMMA 4QJ4A 4ZCLA 1MH1A 4EFLA 3QSYA 2XB2A 5FOWA 4GOJA 4DWJA 3B5JA 3DZ8A 3B6EA 3ZH9B 3RNLA 2IYQA 3AVUA 1HT2E 3C5CA 3QG5A 3GP8A 3B8HA 4ZCMA 1XMVA 5B58C 2EYQA 2QG6A 2W2TA 1UEJA 4MYHA 3VHLB 1GP2A 1Z0KA 1TU4A 4LHVA 421PA 1VG1A 5BN5A 2QMEA 1PZNA 2G83A 5JEEA 5JS8A 3CPEA 3K70B 3L8YA 1WXQA 3RS5A 5HKKD 3ZVNA 1F60A 1TUEA 2VP6A 2NPIA 4HSEA 3KQKA 1D5CA 4BFUA 1YZLA 3N5CA 2E1RA 1QHXA 2SHKA 2ZYUX 4WVFA 3P32A 3FYHA 2FG5A 5GJWC 2NO6A 1Z0FA 4LJ7A 2H92A 1A4RA 1FZQA 1JEDA 3SFZA 1MT0A 5LB2A 2V4ZA 1CJKC 3BB4A 3IPYA 2FDCA 3MWKA 3AF1A 3IQXA 2HT6A 1QHGA 2CCGA 1N6PA 4Q5IA 3W8NA 3MWLA 2ZE7A 1MR3F 3KXKA 1KI8A 3CNOA 1OH5A 4M9ZA 1CJMA 1HUQA 2C2HA 821PA 3OHMA 1VIAA 2V55B 2QTVB 3CZQA 2WJJA 3O8DA 2VTKA 3WNDA 4B76A 2QT0A 3FHCB 1IXSB 2IYVA 4KJZA 4Q03A 4ZI3A 4GZMA 5KU1A 4OJKA 2G1JA 4HI0E 5H70A 3VR1A 4PSKA 3ICEA 3CONA 3CH4B 3EZ2A 4C3ZA 1J8MF 1LF5A 4IEIA 3U60B 3NEJA 4D25A 1F5NA 3EXAA 1OW3B 3C8UA 3CPHA 4RSGA 3AQ4A 1E2FA 1T0HB 3X1ZA 4RZXA 2J0SA 3DDCA 1Z3IX 3DM9B 3MRSA 1JAIA 4TSFA 1AM4D 4IOKA 5A0FA 5C4MA 1IOZA 4IXNA 3AH8A 2WKQA 1G3UA 1UKVY 4F92B 1SHZA 3BFXA 4KU4A 4E07A 4QBIA 2BEJA 4NYMR 2ZRHA 3A58B 4Y0VA 4AC9A 2FV8A 4M8NE 2QA5A 1XD2A 4P4SA 2AK3A 2MMCA 4K8OA 5KPDA 2OE2A 2DFNA 2ODNA 5FR2A 5FL7D 5FTLA 1NVVQ 3QF7A 4TLAA 4US0R 5FPTA 4D0LB 1H8ED 1Q3HA 2NG1A 4L5BA 2GJ8A 4UNNA 2IYRA 1KHTA 3QKRA 1CF4A 1RPZA 4UJ5A 3SJBA 3TW8B 4LJ8A 5AJWA 2QSYA 2BC9A 4AG5A 2FOLA 2MSEB 5L8VA 5BN3A 4UJ3A 2I1QA 1N6NA 1LS1A 2RH5A 1QHYA 4EQ6B 1SVMA 2GVZC 1BH2A 2IF2A 2VHCA 2WZQA 4TMKA 4DLRA 4NE2A 2I1VB 4D0GA 3GLFA 2FPMA 2ZR0A 3RWMB 2UZ3A 4PSVA 4JL6A 4Q4LA 5DYIA 2AXPA 1ZUHA 2JJ2D 1U0HC 1TPZA 1SKYE 1MO4A 1Y3AA 3QUSA 3SYNA 6Q21A 3AP2A 4PC6A 1ZRHA 4B47A 2YKGA 3UWOA 2J3EA 3SYKA 2MMGA 5CIWA 2QP4A 1RFLA 1QG2A 2V9PA 1R8QA 1JB1A 2Y8EA 4O0MA 2NOAA 3CNNA 1T3LA 1ZM4A 2VIIA 3BXZA 1KTVA 1YZKA 1U2RA 3AKDA 2GZAA 2PMKA 2Z4SA 4GBMA 3A36A 5HE8A 2HV8A 3AUYA 1FTSA 5J4YA 4LBWA 3RAPR 3AVQA 4QHSA 2GA8A 2IUTA 1YVDA
chains in the Genus database with same CATH superfamily
3IP9A 1BDBA 3E3MA 4WK0B 3WNCA 4L0CA 5CD1A 3MHTA 1ZN8A 1GTRA 4ZEOA 3GFOA 4QATA 1AD2A 3AT1A 1MOQA 1FUUA 3GNTA 3IT2A 4NY1A 1NP6A 2R7LA 4QDTA 4UVGA 2QTFA 1GCIA 3SFVA 4KBYA 4A3SA 1N0VC 2PD6A 3KALA 1GPJA 1VIVA 1F4PA 3MJVA 1FNSA 1EFRD 2HBZA 1DJLA 5DT2A 3L8FA 1PG5A 3X0DA 1U3GA 1VB3A 3CBQA 5H4GA 3IR6A 1JT2A 3BF7A 1QHNA 1FFDA 3MJHA 2HGZA 2GN1A 4BWYA 2Q5CA 5BYJA 4WECA 5DTIA 2ZPTX 3RRMA 1IBKB 1C3OB 1Z2DA 4H7FA 2OCGA 5I8PA 1TE2A 2QX8A 1UEIA 1CRWG 