3A75A

Crystal structure of glutamate complex of halotolerant γ-glutamyltranspeptidase from bacillus subtilis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
359
structure length
359
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the halotolerant gamma-glutamyltranspeptidase from Bacillus subtilis in complex with glutamate reveals a unique architecture of the solvent-exposed catalytic pocket
pubmed doi rcsb
molecule keywords Gamma-glutamyltranspeptidase large chain
molecule tags Transferase
source organism Bacillus subtilis
total genus 105
structure length 359
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3a75A02
5BPKA 3A75A 2Z8KA 4OTUA 4ZCGA 2Z8JA 4OTTA 4Z9OA 2NQOA 4GG2A 3WHRA 4ZBKA 3FNMA 4GDXA 2DBWA 3WHQA 4ZC6A 5B5TA 3WHSA 2DBUA 2Z8IA 2DBXA 2QM6A 2E0XA 2V36A 2DG5A 2E0YA 2QMCA
chains in the Genus database with same CATH superfamily
2VDBA 1E7FA 2LQHA 1AO6A 3FWBC 2EFEA 2XVUA 4IW1A 1KXPD 3A75A 4OTUA 5FUOA 2EFHA 4K71A 5GHKA 4BY9C 3SIUB 1J7EA 4ZCGA 3KIKA 2XMOA 4F5SA 1HK5A 1BM0A 2AJEA 2BX8A 4GDKB 4NAWB 2LOQA 2LXSA 3ICXA 5IJFA 2BXAA 1HA2A 2XVWA 1GNJA 3WHRA 5DQFA 3LU6A 2KWFA 4GDXA 2LXTA 4I9OA 1E7CA 2XVVA 2BXQA 1MIYA 4FIPB 2I2ZA 2XVQA 4M70B 1E7IA 2DG5A 3G9KD 5ID7A 5GIPA 4TQ0A 3GQXA 2BXNA 4WA6B 1VZSA 2QMCA 3V08A 5BPKA 1HK3A 2NNWA 4S1YA 1KDXA 2BXKA 4E99A 4L8UA 4OR0A 4F5TA 1MA9A 1O9XA 5IJEA 4W4UB 3JQZA 2BXPA 5ID9A 4Z9OA 4OTTA 2DYMA 3VQIA 3TDLA 2NQOA 3LU8A 4GG2A 1H9ZA 1BJ5A 2QHBA 3NVIA 2DYOA 2BXOA 4ZBKA 2BXHA 3FNMA 3H37A 1MM8A 2KBZA 4OT2A 2BXFA 2BXGA 5B5TA 1SB0A 3GQUA 1JNBA 2DBUA 5DBYA 3WHSA 2DBXA 1LNSA 4PO0A 4L9QA 1TXUA 4C31B 1E7GA 4ZBRA 4G04A 4N3ZA 2BXIA 3M99C 3V03A 2VUFA 5IJ5A 1E78A 2YDFA 3H3AA 3KJLA 1MIVA 4L9KA 1FOUA 2BXBA 4TQ1A 4BKEA 1MUHA 3NMUA 1E7HA 4EMXA 2Z8KA 4N0FD 4Z69A 4LUFA 5D7GA 4DM0A 2AGHB 5GINA 3B9MA 1HK2A 2Z8JA 4F5UA 2BXMA 1NT2B 1IJGA 1BKEA 4IW2A 2BXLA 2ROHA 4LB9A 1KW2A 1E7AA 2XSIA 4LB2A 4LUHA 1VFIA 2EFCA 3FWCC 3JRYA 2I30A 4G03A 2BXEA 1TF0A 2Z8IA 4FJCB 4N0UD 1E7BA 1GNIA 2E0XA 5IIUA 2EFDA 4HGMB 3ECPA 1MUSA 2OT3A 4HGKA 4K2CA 3V09A 2OZBB 3GA9L 1HK4A 1MIWA 3B9LA 2K0NA 1HK1A 2JUHA 2CKXA 4G01A 4D7XA 3A73A 5HOZA 5GIOA 5IFOA 1UORA 3PLAA 4LA0A 4F5VA 3UIVA 5IIHA 1J78A 3MHHB 4FK5B 2VUEA 5IIXA 4ZBQA 4ZUXV 4MBEC 2BXDA 1N5UA 4JK4A 1LOTA 4J2VA 4GDLB 3LU7A 2DBWA 2LQIA 3WHQA 4ZC6A 1H5WA 3NVMA 3CX9A 3W1SA 2XW1A 3BPJA 1E7EA 2BXCA 3MHSB 2QM6A 4DHXB 2GUTA 2V36A 3SQJA 3NVKA 3SIVB 2E0YA 2XW0A
