3A6PC

Crystal structure of exportin-5:rangtp:pre-mirna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A high-resolution structure of the pre-microRNA nuclear export machinery
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/nuclear protein/rna
molecule keywords Exportin-5
total genus 41
structure length 170
sequence length 170
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a6pC00
4QHTA 1EWRA 2RB4A 2K5UA 1KKMA 1Z83A 4HAUA 1XWIA 2A5FA 4PANA 2WPDA 1NNEA 4C4PA 4KCGA 3Q5EA 1JJVA 3MWKA 2OT3B 1R0ZA 2QY9A 3HP1A 4G5QA 4O2LA 2ZJZA 1KO1A 2ONJA 2AD5A 4P33A 1Z0IA 2CNWD 4XD7D 3X1WA 3AM1A 1U94A 2CMKA 1Z08A 4PQYA 4LK2A 3RSOA 1BH2A 4NYMQ 3NDPA 4Z54A 2DWQA 1BMFD 3HJNA 1E69A 1I2DA 3EC1A 1U81A 1HURA 2I1QA 4MYUA 4QBIA 4PHFA 4TQAA 2C96A 4QGFA 4JVLA 2WHXA 1X1RA 3AH8A 1QF9A 1M8PA 1TQ2A 4ZKEA 4DSNA 2UVQA 3TIFA 2MMGA 2ZSEA 2ZSFA 3IIJA 4PXAA 2HDNB 1G8YA 4GOKA 1CEEA 1OLOA 1KI1A 2R6FA 1IBRA 4LPKA 2QENA 3ZJYA 1CR0A 1G8GA 2DYKA 1II9A 3B13B 2RGEA 4B34A 4TLEA 4DLWA 1JI0A 2QBYB 2IF0A 1JB1A 5BYKA 3MSXA 2GA8A 2ZJ8A 4DSTA 3ZIAD 4IRUB 1AA9A 2PT7A 2ZE8A 4DLUA 1E99A 2YINC 4Q1AA 1UKVY 3MUFA 1A2KC 1AQYA 2P5SA 1U0HC 3CB4A 5J5CA 4US1R 1M7HA 4A9AA 3PUZA 2J0QA 1NLYA 1G8HA 2H5EA 1S9HA 1VG9B 1Z0FA 3BXZA 5KTYA 4Q18A 5JZVA 2ZRAA 1UJ2A 3EA0A 1SXJE 4PO1A 4TL6A 1N6KA 5B58C 3FHOA 5FTNA 3RS0A 1QVRA 1XEXA 1GDDA 3BFVA 2H57A 1TQ6A 1OPXA 5FOUA 3ZQ6A 1II0A 4LJ5A 3LNCA 1U99A 4LBVA 1G64A 3MRSA 3SS8A 4JLPA 1CR2A 1BOFA 4M1YA 4URVR 2IK8A 4LWZA 3Q85A 1U9IA 2G77B 2XSZA 3A1SA 2XSZD 5KNCA 3U4QA 1DTSA 3SJZA 3TUZC 1QHHB 2GCNA 4C0HA 4TYWA 2ZEJA 1TPZA 1ZC4A 4IVQA 3NBXX 4B71A 4DLXA 1SVIA 3L0IB 5KOYA 4B6EA 3EWSA 2ZRBA 2QE7D 3W8RA 3THWA 1SKYB 4Z8XA 2F43B 3X1ZA 3EARA 221PA 1DAEA 4TN1A 1X8JA 1TUEA 3ZVRA 3KJEA 2CJWB 4JJZA 4DZZA 2OBLA 2V7QA 1SGWA 1S3GA 5DNYB 3GJ8A 2ZUBA 2C9YA 2WKRA 4LHZA 1V43A 2V4ZA 3W6OA 4M22A 5J4KA 2A78A 3EPHA 2GILA 4TT3A 5CYOA 5LD2B 4DT1B 4FD2A 4C0BA 2FSIA 1P4SA 4BECA 1LS1A 2WWXA 3IBYA 3DZ8A 5DYGA 5LB4A 3EC2A 1UEJA 4HLQB 2JLRA 1ZINA 1PLJA 2PJZA 3PENA 3QKTA 4EJSC 3GEHA 3IHWA 3HU2A 3VHXA 1MO5A 2C95A 2PZFA 4LV8B 4Q7KA 4AYTA 5JS8A 2FOLA 4PR0A 1KK1A 3Q7PA 1OB2A 1ZNZA 1G41A 1NIJA 3KQNA 4PZLA 5EZ6B 2WVJA 1J99A 4GNKA 1OF1A 1CBUA 3MMPA 1D2EA 4AYWA 1NY5A 2ZYUX 2NOAA 5FBRB 3PEVA 1G7TA 4TLBA 2NPFA 2PLRA 3CX7A 2GXSA 5CIQA 3A1VA 3CF6R 3PQCA 1IJEA 2BV3A 5FUYA 1Z3IX 1J7KA 4MYTA 4NU0A 2GJ8A 3IPXA 3K9HA 4JL5A 3SR0A 1Q1BA 2XXAB 1R5NA 2F1IA 1M74A 1V5WA 1XTSA 3BH0A 1JR3A 2I4IA 4YXWD 3H2YA 3U6KA 2BBOA 4MA4A 2GEDA 4Q21A 1G6HA 4DDUA 1NN1A 3FKQA 1DAHA 1LF0A 1Z6TA 4TQ9A 1EXMA 2R6GA 1GL6A 2G9NA 4B35A 3EPLA 4ON9A 3GFPA 1OFHA 4HZUA 3QY0A 3SOPA 5B57C 2AK2A 1T8TA 2DBYA 2I1VB 4CW7A 2OESA 2PMKA 1Z06A 1AJEA 1FPMA 1XF9A 1P73A 2ZPTX 3FDIA 4TL9A 3ICQB 3NTUA 1P60A 2XB2A 4U02A 4XH9B 5J47A 4CEIB 2FH5B 1JPJA 5AUNB 1Q0UA 3LBIA 4MITA 2OFOA 2JLZA 3FKSD 4QXAA 3THWB 3K09C 3TLXA 3CRMA 3MWLA 2XB4A 4G5SA 1P2UA 3B1WA 4HZIA 2LKCA 2WWIA 2H17A 3G5UA 2IWHA 4GDFA 1MO6A 1G4UR 1Z0AA 2ODEA 4I1SA 2UKDA 1XTQA 2JLVA 3U5ZB 2GJKA 621PA 2WSSD 1EG7A 2GF9A 1CJMA 4B2PA 1JJ7A 1ZD1A 1W4RA 2WJYA 1VHTA 2AR7A 2J0SA 3SEAA 4D4KA 2ZI6A 2P65A 3VX4A 1G3QA 1OKKD 3BE4A 3CWQA 1OKKA 3T1VA 3VKHA 2Z6VA 5FBWB 1AS2A 5M04A 4KBFA 4JIMA 4MGKR 4EDHA 1KIMA 1E0AA 1XMVA 1JQJC 4CIDA 2QAGB 3RDPA 3H1TA 5LDDC 2DWOA 2BOVA 2V55B 2ZJ5A 3HR8A 4L15A 1CF4A 1ZYUA 1IN8A 2ZRHA 3TKLA 3I3SR 4MKIA 3ZS9A 3TK1A 4AKIA 4WXPA 2FN4A 1ZW6A 1G21E 4ZPXA 2F1RA 4RCZA 1E2DA 3SJCA 1X1SA 5JI3E 1COWA 2ODBA 3CR7A 3QUSA 4NH0A 4MDEA 1WMSA 2OLJA 3KQKA 2EYQA 1X3SA 3OFND 2LKDA 3O8DA 3OFNA 3V9PA 3MLEA 2NO1A 3RWOA 1XXHB 3MG9A 2QSZA 1E94E 4KVGA 4BFYA 3BOSA 1L4YA 1XZPA 1R7RA 4DCVA 4D6PA 3CO5A 2ZU0C 2OCBA 1GM5A 2QGNA 3W5IA 4B74A 3THYB 3P4XA 3EA5A 1HQYE 1US8B 1ZCBA 5C4GB 4BFTA 1E2MA 2IEYA 4GRAA 4OK6A 4OHYA 4DSUA 2XZOA 2EVWX 3RS3A 2CLDX 2QRZA 4QC2A 1OJLA 4MRSA 3UXMA 4CEJA 3TNFA 4RD6A 2QMEA 5FPHA 3SC3A 2YWEA 2LWIA 1J70A 4HB0A 2I3BA 5FUVA 3SBDA 2WJIA 1SKQA 1YZTA 2IYZA 4KYUA 2ZS9A 4XVRA 2VBCA 3J81k 2PCJA 3KX2A 3UMSA 1E2QA 1N0UA 1EESA 1R6BX 5FUXA 3VX3A 3Q9LA 3I4LA 2RGNC 2EFHB 3QENA 1NG1A 4Q4HB 1FNNA 4A1FA 4IDPA 4AY2A 2FEMA 4FI3C 1OYYA 2VP6A 4UJ3A 5BN4A 1ZU4A 4LY6A 3JZAA 4AKGA 3U44A 4HSEA 3GFTA 4EJSA 2OLKA 1QHNA 3I1FA 1EWQA 4PTLA 1DO2A 3SFZA 1EGAA 3VR1A 4JBYA 3B1XA 2GNOA 1YZKA 5D3MB 2GJSA 1XD2A 1Z47A 4WW0A 4B6FA 2F9LA 5FPSA 4OK5A 4KV9A 3IHLA 1CU1A 4P4TA 2KSQA 3GLGB 1G3UA 1XEFA 1W4AA 2ZJBA 3A37A 5KUTA 1IHUA 3A4LA 5AJVB 2ZQ5A 2XNDD 4QOSA 2ZJ2A 1G5RA 3K0CC 3ZS8A 1G19A 4BQSA 1YRAA 4CGZA 1E2FA 5L3QA 1TQ4A 2JEOA 5EJEA 1E79A 1IOZA 2OXRA 1F3OA 1R4AA 1YVDA 3FWYA 2H92A 1KMHA 3EZ2A 3EIQA 2GCOA 2H16A 1P61B 1M7BA 3K9GA 3PIRA 4DWJA 4UXHA 4NHOA 2ZAOA 4Q9JA 4WAUA 2FWRA 1SHKA 5SZIA 2V9PA 2D06A 2W00A 1QVAA 2VQSA 4NCNA 4QM7A 1ZD8A 2IT1A 3L8ZA 4AI6A 3QPWA 3BGWA 5BWMA 4U00A 3IGFA 4LOAA 2G1JA 2BEKA 2NO6A 4FMDF 2OSBA 1E4YA 1KK0A 2A5DA 2Z5FA 1EFTA 4YQFA 3NDBB 1T6NA 5DI3A 1G18A 2VYFA 1Y63A 1Q1ZA 1HT2E 3CKLA 5KYKA 2CVFA 3I5XA 2VEDA 4C7OB 4JBWA 2FJUA 1E96A 4I4LA 2YOFA 1NBMA 4XWOA 2W0SA 4K46A 2ORIA 1XPRA 1E1RA 3DOEA 