4ZA2A 3SQXA 4ZC1A 4N0MA 2XR1A 2D54A 1H2FA 3QLVA 1W5TA 4K6HA 5ETJA 3UICA 1OUMA 4LOJA 2OPHA 1J2YA 3IUEA 4J1SA 1PR5A 4EI7A 2Z6QA 1AG9A 1VL0A 4WA7A 1NDUA 4MAMA 4JVMA 4KWCA 2IYLD 4GEKA 2H3HA 1U0EA 1PFWA 5JNLA 3W3ZB 2GO7A 3CZCA 4KI0A 1K7CA 3ECSA 1F8UA 4DTIA 1OPXA 2WI8A 4I9NA 4RKRA 4LY9A 4PONA 1PO7A 4EX6A 5C7OO 1T10A 2XF2A 3GRKA 1KDRA 2NQTA 4NU0A 4Q4JA 3NHYA 2NU6B 1R6BX 1YAJA 3NX4A 4QBFA 3VOSA 3TWOA 1Y5IA 4F5YA 1JQBA 4UCWA 3HN2A 3OCWA 4RM3A 2F3PA 1RLTA 4EA7A 5F3DA 3ZHBA 2J0EA 2ZU0C 4HS4A 4A82A 4AMUA 1NLFA 3LPDA 4AD8A 4NI5A 1VMAA 5GOTA 1ODIA 2H5JA 1BGVA 4X8OA 3IAXA 4ZO9A 3UJ8A 1Z62A 4ZI7B 2PY6A 3W8FA 2EARA 5EE1A 1IJFA 4QRDA 1N2CA 1ZOPA 2JKZA 2O3UA 2AKAB 2P9BA 2VPQA 2QG4A 2YHBA 3P9PA 4TKVB 2XUGA 3TZBA 1E0AA 4KI7A 3L18A 3U7JA 4BZQA 1T9CA 1X7WB 2DSTA 3GG2A 3HNOA 3L0SA 1O6BA 4QJ3A 1UDRA 4DCSA 1V35A 4UTXA 1E69A 1XMSA 3JQ9C 4GWKA 4Y6GB 1CUSA 4BNNA 5IJZA 4DV6B 1ZQ9A 3U13A 1BWQA 1DL5A 4ENVA 2QUAA 2ISCA 4UUOA 2WZCA 4X1OA 2P9EA 4FMDB 4S1TA 1K97A 3KJXA 4BAUA 3MYRA 2GSDA 4NJOA 4ZPJA 1FFXB 4MVCA 5FULA 3NHJA 1Z63A 3Q0EA 2GDJA 2WWWA 4Q3CA 2FQXA 4G37A 2ZI9A 4E30A 1W76A 5CH5A 4HATA 3FA2A 4DDKA 4L75A 3CB4A 4QXPA 3U3DA 1FSSA 4DLLA 1ONPA 2C77A 1AKRA 2GARA 2PX3A 3P9RA 4IL5A 7ABPA 1EX6A 1W36D 2V0GA 3EISA 1R6UA 3PHHA 3NDJA 2OV2A 1BW9B 4R2XA 2OCBA 3JVDA 4CR7A 1KOFA 1L4UA 1NV8A 1WE2A 1G66A 2YFKA 3EAQA 3R23A 1RR6A 4YO8A 3IMFA 2ZIFA 4DSOA 2F8TA 1EFLA 4CN9A 2VNIA 5FBKA 4IMIB 1P3JA 3QYAA 4MKZA 4UTZA 2XMCA 3WFZA 1U3UA 3ROTA 2M32A 3BJIC 2RARA 3B2QA 1LS6A 2C4NA 1DAEA 4RH1A 1WUHS 3P71T 3QLTA 2YY6A 5DHAA 1RHKA 1M5UA 1ZIXA 4C2BA 2KBEA 3WB1A 3ELUA 3NC0C 3PC8A 4BO5A 5D1NA 1MDBA 4PR0A 5G3ZA 2GBLA 1IVYA 4BAGA 3COJA 1TFUA 4HB3A 1ESNA 4BNDB 4MMZB 1R4MA 1XWWA 1ZK1A 1TCBA 3F74A 3JALB 3T7KA 4Q9JA 3D2BA 5JISA 1Y1QA 2PLNA 5D51S 2Y68A 3EN0A 2CFTA 1Z75A 1B6TA 3K0BA 4QA9A 1YKFA 3RC1A 3WGQA 3MWDA 1FDWA 4UBIA 4YO7A 2QSUA 1F12A 3TR6A 3VRHA 4B6RA 3LRPA 4B3FX 1CIJA 2VUHB 2VSXA 2SKDA 3KYJB 3G2IA 3E7XA 1XTUA 4MUYA 4RHUA 3NGMA 4JOCA 1YR9A 4M0MA 3H17A 3A10A 4O2LA 4BPRA 4TSKA 1YZ3A 3CURA 4XYLA 3MB5A 2DHRA 1LBSA 1NI3A 1LQTA 2H4HA 3E8MA 3CZAA 5FIUA 4PYJA 3LVBA 3V46A 4B32A 4TWBA 3I2KA 3JQ7A 1SG6A 3P9NA 4WFIA 1W29A 4RH3A 3OTOB 2WD7B 1DG1G 4Q6WA 3D1JA 3M89A 2FUNB 3O82A 3QI7A 1ISPA 3R4VA 4FLEA 3BZWA 4H4DA 1ZISA 5CAEB 4KQKA 5GVSA 2I91A 3ECCA 4FMPA 4PQRA 3CVJA 4LVOA 3LL7A 4KAFA 4I50F 4CU5A 2B4RO 3MLEA 3B5EA 1PJAA 4GM0A 1US8B 3ZDAA 4FJ1A 1P9LA 5IULC 3LSTA 3ZLTA 1G20B 1UKZA 4K3VA 