chains in the Genus database with same CATH topology
2VDBA 1E7FA 1AO6A 3FWBC 2EFEA 2XVUA 4IW1A 1KXPD 3A75A 4OTUA 5FUOA 2EFHA 4K71A 5GHKA 4BY9C 3SIUB 1J7EA 4ZCGA 3KIKA 2XMOA 4F5SA 1HK5A 1BM0A 2AJEA 2BX8A 4GDKB 4NAWB 2LOQA 3ICXA 5IJFA 2BXAA 1HA2A 2XVWA 1GNJA 3WHRA 5DQFA 3LU6A 4GDXA 1E7CA 2XVVA 2BXQA 1MIYA 4FIPB 2I2ZA 2XVQA 4M70B 1E7IA 2DG5A 3G9KD 5ID7A 5GIPA 4TQ0A 3GQXA 2BXNA 4WA6B 1VZSA 2QMCA 3V08A 5BPKA 1HK3A 2NNWA 4S1YA 2BXKA 4E99A 4L8UA 4OR0A 4F5TA 1MA9A 1O9XA 5IJEA 4W4UB 3JQZA 2BXPA 5ID9A 4Z9OA 4OTTA 2DYMA 3VQIA 3TDLA 2NQOA 3LU8A 4GG2A 1H9ZA 1BJ5A 2QHBA 3NVIA 2DYOA 2BXOA 4ZBKA 2BXHA 3FNMA 3H37A 2KBZA 4OT2A 2BXFA 2BXGA 5B5TA 3GQUA 1JNBA 2DBUA 5DBYA 3WHSA 2DBXA 1LNSA 4PO0A 4L9QA 1TXUA 4C31B 1E7GA 4ZBRA 4G04A 4N3ZA 2BXIA 3M99C 3V03A 2VUFA 5IJ5A 1E78A 2YDFA 3H3AA 3KJLA 1MIVA 4L9KA 1FOUA 2BXBA 4TQ1A 4BKEA 3NMUA 1E7HA 4EMXA 2Z8KA 4N0FD 4Z69A 4LUFA 5D7GA 5GINA 3B9MA 1HK2A 2Z8JA 4F5UA 2BXMA 1NT2B 1IJGA 1BKEA 4IW2A 2BXLA 2ROHA 4LB9A 1KW2A 1E7AA 2XSIA 4LB2A 4LUHA 1VFIA 2EFCA 3FWCC 3JRYA 2I30A 4G03A 2BXEA 1TF0A 2Z8IA 4FJCB 4N0UD 1E7BA 1GNIA 2E0XA 5IIUA 2EFDA 4HGMB 2OT3A 4HGKA 4K2CA 3V09A 2OZBB 3GA9L 1HK4A 1MIWA 3B9LA 1HK1A 2JUHA 2CKXA 4G01A 3A73A 5HOZA 5GIOA 5IFOA 1UORA 3PLAA 4LA0A 4F5VA 3UIVA 5IIHA 1J78A 3MHHB 4FK5B 2VUEA 5IIXA 4ZBQA 4ZUXV 4MBEC 2BXDA 1N5UA 4JK4A 1LOTA 4J2VA 4GDLB 3LU7A 2DBWA 3WHQA 4ZC6A 1H5WA 3NVMA 3CX9A 3W1SA 2XW1A 1E7EA 2BXCA 3MHSB 2QM6A 4DHXB 3SIVB 2V36A 3SQJA 3NVKA 2E0YA 2XW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPK A;  3A75 A;  2Z8K A;  4OTU A;  4ZCG A;  2Z8J A;  4OTT A;  4Z9O A;  2NQO A;  4GG2 A;  3WHR A;  4ZBK A;  3FNM A;  4GDX A;  2DBW A;  3WHQ A;  4ZC6 A;  5B5T A;  3WHS A;  2DBU A;  2Z8I A;  2DBX A;  2QM6 A;  2E0X A;  2V36 A;  2DG5 A;  2E0Y A;  2QMC A; 
#chains in the Genus database with same CATH topology
