3A6SA

Crystal structure of the mutt protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
125
Chain Sequence
MKKLQIAVGIIRNENNEIFITRRAMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mutator mutT protein
publication title Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 35
structure length 125
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3a6sA00
1V8IA 5FSIA 2YVOA 2JVBA 3EESA 3EXQA 1OW2A 5DEQA 3I7VA 4N1TA 1JKNA 3F6AA 5FSOA 5GHMA 1X83A 4MPOA 5IW5A 3A6UA 2FMLA 1NQZA 1V8SA 3WHWA 2PQVA 2J8QA 5DPKA 4ILQA 2ICJA 2PNYA 2B06A 1V8YA 3Q1PA 4KG3A 1PVFA 1JRKA 4NFXA 2Q9PA 5BONA 5ANUA 3X0LA 4JZSA 4S2XA 3SMDA 1MQEA 1VK6A 2FKBA 4S2WA 2CL3A 3X0OA 5DDGA 4S2YA 1KHZA 4V14A 3QSJA 3FJYA 1XSBA 1XSAA 2I6KA 2W4EA 4C9XA 3O61A 3Q91A 3A6VA 3ZR1A 1X84A 3GZ6A 1PUNA 3HHJA 1SOIA 3BHOA 2KDVA 1V8LA 2A8PA 5DD4A 5CFIA 3A6SA 3SONA 4HVYA 3P6YA 3G0QA 2A6TA 3COUA 3GWYA 2B0VA 1XSCA 1I9AA 4IJXA 3HYQA 1V8TA 1G9QA 1R67A 4JZTA 1RRQA 3O52A 4KG4A 3Q4IA 2AZWA 2VNPA 3X0JA 5GHQA 1VRLA 3MDIA 1KT9A 3X0PA 1NFSA 2GT4A 2QJOA 3GG6A 3Q2TA 1MR2A 3J7Ye 2YVMA 3O8SA 5C8LA 1HZTA 3X0QA 1KTGA 2G73A 4JZVA 2I8TA 2FVVA 5FSLA 1VHZA 3SHDA 1V8UA 3OGAA 2KDWA 1MQWA 1PUQA 2O1CA 3ZR0A 5CFJA 4YPHA 5BS6A 1V8NA 2YVPA 3BM4A 3MCFA 1Q33A 2B2KA 3DKUA 3EEUA 4NFWA 2GB5A 5GHJA 3FFUA 1Q27A 2A8QA 1K26A 1PPVA 2DHOA 3I9XA 4KTBA 2YVNA 1VC8A 4ICKA 1MUTA 1G0SA 3GRNA 1X51A 3N77A 2VNQA 2YYHA 1RRSA 3X0IA 5C7TA 1MP2A 2A8SA 4HFQA 4S2VA 5FSMA 3E57A 3AC9A 3P5TA 1U20A 5IW4A 4YPRA 5GHNA 2DSBA 3R03A 2ICKA 2RRKA 2I8UA 2A8RA 5ANWA 2R5WA 5ANTA 5FSKA 2DSCA 1V8WA 3ID9A 3L85A 1VIUA 2A8TA 3GZ8A 3O69A 3A6TA 5I8UA 5ISYA 1QVJA 3H95A 4N1UA 3CNGA 1VHGA 3F13A 1V8VA 1SJYA 3FSPA 5GHPA 1HX3A 5LPGA 5ANSA 3DUPA 3O6ZA 5ANVA 5FSNA 3BAPA 2DUKA 1Q54A 2G74A 1V8RA 3KVHA 4JZUA 3X0KA 1V8MA 1SZ3A 3Q2SA 1GA7A 5C7QA 5GHIA 1NQYA 2GT2A 3X0NA 3X0MA 4DYWA 5HZXA 4YOQA 3FK9A 1RYAA 3X0SA 5GHOA 1K2EA 1TUMA 3Q93A 4KYXA 1PPWA 2QJTA 3ACAA 1PPXA 3RH7A 3X0RA 3U53A 2O5WA 1PUSA 3I7UA 4K6EA 3GZ5A 2QKMB 3MGMA 1VC9A 1VCDA 1VIQA 2XSQA 3FCMA 3N9UA 4C9WA 1NFZA 1MK1A 2DSDA 3MDGA 1IRYA 1F3YA 1SU2A 3EF5A 2O5FA 4ZG0A