3B8HA 4ESHA 1RW4A 4IEIA 3QSYA 4QGHA 3LFUA 4L9WA 2IYUA 5DI9A 1J8MF 5HR5A 2QNRA 4DCNA 4HUTA 3PEYA 3U3MA 2G3YA 4D4JA 3LA6A 5HKKA 3RYTC 1RFLA 4O0MA 4ASUA 4XTCS 1D5CA 2DCUA 5DLQC 3SU8A 1Q44A 2GXAA 5C18A 5HCNA 2BBWA 1H8EA 3AV0B 3VKGA 3AUXA 4OI2A 4UNNA 1E2EA 4FWTA 2WIAA 1RIFA 4AG6A 3R8FA 5LPNA 2V3CC 3PJRA 3K0AA 4LHYA 4PQFA 2EWWA 1FTNA 3GPLA 2NG1A 1OXVA 4L8GA 3SFVA 3T61A 2AFHE 4JLAA 2CK3D 5EUMA 3CX8A 2B92A 2FSFA 2F9MA 1O87A 2CJWA 2OZEA 4LI0A 3FMPB 2VP2A 4JL6A 3TMKA 4YXWA 2NO0A 5L3QB 1SVOA 5FOWA 3GLIA 3NG1A 1B23P 3QPUA 1QHXA 4MGIR 3GJ4A 1KJYA 3LVRE 5DYIA 5KDLA 1MRNA 4CRWB 4AD8A 5G41A 5FBQB 1XMSA 3UWKA 5HZHA 2QE7A 5BN5A 1Q1QA 1ZCAA 5FOVA 3NKVA 4JVNA 5FR2A 1KJZA 1HT1E 1Z0DA 2A5YB 2IL1A 2VF8A 5GJWC 2WJGA 5E7IA 2WZQA 3TJZA 2Z43A 1H8HA 1FX0A 1OIWA 1Q22A 3AVPA 5CK4A 4IOJA 1R10A 3GD7A 4C0SA 1E2JA 3A1WA 3EX7C 1BO6A 5CYPA 1R0WA 5BQ5A 3WP0A 2BDTA 4B32A 1WBBA 3B2EA 2VHTA 2O8FA 1D2MA 1TU4A 3AVWA 2ZI7A 2GXQA 3KXIA 3K70B 5CM9C 3UMFA 4QJ3A 1P6XA 2P3SA 1NBME 5EP2A 3KJGA 5FBVB 2W6ID 3VQTA 3CPEA 4GP6A 5JBQA 1G6OA 3GP8A 2WMOB 3F0TA 1KGDA 3MJHA 4O3MA 4Q9IA 1MT0A 2ZSAA 4PHGA 1TX4B 3GJ3A 4XWAA 1GIAA 1QBKC 5JFGA 4BFSA 3X1DA 1A4RA 2FF7A 4URYR 5EXXA 1X8KA 4YMUA 2G0NA 4EIWA 4Q5IA 4ACAA 1GRQA 1GG2A 3CWZA 2J0VA 5B30A 3DKPA 3GJ0A 1YZNA 1FMJA 1RC8A 5E95A 5EUQB 4AKEA 3C5HA 3ZIAA 3NH9A 2ONKA 2ANBA 1NVVR 1SHZA 2VIIA 4TYPA 3BJIC 2KBEA 3B1YA 3HU3A 1PJRA 1YE8A 4Q02A 4RJLA 2FU5C 1GFIA 1R5BA 3EZ7A 4HAXA 3U3JA 2ZYWX 1FP7A 5JCZA 1KI2A 1M2OB 2Z4RA 1IN4A 3OE7D 5JHGB 2CCGA 2PLFA 1RRFA 1JR6A 3O8BA 2IUUA 1ZM2A 3SHFA 2A2ZA 4H9GA 4QJ5A 4B75A 1DAKA 1W47A 4B43A 2EFCB 2VP0A 3F8TA 2FV8A 1GNPA 2QRNA 3BB3A 1Y3AA 4TYNA 2DR3A 2J7PD 1AQUA 2XAUA 4IOMA 2GEVA 1TF5A 3KQUA 1PUJA 2CL0X 1Q21A 1J90A 3ZD7A 4IFEA 1WQ1R 4N0EA 4G5RA 3SQWA 3N2EA 5DH9A 4ZIRB 3KB2A 1UDWA 1AS3A 2PZGA 3RANA 1VCMA 3IILA 3ZGXA 4OQMA 2GZAA 1UFQA 1WCV1 3FTQA 1P62B 2OO7A 3Q8XB 1ESNA 2O8EA 3IPYA 2WV9A 4C0AC 3IO5A 1T0JB 2RKOA 4ZCIA 4Y0AA 3REGA 2D74A 1DG3A 2ZE6A 5BYJA 4E5UA 3I61A 3NVAA 2FDCA 5CIWA 3FMIA 3QXSA 3R20A 4Q01A 3U7HB 4HI0E 1G8FA 4OYHA 3U7GA 3TRFA 3TR0A 1QG2A 4OJKA 2OUKA 5F98A 4NCIA 1LB1B 4Q1EA 4BZPA 3KXKA 2J45A 3ICEA 1XJCA 1N2CE 2WBLC 1VECA 1MV5A 2CBZA 2PEZA 3H0KA 3U3OA 4A0FA 3OEED 1HUQA 4QHYA 3I62A 1BMFA 3WRYC 1SVMA 1XNJA 1Z0KA 1BYIA 4WIAA 1YQTA 4M21A 1P5ZB 4QL3A 4A36A 1IJFA 2GZDA 2V8OA 5DN6A 2OV2A 2W6IA 1E9DA 3KJIA 4RY2A 4BRUA 2XTNA 5J4YA 4IVPA 4BWYA 2IYLD 4RSGA 1LFDB 2PEYA 4EAQA 1F5NA 1RJ9A 2GWHA 4BFXA 3ZH9B 4RZUA 1JR3D 4BRWA 3T12A 4CDGA 1X86B 4ZO4A 2L0XA 1S8FA 1ZM4A 4LJ9A 2N1BA 4G01B 4QGAA 3W8NA 2J7PA 1X8LA 4IDNA 1ELOA 4JKIA 2JDID 1H8HD 3UWOA 3SYKA 2BCJQ 4M9XA 2NZJA 3EASA 3THXA 2YZ2A 3DVLA 5B2ZA 1OXSC 2HT6A 2QTHA 2RGBA 2JAQA 1W36B 3N5CA 4ZDJA 2JLYA 3QJYA 1IONA 1CJUC 1E32A 4LGMA 1T0HB 3QOFA 1JXOA 2J7KA 1NN5A 2OFXA 3WMEA 2QT0A 2Q9AA 2JDIA 5KNDA 2XJ9A 1LS6A 4C0KA 3EWAA 5G3YA 4W5HA 2O0HA 1G9XA 2F1JA 1KDOA 3AVXA 2ZJOA 3CNLA 2ZRLA 4GT1A 1CULC 1KI6B 5IK2A 4OI0A 2BKEA 2BMFA 2QTFA 1S9DA 3CBQA 3LV8A 3P4YA 4QNRA 4B73A 1I4DD 1OHHD 5FPYA 3ZQJA 2OAP1 1DADA 4QHSA 4BFUA 5B64A 2B21A 5K8IA 4Q03A 3K0FB 4TSFD 1ZAKA 2WJVA 1Q20A 2XTMA 4PPQA 4BLSA 1WE2A 4RVCA 1YJ5A 2GCPA 3DOFA 3K9LA 2BHRA 1XEWY 4M1OA 2ZSDA 4RCYA 3SI7A 1UPTA 1XEWX 4OHXA 3L8YA 2LCFA 3THXB 1GOTA 4HATA 2Q9CA 3DPUA 4P0TA 1MKYA 3Q7QA 4Q7MB 3L0OA 2ZRPA 5J4LA 3TSOA 3WBKA 3PG5A 5P21A 2JJ8A 5F2EA 3EXAA 1ZNWA 3LAWA 2VL7A 1U9IC 2R9VA 1JAIA 2HCJB 2HJVA 5EE0A 1U98A 2NMVA 2R62A 3T35A 5DN6D 1IN6A 1TF7A 3DMDA 2HV8A 4YDHB 5AUPB 1UAAA 1N3BA 1YR8A 2YWFA 1CJVC 4NYJR 2WMNB 4MKFA 1CLUA 2FPLA 1LNZA 5DSZA 1MR3F 3VR2A 4OQFA 1LF5A 1QZXA 5H1YA 1E2GA 3SBEA 4A82A 1XB2A 2IXFA 2B8WA 2ZRIA 2G0TA 4PAMA 5D3MA 4LZZA 5H68A 1FUKA 1U90A 3NHAA 4XTRA 1UKEA 1T3SA 3TBKA 4KO8A 1VHLA 1KDRA 2UZIR 4PAOA 4C0QC 3CH4B 1IY1A 3ZDQA 1C1YA 4N1AA 3GLHA 1W0KD 1W7AA 3A8TA 1GITA 2BMJA 4TL7A 1CXZA 1I4LD 4KBGA 2WWGA 5AR1A 4KODA 2JLXA 4JLKA 3VMFA 4TMXA 3LY5A 1US8A 3ZYCA 1NL3A 5JCPA 1EK0A 4U7DA 1AM4D 3U7EB 1W2HA 2X1VA 4Y0VA 4KU4A 1Q1EA 2QI9C 4NYJQ 4V0OA 2DFNA 1SXJC 4C3ZA 1ZU5A 5FL7A 4HDQB 2IYQA 2DFKB 2ZREA 3WNBA 1F2UB 2F7SA 1T4GA 3B5JA 3GQBA 4M1WA 4NYMR 2IUTA 4PC2A 2Z83A 4KLNA 3WNCA 4E07A 4RD2A 4BUJA 1RZ3A 3A1TA 2ZRKA 2ZRDA 3LQRA 1G20E 3AB3A 2BIFA 3MFYA 5CJ2A 4BFZA 4D0LB 5F9HA 3QF4B 1W0KA 1S96A 1VCIA 3Q5DA 1VYTA 3KTAB 2X2EA 1M1YE 4MGZR 1KKLA 2W2XA 1GNQA 2KBFA 2ZE7A 1DVRA 2AWOA 3K8YA 1QRAA 3MJRA 1RE0A 5FTLA 2ATXA 1LTQA 3JZMA 1GSIA 3S1AB 1KDPA 1Q3TA 3LW7A 2PT5A 4B3DA 3FMOB 2OG2A 2WJHA 4XVQA 1U8ZA 3ND8A 4I99A 2XOKA 1XD2B 5AJXA 1SZPA 3CM0A 1BYUA 3T15A 2CLSA 3AF0A 1GWNA 1NSFA 1VDZA 2C98A 4FMBB 4PC6A 2IX3A 821PA 1F2UA 4BZXA 1Q57A 1P2VA 1T8UA 5CJPA 2QP3A 3AP1A 1NJGA 1FP6A 4IOKA 2B6HA 1S2MA 2P5TB 4PPGA 3PITA 1M7GA 4QBGB 5KDOA 1E98A 4TYYA 4JT2A 3UG7A 4FXPA 1TTTA 2XZPA 1E9CA 5E7JA 3ZVLA 3E2IA 1KSHA 1GL9B 1H8ED 1P9NA 2F43A 2GEUA 3ASZA 3CH5A 1R8QA 4KXFB 4LSGA 1WB9A 4C30A 2R8RA 2AK3A 1XMIA 3FFBA 1W0JA 2FNAA 4US2R 3AGQA 3MD0A 2OCYC 4NP6A 4D0NA 3C5CA 3ADDA 1E9SA 2FA9A 1W5TA 3AVUA 4NMMA 4FCWA 1DE0A 3ND9A 3CF0A 1OXXK 4D4LA 3NBFA 5C2JB 4DUGA 