3A7LA

Crystal structure of e. coli apoh-protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a7lA00
1E2ZA 4TQUS 3SE0A 1H9SB 1Q12A 1ZYRC 2EDGA 1OXXK 1DXMA 2K7VA 3M85A 3MXUA 2EJMA 1I6VC 1IYUA 1Y8NB 5C0XH 1T5EA 1Y8OB 3VR6A 2KA7A 1DCZA 3KLRA 2IT1A 1Z6HA 2NN6G 3T56B 2DNCA 4DNTB 4KHZA 1B9MA 1E2VA 1GHJA 5K36H 2D62A 3HGBA 3NE5B 3IFTA 4LJZC 3CRLC 1GUOA 3GD7A 1OXUA 3ND8A 3L7ZC 1Y8PB 2A69D 3DXJC 4G7OC 2EJFC 2K33A 3D31A 3M4YA 3WDNA 3A7AB 3FPPA 3T53B 2PPBC 1V8QA 3A8IE 3PUZA 1YNJC 1H9KA 3H94A 3A7LA 4KI0A 2O5IC 2B8GA 1LABA 1IYVA 3M7NA 2R6GA 3LNNA 2BA0A 2A68C 1GUGA 2YYZA 1GJXA 1Q90A 2PCFB 1LACA 1IW7D 4JBWA 4H44C 1GUSA 2BDOA 2JEBI 3OW7A 3T51B 1OXSC 3D4RA 5K36G 1OXVA 2BE5C 3N6RA 1CFMA 1E2WA 2A6HD 4KN7C 4DK0A 2KCCA 3IKJA 2A6EC 2L5TA 3BG3A 5BN5A 3QJYA 4IFDH 3VR3A 5KNBA 2AUKA 4KKUA 4H13C 4JK1C 4XIGS 5JEAH 3VR2A 2A69C 2B8FA 3CRKC 2E76C 4LK1C 2JE6I 4KKTA 1GUTA 1Q1BA 1DD2A 2LMCB 1QJOA 4IQZA 4I7ZC 2F1MA 5KNCA 3FMCA 2ZT9C 1Y69U 3I72A 1CTMA 1HCZA 1FYCA 1K8MA 1VF5C 2BA1A 3PUVA 4RCNA 2E75C 4DK1A 4KKSA 3QIAA 2D5DA 1VF7A 4IFDG 1TU2B 3RLFA 5JEAG 1TKWB 1H9SA 4XTCS 3A8JE 2NN6I 3AB9A 3TZUA 5BN3A 3BDOA 2O5JC 4OO1H 2EJGC 2CW0C 1EWHA 3I4LA 2Q8IB 3U9SA 4H0LC 3VR4A 1O7LA 2JEAI 1H9JA 1ONLA 1B9NA 2DNEA 3A8KE 3PV0A 3QG1A 2V4DA 4L8JA 1VCIA 1G291 3VA7A 3ND9A 1H9RA 1Q1EA 4BA2I 3LWUA 1GUNA 4G7HC 1GHKA 1HQMC 1IW7C 3OOCA 3PUWA 2E74C 2A68D 1H9MA 1HPCA 2D2CC 3EQLC 2JXMB 2DN8A 2A6HC 2AUJD 4OO1G 4KMUC 3OPOA 2BE5D 4OGQC 1K8OA 3I73A 1SMYC 2K32A 3PUXA 3PUYA 3W3AA 4KN4C 4G7ZC 2PNRC 2A6ED 2NN6H 3GQBA 1VDZA 3SDZA 5KNDA 2QF7A 3P20A 4HR7B 4PV1C 4BA1I 1BDOA 1O78A 1A6XA 5A35A 1ZKOA 4DNRB 2EVBA 3VR5A 1PMRA 3MFYA 1OXTA 5BN4A 1V43A 4TKOB 1FR3A 1CI3M 2AWOA 5C0XG 4GZYC 1YNNC 1HTPA 1Z7TA