 2VDB A;  1E7F A;  2LQH A;  1AO6 A;  3FWB C;  2EFE A;  2XVU A;  4IW1 A;  1KXP D;  3A75 A;  4OTU A;  5FUO A;  2EFH A;  4K71 A;  5GHK A;  4BY9 C;  3SIU B;  1J7E A;  4ZCG A;  3KIK A;  2XMO A;  4F5S A;  1HK5 A;  1BM0 A;  2AJE A;  2BX8 A;  4GDK B;  4NAW B;  2LOQ A;  2LXS A;  3ICX A;  5IJF A;  2BXA A;  1HA2 A;  2XVW A;  1GNJ A;  3WHR A;  5DQF A;  3LU6 A;  2KWF A;  4GDX A;  2LXT A;  4I9O A;  1E7C A;  2XVV A;  2BXQ A;  1MIY A;  4FIP B;  2I2Z A;  2XVQ A;  4M70 B;  1E7I A;  2DG5 A;  3G9K D;  5ID7 A;  5GIP A;  4TQ0 A;  3GQX A;  2BXN A;  4WA6 B;  1VZS A;  2QMC A;  3V08 A;  5BPK A;  1HK3 A;  2NNW A;  4S1Y A;  1KDX A;  2BXK A;  4E99 A;  4L8U A;  4OR0 A;  4F5T A;  1MA9 A;  1O9X A;  5IJE A;  4W4U B;  3JQZ A;  2BXP A;  5ID9 A;  4Z9O A;  4OTT A;  2DYM A;  3VQI A;  3TDL A;  2NQO A;  3LU8 A;  4GG2 A;  1H9Z A;  1BJ5 A;  2QHB A;  3NVI A;  2DYO A;  2BXO A;  4ZBK A;  2BXH A;  3FNM A;  3H37 A;  1MM8 A;  2KBZ A;  4OT2 A;  2BXF A;  2BXG A;  5B5T A;  1SB0 A;  3GQU A;  1JNB A;  2DBU A;  5DBY A;  3WHS A;  2DBX A;  1LNS A;  4PO0 A;  4L9Q A;  1TXU A;  4C31 B;  1E7G A;  4ZBR A;  4G04 A;  4N3Z A;  2BXI A;  3M99 C;  3V03 A;  2VUF A;  5IJ5 A;  1E78 A;  2YDF A;  3H3A A;  3KJL A;  1MIV A;  4L9K A;  1FOU A;  2BXB A;  4TQ1 A;  4BKE A;  1MUH A;  3NMU A;  1E7H A;  4EMX A;  2Z8K A;  4N0F D;  4Z69 A;  4LUF A;  5D7G A;  4DM0 A;  2AGH B;  5GIN A;  3B9M A;  1HK2 A;  2Z8J A;  4F5U A;  2BXM A;  1NT2 B;  1IJG A;  1BKE A;  4IW2 A;  2BXL A;  2ROH A;  4LB9 A;  1KW2 A;  1E7A A;  2XSI A;  4LB2 A;  4LUH A;  1VFI A;  2EFC A;  3FWC C;  3JRY A;  2I30 A;  4G03 A;  2BXE A;  1TF0 A;  2Z8I A;  4FJC B;  4N0U D;  1E7B A;  1GNI A;  2E0X A;  5IIU A;  2EFD A;  4HGM B;  3ECP A;  1MUS A;  2OT3 A;  4HGK A;  4K2C A;  3V09 A;  2OZB B;  3GA9 L;  1HK4 A;  1MIW A;  3B9L A;  2K0N A;  1HK1 A;  2JUH A;  2CKX A;  4G01 A;  4D7X A;  3A73 A;  5HOZ A;  5GIO A;  5IFO A;  1UOR A;  3PLA A;  4LA0 A;  4F5V A;  3UIV A;  5IIH A;  1J78 A;  3MHH B;  4FK5 B;  2VUE A;  5IIX A;  4ZBQ A;  4ZUX V;  4MBE C;  2BXD A;  1N5U A;  4JK4 A;  1LOT A;  4J2V A;  4GDL B;  3LU7 A;  2DBW A;  2LQI A;  3WHQ A;  4ZC6 A;  1H5W A;  3NVM A;  3CX9 A;  3W1S A;  2XW1 A;  3BPJ A;  1E7E A;  2BXC A;  3MHS B;  2QM6 A;  4DHX B;  2GUT A;  2V36 A;  3SQJ A;  3NVK A;  3SIV B;  2E0Y A;  2XW0 A; 
#chains in the Genus database with same CATH homology