chains in the Genus database with same CATH superfamily
1V8IA 5FSIA 2YVOA 2JVBA 3EESA 3EXQA 1OW2A 5DEQA 3I7VA 4N1TA 1JKNA 3F6AA 5FSOA 5GHMA 1X83A 4MPOA 5IW5A 3A6UA 2FMLA 1NQZA 1V8SA 3WHWA 2PQVA 2J8QA 5DPKA 4ILQA 2ICJA 2PNYA 2B06A 1V8YA 3Q1PA 4KG3A 1PVFA 1JRKA 4NFXA 2Q9PA 5BONA 5ANUA 3X0LA 4JZSA 4S2XA 3SMDA 1MQEA 1VK6A 2FKBA 4S2WA 2CL3A 3X0OA 5DDGA 4S2YA 1KHZA 4V14A 3QSJA 3FJYA 1XSBA 1XSAA 2I6KA 2W4EA 4C9XA 3O61A 3Q91A 3A6VA 3ZR1A 1X84A 3GZ6A 1PUNA 3HHJA 1SOIA 3BHOA 2KDVA 1V8LA 2A8PA 5DD4A 5CFIA 3A6SA 3SONA 4HVYA 3P6YA 3G0QA 2A6TA 3COUA 3GWYA 2B0VA 1XSCA 1I9AA 4IJXA 3HYQA 1V8TA 1G9QA 1R67A 4JZTA 1RRQA 3O52A 4KG4A 3Q4IA 2AZWA 2VNPA 3X0JA 5GHQA 1VRLA 3MDIA 1KT9A 3X0PA 1NFSA 2GT4A 2QJOA 3GG6A 3Q2TA 1MR2A 3J7Ye 2YVMA 3O8SA 5C8LA 1HZTA 3X0QA 1KTGA 2G73A 4JZVA 2I8TA 2FVVA 5FSLA 4J7HA 1VHZA 3SHDA 1V8UA 3OGAA 2KDWA 1MQWA 1PUQA 2O1CA 3ZR0A 5CFJA 4YPHA 5BS6A 1V8NA 2YVPA 3BM4A 3MCFA 1Q33A 2B2KA 3DKUA 3EEUA 4NFWA 2GB5A 5GHJA 3FFUA 1Q27A 2A8QA 1K26A 1PPVA 2DHOA 3I9XA 4KTBA 2YVNA 1VC8A 4ICKA 1MUTA 1G0SA 3GRNA 1X51A 3N77A 4J7GA 2VNQA 2YYHA 1RRSA 3X0IA 5C7TA 1MP2A 2A8SA 4HFQA 4S2VA 5FSMA 3E57A 3AC9A 3P5TA 1U20A 5IW4A 4YPRA 5GHNA 2DSBA 3R03A 2ICKA 2RRKA 2I8UA 2A8RA 5ANWA 2R5WA 5ANTA 5FSKA 2DSCA 1V8WA 3ID9A 3L85A 1VIUA 2A8TA 3GZ8A 3O69A 3A6TA 5I8UA 5ISYA 1QVJA 2CZRA 3H95A 4N1UA 3CNGA 1VHGA 3F13A 1V8VA 1SJYA 3FSPA 5GHPA 1HX3A 5LPGA 5ANSA 3DUPA 3O6ZA 5ANVA 5FSNA 3BAPA 2DUKA 1Q54A 2G74A 1V8RA 3KVHA 4JZUA 3X0KA 1V8MA 1SZ3A 3Q2SA 1GA7A 5C7QA 5GHIA 1NQYA 2GT2A 3X0NA 3X0MA 4DYWA 5HZXA 4YOQA 3FK9A 1RYAA 3X0SA 5GHOA 1K2EA 1TUMA 3Q93A 4KYXA 1PPWA 2QJTA 3ACAA 1PPXA 3RH7A 3X0RA 3U53A 2O5WA 1PUSA 3I7UA 4K6EA 3GZ5A 2QKMB 3MGMA 1VC9A 1VCDA 1VIQA 2XSQA 3FCMA 3N9UA 4C9WA 1NFZA 1MK1A 2DSDA 3MDGA 1IRYA 1F3YA 1SU2A 3EF5A 2O5FA 4ZG0A