chains in the Genus database with same CATH superfamily
1E2ZA 2EPBA 4LF9L 4CBVA 2VZAA 4HEDA 1YIJA 1HNWL 2E2IB 1XXGA 4UDUC 4MNOA 2JA5B 3RNUA 4DR6Q 1DZ1A 4A3EB 4A3IH 4DR1Q 2RDHA 1RL2A 3FKIG 2I0QA 2F0FA 1PLFA 5LL6S 4JI1L 5CR3A 1Y8PB 3VYSA 2PO4A 3M4OB 2E2DC 5C44B 5H1SE 1H95A 3J81c 3Q8DA 2L11A 4B3SL 4XXEA 3MEHA 3HOXH 2F0UA 1KAWA 2B2YA 4DV0Q 2IWHA 3I7FA 1WTWA 4JBWA 2Q8RE 5IP7G 1G51A 4A3BB 3N6RA 1LTBD 4K6DA 1LUZA 2KCCA 2C35B 1YBYA 1G91A 2I07B 3JC66 4JI2Q 4JI5L 3NTKA 4K0KL 2NVXB 1I3QB 1GVPA 2WAQE 4HIMA 1TY2A 2UXCQ 4BY7G 4GLXA 4NW2A 3J80L 1DOKA 3C46A 5KRUA 1FJGL 1O7IA 4R9WA 2JA7B 5CV8A 2H1EA 2GN5A 4DXGA 3KYHC 5M3FB 2F0WA 1F9QA 2M00A 2HIXA 1M8AA 5GROA 1ILPA 3BDOA 1EWHA 1HA5A 2JA8H 1K83H 3ICEA 2UU9L 3P7JA 4CJ1B 5C3XA 2JEAI 1B9NA 3GO5A 3QG1A 5D14A 4WORA 3MHBA 4BA2I 2ASBA 5CMDA 1WTQA 4POFA 4G7HC 2WB1E 4GKKQ 3OOCA 3HOZH 3KDFB 2D2CC 2BOSA 2HHHQ 2IX3A 4L63B 1PYWD 5IYBG 2VQFQ 1SJED 2VQEQ 1X32A 4NKLA 4NP5A 3H0GG 5K5PA 3M4QA 3FKIH 4GNXB 2UXBQ 1IBMQ 2ZM6L 2F3WA 4RCOA 4C3HB 1JWSD 1YNNC 3EVQA 3AQQA 3S17H 1SNQA 1AZPA 3OHXC 2K7VA 4GLVB 1STNA 4LF9Q 1T5EA 4DPGA 3CCEA 3K57A 2KA7A 1HNWQ 5HGQA 4CDFC 4A75A 5IP7H 3TRZA 2K6AA 2HIVA 4B9XA 3PIO3 3NE5B 4XT3B 1F77A 1JWUD 3AMUA 1LM0A 3U58A 1N33L 2JJQA 4DUZQ 3D31A 4L5RC 1F2MA 1B70B 4JI1Q 3A8IE 3I8ZA 3PUZA 1NNXA 2NTSA 1LABA 1QUQB 3S1RB 4K8JA 4BY7H 4MTKA 2N88A 4H44C 3S1QB 1PZID 4RHRA 1P16A 1SNCA 1JICA 2ZTEA 1IL2A 1JWMD 2AUKA 3Q23A 3C3LA 3HEJA 4X3KA 1DD2A 3S16B 1WI5A 4POGA 3WWVA 4JI5Q 1O7YA 2PW5A 2NVTH 2F52A 1KIXA 1BCPF 1MI2A 5EJWA 1FYCA 1K8MA 3MXNB 5JVG3 4CKBA 1SNMA 3PUVA 2NYZD 4P75A 3PSIA 4C2MH 1K73C 2DY8A 1AZQA 2B2YC 1FJGQ 1EL0A 1LTTD 2KEEA 4NPSA 5IYBH 