5K4GA 4RJIA 2AKEA 5L53A 1UPFA 1EFTA 1R27A 4LSGA 3YASA 2I2AA 4LDPA 5JATA 5LQJA 3OQNA 1NSYA 1FDOA 3KAJA 4YRFA 1OZFA 1BSVA 1QLHA 4NZYA 4WCFB 3I39X 2CY0A 2W2XA 4U6QA 5ANRB 3T5GA 1MHPA 3KEGA 4OHBA 3WBFA 1IWPB 1JKJA 4JC4A 2PQ2A 1C1YA 5ARCA 2JVKA 2H0AA 4EIWA 3ZQKA 4F4DA 3U1VA 1YZNA 5GZ3A 4M1QA 1LJ8A 1T9AA 4R69A 1UXHA 2H2FA 3VYSB 2XD9A 2VK1A 4C5AA 1ESZA 1GKIA 3E48A 4DDHA 3FTFA 2OBYA 1KBZA 1XTZA 2FRXA 2YV2A 1KC3A 1HBJA 4OG2A 4YFYA 4DG5A 1W2WB 2VH5R 3ESYA 3F8WA 4Y2RA 2R7KA 4B6PA 2ZU6A 4GMDA 3UUEA 1HYBA 1PDVA 1XD9A 1TVKA 1DX9A 1EP9A 3BORA 1ATZA 5BR8B 3B9QA 3VR6H 4AJKA 3F9RA 2CF6A 4RNCA 3QW2A 4N82A 1L1EA 3JQRA 4JUBA 4MHOA 4P82A 4WQMA 4TWAA 2XMZA 4C0KA 3HFRA 4QU9A 4R2HA 3ZDQA 1SQGA 1QJCA 1QGDA 1SIBE 2OO7A 2Q5HA 2AJBA 1ICIA 2VHQA 1X7YB 2YZ2A 2FN8A 4FFBB 3JQBA 4Z0HO 2O4UX 4C6TA 3L8ZA 4JJZA 4ZVRA 5TMDA 2Z3VA 1OYYA 4G4GA 4B83A 1OXBB 1KEEA 4LF7B 2I4OA 2OKCA 2C4WA 1DX4A 3P2EA 1QMPA 2GZ3A 3QWBA 3KG2A 4X9XA 4B79A 4R3WA 3QPCA 2QJOA 1WSWA 1HX7A 4DNXA 3VH3A 3L93A 5CHEA 3U39A 1HT3A 2F9FA 1EK1A 5EUBA 5C1DA 1DELA 1G5QA 1IOVA 1U0GA 2VDWA 4NYJQ 4ZXPA 5T3YA 4YRNA 5ADWA 5FRDA 4XM2A 4AZ3A 4MVJD 2QAGA 2JHPA 4Q1DA 3VNUA 3NEPX 1GSOA 3QJYA 4XOUA 5DTEA 1LLQA 1YR8A 2QW8A 2XIQA 3HO6A 2GM9A 4EYQA 3HM9A 4YN3A 5KJCA 2ZYVX 4BJ5A 3AY3A 5ALOA 5F4BA 4ZVLA 3B38A 3TCKA 4NZOA 4ZQIA 4NJMA 1L9KA 3O03A 5BQPA 3RJ9A 3IOYA 5HFAA 5AVYA 1WULS 5K3EA 1FFXA 2E6UX 5DM60 2DBZA 3THYB 2AF4C 2QMQA 1N8KA 1WW2A 2WKRA 1P91A 5EINA 3SY8A 4ZDIA 3EIOA 4PW0A 4D3FA 2IYWA 5A4IS 5KEIA 4F45A 3WLMA 3U09A 2X1LA 3GA5A 5DGIA 1W88B 2X9VA 3K0FA 4YCAA 4JFAA 1ZY2A 1M7GA 5C37A 1M0TA 1DEKA 3VU9A 1T1RA 1IDOA 1VRWA 2V7TA 4EYOA 1EUDB 4UC0A 4JI5B 2IY8A 3G79A 4IKPA 3AC0A 1GPMA 4OP2A 2DY1A 2XZLA 3HBNA 4PTZA 2FLVA 1H1LA 4RV9A 3GXOA 1Q77A 1LY1A 4KTTE 4LVUA 5I7SA 1JWLA 2YRXA 1G6OA 2W43A 2WA2A 2X6QA 4R31A 4E08A 1W49A 4RVUA 3C74A 3GRAA 3DDZX 1OLSA 4JDPA 3ROFA 1FYXA 1LLCA 4IKOA 4ECAA 4PZLA 4M54A 3ZTTA 2BTQB 4KNWA 2AVDA 3GJ7A 3L05A 3VAZA 2ZREA 2VAVA 2GTHA 1YMQA 5GY7A 4HF7A 4V1CA 1EP3B 2HA3A 5GJVC 4I5DA 1U7HA 1ABBA 1DAGA 1G6Q1 1H5QA 1HMPA 3K9NA 4FYIA 5FTJA 3HKCB 5B53A 4L07A 1IHXA 2BFPA 3O3MB 4HGZA 2HWUA 1P0MA 2OGZA 2WFMA 3AUSA 3H8SA 3IQGX 3PUIA 4ZVOA 1M1NA 2XDQA 2IU4A 3KKNA 4IJUA 4MYCA 1AO3A 2VP5A 3CUTA 4CM5A 1EZ4A 2I7DA 4RABA 2AWNA 1P3DA 4H59A 3UMYA 2WM3A 1O89A 1PK7A 4C0JA 1F5SA 3OLXA 1QIMA 2VDUE 3GBPA 4YCSA 1C9YA 2I3BA 3DO8A 2QX6A 5BVHA 1NJGA 4KG7A 4E15A 1Q0TA 3K5HA 2VRNA 3TTTA 4FS3A 3WHPA 3L2OB 