chains in the Genus database with same CATH topology
1V8IA 5FSIA 2YVOA 2JVBA 3EESA 3EXQA 1OW2A 5DEQA 3I7VA 4N1TA 1JKNA 3F6AA 5FSOA 5GHMA 1X83A 4MPOA 5IW5A 3A6UA 2FMLA 1NQZA 1V8SA 3WHWA 2PQVA 2J8QA 5DPKA 4ILQA 2ICJA 2PNYA 2B06A 1V8YA 3Q1PA 4KG3A 1PVFA 1JRKA 4NFXA 2Q9PA 5BONA 5ANUA 3X0LA 4JZSA 4S2XA 3SMDA 1MQEA 1VK6A 2FKBA 4S2WA 2CL3A 3X0OA 5DDGA 4S2YA 1KHZA 4V14A 3QSJA 3FJYA 1XSBA 1XSAA 2I6KA 2W4EA 4C9XA 3O61A 3Q91A 3A6VA 3ZR1A 1X84A 3GZ6A 1PUNA 3HHJA 1SOIA 3BHOA 2KDVA 1V8LA 2A8PA 5DD4A 5CFIA 3A6SA 3SONA 4HVYA 3P6YA 3G0QA 2A6TA 3COUA 3GWYA 2B0VA 1XSCA 1I9AA 4IJXA 3HYQA 1V8TA 1G9QA 1R67A 4JZTA 1RRQA 3O52A 4KG4A 3Q4IA 2AZWA 2VNPA 3X0JA 5GHQA 1VRLA 3MDIA 1KT9A 3X0PA 1NFSA 2GT4A 2QJOA 3GG6A 3Q2TA 1MR2A 3J7Ye 2YVMA 3O8SA 5C8LA 1HZTA 3X0QA 1KTGA 2G73A 4JZVA 2I8TA 2FVVA 5FSLA 4J7HA 1VHZA 3SHDA 1V8UA 3OGAA 2KDWA 1MQWA 1PUQA 2O1CA 3ZR0A 5CFJA 4YPHA 5BS6A 1V8NA 2YVPA 3BM4A 3MCFA 1Q33A 2B2KA 3DKUA 3EEUA 4NFWA 2GB5A 5GHJA 3FFUA 1Q27A 2A8QA 1K26A 1PPVA 2DHOA 3I9XA 4KTBA 2YVNA 1VC8A 4ICKA 1MUTA 1G0SA 3GRNA 1X51A 3N77A 4J7GA 2VNQA 2YYHA 1RRSA 3X0IA 5C7TA 1MP2A 2A8SA 4HFQA 4S2VA 5FSMA 3E57A 3AC9A 3P5TA 1U20A 5IW4A 4YPRA 5GHNA 2DSBA 3R03A 2ICKA 2RRKA 2I8UA 2A8RA 5ANWA 2R5WA 5ANTA 5FSKA 2DSCA 1V8WA 3ID9A 3L85A 1VIUA 2A8TA 3GZ8A 3O69A 3A6TA 5I8UA 5ISYA 1QVJA 2CZRA 3H95A 4N1UA 3CNGA 1VHGA 3F13A 1V8VA 1SJYA 3FSPA 5GHPA 1HX3A 5LPGA 5ANSA 3DUPA 3O6ZA 5ANVA 5FSNA 3BAPA 2DUKA 1Q54A 2G74A 1V8RA 3KVHA 4JZUA 3X0KA 1V8MA 1SZ3A 3Q2SA 1GA7A 5C7QA 5GHIA 1NQYA 2GT2A 3X0NA 3X0MA 4DYWA 5HZXA 4YOQA 3FK9A 1RYAA 3X0SA 5GHOA 1K2EA 1TUMA 3Q93A 4KYXA 1PPWA 2QJTA 3ACAA 1PPXA 3RH7A 3X0RA 3U53A 2O5WA 1PUSA 3I7UA 4K6EA 3GZ5A 2QKMB 3MGMA 1VC9A 1VCDA 1VIQA 2XSQA 3FCMA 3N9UA 4C9WA 1NFZA 1MK1A 2DSDA 3MDGA 1IRYA 1F3YA 1SU2A 3EF5A 2O5FA 4ZG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8I A;  5FSI A;  2YVO A;  2JVB A;  3EES A;  3EXQ A;  1OW2 A;  5DEQ A;  3I7V A;  4N1T A;  1JKN A;  3F6A A;  5FSO A;  5GHM A;  