2GVAA 1VQEA 1KNEA 3U9SA 3I2ZA 3DWQA 3A8KE 3DWAA 1SROA 3MXPA 3RD4A 4DV6L 2FMCA 4DR7L 1UEAB 1ESFA 5C3EB 1IW7C 4HJ7A 1EIHA 1N8RC 3I4MG 2QCPX 5KIXA 1IZ6A 2K05A 1B1ZA 4KN4C 1IBKL 3TS2A 3W3AA 5GQOA 3DHQA 1K3RA 4ZLTF 1V1OA 2E5LQ 1A0IA 1LTSD 4A76A 2RHQB 4WJ4A 5D3DA 1V43A 1XPRA 1CI3M 2L55A 3TQYA 4DV3L 4C3IH 4X62L 2I5LX 1QOHA 4RHSA 4A93B 2R7ZH 2ZM6Q 3S15H 3ER0A 1N32L 1HFNA 3K5MA 3F8TA 1O7ZA 2QDLA 3C2PA 4V190 1XNRL 3S2HH 2F0IA 1EIYB 1YVCA 1HZCA 4ME5A 4N9PA 1E2VA 3OMCA 4AIMA 2D62A 1EQVA 3HGBA 4C3JG 1VQIA 1ET9A 4AYBB 1YJWA 4AYBE 2PPBC 3H3VC 4YCWA 3NPPA 1D5XC 4QY7A 1VQFA 1N33Q 5LMNW 1SNDA 5G3LF 3DLLA 3GP7A 1V1PA 1UUPA 4IURA 1IW7D 1NY4A 5LMUQ 1NSNS 2ZXRA 2OTLA 2O4XA 1TQOA 3DEOA 4F7XA 1TWHB 2SDFA 2E76C 2EYLA 1HZAA 3LX0A 4UHVA 2XTIA 5FO8B 1B4OA 4A3MB 5M5WB 1VF5C 1TS3A 1SBBB 2AMCB 3MZ5A 1GKHA 1Z9FA 1XNQL 4DGZA 4JI4L 2K5DA 2K5HA 3I4MH 4B3TQ 1STEA 1VQ8A 1HHVA 4FP5D 2C5CA 1M90C 2ATWA 1HR0W 4A3FG 4B9WA 2OQKA 1SYEA 1ONLA 4IPCA 2DNEA 2K5QA 2EIFA 2V4DA 1XPUA 1PRTC 2HCCA 2BDNA 3D0FA 5A2QL 5EKIA 3NSWA 3TSSA 4IPHA 4DR7Q 3U4ZA 2L4NA 3ERSX 4EQOA 4EVOA 5IGCA 3D6CA 1SN8A 4I7AA 1B50A 2PNRC 2F0LA 4JPBW 1U4PA 1QCBD 3GDEA 1IBKQ 2PNHA 5C4JB 4C3JH 5M5XB 4L5QA 5CBAE 3ULLA 1HTPA 1Q12A 4HIDA 3GV3A 5D3IB 5C0XH 2XWJB 4DV5L 4X62Q 3VYUA 4B3RL 5NUCA 3VR6A 4JI0L 2Z0SA 2GA4B 3EIVA 1WD0A 2NN6G 4FXKC 5M3MB 1CM9A 3W5OA 4FNFA 1F9PA 1JORA 1CKNA 1OXUA 2K5WA 3A56A 2MPMA 1HFGA 3A7AB 4F8MA 3H94A 1JE5A 4DF7A 1LT5D 1TS2A 5LMNL 1YZ6A 1SRUA 1I50H 2KHIA 5CV7A 3GTGH 1LTRD 4YWLA 3V2TA 1Q3LA 5IGDA 3S1MH 2CVRA 2NWGA 4LWCA 2CWPA 3ITPA 3TP6A 4KD4A 2YU9B 2ZJQA 1BKBA 4BXXG 4OO1I 1PTOH 2N78A 3KLSA 4LFCQ 3OYYA 1G8ZD 1PH7A 5JPNC 1ESRA 4JW0A 4LK1C 4CHTB 5JPMC 1ICFB 