3G0GA 2YMPA 1RACA 1U2SA 3FBWA 4RACA 5E4TA 4TS9A 2HIGA 4KWTA 3Q7IA 4ZKDA 1RQXA 3RI3A 4AUEA 2FFAA 5B5SA 3PJGA 2A78A 3VYTB 5DJ5A 5CDFA 1V95A 1GZHB 4KXQA 4LRYA 1BHSA 3DJYA 5T5QA 2BBTA 3T5MA 3WVNA 2Z4TA 2PSJA 4U1RA 3KSBC 3NETA 4NCIA 3K1TA 2A9VA 121PA 1CB7A 4YRIA 3FAKA 4Q7JB 1EE9A 1SNYA 3FVVA 1UWKA 2H29A 1XDDA 5DNYB 1UL1X 3OQHA 3JQ8A 2C2GA 2ZS9A 2BF4A 3V4FA 2EWMA 3UT0A 4GC9A 2ZWMA 3BMOA 4YCMA 3PC4A 5TR9A 3SDZA 2Q0SA 3PQ5A 2QENA 1DHRA 1QMGA 1CJTC 1WXWA 1ZGCA 2ZIZA 2GF9A 2FWAA 1V1RA 4ZPXA 1MMFB 2W4MA 1HG0A 4HXEB 1DQNA 2HF9A 4OMFG 3U16A 2VAMA 1RCUA 1Y9DA 1ZL2A 4PIMA 4RIFA 5ENZA 1P3Y1 3VNRA 4QGSA 5FUQA 3FTNA 4MI3A 5DRTA 1XKTA 3DO6A 3BQNB 3CNEA 1FRFS 1CC1S 1GL9B 2D2VA 2EDCA 2EKBA 2PRIA 4IG4A 4QGFA 3UOGA 3WK8A 2XVXA 4DV1B 1N9GB 1U31A 2J33A 1N34B 4QUHA 4J29A 3WYAA 4I1RA 1S2OA 1CY2A 2C2XA 1KY4A 3NDPA 5TXGA 3R7AA 3WL7A 1UPXA 2B5OA 2B5VA 1GN8A 3C3YA 3QUBA 4UM7A 1QTQA 4G36A 3QBVA 4P4UA 3DKIA 4CI0B 1ICEA 5M7EA 3UF0A 3JQFA 1VFNA 1Z28A 3GN1A 1B15A 4IX1A 4NG4A 4YJ3A 4B4VA 5I9IA 4JFRA 1VPDA 1BWPA 3PHLA 2RGXA 4IPTA 4RCYA 3FTEA 2XJ9A 1GU1A 2KI5A 4LTDA 3MMSA 2ZJ6A 4J16A 1A9YA 1KARA 2OHVA 3MERA 1H2BA 1VE3A 1V71A 2B6NA 4OHPA 4P31A 4ER5A 3QVJA 1I9CA 2ACWA 4N1AA 3WLKX 2PBRA 5JMOA 4D4KA 3ROZA 4DOMA 3OETA 3FUVA 3PGLA 4JT8A 1QANA 1ZRNA 3UXMA 1RKXA 4GPZA 4AULA 3Q72A 1KVUA 4LXYA 2BIFA 3AWIA 5GPBA 4KPFC 1FVHA 4CT5A 2ZUEA 1QH1B 1XVLA 4BP1A 1HQDA 3F8TA 1V2HE 1Z8DA 3QSGA 2YVAA 3TCNA 4CCYB 3CKMA 3VNVA 1S8FA 3RU7A 1P4JA 2GCIA 2VNHA 1UWLA 3PDUA 4Z1MD 1JJAA 1TT5B 2VT2A 4KACA 4ASUD 3OZ7A 1VL2A 3U19A 4X97A 2BI7A 1Z4LA 2H11A 3B7WA 4DUPA 4I6EA 4L5JA 3PUJA 1F1JA 1E7MA 5FYDA 1BEEA 3TUZC 2K7FA 4RKEA 5KVCA 3FTDA 1GZ7A 3TZEA 3SBEA 2VT7A 2DFVA 3HUEA 1TT5A 1ZN9A 3CKYA 5JAQA 3V1MA 3S5UA 1JNYA 4PX3A 4G01B 5BSHA 1GGNA 3ZU3A 1EDZA 3JQ9A 1BHO1 4LDJA 5CDUA 1U3WA 1CKEA 3DEZA 5D3MB 1AF4A 3G2QA 3V8QA 4BPBA 1JG4A 3T5DA 4G5XA 1L4LA 3PGKA 4GL4A 4EA9A 4H7IA 1KJJA 3U62A 3KJIA 4UNSA 2OCYC 3TVTA 3V7YA 5HBGA 4LYYA 3T95A 3LUHA 1UF9A 2RHCA 3PG5A 3GVIA 3NJRA 1HTWA 3O4GA 5IBRA 1RFGE 5IJWA 2WBLC 1BJRE 2R1VA 3WAJA 2Y4OA 3PXDA 2D1TA 3OTGA 4P5PA 4HAYA 2JIRA 2A9RA 1W94A 4KWIA 3CPJB 1YU6A 3A4TA 3FR7A 4L8LA 3SJAA 4LE2A 1MQAA 3K6SA 2IIBA 4Q4AA 5JC1A 1CUWA 3BD8A 2DE0X 2IE0A 3BH7A 4FGZA 3ESAA 1E3SA 1BMDA 1BQEA 3KOMA 1FUEA 1WHTA 1F06A 1LKZA 3PGMA 4WLNA 4A2PA 4MV5A 4AURA 4D8VA 2ZWAA 4I5GA 1EAYA 5BURA 5CVJA 4HP8A 1UK9A 5EPUA 3QJ5A 1GNQA 1GG2A 1JBKA 1WB9A 3OJFA 4FT4A 4ZQFA 3WYCA 3KVVA 5JUWA 