1X83 A;  4MPO A;  5IW5 A;  3A6U A;  2FML A;  1NQZ A;  1V8S A;  3WHW A;  2PQV A;  2J8Q A;  5DPK A;  4ILQ A;  2ICJ A;  2PNY A;  2B06 A;  1V8Y A;  3Q1P A;  4KG3 A;  1PVF A;  1JRK A;  4NFX A;  2Q9P A;  5BON A;  5ANU A;  3X0L A;  4JZS A;  4S2X A;  3SMD A;  1MQE A;  1VK6 A;  2FKB A;  4S2W A;  2CL3 A;  3X0O A;  5DDG A;  4S2Y A;  1KHZ A;  4V14 A;  3QSJ A;  3FJY A;  1XSB A;  1XSA A;  2I6K A;  2W4E A;  4C9X A;  3O61 A;  3Q91 A;  3A6V A;  3ZR1 A;  1X84 A;  3GZ6 A;  1PUN A;  3HHJ A;  1SOI A;  3BHO A;  2KDV A;  1V8L A;  2A8P A;  5DD4 A;  5CFI A;  3A6S A;  3SON A;  4HVY A;  3P6Y A;  3G0Q A;  2A6T A;  3COU A;  3GWY A;  2B0V A;  1XSC A;  1I9A A;  4IJX A;  3HYQ A;  1V8T A;  1G9Q A;  1R67 A;  4JZT A;  1RRQ A;  3O52 A;  4KG4 A;  3Q4I A;  2AZW A;  2VNP A;  3X0J A;  5GHQ A;  1VRL A;  3MDI A;  1KT9 A;  3X0P A;  1NFS A;  2GT4 A;  2QJO A;  3GG6 A;  3Q2T A;  1MR2 A;  3J7Y e;  2YVM A;  3O8S A;  5C8L A;  1HZT A;  3X0Q A;  1KTG A;  2G73 A;  4JZV A;  2I8T A;  2FVV A;  5FSL A;  1VHZ A;  3SHD A;  1V8U A;  3OGA A;  2KDW A;  1MQW A;  1PUQ A;  2O1C A;  3ZR0 A;  5CFJ A;  4YPH A;  5BS6 A;  1V8N A;  2YVP A;  3BM4 A;  3MCF A;  1Q33 A;  2B2K A;  3DKU A;  3EEU A;  4NFW A;  2GB5 A;  5GHJ A;  3FFU A;  1Q27 A;  2A8Q A;  1K26 A;  1PPV A;  2DHO A;  3I9X A;  4KTB A;  2YVN A;  1VC8 A;  4ICK A;  1MUT A;  1G0S A;  3GRN A;  1X51 A;  3N77 A;  2VNQ A;  2YYH A;  1RRS A;  3X0I A;  5C7T A;  1MP2 A;  2A8S A;  4HFQ A;  4S2V A;  5FSM A;  3E57 A;  3AC9 A;  3P5T A;  1U20 A;  5IW4 A;  4YPR A;  5GHN A;  2DSB A;  3R03 A;  2ICK A;  2RRK A;  2I8U A;  2A8R A;  5ANW A;  2R5W A;  5ANT A;  5FSK A;  2DSC A;  1V8W A;  3ID9 A;  3L85 A;  1VIU A;  2A8T A;  3GZ8 A;  3O69 A;  3A6T A;  5I8U A;  5ISY A;  1QVJ A;  3H95 A;  4N1U A;  3CNG A;  1VHG A;  3F13 A;  1V8V A;  1SJY A;  3FSP A;  5GHP A;  1HX3 A;  5LPG A;  5ANS A;  3DUP A;  3O6Z A;  5ANV A;  5FSN A;  3BAP A;  2DUK A;  1Q54 A;  2G74 A;  1V8R A;  3KVH A;  4JZU A;  3X0K