1WTOA 3CF5A 2IHFA 3H3VI 3FHWA 4A3FH 1SNPA 2G9DA 4L6TB 1IXRA 4DAYA 1B7YB 1CTMA 3UE0A 4A3KB 2BH8A 3N52A 4KD3A 1JB3A 3JAMc 4HMJA 4DK1A 4JI6Q 1VF7A 2BH2A 4DKAC 2MJ8A 5BN3A 1VQKA 3BDCA 2R7FA 3GTMB 1TWAB 3GTKH 4JBJA 2EXZA 3HOVB 1RD9D 4LF4L 2VW9A 4KLKA 4R8IA 1EYDA 2E2HB 1HR0L 2EY1A 2JA9A 1HH2P 3ND9A 2VS1A 4GN3B 3D4DA 3MEFA 4X3UA 4GN4B 2JP1A 2UXDL 3TZDA 1KABA 4OX9L 4FF3A 3HOYB 3S14H 1PRTB 2PI2E 2NN6H 4BBSB 4Y52H 3GTQB 4M8AA 1SE8A 2LSSA 4G57A 2Z1CA 2YTVA 1OXTA 2RCFA 3MC0B 1Z7TA 1ZYRC 1OTCA 4A3LG 1I6VC 1Y8NB 1PH9A 4ZRZA 1UWVA 1ET6A 5FLXE 4CDEC 1TT2A 5IP9G 4DV5Q 1SYBA 1B3AA 2Z6KA 1F2YA 3PO2B 4JI0Q 1QVCA 1S5BD 1XTCD 2ENBA 4OWTB 5I9PA 3NK9A 1PV4A 4BXXH 4LF6L 1NTGA 1Y1VG 3GTPH 2Y0SB 5GAHC 2BCOA 4KY5A 1KTKA 1VQGA 1YNJC 3J80i 3H91A 4QCLA 4K5VA 3NHHA 1P8LA 2SNSA 3V96A 1GUGA 2OXPA 4IALA 2BDOA 1A63A 2JEBI 1MJEA 5LMNQ 1K8AC 1OXVA 2BE5C 3DM3A 2XVSA 3VR3A 5D65A 5FLMG 3VR2A 4A3IB 5JVH3 2NB0A 4U68A 1G2SA 1T9HA 5J22A 4DNIA 4H02A 1JJGA 4KHVA 4DV0L 1SE3A 5E3FA 2OTJA 3CCMA 2OF1A 2ZXOA 2LXKA 2OQ0A 4P71A 3CXCA 1VQOA 5IYDG 2E75C 3KF6A 3E5SA 1C48A 2VXWA 3K59A 1PYSB 1C4QA 1HUNA 3TZUA 5GADC 1RCVD 4HJ8A 2B3GA 2R93B 4QL5A 2TMPA 3VR4A 1O7LA 3T16A 2UXCL 1KRSA 2HQLA 3DWPA 2MUYA 3SK4A 3M9BA 4LF4Q 2N3SA 1YNJD 3E0JA 1HJPA 3I90A 1U0LA 2J4XA 1A2UA 1SFOH 4A3LH 2UXDQ 3SXHA 2BE5D 4DK3C 4OX9Q 1VQ4A 1Q46A 2KBNA 3U50C 3U9OA 1A3UA 4K6LA 3GTOH 5EQ0A 3DM1A 4WJ3M 2JA8B 4GZYC 2PZWA 1SYGA 1UNSA 1Y1VH 2E2JB 5ELNA 3K7AB 2EDGA 2TSSA 5EPLA 2PQAA 1LTLA 1EEID 2HHHL 2J0TD 1WTVA 2PZTA 3K80C 1WD1A 4LFAQ 2AQ3B 3NQIA 1STHA 4JI8L 2XRQD 2F03A 4A3JG 1STGA 2R92G 3AFPA 1QZGA 3HOZB 4O2DA 4BBRG 2L1BA 2HQEA 3E9IA 4OL7A 2B63B 2OEOA 5J1ZA 1GUOA 3IFDA 4NDXA 2UXBL 1IBML 