9MHTA 1EVZA 3GPBA 2AVNA 4IKEA 1IAQA 2Y1EA 5AJVB 1ULUA 4MR8A 1BWRA 3ZEIA 1SU6A 4LXXA 1G8AA 2X8BA 3QVSA 4YRSA 3BE8A 4C2UA 4C89A 3R74A 1XK7A 2C94A 3A14A 2C4UA 2Q9UA 1DAHA 4PLHA 2VNSA 4DEVA 1G7SA 5TQ2A 4XGQA 3IEKA 5KTKA 4OI2A 1J56A 1LFAA 1XZNA 2FFQA 2KW5A 1RXYA 3BMXA 3ICVA 3EFOA 2JAOA 3OKFA 4YRTA 1H65A 5EWJA 2W9XA 3T06B 4D5EA 4GG1A 1XDUA 1PNRA 3WXBA 4ARUA 1HG1A 3R6WA 4MVJA 4PLFA 5BPFA 4B3GA 2HTEA 5EZSA 3GLIA 2ATCA 4Y1RA 2N3ZA 3OMWA 2HCBA 3A3OA 4LIPD 5JAIA 4JLWA 5DI3B 3X1DA 2Q4BA 2ZYWX 5LDHA 4YUZA 4KFCA 3W7VA 1E5VA 1CIPA 1U6KA 4NCAA 1K5DA 4CFZA 3ZCUA 5U4XA 1FDSA 2XHEA 3ZE1B 4EQZA 1C4XA 1IHOA 2FR1A 3VKWA 2VHJA 3PHCA 1FB5A 3AM5A 2V96A 3OJ0A 2AXEA 2B2XA 2PS3A 2Q5JA 2YHUA 5BWNA 4G2NA 2P6NA 2BFFB 3BK7A 4BVBA 3KZ1E 4H18A 2JA2A 1DV2A 1P7CA 2Q4TA 2VJNA 2Z6VA 3I04M 4OMCA 1CDEA 3HLYA 3Q8XB 5J2TF 3SEAA 5FWAA 4Z4HA 4LOLA 4R2LA 3HVHA 1Y8CA 5EZYF 3SG0A 1XTKA 1QTIA 1JA1A 1JDJA 1V39A 1Y7LA 4MR7A 1WP9A 1QVAA 4OHXA 2O1EA 4CV1A 4G1MB 5JQGB 1Z29A 5K8IA 2FG7C 3GRFA 1CQJB 1P1BA 2FQWA 3OBIA 3LC0A 5FNZA 3QFCA 3EPHA 3U26A 3G88A 5EVCA 3PP8A 2IV7A 4CE6A 5FV7A 4GDMA 1ZX1A 5C2JB 5AVXA 4R68A 5T6BA 3VXKA 3LUJA 5AD1A 2D0OB 3OA2A 3K8QA 4EJ6A 4ZTUB 3VAYA 1T36A 3LX6A 2UV8A 3FLBA 3V1NA 1MH9A 3BJZA 1WABA 1DEOA 2I76A 2I3DA 3PVCA 2BFDB 4HK4A 4P08A 4CMJA 3RYHA 1T5TA 3G2OA 2K87A 3A70A 3EHDA 5CGZA 3A9UA 1GPNA 4PCUA 3NG1A 2PR7A 1HF3A 1PD0A 1XJQA 3P5SA 3TL3A 3IE2A 3I64A 4AMZA 1US8A 4P80A 4W4TA 5D6OA 2HM7A 2F3QA 2BR5A 2R5NA 4LK2A 4F46A 5HHTA 3DEHA 4KIFA 3KR9A 4NR0A 4RY0A 1BO6A 4GP7A 2R8ZA 1RE1A 3WK7A 3EDRA 4X8MA 3SSMA 3E9CA 4P3NA 3HCCA 1G21E 2W6QA 1M67A 1MQ9A 8OHMA 4MQBA 3BWMA 2AG0A 4WY5A 4B2IA 2CMHA 4NABA 4E1VA 1X3LA 4HX5A 1F9AA 4AWAA 4UE3S 4UOQA 2DQZA 4NV3A 2VJKA 3SYTA 1HOXA 4FN5A 5F77A 5FHQA 4MW5A 3ZR4B 3MCTA 4KPUB 1JI3A 3HKBB 1WMEA 4H16A 1V26A 2FI1A 5IVKA 3A7DA 4E5UA 3KELA 2HCRA 2QOEA 2C4HA 1RQRA 2V03A 1PL7A 1BZYA 2WVAA 3EUEA 2E55A 2FMKA 1E2DA 2C04A 4UW9A 2KJQA 5BV0A 3E5RA 1GAWA 3ZW8A 5LMUB 3D3NA 1NF3A 2HCFA 3N07A 4RULA 1E2HA 3K32A 3DKVA 4MYTA 2WM8A 4M76B 4M0UA 1ODKA 3KLBA 2FSGA 4RQUA 2H1RA 3MK31 3Q88A 4YT4A 2HK6A 4QSHA 3ZTYA 4WOCA 5AOVA 2HRZA 2NUAB 3ROQA 5CFOA 5M29A 3V1KA 4I4TB 3D4OA 3B9RA 1K75A 2OOSA 3AR4A 2P65A 1J24A 3GRCA 2QPTA 1FX0A 3QA3E 4H6VA 4WH0A 5DYWA 5EVJA 3QNWA 2NUAA 2QLBA 3CFYA 4LXQA 2B8JA 1WCXA 2YWCA 3AO0B 4NNOA 1G8KA 1KAGA 3SMQA 2YC4C 1SCAA 4KQ6A 3SZLA 3GEEA 5G0VA 2J31A 5AVVA 3WGNA 2VHYA 1B3RA 1NLYA 5JDCA 2UUAB 3NUGA 5AMXA 1W6RA 