4ZDIA 2VHUA 2BVNA 3QKSA 4J0QA 6Q21A 1JR3E 2R2AA 4NBSA 1WP9A 3FB4A 1GP2A 2YJTD 2ZANA 1CRPA 3EIEA 4EJSB 1P75A 1N6HA 2GVDC 2ZI9A 4Q00A 3ZZ0A 1FX0B 2JASA 1ANKA 5FI1B 4DUGD 2XZLA 4PAQA 4Q9LA 2QU8A 4Q4HA 1W1WA 3T34A 3KDSE 1YZGA 2EFGA 2IBMA 2RH5A 3IDQA 3QXJA 4DXAA 3ZZUA 1KI6A 1UF9A 2D2EA 4JJKA 4KFRA 5AJZA 3L0PA 1IXSB 1L4UA 4RFSA 1FTSA 4TWZA 1KI8A 5JEDA 5J40A 4PPNA 4UKDA 1BKDR 4P31A 4HLUC 4URXR 3HR7A 3CZQA 4M1SA 1Z2CA 2O8FB 1YR9A 3D8BA 3DKVA 4W5WA 1RKBA 4MUBA 4H1UA 1XCPA 2JLSA 2HYIC 1ODFA 1OIVA 2N42A 1FFHA 5IDVA 4AIIA 3UANA 3QBTA 2XGJA 1DAMA 3A4NA 1TF2A 2IYVA 5H8WA 4NDZA 3EIHA 4EKDA 1CIPA 2PZEA 2A9KA 4R7ZA 2FE4A 3KUCA 3WBJA 1SKYE 3KKQA 1G7RA 1E2IA 1EFCA 2B8TA 5DIFA 4DLYA 521PA 4UNRA 3H86A 1OFUX 1XD9A 3BORA 3GLIE 1RPZA 2JJ1A 1KO8A 1GRRA 1NN0A 4G1UC 4IDHA 3P32A 1N0WA 3GCGA 1CP2A 4RKEA 1YHNA 5FH9A 2Q3FA 3OAAD 4R9UC 2ZVQX 1KO7A 3E5HA 1N6IA 4LHXA 2QP4A 4X8MA 1OH6A 3FHCB 1KSFX 4GBMA 3WYGA 2N46A 3AEZA 3A36A 3LO5A 3QKRA 5UKDA 4AG5A 4ZIRA 1GUAA 2GK7A 1C4OA 1P9RA 4OHWA 2EYUA 4V0KA 1EFRA 4KAXA 4A8JC 1OXUA 2FX3A 4KFUA 3CF2A 2GETA 2CL6X 4F4CA 1VCNA 4HB2A 3NXSA 3WNDA 3AF1A 4DLRA 5C4MA 1GTVA 4JLJA 4IFBA 5JLJA 5K8LA 2HXYA 1ZNYA 4U5XA 2GF0A 5HPYB 1F6BA 4TMTA 2QAGA 1JALA 2VSXA 5FPKA 1G8PA 4YMVA 5LD2C 2RHMA 3RRYA 4GZMA 2GVZC 1VMAA 4F4IA 3AKYA 2FSGA 1QG4A 4JLDA 3CRVA 1XFAA 2ZITA 1UEIA 2GTPA 3H84A 4Q7JB 3GEIA 4YMWA 2O0KA 4ITRC 3W6NA 2V1UA 1D9ZA 2XXAA 2JA1A 3GLFE 2PCLA 2VP5A 3B85A 5D3QA 2F55A 2NZ8A 1PLKA 2ZRNA 1XTKA 1H65A 3ADKA 3A6PC 2YWHA 3BFXA 2HLDA 3GJ5A 3U6BA 5LB2A 2P67A 4AC9A 3BFKA 3GJ6A 5DISB 3R7WB 3PXGA 2IC5A 2ZETA 1W4BA 4JBXA 3A58B 2GESA 2AX4A 1L8QA 1JEDA 4AKHA 3O8CA 3T5GA 4DC9A 4EFNA 2ERYA 4PSAA 4AURA 2DFLA 2O8CA 4M0LA 2CDNA 4MRPA 4P4SB 3C14C 1IM2A 4PFSA 4UNQA 3TSWA 3AVOA 2ZE5A 3I92A 1PUIA 4S2EA 1XD8A 1XBTA 1YR7A 4W7SA 1G3RA 1PLLA 3ADBA 1RRPA 1F48A 2ZRJA 5EE5B 4F4JA 1N6PA 5CITA 3EPKA 4MRVA 1MO3A 3B1VA 2QUZA 3TUJC 2NTYC 2Z0MA 3PUXA 4KVAA 1XRJA 3C4JA 3VU9A 5CB8A 1DELA 1XXHE 3MGCA 3JVUA 1G16A 2P6UA 4LRWA 4Q1BA 1E9FA 2YV5A 3HPRA 1R8SA 3MCAA 3HYTA 5IRCD 4NCHA 2ZRMA 5DHFA 4OI4A 2OILA 2Q0HA 2FFQA 3P26A 4NPHA 2UZ3A 3FMFA 2A3RA 4LYFA 4V0MA 5E4FA 2C04A 5LBIA 2IS1A 3NBYC 3EZ6A 4NONA 4HB3A 1IY0A 1VG0B 1IN7A 1HY3A 3VAAA 2FFHA 3UIEA 5SZHB 2JLUA 1NJFA 2KWIA 2YWGA 3CNNA 2AXPA 1DEKA 4D80A 3I72A 3JVVA 1UKZA 5K8UA 1N6OA 2QZ4A 4OHVA 4LBYA 1E0JA 2GKSA 3W3ZB 5EP4A 4BLRA 3M0EA 4G5GA 2CE7A 3QKSB 4Q19A 3BWDD 2ZI3A 5KNBA 3IQXA 1QHYA 4NCJA 1FQJA 4YONB 3O47A 2DWPA 3LXXA 1KK3A 1NP6A 4JS0A 5SZJA 3U60B 2IS2A 2ECKA 4QRHA 2ORVA 2G6BA 1KMHB 2P0EA 4CZ2A 3CONA 1LW7A 1IN5A 2FFAA 2J5XA 4D0GA 2REXB 3PCRB 4UNPA 3K0EA 3R8CA 1SXJA 4GZLA 5EXSA 4ERNA 5JS7A 3R9WA 2XOKD 2HT1A 1EX6A 1K5DA 1FZQA 2CCKA 5CK5A 4CEJB 1Q3HA 2QMUA 2V7QD 5E7MA 1UADA 2GDJA 4WBSA 2NQ2C 4ZCLA 4CEIA 1XCMA 2IXGA 4TYQA 4DLTA 1ZJ6A 5DE3A 3KXLA 1II8B 2HCBA 4IHQA 1W46A 4OHZA 1GKYA 3GEEA 2W0MA 3SYNA 3U7FB 3AVTA 4UXJA 1JNYA 4AWXA 2F3RA 1KI7A 2OCAA 4URZR 1KI9A 1PV4A 4LC1A 3TSZA 4EQ6A 3RLFA 5JJKA 1OH7A 4AK9A 2QPTA 1WF3A 1Z29A 2PL3A 1N0VC 3L82B 3WP1B 4GOJA 2Q6TA 2W6JD 2WICA 2PH1A 5GVSA 4Q1DA 4D81A 1AZTA 3X1YA 2CHQA 5HE8A 1HQCA 3FVQA 4D2IA 4ACBA 2AN9A 3QXXA 3TH5A 3SZRA 4B2LA 3A4MA 3K53A 1T5LA 1ZIOA 3SDZA 4TMWA 1FW6A 5KPJA 1OV4A 4KFTA 2ZI5A 1AK2A 4DCTA 2CK3A 4CT4B 4ARZB 1TAGA 3W3AA 4OKSA 1TEVA 3B7GA 4KSBA 1W48A 3FOZA 4RFVA 2QTVB 1R2QA 1KMQA 4LJAA 2HYDA 5FPTA 3R9XA 3DEFA 2VRWA 5KSOA 4KLZA 2CHGA 1G1MA 2GXUA 4NCKA 1FMLA 2XX3A 2G88A 2IS6A 1OW3B 2ZXUA 4ZCMA 4QKQA 4D4MA 1G7CA 1TNDA 2BM1A 3ETLA 3QF7A 2WAYA 1A7JA 1GILA 1TL7C 1XTRA 1XX6A 3PV0A 2OFWA 4GMDA 4B47A 4OI1A 4AYXA 2GCOB 2MSCB 1J8YF 1ZM3A 3C7KA 3CNOA 3CPJB 4PQRA 2QPAA 4A0GA 1CJKC 2CXXA 4JMPA 2ZROA 3W34A 5JECA 4DB4A 1C9KA 2HXSA 4FINA 5AUQA 1D2NA 4V0LA 1JBKA 5FOXA 2QG6A 3IKJA 4IVRA 4NL4H 3LQQA 4Q47A 5AWFC 1DG1G 3ZVMA 3RNLA 1NLZA 4DIEA 1GL7A 1SVLA 2D7CA 3TQCA 2VP9A 5FOTA 1RVDA 4N0DA 1K8RA 4C2TA 4QBHA 1E0SA 4OBEA 2GBLC 2WPDD 4R71A 4EFMA 2YOHA 4V0ME 2GAOA 2BM0A 3B6EA 3X2SA 3BAFA 5JI2E 1QHIA 1T3HA 2AXNA 5GADl 4BLOA 3BRWD 4Q4JB 1Z6AA 2NIPA 2YC2C 4GP7A 3GLFB 4IOLA 1MRSA 3MAAC 2RGXA 4RZXA 3WHLA 3QXHA 4ESVA 1Z63A 3LH5A 4NKRA 4Q4AB 2QORA 4L5BA 2GJ9A 5GVRA 2ZSBA 2AD1A 1KY3A 4BLPA 1XXHA 1WRBA 1U8AA 4IDQA 3SJBA 3SE0A 2VA8A 1W0JD 3UATA 1E79D 4KITB 4TMZA 3DMNA 2FGJA 1G291 1XU4A 5L3SA 4HUQA 3TVDA 1NSTA 4WA7A 1R5OA 1YR6A 3EG5A 5JEEA 3UPUA 1OYWA 3D31A 3VR3A 1DAIA 2IS4A 4DHEA 5AUOB 4P32A 2OAQ1 2ZR0A 3QPVA 4QG7A 4PPFA 5EP1A 4BEBA 4JSTA 1SULA 4C2UA 4MDFA 1G7SA 3B82A 4Q7LA 2C5LA 3O8RA 2G83A 2AL7A 4ZI2A 2OBNA 2ZVPX 4B3FX 2C8VA 4NTZA 3TUIC 4IDOA 5L3RA 1GAJA 1GKIA 1XEXB 1ZVQA 3PUWA 3VR5A 2WOOA 5CM8B 1S4QA 1VKJA 2O5VA 1Z28A 3HDTA 4UQOA 4URUR 1UKYA 3R7WA 1X6VA 2JGNA 3EZ9A 4IKEA 3T06B 4NYIQ 4TSFA 3A1UA 3TVTA 3V4FA 4F92B 3VKWA 3THOA 2FEOA 4DLVA 2EQBA 2A5JA 5KO2A 3CZPA 2QA5A 3M1IA 1AZSC 2MSEB 4G5OA 4BE7B 1NIPA 1S0UA 1B0UA 1SVKA 4XVUA 3GLGA 3U2QA 1NRJB 2GRJA 4M1MA 4OJQA 4HLUA 2J9RA 5JSZA 4XJXA 4TZ6A 1CR1A 1YZUA 1CR4A 5CDFA 2O8BB 4TTPA 3FE2A 1ZMXA 2WWWA 3U3RA 2OM2A 3L43A 1E1QA 3EW9A 4JZKA 2VO1A 2QAJA 