5FLMH 2A69D 3M4YA 1I4GA 2M9VA 2WV6D 1A2TA 1AFPA 3FKIB 2CQOA 4J15A 1I6HH 4DAMA 4OELB 2R6GA 4KK7A 4YWMA 3HZXA 4C1NK 3S17B 4J6HA 5IY0A 1GUSA 1X56A 4AQYL 3K5OA 1JB7A 4QQBX 2VB3X 4DK0A 3RN5A 1KXLA 2EXDA 2FXQA 1C8CA 1EY9A 4DUZL 2Z6KC 2F0VA 1UE5A 5HY6A 2EZVA 1WJJA 3CCRA 2JA6B 4FF4A 2K52A 5IWAL 1SLJA 1PFSA 3SR1A 4I7ZC 2EE1A 3IRBA 2QKIC 4HN7A 5T1IA 1IKLA 1V1QA 1E1OA 2B29A 1CKNB 1K3BC 4J1MA 3GTJB 3L0OA 5C4ZA 3NEMA 2X6LA 5IIFA 4V0BA 4CJ2C 3KBXA 4H0LC 2JA5G 3FVQA 3OIPA 2NZHA 2WAQB 1RKNA 5EKLA 2JYOA 5EKKA 3CQZH 5CV5A 3HKZE 3MVVA 2NVTB 3NP8A 2AKWB 3BS1A 2KENA 1B3QA 3QOLA 5CV6A 3QWNA 1IL8A 1TXYA 1JC7A 4C2MB 2A8VA 2DY7A 4A3JH 2R92H 2AWNA 2QF7A 3HKZG 4DAYB 4A3DG 1O78A 3MWYW 4BBRH 2UUAL 3MFYA 3ZYYX 3SK5A 4A3BG 1E22A 1LYLA 2K03A 4X3SA 3CCLA 2O2LD 3SE0A 1W6KA 2WB1B 2NBFA 3E0EA 5ELOA 1OXXK 5KEEA 5I9OA 1HNZL 3GTLH 2XRSD 2B2VA 4IJHA 1QB5D 2IT1A 3PF5A 2AHOB 1FNUA 4IFDI 4ZK9B 5FO7B 1EY5A 4JI8Q 3RLOA 2E5LL 2JN4A 4Y7NH 1EU3A 3CC4A 4TSSA 1PH8A 5M3FG 4M1UB 2K4KA 1U4RA 1X3FA 2EY6A 1F9RA 3VYRA 1MSHA 4HTHA 4C3IB 1STAA 3CW2C 4QF4A 4ILWA 2R7ZB 3S15B 5IT9L 1BOSA 1LT4D 2MP1A 3BZKA 3IKJA 4QIWE 3J7YW 4AQYQ 2K50A 3RLNA 2B8FA 3OTOL 1KLGD 2YTXA 2FINB 3HOUG 1Z47A 1QJOA 1GXDC 3D4WA 2E2IH 3FMCA 4B3MQ 3UDFA 4MN3A 5IWAQ 3IAYA 4DFAA 3I72A 4C1NI 5LMUL 4QGUA 3G4SA 1S72A 1EQQA 1PTOC 2A74C 4LW1A 1TKWB 1EQTA 5ELBA 1LO5D 3RZDH 3TDQA 3M4OH 1QG7A 2Q2UA 4DV4L 1A3TA 1SR3A 2VNUD 4OWXB 3KJOA 1TIID 4TVAB 4ABNA 3DUZA 4A3DH 5C4XB 2PI2A 2DJFC 1NMGA 1Q8IA 1H9JA 3A5ZB 3VA7A 1G291 2KVMA 4F88A 1TY0A 1B53A 1AW7A 1YNND 3L9AX 4A3BH 3LWEA 1QILA 1FGUA 2WIIB 2A19A 5IGGA 3CC2A 3I4NG 1GD7A 3H15A 4FVMA 4B3TL 3RR5A 5JOBA 3SDZA 2NVXH 3AFQA 4ODGA 4RGTA 4S3SA 3RMHA 3I4MB 