4MYDA 3RHSA 3UBTA 2AL7A 4UEQA 4YP7A 1PL0A 4RXUA 1UJ6A 2WB4A 4WZBE 4O2AB 1RI1A 3Q9NA 1D6SA 4DPLA 4MHTA 1I01A 2WKWA 2IYUA 3NP9A 5AI5A 4BV8A 4GT1A 5DLPA 5I8WA 5EP1A 2VCEA 3MJCA 2GEFA 3EZXA 3ND7A 4DCGA 1ADBA 2WRZA 3WDLA 2X7JA 1DQPA 1DEAA 4HN2A 4I2VA 3KAPA 4JAVC 2CLFB 1SCKA 4BFTA 1MIOA 4X1KB 4TLCA 4H1TA 4G9EA 4KRYA 2BRUC 2JAQA 5B1SA 4BEWA 3DE6X 4IFEA 2NV2B 2XUZA 2ZT6A 1HMYA 3ZY5A 1LC3A 3IBSA 1EWRA 1LTHR 1MZVA 2G80A 1QBGA 1NKSA 2ZBUA 4AMVA 4D9GA 4WN9A 4GOOD 1I24A 2FWRA 1TZJA 1Q1NA 2ZRLA 4DANA 4ZHQF 1TCCA 3QKSB 5BOSB 2WJVA 3JYLA 1K4YA 3OIWA 1QCDA 4OYHA 3OPNA 4MUFA 2YWFA 2EKLA 4AMBA 5FOTA 1R8XA 4NFYA 2ODPA 2IHTA 1WZCA 1H3NA 4S2EA 4DLWA 4F93B 4R1QA 2JHFA 3T5BA 2WZBA 4AK9A 1A1SA 3CEAA 2HQ1A 2QGZA 4M9UA 3FVTA 2PL1A 1DC3A 2G0TA 3ZGOA 4F5WA 2CFSA 2RI0A 2HU8A 3IHTA 3GO4A 4GECA 1B1CA 5JNVA 1P77A 1JPVA 3VO8A 5G4KB 3BRWD 4I36A 3K2BA 4KO1S 4YP5A 4JI3B 2NMVA 2J0VA 1O94A 4XASA 5ILQA 4AMGA 4BEBA 4M98A 2Q3MA 3PB3A 1B7GO 3IIMA 4C6RA 2HYIC 4IIBA 3V2GA 3JPWA 2CLMB 4LQDA 2ZTSA 1QDLB 1XQ6A 4JWTA 3SXUB 3S2YA 4ZI5A 1BVYF 3D6UA 3HUDA 4P2BA 4RDHA 4EKNB 1UUFA 2BF7A 4F6RA 2O07A 1QIKA 1U02A 4MR7B 2FPPB 1ZGHA 3UOAB 2VJOA 4DY4A 1E1QD 3Q3GE 3EASA 3QMMA 2GCEA 3MWEA 8AT1A 4WLEA 4BNVA 3QM1A 4N3AA 5HFNA 5J3JA 3CG0A 2AD5A 1UBGA 4HRYA 4ZOLA 2X77A 3NHWA 3LT2A 1EUCA 3CC8A 1E59A 1HURA 4X5OA 1M72A 4INZA 4PHFA 1Y5MA 4DCOA 3CLRC 3ABQB 3QK7A 2Z83A 2J4FA 4O0LA 2EFGA 3S1SA 4CXMA 3GAAA 1L7RA 3IIEA 1U8ZA 3S8MA 3BERA 1DT5A 3FPCA 2I3ZA 3T3GA 2F3SA 2JFGA 2PT6A 1J2UA 1ECGA 1WMAA 3KTAB 3BX1A 5J47A 3NWJA 1MC4A 1QFZA 2C9OA 2OHGA 4HNGA 5C1IA 5AUOB 4WD3A 1E1QA 3BWXA 1V9CA 3TTXA 4BMCA 2IU0A 1N2XA 3FIJA 5BRJA 4FFDA 4Z86A 3HQ4O 2NUTB 5T64A 1ZW6A 1JG3A 1EBUA 1KC1A 3I0MA 1V1JA 4WCVA 1TTPB 2IDJA 4RL4A 3ETJA 4MUNA 4UD2A 4OI0A 2XODA 2VA9A 3MAJA 4YRRA 2FEAA 2VQSA 1DO0A 3KETA 3LKBA 3ZVLA 3IQZA 1MGPA 1LV8A 4BKUA 3LVFO 1EFKA 1XD2B 2HY7A 1E5LA 1LJUA 4HC4A 4HDMA 5DM2A 3TKAA 4PBRA 4X62B 1E9FA 1A2KC 1E2GA 3BSSA 3C87A 3ND6A 3F67A 5EJ9A 1GKYA 3WG9A 1DDIA 3UWMA 1O4WA 2R6AA 4H2DA 1RYBA 1UK6A 4B46A 2O8FA 1U2DC 2B9VA 3LGAA 3AJEA 3KUCA 1QIDA 1U9IA 2Q5OA 3IXQA 3NBAA 3CXUA 3R7FA 4CDMA 4ZOQI 3QKIA 5B3KA 1Y82A 3I2JA 2WOOA 2G28A 3SNKA 4WZAE 2ZE5A 1D03A 3ILYA 5CM9C 1NMQA 2FPXA 2OXCA 2J3JA 1O95C 2Z43A 1OC2A 3C41J 3M33A 4P54A 4ISBA 2B6HA 4LYGA 5KAMA 3R0IA 4UTPA 2XCOA 5HR5A 1U4OA 1GUDA 1YBFA 3ZJVA 5AVTA 4KRGA 1KK2A 1XE3A 5DBFA 5GONF 2GX6A 1ULTA 1LVUA 2NVOA 1NFRA 2UVPA 3CE9A 5EOVA 4QUDA 2P75A 2O5VA 