A;  1V8M A;  1SZ3 A;  3Q2S A;  1GA7 A;  5C7Q A;  5GHI A;  1NQY A;  2GT2 A;  3X0N A;  3X0M A;  4DYW A;  5HZX A;  4YOQ A;  3FK9 A;  1RYA A;  3X0S A;  5GHO A;  1K2E A;  1TUM A;  3Q93 A;  4KYX A;  1PPW A;  2QJT A;  3ACA A;  1PPX A;  3RH7 A;  3X0R A;  3U53 A;  2O5W A;  1PUS A;  3I7U A;  4K6E A;  3GZ5 A;  2QKM B;  3MGM A;  1VC9 A;  1VCD A;  1VIQ A;  2XSQ A;  3FCM A;  3N9U A;  4C9W A;  1NFZ A;  1MK1 A;  2DSD A;  3MDG A;  1IRY A;  1F3Y A;  1SU2 A;  3EF5 A;  2O5F A;  4ZG0 A; 
#chains in the Genus database with same CATH topology
 1V8I A;  5FSI A;  2YVO A;  2JVB A;  3EES A;  3EXQ A;  1OW2 A;  5DEQ A;  3I7V A;  4N1T A;  1JKN A;  3F6A A;  5FSO A;  5GHM A;  1X83 A;  4MPO A;  5IW5 A;  3A6U A;  2FML A;  1NQZ A;  1V8S A;  3WHW A;  2PQV A;  2J8Q A;  5DPK A;  4ILQ A;  2ICJ A;  2PNY A;  2B06 A;  1V8Y A;  3Q1P A;  4KG3 A;  1PVF A;  1JRK A;  4NFX A;  2Q9P A;  5BON A;  5ANU A;  3X0L A;  4JZS A;  4S2X A;  3SMD A;  1MQE A;  1VK6 A;  2FKB A;  4S2W A;  2CL3 A;  3X0O A;  5DDG A;  4S2Y A;  1KHZ A;  4V14 A;  3QSJ A;  3FJY A;  1XSB A;  1XSA A;  2I6K A;  2W4E A;  4C9X A;  3O61 A;  3Q91 A;  3A6V A;  3ZR1 A;  1X84 A;  3GZ6 A;  1PUN A;  3HHJ A;  1SOI A;  3BHO A;  2KDV A;  1V8L A;  2A8P A;  5DD4 A;  5CFI A;  3A6S A;  3SON A;  4HVY A;  3P6Y A;  3G0Q A;  2A6T A;  3COU A;  3GWY A;  2B0V A;  1XSC A;  1I9A A;  4IJX A;  3HYQ A;  1V8T A;  1G9Q A;  1R67 A;  4JZT A;  1RRQ A;  3O52 A;  4KG4 A;  3Q4I A;  2AZW A;  2VNP A;  3X0J A;  5GHQ A;  1VRL A;  3MDI A;  1KT9 A;  3X0P A;  1NFS A;  2GT4 A;  2QJO A;  3GG6 A;  3Q2T A;  1MR2 A;  3J7Y e;  2YVM A;  3O8S A;  5C8L A;  1HZT A;  3X0Q A;  1KTG A;  2G73 A;  4JZV A;  2I8T A;  2FVV A;  5FSL A;  4J7H A;  1VHZ A;  3SHD A;  1V8U A;  3OGA A;  2KDW A;  1MQW A;  1PUQ A;  2O1C A;  3ZR0 A;  5CFJ A;  4YPH A;  5BS6 A;  1V8N A;  2YVP A;  3BM4 A;  3MCF A;  1Q33 A;  2B2K A;  3DKU A;  3EEU A;  4NFW A;  2GB5 A;  5GHJ A;  3FFU A;  1Q27 A;  2A8Q A;  1K26 A;  1PPV A;  