5A35A 3EFXD 1ZEQX 1HZ9A 1UE6A 1LT6D 1SMXA 3H0GH 2UUAQ 3KF6B 2LFNA 2QILA 3ERQA 5M3FH 3BZCA 1CA6A 4WFN3 1X6OA 1UEBA 1HNZQ 2IJ0A 1KC8C 4DNTB 4JCVE 1B9MA 1C9OA 3T4AC 4GOPA 4C56C 4EX5A 4IUQA 1V9PA 3GD7A 3KFUA 1B8AA 4ZKBB 3DXJC 1IYJB 2RCNA 3CPWA 2K01A 3ULJA 1PXUA 3HOUH 2K75A 1EWIA 4KY6A 4GKJQ 3H6MA 3CU7A 4G4KA 3M7NA 2YYZA 1KL9A 3SGIA 3PO3G 2XN9C 4F87A 4FDBA 3OW7A 4HCEA 3D4RA 1U4MA 2F0TA 1PH3A 1J5EL 2B2VC 2CFMA 3S24A 3J81j 5F2DA 2QDBA 4K14A 2F0NA 1BF4A 2H5XA 2PQAB 3C1FA 1CZGA 4HAEA 3OTOQ 1ENFA 4IUVA 1VMPA 3OWEB 5DM63 1DGSA 5C0XI 2PMZE 1Y69U 2IW3A 4N9TA 2BA1A 1SYFA 4HSPA 3VA5A 5M9OA 1WCMG 5E1FA 4CJ0B 2SOBA 1OO9B 1RF2D 3AYHB 2K14A 3KJPA 3I4NH 4LFCL 3GTGB 4XTCS 3A8JE 3AB9A 1YNXA 4DR3L 3S1MB 4H7BA 4A93G 3J7AV 2CW0C 1FL0A 1S5CD 4DV4Q 4RGNA 1PTOB 1G6PA 3TS0A 3S1RH 5FLXL 1I4QA 3JAME 3HOWG 4HIKA 1KDCA 2QEJC 1PH4A 3S1QH 3U4VA 2EYMA 1PZJD 1SSOA 1SYDA 4JI6L 4FXGC 1B2TA 2JXMB 2DN8A 2SEBD 4BWGB 4KMUC 1CZWA 2D0OA 3CCJA 4RFBA 2EYPA 3KBGA 1U4LA 5KNDA 4PV1C 3K81C 1RIPA 4DNRB 2AQ2B 3UE1A 4ZYSA 1AEXA 2NTTA 4KJNA 1E7ZA 1PDQA 1NAPA 2KJXA 2D9UA 3MXUA 3A74A 3GV6A 4P73A 2VUMG 5ELCA 2F0HA 3J81L 1D1KA 1R4PB 1EYCA 3PO3H 3I56A 1X3EA 4TRDA 1EWCA 3S14B 4YY3Q 2EQSA 4LJZC 2Q2HA 3NELA 4XQNA 1FGBD 1EOVA 2B2WA 2WKDA 3M3YH 2KEDA 4JBKA 3E6ZX 1E1TA 4O1NA 1WYDA 2RSOA 4R4TA 1NR4A 3I55A 1WCMH 1EYGA 2A6EC 4PZ6A 4YWKA 4KKUA 4H13C 1J5EQ 2NVYH 3CRKC 2NVQH 1GM5A 4GOPC 3O13A 4A93H 4RKLA 5IODA 3MXGA 5FKAC 4NMZA 2J7ZA 2F4VQ 1VQAA 2I5MX 4LUOA 1Q82C 3BJUA 3GTPB 3HFZB 4O0AA 1CQVA 4DK6C 3HOWH 1AH9A 1SEBD 1KAAA 1PRTD 1L0WA 3TP8A 1Q8KA 4XYQA 2N49A 1DOMA 2QGQA 1PH6A 4LUZA 1Q7YC 2EJGC 2ICEC 3I4LA 3OSOA 3RUZA 4DR3Q 1VQ9A 1X3GA 3J80c 3P75A 4OHJA 1R9TH 2PQEA 2VY3A 