3WLLA 4URWR 3M6MD 3ZIAD 1TRHA 1U8EA 3M9WA 4DA9A 1AQUA 2R48A 4IGAA 1X38A 1FBTA 4J3NA 4DQUA 2FF5A 2JLYA 3T4XA 1E7QA 1UM9B 5AW3A 2CUKA 4LDAA 5AW6A 3ICQB 4PM4A 1J1ZA 1JHPA 2AMFA 4LECA 3LT0A 3WYEA 3EDYA 5KC8A 1JI0A 5AM4A 5CU7A 4G5YA 3BXPA 5K3FA 1ZAKA 1DS6A 3AYZB 3G5MA 3GJ6A 5DNAA 4JV5B 2XUOA 4MI9A 1Z2CA 4QLAA 3MELA 3OCZA 5ARDA 5FPYA 4M7OA 1N5OX 2MWMA 1Z45A 4K2HA 4G0XA 1XZDA 3HH8A 4C5BA 3P2IA 3FHTA 2ZSDA 2YICA 2LIVA 3RS8A 1JHUA 2JZNA 3RPEA 3NATA 5JNRA 1S0UA 4UATA 1VB5A 2WNIA 4MWBA 4AKGA 1QP0A 4DHEA 3DAOA 3PGVA 4FWIB 2XW6A 3NWOA 4XUDA 2O8BA 2HB6A 4RPIA 2GN8A 1TW2A 2BBSA 2HHCA 3KVYA 1S01A 2I4MA 4U0KA 5FQNA 3H2IA 5DBGA 3UJ9A 4RK4A 2YS7A 3D8SA 1GA4A 4GVPA 4D0RA 4BGDA 4RJLA 4PYKA 2LIPA 1PX2A 2BH9A 3A3YA 2V7UA 3GWZA 2PPLA 2ZUWA 2ZSAA 4NQZA 4IHAA 4ZICA 4X24A 3THWB 2WTMA 2NXEA 4NOLA 4M1MA 3SZ3A 2BTEA 3MCZA 2HBYA 3C4JA 4YMLA 1PZFA 1VKJA 2QAIA 4P35A 3HU5A 3CHYA 2BGLA 5DTJA 1NTRA 2DKNA 2XXJA 5E7IA 1FA9A 1GGHA 1NW9B 2IEZA 2NXWA 3AGPA 4QE3A 5HJ2A 1IUKA 4DV0B 3K9HA 10MHA 4HQ0A 4X3OA 2WVGA 4LYHA 2CVQA 4NHOA 4PF1A 3PSHA 4AJEA 4MPJA 2I6SA 1D6MA 2G04A 2TMYA 5HA5A 5ADVA 3NNNA 4N8SA 3B1WA 4ZQCB 3LBFA 4N47A 4IHJF 3RS4A 3GLGB 2OCLA 3FVWA 5EZYB 5J4KA 2RHLA 3W6OA 6ADHA 1BQ4A 4MR8B 5DTQA 4DMHA 1JE1A 1MOPA 2AN9A 1KS2A 1ZN2A 3GUCA 4AZ0A 2AFHE 2FUEA 2ZJOA 3VO1A 4RY9A 5ICCA 3WLFA 3RC7A 2YJ3A 4A6XA 3M70A 3PWSA 4XFJA 3SR4A 2JFVA 2QTVA 3HJHA 2JGDB 2AFIA 2XGGA 3RFXA 1P60A 4FW9A 4R16A 2HNBA 4IWNA 2NSJA 1C9DB 5BORA 4XD7D 1ZHFA 3PNVA 1JP7A 2ZWIA 1NT4A 1H1TA 2YS6A 2J6BA 4BAZA 4RVNA 2ES4A 2FPWA 3M5DA 2XF8A 1QF7A 3GDHA 3HJRA 4Q19A 2PGXA 3REFA 3QEOA 4C03A 4N03A 1CEEA 1GARA 5JO9A 2DF8A 4JJEA 2H06A 4I81A 3DMTC 4WIAA 3ZKAA 2QYOA 2DBYA 2JEYA 4M0FA 1QRTA 4E51A 4OQNA 4FZ3A 4MAAA 1JJVA 1V7ZA 2XDWA 5FUBA 1UODA 3H9QA 3FAZA 2GZMA 3K8OE 1B8VA 3PCTA 4TL8A 1ZH6A 4ZVUA 1L5KA 2QRNA 1E61A 1M2VB 2VDPB 4MPDA 5JPDA 1VTKA 3E7PA 4EG5A 1W5FA 3M5WA 2X5OA 2XE6A 1X7XA 3GDGA 5EE5B 3WDMA 3CO0S 5IYZB 3IEIA 5JYCA 3U4QA 3AERB 3W6UA 2X8AA 1VKRA 1L1QA 5LU8A 4M8IA 1CP3A 4FMBB 4XOIA 2JRLA 1Z16A 2ZBQA 3WXMA 2EBFX 1ZVMA 2VCHA 3GEMA 4RQBA 2P30A 1QRUA 1BD3A 3U4CA 3QE9Y 1N2EA 4AX8A 2XMRA 3KU1A 4QECA 2D8MA 1IBRA 1WPQA 4J3JA 5E9QA 4ZYUA 2IL1A 1BFKA 2PGNA 3DLCA 4GX1A 4C29A 5BUZA 4W9RA 3C5HA 5JYDA 1OZGA 4KPYA 4ALJA 1AKQA 2PUVA 3FCCA 3KQOA 5IW8A 3WIVA 4F1KA 5EMNA 2Q3CA 1I2ZA 1X7HA 4B2PA 5JWRA 4OB6A 1MPTA 2QIPA 4QGHA 2Y92A 5E2AA 1ZOOA 1X1EA 2X9GA 1G6HA 1T15A 2ZUFA 2QI9F 1Q16A 1TVMA 2BFNA 