2DHO A;  3I9X A;  4KTB A;  2YVN A;  1VC8 A;  4ICK A;  1MUT A;  1G0S A;  3GRN A;  1X51 A;  3N77 A;  4J7G A;  2VNQ A;  2YYH A;  1RRS A;  3X0I A;  5C7T A;  1MP2 A;  2A8S A;  4HFQ A;  4S2V A;  5FSM A;  3E57 A;  3AC9 A;  3P5T A;  1U20 A;  5IW4 A;  4YPR A;  5GHN A;  2DSB A;  3R03 A;  2ICK A;  2RRK A;  2I8U A;  2A8R A;  5ANW A;  2R5W A;  5ANT A;  5FSK A;  2DSC A;  1V8W A;  3ID9 A;  3L85 A;  1VIU A;  2A8T A;  3GZ8 A;  3O69 A;  3A6T A;  5I8U A;  5ISY A;  1QVJ A;  2CZR A;  3H95 A;  4N1U A;  3CNG A;  1VHG A;  3F13 A;  1V8V A;  1SJY A;  3FSP A;  5GHP A;  1HX3 A;  5LPG A;  5ANS A;  3DUP A;  3O6Z A;  5ANV A;  5FSN A;  3BAP A;  2DUK A;  1Q54 A;  2G74 A;  1V8R A;  3KVH A;  4JZU A;  3X0K A;  1V8M A;  1SZ3 A;  3Q2S A;  1GA7 A;  5C7Q A;  5GHI A;  1NQY A;  2GT2 A;  3X0N A;  3X0M A;  4DYW A;  5HZX A;  4YOQ A;  3FK9 A;  1RYA A;  3X0S A;  5GHO A;  1K2E A;  1TUM A;  3Q93 A;  4KYX A;  1PPW A;  2QJT A;  3ACA A;  1PPX A;  3RH7 A;  3X0R A;  3U53 A;  2O5W A;  1PUS A;  3I7U A;  4K6E A;  3GZ5 A;  2QKM B;  3MGM A;  1VC9 A;  1VCD A;  1VIQ A;  2XSQ A;  3FCM A;  3N9U A;  4C9W A;  1NFZ A;  1MK1 A;  2DSD A;  3MDG A;  1IRY A;  1F3Y A;  1SU2 A;  3EF5 A;  2O5F A;  4ZG0 A; 
#chains in the Genus database with same CATH homology
 1V8I A;  5FSI A;  2YVO A;  2JVB A;  3EES A;  3EXQ A;  1OW2 A;  5DEQ A;  3I7V A;  4N1T A;  1JKN A;  3F6A A;  5FSO A;  5GHM A;  1X83 A;  4MPO A;  5IW5 A;  3A6U A;  2FML A;  1NQZ A;  1V8S A;  3WHW A;  2PQV A;  2J8Q A;  5DPK A;  4ILQ A;  2ICJ A;  2PNY A;  2B06 A;  1V8Y A;  3Q1P A;  4KG3 A;  1PVF A;  1JRK A;  4NFX A;  2Q9P A;  5BON A;  5ANU A;  3X0L A;  4JZS A;  4S2X A;  3SMD A;  1MQE A;  1VK6 A;  2FKB A;  4S2W A;  2CL3 A;  3X0O A;  5DDG A;  4S2Y A;  1KHZ A;  4V14 A;  3QSJ A;  3FJY A;  1XSB A;  1XSA A;  2I6K A;  2W4E A;  4C9X A;  3O61 A;  3Q91 A;  3A6V A;  3ZR1 A;  1X84 A;  3GZ6 A;  1PUN A;  3HHJ A;  1SOI A;  3BHO A;  2KDV A;  1V8L A;  2A8P A;  5DD4 A;  5CFI A;  3A6S A;  