 2VDB A;  1E7F A;  1AO6 A;  3FWB C;  2EFE A;  2XVU A;  4IW1 A;  1KXP D;  3A75 A;  4OTU A;  5FUO A;  2EFH A;  4K71 A;  5GHK A;  4BY9 C;  3SIU B;  1J7E A;  4ZCG A;  3KIK A;  2XMO A;  4F5S A;  1HK5 A;  1BM0 A;  2AJE A;  2BX8 A;  4GDK B;  4NAW B;  2LOQ A;  3ICX A;  5IJF A;  2BXA A;  1HA2 A;  2XVW A;  1GNJ A;  3WHR A;  5DQF A;  3LU6 A;  4GDX A;  1E7C A;  2XVV A;  2BXQ A;  1MIY A;  4FIP B;  2I2Z A;  2XVQ A;  4M70 B;  1E7I A;  2DG5 A;  3G9K D;  5ID7 A;  5GIP A;  4TQ0 A;  3GQX A;  2BXN A;  4WA6 B;  1VZS A;  2QMC A;  3V08 A;  5BPK A;  1HK3 A;  2NNW A;  4S1Y A;  2BXK A;  4E99 A;  4L8U A;  4OR0 A;  4F5T A;  1MA9 A;  1O9X A;  5IJE A;  4W4U B;  3JQZ A;  2BXP A;  5ID9 A;  4Z9O A;  4OTT A;  2DYM A;  3VQI A;  3TDL A;  2NQO A;  3LU8 A;  4GG2 A;  1H9Z A;  1BJ5 A;  2QHB A;  3NVI A;  2DYO A;  2BXO A;  4ZBK A;  2BXH A;  3FNM A;  3H37 A;  2KBZ A;  4OT2 A;  2BXF A;  2BXG A;  5B5T A;  3GQU A;  1JNB A;  2DBU A;  5DBY A;  3WHS A;  2DBX A;  1LNS A;  4PO0 A;  4L9Q A;  1TXU A;  4C31 B;  1E7G A;  4ZBR A;  4G04 A;  4N3Z A;  2BXI A;  3M99 C;  3V03 A;  2VUF A;  5IJ5 A;  1E78 A;  2YDF A;  3H3A A;  3KJL A;  1MIV A;  4L9K A;  1FOU A;  2BXB A;  4TQ1 A;  4BKE A;  3NMU A;  1E7H A;  4EMX A;  2Z8K A;  4N0F D;  4Z69 A;  4LUF A;  5D7G A;  5GIN A;  3B9M A;  1HK2 A;  2Z8J A;  4F5U A;  2BXM A;  1NT2 B;  1IJG A;  1BKE A;  4IW2 A;  2BXL A;  2ROH A;  4LB9 A;  1KW2 A;  1E7A A;  2XSI A;  4LB2 A;  4LUH A;  1VFI A;  2EFC A;  3FWC C;  3JRY A;  2I30 A;  4G03 A;  2BXE A;  1TF0 A;  2Z8I A;  4FJC B;  4N0U D;  1E7B A;  1GNI A;  2E0X A;  5IIU A;  2EFD A;  4HGM B;  2OT3 A;  4HGK A;  4K2C A;  3V09 A;  2OZB B;  3GA9 L;  1HK4 A;  1MIW A;  3B9L A;  1HK1 A;  2JUH A;  2CKX A;  4G01 A;  3A73 A;  5HOZ A;  5GIO A;  5IFO A;  1UOR A;  3PLA A;  4LA0 A;  4F5V A;  3UIV A;  5IIH A;  1J78 A;  3MHH B;  4FK5 B;  2VUE A;  5IIX A;  4ZBQ A;  4ZUX V;  4MBE C;  2BXD A;  1N5U A;  4JK4 A;  1LOT A;  4J2V A;  4GDL B;  3LU7 A;  2DBW A;  3WHQ A;  4ZC6 A;  1H5W A;  3NVM A;  3CX9 A;  3W1S A;  2XW1 A;  1E7E A;  2BXC A;  3MHS B;  2QM6 A;  4DHX B;  3SIV B;  2V36 A;  3SQJ A;  3NVK A;  2E0Y A;  2XW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...