3GLFB 5EQDA 4RVFA 4V02A 2R60A 3EVBA 2Q5QA 3DKPA 4MDFA 4CF7A 2CXPA 2ZAIA 1TI7A 2P6OA 3KQSA 4XLLA 1PGNA 1RTTA 4AP9A 2JJYA 4EUNA 1Z8HA 2W58A 3M1LA 5BW8A 2X5KO 2GCGA 3K96A 4WXPA 3UO8B 3DXXA 3HI4A 2O7NA 4RYLA 1VJ1A 3GEPA 2CXNA 2WYUA 5FYQA 5JZBA 1Y8ZA 4TKUB 1V3UA 3HVIA 4YAGA 4J3FA 2EHDA 4LC9A 2WPNA 1PG0A 2YHIA 3BXEA 3TI9A 3ZQJA 4BO9A 5T57A 3AL2A 1JECA 2Q46A 4KQMA 2GN2A 2DECA 4IG9A 4B9AA 3QFSA 3FGOA 4Q39A 3TLGB 3SWWA 1K8YB 4FGWA 2X4LA 4PG6A 2Q1WA 4L8YA 4P0TA 2QTTA 1V41E 2YW2A 5ILGA 4F8YA 3EIWA 4FOPA 5F78A 1HFWA 3I2HA 4IIDA 4BL5A 2RGNC 1NY6A 3KV3O 3EVNA 2WUDA 2GZHA 2ECQA 3AJRA 1WCWA 1K3FA 3E05A 1WCIA 2Z56A 3F5MA 4MRMB 1QYIA 1V96A 3R7NA 4YLEA 3DA8A 2NVUB 3NM6B 4ALMA 2GT1A 3BCUA 3CRRA 4WOBA 4ZCPA 4D8WA 3F9IA 1D2EA 3IIJA 3C6KA 3THYA 1U2QA 2O2EA 4C14A 3GLGA 2AC2A 3EVGA 3FMGA 2H7XA 2NVBA 3FSRA 4K6CA 1FNDA 8ADHA 2GH1A 5A5VA 2CL0X 1FDRA 1RRPA 3AW8A 4XUEA 1VXRA 4GKKB 3ZWMA 4RFSB 2ODBA 1CY4A 1JAXA 3AHIA 3ESCA 3GCWA 3JAKA 1PFGA 3OQVA 3G17A 4AY4A 3PWZA 3RVBA 4G56A 2J67A 4C87A 1II8A 4PGHA 2ZJBA 4GU5A 4G81A 1OXKB 4IIGA 3T94A 1RZRA 4DC9A 1N6LA 3REQB 2BDTA 3RV4A 2BKVA 3FRJA 4OK6A 1KMNA 4MIOA 1KRHA 1ZNWA 4OKSA 1C3LA 2RCYA 5P21A 2AQ8A 1II8B 1N7GA 1KKUA 3UTDA 4HH1A 3MRVA 5B1IA 1E0KA 1Q3TA 2GAAA 4NVRA 3ZI7A 3OPVA 4XEUA 3ISTA 1U98A 4M60A 3H9UA 1AKUA 1X0VA 1L4YA 1L5QA 2FXVA 4FUTA 5AT1A 3OU7A 2BHTA 1NRIA 2CHUA 2P9JA 4V38A 5AIAA 1T2CA 3LYHA 1ODLA 4FYYA 4M53A 2Q9CA 3T7AA 4LHXA 4EZBA 3I72A 2EF0A 3NC4A 2JNWA 1B8OA 2R1UA 3AEXA 3OF3A 3BBPA 3O8QB 3RVOA 5HPYB 1NY5A 4QOHA 3HDVA 4BUCA 5A06A 3ZY3A 3WL5A 2AJ8A 1KYZA 1UBMS 4IIFA 3COYA 4ZDJA 1A9XB 4GXQA 5AKKA 3N58A 4CL2A 4DVGA 1PQPA 4JWKA 5I7AA 2CEKA 3MYYA 3WBKA 1B4DA 3MLBA 1TAHA 5K0BA 3AESB 2POQX 4UM9D 3SYLA 1VSBA 5IM4A 4C7KA 3DP7A 1JIQA 3WTBA 4S12A 4HZUA 5DISB 2RB5A 2VYVD 2YJTD 2CV2A 2W6MA 1CQIA 4LZZA 4LYJA 3OIVA 3W5UA 4DIMA 2XLBA 1B41A 2ZB3A 4X6LA 1WETA 2PUAA 4CEJA 1E96A 3O5AA 4ODIA 4CM1A 1SUFA 3CUWA 3RYFA 1NU6A 3T7CA 4LJLA 1YOBA 1J70A 3DYIA 4TMZA 3ADKA 3SEZA 1U7WA 3IJ5A 1DX6A 2B21A 3GRYA 4JQCA 4CQMB 4HWSA 3OJWA 4PRZA 1QLJA 1L8XA 1IZZA 3PFHA 1NVAA 3TZHA 5L45A 3O0TA 5JMWA 1A0OA 3ZLVA 3I62A 2P0AA 2VXOA 4LF6B 3V7FA 4PZUA 4FKBA 2YFQA 3OPYA 2WYHA 3AERA 4ZVKA 1DAFA 2WIKA 2HRBA 3WI7A 3Q2IA 4FILA 4D6PA 2ZRCA 4JQZA 1AUQA 3TGWA 3EE6A 4KV9A 1NVDA 1B6RA 3D02A 4U8HA 2WF5A 1X8JA 4PAQA 5BSKA 1BN6A 3EDCA 3SLGA 4A0QA 1JUDA 2IYAA 1M8JA 3KK0A 3HUTA 5ALGA 5DO9A 2Z4RA 4IVQA 1S3GA 1VG8A 1JU3A 1PJ4A 2DQ4A 3ETEA 3WK6A