3SON A;  4HVY A;  3P6Y A;  3G0Q A;  2A6T A;  3COU A;  3GWY A;  2B0V A;  1XSC A;  1I9A A;  4IJX A;  3HYQ A;  1V8T A;  1G9Q A;  1R67 A;  4JZT A;  1RRQ A;  3O52 A;  4KG4 A;  3Q4I A;  2AZW A;  2VNP A;  3X0J A;  5GHQ A;  1VRL A;  3MDI A;  1KT9 A;  3X0P A;  1NFS A;  2GT4 A;  2QJO A;  3GG6 A;  3Q2T A;  1MR2 A;  3J7Y e;  2YVM A;  3O8S A;  5C8L A;  1HZT A;  3X0Q A;  1KTG A;  2G73 A;  4JZV A;  2I8T A;  2FVV A;  5FSL A;  4J7H A;  1VHZ A;  3SHD A;  1V8U A;  3OGA A;  2KDW A;  1MQW A;  1PUQ A;  2O1C A;  3ZR0 A;  5CFJ A;  4YPH A;  5BS6 A;  1V8N A;  2YVP A;  3BM4 A;  3MCF A;  1Q33 A;  2B2K A;  3DKU A;  3EEU A;  4NFW A;  2GB5 A;  5GHJ A;  3FFU A;  1Q27 A;  2A8Q A;  1K26 A;  1PPV A;  2DHO A;  3I9X A;  4KTB A;  2YVN A;  1VC8 A;  4ICK A;  1MUT A;  1G0S A;  3GRN A;  1X51 A;  3N77 A;  4J7G A;  2VNQ A;  2YYH A;  1RRS A;  3X0I A;  5C7T A;  1MP2 A;  2A8S A;  4HFQ A;  4S2V A;  5FSM A;  3E57 A;  3AC9 A;  3P5T A;  1U20 A;  5IW4 A;  4YPR A;  5GHN A;  2DSB A;  3R03 A;  2ICK A;  2RRK A;  2I8U A;  2A8R A;  5ANW A;  2R5W A;  5ANT A;  5FSK A;  2DSC A;  1V8W A;  3ID9 A;  3L85 A;  1VIU A;  2A8T A;  3GZ8 A;  3O69 A;  3A6T A;  5I8U A;  5ISY A;  1QVJ A;  2CZR A;  3H95 A;  4N1U A;  3CNG A;  1VHG A;  3F13 A;  1V8V A;  1SJY A;  3FSP A;  5GHP A;  1HX3 A;  5LPG A;  5ANS A;  3DUP A;  3O6Z A;  5ANV A;  5FSN A;  3BAP A;  2DUK A;  1Q54 A;  2G74 A;  1V8R A;  3KVH A;  4JZU A;  3X0K A;  1V8M A;  1SZ3 A;  3Q2S A;  1GA7 A;  5C7Q A;  5GHI A;  1NQY A;  2GT2 A;  3X0N A;  3X0M A;  4DYW A;  5HZX A;  4YOQ A;  3FK9 A;  1RYA A;  3X0S A;  5GHO A;  1K2E A;  1TUM A;  3Q93 A;  4KYX A;  1PPW A;  2QJT A;  3ACA A;  1PPX A;  3RH7 A;  3X0R A;  3U53 A;  2O5W A;  1PUS A;  3I7U A;  4K6E A;  3GZ5 A;  2QKM B;  3MGM A;  1VC9 A;  1VCD A;  1VIQ A;  2XSQ A;  3FCM A;  3N9U A;  4C9W A;  1NFZ A;  1MK1 A;  2DSD A;  3MDG A;  1IRY A;  1F3Y A;  1SU2 A;  3EF5 A;  2O5F A;  4ZG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...