3NEYA 2ZI4A 4F7WA 5F9FA 2AWNA 4FCVA 4RFSB 1P3JA 3BK7A 2MMCA 2H18A 4JL8A 1Q12A 4TLAA 1PZNA 2REBA 3U4QB 4LV5B 3QG5A 4A92A 1E2KA 1NF3A 1KSJA 3NC0C 5JWOA 1KJWA 4CEHB 2RMKA 4C0JA 4B3CA 1KI3A 3NHBA 1ZM9A 1M6NA 4RD3A 1FUUA 2WWYA 4RZ2A 4CT5A 4BPBA 3RABA 3MWYW 4Z8YA 2REOA 4IXMA 3S1AA 4A8JB 1AIPA 3G82C 4DDTA 2KI5A 3PEUA 4I81A 2ZYVX 2WKPA 2R6DA 4HDCA 1E2HA 1SVWA 4PHHA 3KQHA 1TMKA 3I73A 2O8DA 2O0JA 5G53C 121PA 1ESMA 1WA5A 1XJQA 2C77A 2V1XA 3D6TB 4FIDA 3TGPA 3T1OA 4M1TA 2J46A 4LDJA 4DJTA 3V4RA 4L4UA 1GRNA 2E1RA 4DBLC 3QEOA 2F1HA 4TMVA 1XZQA 1SVSA 4I1OA 2D4HA 4HEJA 5FTKA 1DAGA 1TEXA 1ZM7A 1ZNXA 4LHWA 2DB3A 2IW3A 1A2BA 4ARZA 1JQLB 2Z4SA 1Z8FA 2SHKA 3K0SA 1CTQA 2VHJA 1NY6A 4US0R 4B44A 1ZRHA 1XTJA 2BJWA 4QBFA 3QF4A 1F2TA 2JLQA 1I2MA 2W2TA 3E70C 4LBWA 4DB2A 4I1UA 2JIZD 3QKRB 1RRGA 2ZJAA 2FPMA 4CYMA 3K0FA 1E2LA 5CDFE 1KZ7B 2Q21A 1UBCA 4LV6A 2CLCX 3BB4A 2G1KA 2PBRA 3GLGE 1VYUA 5JRZA 2WTUA 1KAGA 2WJJA 1NKTA 5KDDA 2J0UB 1N6NA 2C78A 1NMYA 3AKEA 4A2QA 5AJWA 3B78A 4NZYA 4LX0A 3OEHD 4EPVA 4DT1A 1LVGA 1HV8A 3FFAA 1E2NA 2VHQA 3THYA 4D26A 1L2TA 3GLFA 1Z5ZA 1XTIA 3P20A 3BIFA 4DEYA 2GJAA 2BKUA 3OIYA 5L8VA 1JPNA 1ONBA 3TW8B 3WHKA 5FR1A 2KB0A 2IHBA 2W6JA 4PC1A 2HF9A 1FQKA 2XNDA 1ZC3A 3CR8A 4TMKA 1OB5A 2ZTSA 4EPWA 3QVVA 4ABYA 1KO4A 4E03A 2OCPA 5EE9A 2RCNA 8OHMA 4M9SA 2WSMA 4JYBA 421PA 1RJ9B 3OF5A 2H7VA 4WZBE 5TXGA 2D2FA 1J2JA 3NWJA 3N2IA 4LJ7A 4WZ6A 3X1XA 5JHHB 3HU1A 5KSYA 4RD1A 2W58A 5CLLA 3LXRA 2WM9B 4O2RA 2FSHA 2NO9A 1KHTA 3ASYA 2DPXA 3BH6A 2OHFA 3C15C 4OQLA 3TE6A 4Z1MD 1HYQA 3VNVA 1PVOA 4MUAA 4BASA 2ODWA 2MSDB 3ZLJA 4A0RA 1YZLA 3AKCA 3LDAA 3PFIA 1N5LA 3D3QA 2ZR7A 2DY1A 2YHSA 3EAQA 3RS7A 2F6RA 2IYXA 3OHMA 3ONWA 3UKDA 1HE8B 3T1QA 1QHHA 3KKMA 5JJIA 1L7VC 4C7OA 2BCGY 4HLDA 2AKAB 3KQLA 1ZBDA 3D7MA 4MGYR 4A0HA 3I8SA 1ZUIA 1JAHA 2IYWA 3QKUA 3KKOA 3QNUA 1TQDA 4HLCA 3VHLB 5EXPA 2WWHA 4B48A 4DVGA 4BFWA 1NVVQ 1OFTA 4GL2A 5HE9A 1W49A 3AF4A 2J41A 4Q1CA 1XCGB 2GHIA 3LD9A 3LRPA 5G3ZA 1P2TA 4KHZA 3FPAA 1NG9A 1G4AE 1T9HA 4B3XA 4JVMA 4K8OA 5C46F 3GJXC 5TY0A 5FTMA 2VSOA 3TAHA 1TUIA 1E0KA 5KPDA 1TADA 5GJBA 3TQFA 3LX5A 1NLFA 2FG5A 4IW3B 1KY2A 4XSHA 4OQXA 1NN3A 1XPUA 5EE3A 4JLMA 4C0LA 1N5IA 3L0SA 1F60A 4EFLA 5EZ5A 3MWJA 4JT4A 2R65A 2QBYA 4M53A 1N5KA 1G5PA 5HKKD 4PO8A 1G5TA 3BS4A 1GVNB 4XSGA 1DARA 3P1JA 1EFRD 1FNMA 1Z2AA 4GOXA 4GSYA 3DM5A 4WZAE 2P2LA 3EZFA 2FMXA 2V6IA 3GJ7A 1CJTC 1KDTA 5SZKB 4LYAA 3B60A 4TTQA 1E3MA 1E1RD 4ZDKA 3RRNA 3KTAA 2J3EA 1DOAA 2ZS8A 3QVUA 4LJ6A 3OAAA 3RWMB 2P6RA 2BBSA 2YYZA 3K9NA 2GBLA 1UBGA 4WVFA 3LWNA 1W44A 5DHAA 4UXIA 3DHWC 1W2GA 3SNHA 3I5YA 4HAVA 4LPSA 2DHRA 3BD9A 4TLDA 1MABA 4V02A 3B9PA 4FWIB 4GMXA 1T3LA 4WOPA 3RVBA 2C9CA 4K81B 2YVUA 1NVUQ 4ZDWA 2WOJA 2W83A 1BIFA 1XMJA 4JKYA 2JATA 3AVVA 4JLNA 4M4SA 1OH8A 3F5FA 3HWSA 4X8HA 2JJ2A 5GJVC 3W6PA 4JSYA 2IEZA 4LCBA 4RZ3A 3WXMA 1COWD 1S1CA 4KYIB 2EU8A 2VP4A 1ZUNB 2E9SA 2ZJYA 4MRNA 1KK2A 1R0XA 2FGKA 2FZ4A 5FBLB 4A2WA 5JMTA 1E9EA 4FMCB 1NMXA 4R98A 2ZR9A 2ZUDA 2QPOA 3HYRA 2D7DA 1QHSA 1T91A 2ZU6A 1AKYA 4C9BA 2B7BA 3TW4A 5G40A 4A6PA 4R2HA 2WAXA 3H4MA 3GFOA 1KI4A 3UK6A 4QNMA 1XP8A 3CIOA 1NBMD 2FPKA 1UBFA 2RAPA 1N5JA 3TR5A 4Q9KA 4PSKA 4MYCA 3ZZTA 4PHTA 2HF8A 1I4TD 2IWRA 4BZQA 2V6JA 3G0HA 5AJYA 3PR1A 2X19A 2ZM5A 1GZSA 3LVQE 4DLZA 5IHPA 3AVQA 4DSOA 1MO4A 4TZ0A 4YMSA 1KYIA 3ZD6A 2ANCA 3IIKA 1W36C 4P4SA 1YU9A 2CE2X 2IA5A 4WXRA 2OXCA 3L2OB 4MH0R 1ETUA 4KJZA 3IEVA 3BBPA 3OEHA 1DO0A 2IYYA 3NH6A 4GFDA 1Z0JA 4HAYA 4DDWA 4HZUB 1R0YA 5EP3A 2A7QA 3RS4A 1VIYA 4PC3A 2ERXA 1NKSA 3SHWA 5K8TA 2ASEA 2IXEA 2IF2A 2J87A 2GAAA 5TMPA 1U0JA 3GLHE 4TQUS 4FMDB 1A1VA 3GLHB 4CVNA 4F93B 3RS5A 2QMOA 2Q9BA 4EUNA 1P7CA 4HYYA 2IUSA 3VTKA 4NE2A 5HZKA 2KE5A 1IQPA 1DBSA 3OIVA 4ASUD 1UM8A 4O25A 1TU3A 2B7CA 2HUPA 3FHTA 3IBGA 5C1BA 4V03A 3M4YA 4X8OA 2RGCA 4G0NA 3C8UA 3KKPA 4MKHA 2C9OA 5IF9A 3CX6A 5EXTA 4V0NA 3VU9B 5AK0A 1Z22A 2VPPA 1NI3A 4LYJA 4JLOA 4DDVA 1IY2A 2QM7A 5CB6A 4POAA 2Q3HA 1JECA 4ILEA 3RS2A 1ZIPA 1S1MA 4EQ6B 4QM6A 1E2PA 2XTZA 3QQ5A 4DKXA 4P3YA 2X8AA 2BMEA 3DL0A 5FL3A 2NO7A 3R9IA 2O8BA 3BERA 4PC7A 1WXQA 5KSPA 3E1SA 5E3HA 1UDXA 1G17A 1K6MA 3KKNA 3Q72A 2XNSA 4B2IA 4YMTA 2A5GA 2J0UA 1IXRC 3CW2A 3RHFA 1E4VA 1CRQA 4M2LA 2JCSA 2P6NA 2CNWA 4D25A 4HUQB 3SN6A 2CHVA 2DFTA 2D3WA 1ZD9A 2EW1A 4F91B 4FW9A 4I1VA 4KFSA 4DCUA 1ZP6A 4RD4A 3OESA 1QDEA 4JYCA 2IHYA 3W90A 2TMKA 1U8YA 3PUYA 5L3SB 3AF3A 4GI7A 4M1KA 2QEQA 4HDOB 2ZYTX 2AKYA 4UJ5A 5TV2A 1OT3A 1EFHA 4RD0A 2D62A 1II8A 2Y8EA 2X77A 1KTVA 4IXNA 4MRRA 3OZXA 1IAQA 3B1ZA 1S3SA 1Z6GA 2EWVA 2FFBA 4PSVA 5JJLA 5HTKA 1SQ5A 4HAWA 4QGGA 4TLCA 4EPRA 4PZZA 3T1TA 4YC7A 1D6JA 4LBZA 3RRZA 2NPIA 3K70C 5GJCA 2RGGA 2WWFA 3OE7A 3K0AB 4BGDA 1W36D 1DPFA 1OFIA 2JJ2D 5TARA 1RRCA 4P4UA 1HE1C 1IXZA 1KAOA 3VR4A 4OL0A 4DEXA 1MABB 4IEEA 3IO3A 2V54A 3K70D 4TL8A 2XITA 4YDSA 4MQBA 4B3BA 4MYHA 3LBNA 3TAUA 2OE2A 2PJRA 1T5IA 5J4VA 2BBTA 2R44A 3W5JA 3FGNA 3RSLA 4FMCF 3B9QA 3RRMA 1RYFA 3K1JA 4ZV4A 1KNXA 2ATVA 4R2IA 5A4JA 2QN6A 3ADCA 1DAFA 3KFXA 5TB5A 2XJ4A 1NMZA 2HLDD 1JXMA 3WMFA 4A6XA 1WBDA 2AFIE 4L16A 1AS0A 4XOIA 3SQXA 2IYTA 4KSCA 4BFVA 1P2SA 1MOZA 3OIUA 4FN5A 4E09A 3U61B 2ZRFA 1HEIA 2RGAA 4Q4LA 5FOSA 2CL7X 4OQNA 3CRRA 2O8EB 1KNQA 2XEXA 4UNSA 1OIXA 1E9RA 4JLVA 4PX9A 2YOGA 3QIAA 1AGPA 3OIWA 4H1VA 2BEJA 3NIBA 4G3XA 2J59A 3LX8A 1P9WA 3V00A 4LC0A 4LHVA 5IT5A 1KZGB 2ORWA 2H1LA 2QP9X 5FTJA 3LBHA 5JRJA 1VPLA 1N6RA 3FKSA 4JLBA 2RHDA 3I32A 3AGPA 1U0LA 1W5SA 2QMHA 3BC1A 1BS1A 2F3TA 3KUDA 1ZUHA 2RGDA 3CLVA 1KSGA 1E9AA 3WY9A 2CEAA 5KSZA 2X2FA 1U2RA 3K0CA 4F38A 2JLWA 3IIMA 4HB4A 3CUEF 3QI2A 1AGRA 4LUCA 4BEJA 2BMDA 3ZVNA 2HJGA 1UBEA 2JIZA 2GK6A 721PA 1E1QD 4OK3A 1HA3A 1EFUA 5KHOC 3AF2A 3I8XA 3QXCA 3KL4A 1CKEA 2A30A 3PUVA 2ZRCA 1HH4A 5EE1A 1YKSA 3DZDA 2WSSA 3IUYA 3RC3A 1QHGA 1XJ0A 5JSZB 1SXJD 2QAGC 4ZKDA 1E9BA 1O3YA 3KZ1E 2ZIAA 5JWHA 3AQ4A 3M6AA 1XPOA 1F2TB 3FYHA 2QQEA 3DO6A 2NGRA 2VHCA 4Q4JA 2QROA 5ANRB 2VF7A 4XIGS 4Z1MA 3F3YA 1XDBA 4JVSB 2VSFA 4Q48A 5BN3A 4A4DA 1OH5A 2QGZA 3LW8A 2YC4C 5H70A 4XWKA 2HEIA 4A8JA 1HTWA 3SYLA 2RGNA 2QQ0A 2AHOA 5A5GA 5EQTA 3IEUA 1SXJB 2ZRGA 4M8NE 3CPHA 2YKGA 4YLGA 2VH5R 2WIBA 1E6CA 2EFDB 3DDCA 2EFEB 1RYHA 3C16C 3Q3JB 3REFA 4BLTA 1N25A 1AKEA 4XD7A 3PEWA 5FL7D 5ELXA 1VCOA 4Q4AA 1W4CA 3T5DA 3KFVA 3HPQA 2W2VA 2J1LA 5JWRA 1LY1A 2E87A 4E22A 1G3IA 3AP2A 3C41J 1D9XA 5L3VA 1YRBA 1A82A 2ZS7A 3LLMA 3U3KA 3KJHA 5DO9A 5F3WB 1DS6A 1AN0A 3BB1A 2O52A 3PVSA 5BW8A 1A5TA 3QBVA 5FFMA 1NVWQ 5TDHA 1Z07A 2JJ1D 4W5JA 1Z6YA 4RKFA 1LV7A 4GPTA 4Q66C 2BJVA 3VR6A 2PMDA 2GZHA 2R6AA 3NEJA 4B3GA 2IYSA 4PO9A 4B76A 3WRXC 2O8DB 3W9YA 1EX7A 1Z6XA 2BC9A 2C99A 4S35A 3AUYA 2CCJA 3GLIB 2H8KA 5TVKA 4W9MC 2ODNA 2KJQA 4IJMA 4LJ8A 3LLUA 3WYFA 4LJYA 2PX0A 2C2HA 1KOFA 4D82A 3OEEA 3AVYA 1MH1A 4B33A 3CRQA 1OXTA 4DRZA 2QL6A 5DI3B 1VG8A 2BWJA 1VG1A 2QT1A 4M9QA 4NYIR 2R6CA 4QJ4A 4EPYA 4ZI3A 4LJ4A 1G3MA 2YNMA 4N3NA 3N70A 3RAPR 3RC8A 1FOEB 1WDTA 4MKGA 1D8TA 1GNRA 4HAZA 2OBMA 4QFMA 4L9SA 4II7A 4M9ZA 5A0FA 3DM9B 3VNUA 4Z51A 4DIDA 4Q9HA 4LYHA 5FUWA 3UMRA 3QG1A 2CVHA 3KB1A 3P27A 2ZUCA 3SJAA 4EPXA 1KO5A 1M34E 2FZLA 3CRW1 4A15A 3QEJA 2C03A 4A2PA 2QM8A 1OHHA 3IQWA 1NVXQ 5HCIA 3EPJA 3ECCA 2O8CB 1OSNA 3UG6A 5J4HA 4TT3D 1VTKA 3WYAA 1FL9A 5DGXA 2PX3A 5IK2D 3WMGA 3BH7A 3AP3A 2VLIA 3QE0A 1OE0A 2Q3MA 4X8LA 4CF7A 1P72A 2OEPA 4URWR 3K09A 4CEHA 1CS4C 1VYVA 3NC1C 5FI0B 2WKQA 4TTRA 3VFDA 3U44B 4KI0A 1GKUB 3AKDA 4DLSA 1K5GA 1VIAA 5KU1A 1N6LA 4Q1FA 1YZQA 2QSYA 1JEEA 5BXQC 4BLQA 5CLQA 2VTKA 2ZAMA 2IYRA 3GMTA 4DCSA 4EPTA 3NBZC 4FCTA 4PZYA
chains in the Genus database with same CATH superfamily
1H2BA 1X87A 3CXRA 1TIPA 1ENZA 1EWRA 3NGXA 4KAFA 1CHNA 2YN4A 4HAUA 1F38A 2A5FA 4PANA 2WPDA 3RS8A 1NNEA 3BFPA 2GSWA 4KCGA 4ER0A 1ULSA 3Q5EA 4LXTA 1UJ5A 2QY9A 3HP1A 1JKMA 4G5QA 1QRDA 3ZOKA 3OT4A 1L5NA 1QIHA 1Y1PA 4E3WA 2IX9A 2AD5A 4XD7D 2CNWD 3WWCA 5ITZA 4WCDA 1X94A 3D5EA 5E6SB 2PL9A 1T3GA 4HNAA 4PLWA 3V9AA 1C8BA 2BH9A 4AJKA 2OM6A 3NR2A 4TKUB 1XZ8A 1G8SA 1AQJA 3GI1A 4DJAA 4E7PA 5I8WA 3PC6A 5FF9A 2UU9B 3WFJA 4HRVA 5A5FA 3FGPA 2XMQA 1TCUA 1GUDA 1TJNA 4MW7A 3PL1A 2I1QA 4MROA 4MYUA 3THRA 5CTAA 4QBIA 4TQAA 2QN2A 4NVRA 4NJOA 1BE0A 4PX5A 1CQIB 1HEUA 1MC8A 2CJYA 2GS9A 2EZ9A 2B2NA 2WHXA 2ZSJA 5K0ZA 1X1RA 3ACCA 4RLQA 5EQFA 3IP7A 2HA4A 4DSNA 4HEQA 2QLBA 2UVQA 3EIXA 1F3LA 2ZSEA 1T5OA 3KOMA 4IS2A 3WLHA 4CGYA 2JL1A 1CEEA 1W4ZA 3BWYA 1KI1A 5A3QA 3SIWA 1HOXA 1N9GA 3KQYA 1UZUA 1FFSA 3B13B 1ULUA 3IR5A 4TLEA 4W9NC 1HQDA 3FFXA 4FLEA 1EDEA 3RIEA 5BQFA 5IJ9B 2QBYB 5BYKA 1E4EA 1MT3A 2ZJ8A 3R5SA 1UIMA 4XR9A 5KWIA 1AA9A 4D5EA 1TECE 4JXJA 4UDYX 1F0YA 2PSEA 4OP3A 4G23A 4DIMA 3LTNC 4DXHA 2V9CA 4EW2A 4E08A 2C2GA 1T3ZA 3S5UA 1U0HC 2Y66A 2YRFA 2L69A 1Y5NA 3B36A 5J5CA 4US1R 4CF4A 4NXNB 3PUZA 1OI2A 4FHEA 1XA3A 1B00A 1BE6A 4HO1X 5LQJA 5FPQA 2ZRAA 1KOGA 1SXJE 4F5DA 2D2VA 5I48A 4HZGA 3RS0A 1A97A 1FDSA 1YF3A 1SMKA 1XEXA 1GDDA 4MB6A 3GXBA 1NPTO 2H57A 3EQ8A 3DHVA 2TRSB 2Z6AA 1U99A 2VPXA 1U3CA 5CVTA 2CNDA 3ESDA 1VKRA 2ZXFA 3S44A 1ZJWA 5I7WA 3SR4A 3TWOA 1V7ZA 1HZZC 3MRVA 4BBZA 4LWZA 5ERXA 3GHYA 1GG9A 2Q5LA 1RYDA 2G77B 3MAGA 4HGPA 5F5NA 3STHA 3DXYA 3A1SA 4BIMA 1YB2A 3NT5A 4DAEA 1K8QA 3OT1B 4QXMA 3DHYA 3T9CA 2GCNA 4TYWA 2VAMA 2IXAA 3FIUA 8ADHA 2FEKA 4XFDA 4B71A 3L0IB 5KOYA 4PYNA 3OFJA 1GTL1 4DV5B 1CW2B 1Y9JA 2F43B 1Y98A 2ABWA 2GAJA 4X64B 3KCNA 4TN1A 1DAEA 3X1ZA 2OZPA 3ZVRA 4DS3A 1XYYA 3KJEA 3L18A 4JJZA 4DZZA 5J63A 5T64A 1FDVA 2BPOA 5DNYB 4CE6A 1ETHA 3MTBA 5JD3A 2JW5A 2YV3A 3GYGA 5C32A 5JFTA 2PV7A 4TV8B 1FDUA 2O07A 4RGYA 1XV5A 3GJSA 1GUYA 4LAFA 2UYOA 5DNDA 2P2SA 2V4ZA 3W6OA 3ZCTA 4BO5A 3S8YA 4OP2A 3EPHA 3EIFA 1U8FO 4FD2A 1DXOA 2E85A 3S2YA 1LS1A 5BO5A 1SRQA 1Q0SA 4IQ4A 4L27A 3SXJA 1YBAA 4JJ8A 1U02A 2O8NA 1E7SA 2PQMA 2ZSUA 4FYVA 5EQDA 4BN0A 4BCCA 3NNDA 3KOYA 3C45A 1RKXA 1CZNA 2VPYA 3LRTA 5CDYA 3O74A 1Y48E 4MV3A 3IHWA 5ALKA 4RVUA 3HU2A 2C95A 1W52X 2PZFA 4Q7KA 2UVPB 4XAQA 3IT2A 4RLSA 4BTLA 5KNBD 3B3GA 2I6TA 1KK1A 3Q7PA 3DNFA 3I01A 3IR6A 4ZARA 1G41A 1N92A 3HNOA 5CBKA 2EF1A 5HF8A 1U0OC 5JDCC 1F7UA 1CBUA 4UMVA 4RDHA 3TEMA 1GPKA 1PR5A 3MMPA 4I9UA 3CC8A 2XCTB 4RC9A 2BGJA 2ID7A 1YDEA 3PEVA 4WY5A 5EERA 2NPFA 4TRNA 2PLRA 5A1JA 2KQUA 3OE4A 4TKLA 3C1TA 3CF6R 2PWAA 1EUZA 2BV3A 2HL6A 3H9QA 3PQ8A 4Q4CA 4ZZ3A 1I10A 1OXMA 2HPZA 2GJ8A 4JBIA 5A06A 2WUFA 3IPXA 2A0WA 4BCBA 1A4UA 1Q0TA 1CUGA 4UULA 3Q4GA 1FNDA 1GUFA 3HJAA 3WWYA 3C97A 4GZ6A 4LRSB 1QZ3A 1XTSA 3IPLA 2VWPA 4OXRA 1YDMA 4WLFA 5T4FA 3AUJB 4MPDA 4I1YA 1IYZA 2BBOA 4KWEA 4JP8A 3SQMA 5BNTA 4K86A 2GEDA 4GBGA 1QHFA 4C6HA 1G6HA 3U4DA 4WXEA 1GQRA 3QU4A 1Z6TA 4HTAA 4TQ9A 4YJHB 4YMIA 5HZMA 4ND8B 1DP4A 1F9AA 3CCFA 4B35A 2EERA 3IVMA 1XC7A 4HH3C 4HZUA 4LDPA 3QY0A 4ON9A 4P80A 3PQ7A 2AK2A 2DBYA 2I1VB 3TS1A 7MDHA 3RSQA 2BF7A 1FPMA 1GLVA 1XF9A 4M55A 2ZPTX 2HSWA 1B76A 5ALZA 2OWDA 5ES3A 2B1QA 2V45A 1FTWA 4KQKA 4Q3NA 2PBFA 3ETEA 4HS4A 5AUNB 1Q0UA 1V4BA 3DQZA 3PVCA 1C4WA 2X13A 2XZTA 3AQIA 3NDIA 4M8LA 5HBRA 5JSFA 4XQGA 4Z53A 1ZXXA 4QXAA 4R2WA 1GFSA 3THWB 1QTNA 2B6NA 4ZHQA 3W2FA 2CNLA 3MWLA 2XB4A 4G5SA 5HEKA 4HZIA 1CDOA 2F64A 2LKCA 5LMCA 4GDFA 4RSHA 1ODTC 1YBMA 1XZLA 1XTQA 4HKTA 2VC2B 1QS0A 1F51E 4K9NA 2WSSD 4FUTA 4Q3DA 2PM8A 1QYRA 1U8CB 4FKBA 1N0HA 1LPAB 1Z4LA 1UODA 2WJYA 1CQWA 1P7WA 2AR7A 3DTNA 4WXMA 4D4KA 3L7MA 2ZI6A 1BH6A 1AGYA 1UFRA 1EJ2A 3T1VA 3EN0A 3OZIA 1CFZA 1TT5A 1IBSA 3MILA 2RH9B 4NATA 5FBWB 4Z3OA 1LVHA 1DL5A 3PDWA 4KBFA 5BQPA 4MGKR 3RYFB 1QC5B 2VKTA 4ISCA 5I3CA 5ILOA 1WXDA 1KIMA 3VH2A 3IFSA 4IIYA 3DLCA 2DUWA 4U7WA 1YZFA 3ZQ4A 3M5DA 1UH5A 1ZEJA 3L0DA 3NETA 3UF0A 3E15A 4CIDA 3LUBA 5LDDC 3UGJA 1OBFO 3HR8A 3BXFA 3B52X 4INOA 1R8XA 4MDYA 3TKLA 3HXOA 3I3SR 5IVKA 4MKIA 2JJQA 4QO8A 1MVLA 2BL4A 2Z2YA 1UR5A 2GASA 3TK1A 2OXFA 4WXPA 3HH8A 4EECA 5T7BA 3OFKA 3WSTA 4KLCA 1KEVA 3FETA 5FKJA 2JEYA 2XUHA 5C7LO 2WR8A 2F1RA 2ZPUA 4RCZA 4QT0A 5A7GA 1E2DA 4YK7A 2WDPA 3H9BA 3JALB 1E6LA 3SQLA 1K6EA 3QX9A 2HU2A 4D02A 4I8IA 3G8YA 1N32B 2B8JA 5HGJA 5BXYA 3KQKA 4QUDA 1DJPA 1YMQA 1U1GA 2FUKA 2B2XA 2V65A 3B6ZA 3H11A 3OFND 3BWXA 5FLKA 4ARUA 3MLEA 4RHFA 1Q0LA 2C4WA 5SYAA 2NP7A 5EIBC 3HCOA 1MC4A 1E94E 3WAJA 2F3PA 2BN4A 2UYQA 5JJBA 2P2DA 1I0LA 2XUDA 2ZU0C 3KELA 4OHFA 3NBAA 1Q0PA 4QJIA 2PPLA 5F51A 5FBZA 2HCFA 3WQSB 3EUAA 2XMRA 3G85A 4ZT3A 2IUFA 2H4FA 4OHKA 2QTWB 4TLLB 4KZPA 5C4GB 3SJUA 2HWKA 4D0SA 3PC4A 3FDJA 2XZOA 2AR9A 2QRZA 2WLSA 3UUEA 3G17A 3KKLA 2QMEA 3TLJA 3JAWB 4U7PB 1LRKA 3UTCA 2YWEA 3JQ9A 4NK5A 3RGGA 1SR8A 2AYZA 2LWIA 3FJOA 4YHHB 2WYVA 3AB7A 4IHAA 5K0LA 5I4IA 2KPOA 3G0GA 3SBDA 1GNTA 1VHDA 2I4RA 1SKQA 4KYUA 1AKNA 2P6OA 3BE8A 3ANNA 3BJEA 4CDNA 1EUQA 3EDOA 1L0BA 1ZVJA 3V1MA 5ALSA 3KEQA 4O02B 1ISJA 1Q14A 3R6WA 1E2QA 1N0UA 1U6IA 4XDZA 1EESA 4EUSA 3A0UA 1R6BX 3WXBA 4CNBA 3E9NA 4MKRA 5FJJA 3W7VA 3GC6A 3QFTA 2RH8A 4UHKA 1Z7BA 3DUWA 1NBEA 2EFHB 2GHTA 2HU8A 1P0IA 4GNRA 4O63O 1ADGA 2NACA 1L5LA 3AW8A 4Q4HB 1D07A 1FNNA 1EZZA 4IDPA 4PZEA 3BMNA 1OYYA 4MEJA 5BN4A 2NSJA 3JZAA 1ODKA 2JKZA 2XVXA 2D5LA 4KK4A 3I1FA 4EJSA 4ZI7B 2GAIA 3IRVA 5ITWA 3RYFA 4TS9A 3KSAC 4X63A 4YRCA 2LZ0A 1EB9A 2ZCJA 1VLQA 4IP0A 2QXYA 1CDDA 1VZ2A 1GT91 3LHIA 3RHSA 4JBYA 5GM2A 1JEAA 4FSHA 4X3OA 1WZNA 3VJMA 3Q11A 2AOTA 5KVCA 3TPFA 3Q12A 1GV1A 1Z47A 2B3TA 4R5HA 4WW0A 3SP1A 1H9AA 2IQIA 1IL0A 2E55A 3F71A 4N40A 2AE1A 2PVPA 3D8HA 4AYXA 4UTRA 4PG4A 1OFGA 1Y8RA 4ZT5A 4IDBA 1XEFA 3R3JA 4J0CA 3PFKA 2ISSD 3N07A 2VF5X 2PX4A 4PZUA 2PX6A 5AJVB 3RUIA 4D81A 1NQXA 4D0RA 1DLJA 5CPBA 3K16A 1G5RA 3Q9SA 4KMRA 2QL5A 4BQSA 2BFFA 2R7AA 2KM1A 5E3JA 1TQ4A 3CG4A 5EJEA 2YFYA 3RBVA 2OXRA 3W2HA 4PLZA 3O0TA 4CKZA 3UCXA 1DDIA 3BGSA 4QU5A 1I7QB 1RI4A 4G4JA 1KVSA 2H16A 4IS3A 4JEIA 1M6HA 1MAVA 1P61B 1KC3A 4J7AA 4L6AA 5B1DA 4AJ2A 4D44A 2M98A 3BG5A 1Q1NA 2DZDA 1R6UA 3ESQA 4DWJA 4C04A 1O5IA 4WAUA 2Q45A 3DE1X 4GPD1 4K40A 4WBNB 1LBIA 1DKNA 5SZIA 4PNPA 1YULA 3ZXUB 1J22A 4BVBA 2ZIGA 5J58A 2PKYX 3K0HA 4LRYA 1DBIA 2B36A 3ROTA 1CB0A 2D00A 1QVAA 2VQSA 1KWKA 1A1SA 4RA9B 5F1PA 1ZXLA 1ADJA 1VFNA 5LFAA 2I76A 4JA2A 3IGFA 5CRIA 4A23A 1Y6ZA 5C53B 2NO6A 4U7HA 1A2QA 4B4DA 3KPYA 3W5CA 1O96A 4N4AA 1KK0A 1GTZA 2COEA 3GFVA 2Z5FA 1EFTA 4Y2TA 5D01A 4BMNA 4BWGA 4O1HA 3AETB 2VYFA 2H3EA 1XCLA 4V3BA 4BX2A 2XI4A 1CK4A 1AQNA 1PEYA 2WM8A 4MUFA 2VEDA 4C7OB 2QR3A 3FVRA 2FJUA 4GU5A 5F7XA 4I4LA 3SX2A 2P68A 2YOFA 1YL7A 4K46A 4EI8A 3LXMA 1ZOSA 1IRXA 2X3UA 3CT4A 2DM6A 1XPRA 3VBEA 1RD4A 4FMPA 3SBOA 3ABRB 1GAXA 2VBFA 3T7DA 4IEIA 3QSYA 5JNTA 1VSTA 2B8EA 2C2WA 2F90A 3M1YA 2X0FA 1PGPA 1D1PA 1J8MF 5B6PA 4HDRA 4P2GA 5C35A 1UPUA 1XZJA 1JQEA 4NJEB 1T1EA 3DV0A 1NNSA 3D2LA 3LA6A 1GRVA 1OYVA 4J75A 3DAGA 4R0VA 3A05A 4EUKA 4O0MA 1JFTA 4XTCS 1J56A 3LP6A 4DIBA 3SU8A 2GXAA 3OC0A 5CT8A 3ZN2A 4KFCA 3DQPA 3EFHA 1TYBE 4JNKA 2O4CA 4TUYA 3NCHA 4UNNA 4MV9A 1NAHA 2KHZA 1TAUA 5LPNA 2V3CC 2ZJ1A 4I3HA 3WNVA 4JZYA 5DT9A 1OUMA 3JARA 2V7GA 3RF7A 1FTNA 2WQ7A 4L8GA 4DR6B 2YZKA 3T61A 3HBAA 3L1UA 1WUKS 3W3AD 4JLAA 2HJ9A 4J0DA 4TWRA 1AHPA 2FSFA 1CRLA 3T7RA 2F9MA 1I4EB 1O87A 4CXMA 2IXTA 1PP4A 3OO1A 1IEQA 2XAAA 2X0KA 1GG8A 2VP2A 3CINA 3FMPB 3P5SA 4LI0A 4MZDA 3QFSA 4RL6A 5A3VA 3FUXA 3NATA 3WWZA 4EF5A 1SVOA 1GGNA 4F97A 5L3QB 2W2KB 3UJCA 4ZCSA 1UWLA 1S2DA 4NIMA 3MJTA 4S0ZA 3RT1A 4B9AA 3I6YA 4RMIA 3DAFA 4CRWB 2NVOA 4AD8A 3OPQA 5G41A 2O7VA 2A86A 4J49A 3UWKA 1FSZA 4I5IA 5JO0A 3PD7A 4J3JA 4KYVA 3QE2A 4W5NA 2XQVA 4JVNA 1M1ZA 2A5YB 1HT1E 5FR2A 2C7RA 5DNUA 2WJGA 2AGVA 2Z43A 3OJFA 2LV8A 1RRMA 4MQEB 1FX0A 4J8PA 2IUEA 5CK4A 3LOPA 1R10A 3GD7A 5D3ZA 1PT5A 1E2JA 1O6ZA 2B25A 4FOLA 1BO6A 4FX5A 1R0WA 5CYPA 4NI5A 3N74A 4QPNA 5CFNA 4EO9A 1P19A 3PF8A 3F97A 1PTKA 1BROA 4P81A 3K70B 4Q34A 5CM9C 1ORTA 4PLTA 4QJ3A 4Y2YA 5JTUA 3KJGA 3NWOA 4CKCA 1MTOA 3MK31 2G9RA 4HFMA 4IVNA 4WZAA 3VQTA 5JBQA 4LMRA 3CX4A 4DZRA 3DCYA 3D4OA 1C3VA 2VYQA 4O3MA 3OBBA 3WGVA 4BO3A 5D8DA 3C3AA 3DTVB 1AG9A 4UAVA 5LXTB 5I7SA 3X1DA 3HB1A 2FF7A 1BZYA 2VRCD 2ZJ6A 3MWDA 1Q2UA 2G0NA 4EIWA 1ZESA 3ZWYA 3J7AC 4EHHA 2QDKA 4RVFA 3FDZA 1T5TA 4DWWA 1GG2A 5B30A 3GJ0A 1YZNA 1FMJA 1BXRB 1D6MA 3DFFA 4KE6A 4KDRA 5AKYA 3RUHA 2NVUA 3U4CA 5AK3A 4CUZA 2OXEA 3NH9A 3OCXA 3UBTA 1KE2A 4TYPA 1B93A 1NVVR 1SHZA 3ZV3A 3AHIA 2WYUA 3TI7A 2P2ZA 3EMDA 3PNMA 4INJA 5D6NA 1QJCA 2YY7A 5H83A 2XRZA 3EDMA 3WK7A 3HU3A 3KT8A 4LFCB 3IAS1 1LPNA 1YE8A 2HDOA 2Y1XA 4G36A 4HDSA 4RJLA 1GFIA 1R5BA 4CMAA 1E6UA 2WJWA 3ZDBA 3AL0C 1U3VA 1FP7A 2IZ5A 2ZDQA 5JCZA 2C9MA 3M9LA 1OTHA 1K6IA 1IN4A 1KFKB 5JHGB 2CCGA 3TFQA 1C50A 4CLHA 4NRDA 3SHFA 5BV8A 1L5VA 4QJ5A 2ILTA 4ZO9A 4B75A 2HWWA 3CPSA 1DAKA 5HWSA 2QQ5A 2HC9A 3AJ9A 2FR1A 2JKYA 3K6SB 1O54A 3DR3A 2E4WA 3F8TA 3IXMA 3TFOA 3NMUF 3NXKA 1KZ9A 1Y3AA 2B4KA 3BB3A 3NX4A 4GLOA 1ORDA 1MZVA 5KHAA 4WBNF 2PD3A 3FZYA 4KQ2A 3DL2A 5IJ9A 3CJTA 3KQUA 1GZUA 1Q21A 2DHQA 2O2YA 1B1AA 3NB0A 3IOYA 4X44A 5DXFA 5IP5A 4A0SA 5DH9A 4LWOA 1HFWA 4DQ0A 4ND3A 4YR9A 2G7ZA 4X7RA 1NXVA 1R4NB 3IAM6 3RJTA 3KPUA 1VCMA 2J9ZB 5ELMA 5HQTA 5L4LA 4B6SA 3IILA 2PLNA 5KTRA 3KZKA 1CUDA 2XE8A 1WCV1 4TRJA 1E6KA 1TMGE 2I1WA 2OO7A 3LUJA 1XTPA 4FXOA 2VP3A 2E6KA 2E4XA 2O8EA 1U5BA 5BW5A 3A9TA 3IO5A 3U9LA 5LZ5A 2I99A 3M4ZA 4FOPA 2IHVA 4OAOA 2YXLA 4WEOA 2ZE6A 2X5JO 5BPHA 3NVAA 3FMIA 2PUVA 1FE8A 2FEPA 4FEGA 1QO9A 4HI0E 3F5DA 4CQMA 5K51A 3PE6A 1M0SA 1BFUA 2GLXA 4FSXA 4M99A 5F98A 5A1TA 4Q1EA 2C00A 2FPPA 1WB6A 3KKEA 3ZV6A 1ILEA 4HXYA 1B14A 2HQRA 2BEUA 1RBMA 4Y2RA 2CBZA 2PEZA 5B7QA 2XNHA 1HUQA 3C3XA 5CXXA 4ZO8A 2G67A 3SZGA 3UOGA 5FAKA 4HJXA 1Z88A 3PVZA 3MPUA 2AEJA 3B3FA 3MCZA 2PUHA 3VGJA 1Y6RA 3TF5A 1JDBB 2ONCA 2GZDA 2XBUA 4ZXFA 1Z0ZA 4MVJP 4B79A 2Z6UA 4BRUA 4PCVA 5J4YA 1DUIA 1YB1A 1DG9A 4IVPA 4CL3A 4KXLA 1XTBA 2I9PA 4K6MA 4W7IA 2HMWA 3AETA 3GA7A 4M60A 3OPVA 2R8XA 3VYUB 4BBJA 4LKRA 5FHRA 4FYKA 1B6TA 4BFXA 2CNKA 2G9UA 2G76A 3NRBA 4MS3B 4YUXA 4R8MA 4OATA 1RTTA 4ZO4A 1S8FA 1ZM4A 2Q7DA 4DRYA 1KFBB 1K1EA 2N1BA 2X9NA 4QOIA 4BWVA 3E1GA 3AI7A 2BRUC 4G85A 3W8NA 4EB8A 5HIKA 1X8LA 3MEQA 3SYKA 3WJ2A 3G8DA 1NJ1A 4WKOA 4M9XA 2RG1A 4JI8B 1OXSC 3JYLA 4RK5A 1RLIA 5C80A 3QLUC 4K05A 1IONA 1E32A 1LSSA 1OAOA 2EG5A 5E38A 3A6JA 3ANSA 2J7KA 1KJQA 2OFXA 3FNRA 1JAZA 3L7IA 4KQ9A 5LBTA 5KMGA 2UVPA 3NOVA 2Z9BA 1Y1TA 4ADSG 4NMLA 4IHJA 1KEPA 3DDWA 3IE2A 1HE5A 1RKQA 2F1JA 1IJKA 2DBRA 1YIDA 1ODIA 2YW9A 2ZJOA 3CNLA 3O1IC 4LZAA 3BMQA 4GT1A 4MV6A 1KI6B 4F85A 4JCCA 1AQIA 2BMFA 3OZFA 3P2EA 1M6WA 4WK0B 1S9DA 9LDBA 5A9SB 2ZXEA 3H9JA 3LV8A 3GGSA 1W5AA 2C61A 1NFFA 1WPXA 1M54A 5K8IA 2PGOA 2X2PA 3FJYA 4QWWA 4S24A 5EWMB 5B64A 1Q16A 3PP8A 1K8YB 3OWOA 3K0FB 4TSFD 3DPIA 3TJMA 4PPQA 3TLYA 4BLSA 1WE2A 5FWYA 2PGDA 1KHHA 3DOFA 4JFRA 2BJHA 4RCYA 1SC3A 1KOJA 3DL7A 4OHXA 1A8QA 3CLUD 3Q8WA 3MJ4A 4S3MA 4NQRA 3THXB 5F4ZA 1WS6A 4DW8A 3Q7QA 4FFSA 2ZRPA 3KZXA 2C2OA 5J4LA 1PFKA 1VHQA 4WI1A 2BGMA 1E8DA 1GGFA 1R50A 1XCOA 1DZ3A 2H1HA 2JAOA 4MR8B 4V0SA 3IUPA 5ED0A 1BW9A 3LAWA 2VL7A 4BO7A 2M6LA 5JQGF 2HCJB 1KPHA 4Y8VA 3ZEAA 8GPBA 5DGDA 1CJBA 1JDNA 2R62A 5CCDA 1IN6A 1J5XA 2GRAA 2PGNA 3HJUA 3KQTA 4U7GA 2HV8A 5T3YA 3DZBA 3V6LA 5AUPB 1DRKA 2ACVA 2I2CA 1MGPA 2YWFA 4RQTA 5AVUA 2PMCA 3MJFA 2X0RA 5DSZA 4MXDA 1JR4A 1MR3F 4NBRA 4YRGA 3VR2A 1X14A 4OQFA 4C4XA 3T9FA 1QK3A 4FR2A 5H1YA 4A82A 2CV2A 4L5IA 2V7XA 2KYRA 2WTXA 1E5XA 1E7WA 2Y92A 2ZRIA 5J59A 5K9ZA 1CC1S 1W73A 2ISCA 1FUKA 3NHAA 1UJCA 1WLSA 2H9YA 1G63A 1YRQA 3EIUA 3LXUX 2RE8A 4C0QC 1KDRA 3NP7A 5JVDF 5DM60 4C07A 4U5QA 4PG8A 2DQ4A 2XQKA 3ZDQA 3W5HA 2CY0A 5LMUB 5LZ9A 1IPFA 2FTKE 2PRIA 4FK8A 3HEMA 5SICE 3UWSA 5EJ4A 1TA4A 1NVKA 1W0KD 3A8TA 3NASA 4NAHA 1T0PA 4IM7A 4TL7A 4KBGA 4UU1A 2ZBEA 5B6IA 1RBZA 2WWGA 1IEWA 4REQA 4KODA 1TA9A 4P3OA 1MIOB 4QYIB 2JLXA 2HMVA 3VMFA 1R9JA 4TMXA 5BNZA 3IQGX 3LUHA 5JCPA 1EK0A 2EHJA 1T8PA 1JG3A 4KU4A 5FEMA 5T5QA 3A2KA 1FUYB 3TCNA 4V0OA 5T6MA 3Q8LA 4KBYA 1PGJA 4HDQB 5AIBA 2IYQA 3WNBA 4H0NA 4KRFA 3QWFA 2W8BA 4TYMA 4YP5A 2GWRA 1RADA 4XQ9A 3A1TA 3OFSA 3MFYA 1GGHA 1G20E 3H5OA 1VPDA 1ZLYA 2BIFA 3LQRA 3SHOA 1W0KA 3HEAA 3JQCA 2H1VA 3Q5DA 4ZVPA 1VYTA 4B4KA 2WB2A 1D8AA 1V11B 2CUZA 3K4HA 1KKLA 2W2XA 4F0JA 1U1IA 4NENB 2P2NA 4RVNA 2NXEA 1Z18A 1KDZA 1FYXA 1DVRA 5FTLA 4I55F 3U9SA 2ATXA 5MFZA 1WVIA 3OI7A 1SCDA 3OMXA 3OZEA 3S1AB 2FE1A 3JX9A 2WG0A 1IPHA 3R6DA 5TS2A 4M86A 3V4LA 4D8VA 5LP6B 4OJYA 3FMOB 5HM6A 2OG2A 3FXAA 4GE0A 2XZDA 5ELLA 4DMLA 3ND8A 4PYIA 3GH3A 3KU1A 1DLIA 2XOKA 2FMFA 2IIBA 3L0CA 4I99A 2PYIA 4I55A 1K7YA 4IR7A 4NE9A 4UM9D 5AJXA 4PSUA 3K5WA 5BUSA 1BYUA 1JUDA 4C88A 2CLSA 1GWNA 2C98A 3EDRA 1YXMA 4FMBB 5CP8A 5C8YF 2IX3A 1L7XA 2G1AA 2QVXX 1BFKA 1FU8A 2XYQA 1P2VA 2PKRA 2YV4A 5CJPA 5BV1A 1J0EA 4S1OA 5JAZA 5JZMA 3E5MA 1SHLA 2LE0A 1CYDA 5CAEB 3PPXA 4LGVA 4PPGA 4E51A 3COVA 4QBGB 1N78A 4IRMA 3HXTA 4F12A 1MV8A 3L4EA 1GEEA 3RVRA 4ZK2A 1T6YA 2XZPA 3VTZA 1YKGA 4MWOA 2BFNA 1H8ED 1KBZA 1P9NA 2Y1EA 3ANYB 4IFTA 3ASZA 2OOKA 1R8QA 2B0JA 1PX0A 2W2NA 3L4SO 1LDNA 4LSGA 4R3WA 5EKXA 2D1YA 1WB9A 4UE3S 1WM1A 1YZYA 4RXMA 1NDUA 1WXIA 3MD0A 4NP6A 3ADDA 1OGJA 4XIIA 3DE3X 4KAJA 2ZIVB 4A5OA 1PGQA 1DQNA 2WUGA 4NX2A 1E9SA 4EX6A 4D9NA 4L2IB 4DG5A 3AVUA 3K2QA 4MVJI 1O97D 3HL4A 4NBWA 3PFBA 4JOCA 1BN7A 4YR7A 3NBFA 2AE2A 3EQ9A 3K8ZA 5GGYA 3HVUA 1OX5A 1SOMA 4P3NA 9MHTA 4MHTA 4DA6A 1JHAA 3C43A 4YAIA 2C1EA 3UJ7A 1P3DA 1KORA 5EZYB 1ULAA 1RXVA 4NBSA 1WP9A 3EGXB 3FB4A 2VG8A 5DK6A 3RJMA 2ZLBA 4E0BA 1LDMA 1PJ4A 2BGLA 3T99A 1VRWA 1CRPA 1BSVA 1E5LA 4EJSB 1ORIA 3ZWBA 1MQ8B 2JASA 2H0RA 2I6SA 4GMKA 5DX0A 1IC6A 5KQGA 2I6XA 2R4TA 3LQ2A 2XZLA 3GP5A 4Q9LA 4Q4HA 5CUQA 3T34A 5C3MA 5BWBA 2EFGA 1WUTA 4QREA 1M5RA 4K28A 4P83A 2AJTA 1U31A 5ISMA 4MS3A 3ZZUA 3LKBA 2D2EA 3L0PA 1SB9A 3D3WB 1QH8B 3P2IA 4Q9DA 5C1PA 1L5QA 1P5JA 4DJJA 4PYQA 4RFSA 5DTRA 5BP7A 5IT9A 2G4VA 3KR2A 3I6BA 2I80A 1U2ZA 5JEDA 3PRJA 3V4VB 4E70A 3Q87B 1BKDR 3N8KA 2GHRA 4GW3A 2P3OA 3I5MA 4DG8A 4HK4A 1Z2CA 4N8EA 1YR9A 2NYVA 4W5WA 1LSOA 2JH9A 1T9GR 4DJEC 1NOKA 3IEKA 2I87A 4H1UA 2EATA 1C5KA 2ICAA 1OIVA 2N42A 1T1JA 1FFHA 3DV9A 4ENUA 16PKA 1I7LA 4QG3A 3P4UA 3A4NA 2GQ0A 2PSSA 8LDHA 3UFBA 3AFIA 3KDPA 4CMBA 4NDZA 2I2WA 3IE1A 1JG4A 1Q0HA 1Z5PA 1GXSB 2VDWA 3KJQA 2R00A 5JMWA 3N0WA 2EW8A 5A4FS 2JVKA 4XYLA 3V4PB 3DUFB 2C3OA 1EFCA 1YCGA 1L6IA 1RKVA 1SOWA 3KSZO 4NH4A 3H86A 2QAIA 1VL8A 3BE6A 5T4BA 3NBQA 3EGEA 1XHLA 3DNPA 3EXHA 3GCGA 4MW6A 4RKEA 5DULA 2BLLA 3AMVA 2F3UA 4ALJA 5CA1A 1BGWA 3E5HA 4AN4A 2QP4A 1XKQA 2WFLB 2WYIA 2YQ5A 3COZA 2DUNA 3PWZA 1GZVA 4JYPA 3A1CA 4ANFA 5DHTA 3QKRA 3LO5A 4FDAA 1GUAA 3JARB 4FHZA 4HPWA 3OZ7A 5GP1A 4WOBA 1M75A 2GH1A 2IY8A 2IYAA 4V0KA 4XJTA 5FDFA 1VCHA 1OXKB 2ZTVA 1OXUA 1PG5A 2LTAA 4KFUA 1B15A 5J2UF 2Q5CA 3CF2A 3ZWPA 3X44A 1V7QA 5TPZD 4FVTA 2CL6X 3DUFA 5AW9A 1TCCA 1M2VA 4RF2A 5CH3A 2QYHA 5EZQA 5F5LA 3SDBA 1K7EB 1MTZA 4FBMA 3HQ4O 4JLJA 3USES 5MGNA 4RHEA 1WXGA 1WMDA 2O2IA 4B6JA 1IZ9A 1ZNYA 4PGAA 1U0SY 5ENVA 3DBLA 4IIUA 4J43A 1SY7A 1AF4A 3K4QA 4N12A 3RYCB 5I45A 5FPKA 3EF3A 3L49A 5DK4A 2V0NA 5LD2C 2X8JA 2RHMA 5D5PA 3IT3A 3R5TA 4I3GA 2GVZC 3TB4A 2W6PA 4F4IA 1OWPA 2FHSA 3LP8A 3IH5A 1Y6QA 3CRVA 2ZITA 3PNKA 4TUYB 3WDMA 4EY5A 3GRCA 4XWWA 2Q2VA 3DVRX 4H6WA 1SOAA 3LPAA 3O4GA 1CY7A 4G37A 1QH1A 1D9ZA 3OIGA 3KDAA 1DC7A 5J1TB 4ES6A 1E1YA 1J2EA 2PA0A 3EBLA 3JQGA 2PX8A 2IYEA 2F55A 2WIDA 2NZ8A 4FGWA 4CU2A 2B1JA 1OLXB 3PLNA 5DBOA 5KC9A 1M0WA 3A28A 2ZAYA 3ADKA 4OUDA 2WAMA 5LKAA 3HZRA 2VJDA 4GM4A 1Z15A 3KQPA 3U6BA 1SQFA 4YCDA 4Y2UA 3R7WB 1Y1KE 5DISB 4BOYA 2ZETA 5AOAA 3J80A 1D3AA 2GESA 4RH1A 3GEPA 5BSMA 1ZIDA 2R1TB 4AKHA 2QS9A 1PYOA 2BHTA 2L18A 2WZBA 3IYLW 4AURA 2Z2XA 2DFLA 3NV9A 2A9RA 4M0LA 1TM1E 4TV9F 4ENTA 4PFSA 4R7TA 2RSLA 3DBIA 2HHAA 3BL5A 4FFVA 4UNQA 3ZWOA 3AVOA 2CXRA 4WFQA 5B1YA 1AA6A 1UBSB 3I3OA 1KRHA 3EF0A 1H85A 4L50A 5EPOA 2PKCA 3ICPA 1XBTA 1L4LA 2G5TA 1YR7A 4TS3A 3ORYA 4W7SA 4F4JA 1F48A 1MXFA 3DE5X 2OR3A 1KJIA 3OQIA 3VSBA 3EPKA 4E2FA 1ZWLA 5BY2A 3ESYA 1R1DA 2EJCA 3MZ0A 4RJKA 3V7WA 3SF0A 1OBOA 3MGCA 3JVUA 1KBOA 2P6UA 4QIHA 3W1EA 3P0FA 4EG5A 5JYDA 2CZQA 4Q1BA 2WU1A 1V6SA 4M1QA 4UVDA 3UOWA 1YR3A 1R8SA 3VVCA 3A14A 4CFSA 5BVGB 1HYBA 5BWCA 4JNCA 1H05A 4IFIA 5C31A 3P26A 1T6BY 2WWTA 3FMFA 3GFRA 3L7JA 3PPYA 4BQPA 2X1LA 1TZ2A 3C8DA 3MMXA 4BN5A 1JJIA 4V0MA 8ABPA 1R4MA 1Z3CA 5GMOA 2C04A 3AWDA 2IS1A 3KXDA 3ANLA 3GLUA 1S3IA 4K6GA 1RLOA 3H19A 4JQCA 4N9QA 1O5TA 1QGYA 2SBTA 4MP6A 1IN7A 2A6PA 1OD6A 2QNBA 1YGPA 3IDAA 2W4QA 4MOWA 4CQMB 3L6DA 5L53A 3UIEA 5SZHB 1VE3A 4UE2A 2JS7A 3CNNA 4KXYA 4OYLA 3IP3A 2Z8YM 1U3GA 3N5KA 5HMLA 1FTQA 1IDOA 1U3TA 2G72A 4ARAA 4D80A 4R51A 3IX7A 4YV0A 3OUTA 1ADFA 1PK7A 2NTEA 4X1OA 4BX3A 1Y5RA 3ACBA 2JK1A 3DL4A 5K5EA 5KQMA 4RVGA 3MRXA 4TPKA 4CR7A 2FK8A 4NZOA 2Q3EA 4BLRA 5DZSA 5EP4A 3E8MA 3HYCA 4G5GA 4KEAA 3NGLA 2CGEA 3T54A 4R2JA 4MVJG 1EFAA 1T43A 1TM2A 2ZI3A 3EXEB 5BV2P 1Q2XA 1QHYA 1NRWA 1CNEA 1SG0A 4LXHA 3LVFO 3TLEA 4AB1A 3NYRA 1WUHS 4Q3CA 2NAPA 3O47A 1FXWF 4UTXA 1QQAA 1KK3A 3BWMA 5SZJA 3CEMA 3VPXA 2IS2A 2ECKA 4PFQA 5H02A 3O95A 4CZ2A 3CONA 1JFSA 4B8WA 1I7DA 4IINA 2J5XA 3I2KA 3PCRB 5BW4A 3A2MA 4YS6A 1MJGM 4IV8A 4LX8A 2VQFB 2XOKD 4UUOA 1K5DA 1BXGA 1FZQA 1YCDA 3EVGA 4O29A 3QV1A 4UUAA 5CCXA 2PSJA 5FO0A 2V7QD 2GDJA 1NHGA 4WBSA 2NQ2C 4IGEA 5EVJA 3OZRA 1PFGA 1Z4NA 2DUUA 3ITKA 4GGPA 2C3UA 4TYQA 1W59A 4XQCA 1TB4A 1O6BA 2TS1A 3VSEA 3ENNA 4YJ3A 1JXAA 1PFVA 4IHQA 1CUJA 1A50B 1DKPA 1SXHA 4GKVA 4OHZA 1JKXA 4ARSA 1GKYA 5DBHX 2W0MA 3SYNA 4ZMSA 3AVTA 3FTCA 2FR8C 1ZCFA 3SSOA 2Z8ZA 3GLQA 5P8WA 5A0VA 4RMNA 2YVLA 5HOEA 3KSBC 2GZSA 5IDXA 4JDUA 1MOSA 1OA0A 5A4MS 3NOQA 2B61A 3BUSA 4K2HA 1TTHA 2JHPA 4I4TF 1XSEA 2CLFB 3K2IA 3NHWA 3QWBA 1Z29A 4PICA 4RIFA 1VE1A 2F8SA 4YUVA 5KNDD 1ZISA 4KWCA 2DKNA 4Q39A 2E48A 2I4TA 2PL3A 4UC0A 5T8KC 3L82B 5JANA 5DTQA 1RYZA 2X0EA 2W6JD 3L6UA 1EFPB