1D8LA 4JI3L 1YITA 1JCKB 3SHLA 3F2UA 3CP0A 2F0DA 2K04A 1GHKA 3L3OC 4PMCA 2LKVA 3K8AA 4LF5Q 3EN2A 1S5DD 2ICIA 1MD2D 4OO1G 1D1IA 2VUMH 2MNAA 3I73A 1I94Q 3PUXA 2G9HD 4A3GB 2A6ED 3BZDB 3GQBA 1BNZA 4K5WA 1PRTF 3X3MA 3NENA 3PIPA 1CUKA 5BN4A 1VQLA 1C7YA 1SAPA 1K0RA 4R4QA 2EOTA 1S3OA 3M85A 4GS3A 4XQJA 1PFMA 3I4OA 5EBDA 4PMBA 1VQ6A 3RZOH 3K7UC 1A3VA 1E3PA 1AE2A 1CSQA 3LGJA 4A3KG 1BUVT 2HDLA 3CD6A 3X3NA 4LF8Q 1J9OA 1S40A 3A7LA 4ZUJA 2ES2A 1X3QA 3PQIA 4LFAL 1IYVA 1NJIC 1Y1VB 4YIJA 1NE3A 3QO2A 3FDTA 3UDGA 1RDPD 2ID0A 1PVOA 4MZ9A 3TREA 2K28A 5C4JH 2F0SA 1XWEA 2F0QA 3NWSA 5KNBA 5M5XH 3S1NB 1NCVA 4RWSC 1ZXTA 4L5SA 1KDBA 3I91A 4QB4A 1A15A 5LHY1 1XMQL 2JE6I 3P1HA 1L2FA 4RMFA 3J7AF 2WFWA 1Q81C 3SEBA 5M5YH 3F2BA 3HOYG 3WOFA 1EIGA 1TWFH 3RN2A 1CKMA 4XYOA 4GOPB 1PYBA 5I2YA 4BBSG 4QUFA 2B2WC 2F0PA 1WTXA 4NXML 4PZ8A 4IUUA 4JOIA 1TR5A 2D5DA 3RLFA 1VQCA 2HUGA 2Q8TA 4OO1H 4P72A 5C6AA 2FHTA 2WP8J 4UP7A 2UUCQ 5CORA 3PCOB 1HXYD 2L12A 1L0YB 4IUNA 1CA5A 4LF7L 2A1AA 1RJTA 2KUMA 1VQDA 1DONA 3PV0A 3TEHB 5EGTA 3EROA 1WOCA 3LWUA 4IPDA 1QVGA 3R2TA 1F2ZA 4JI3Q 1EY7A 1ZYRD 3PUWA 1H9MA 1EY4A 1J8IA 2Y0SG 3HOXB 2YTYA 3OPOA 1ILQA 4OGQC 3PUYA 3MXNA 2N8NA 5FOBB 3P20A 1N34Q 4QUCA 1TWCH 3CMAA 4N8FA 1BR9A 1V1PB 4NB3A 1S5FD 3NUCA 1BBWA 5GAEC 1MSGA 1MHWC 3OW2A 1MBYA 2RDGA 3T13A 1IYUA 1HA6A 3CQZB 2F3IA 3K5LA 1D5MC 3CKIB 1WTPA 2B2UA 4ZUIA 4OEMB 1GHJA 3CAMA 5IOCA 1C0AA 1BO0A 2VB2X 3T1YL 4LFBQ 3S2DH 5IP9H 2E2HH 1WTRA 1LTGD 3CRLC 2IL8A 2I46A 3I70A 4DV2Q 4HMIA 1Y1WG 2B39A 4A3JB 2R92B 5I2XA 1QNUA 3R93A 2NZOA 4JI7L 2CH4W 2XNAC 1K83B 5DNFA 2D0PA 3HOYH 3CCUA 3DEPA 1VQBA 3TP5A 1JOOA 1LACA 3ZJYC 1BXTA 3T51B 2R93G 1SNOA 4UP9A 4BBSH 3GTQH 2WINB 4FO2A 1KRTA 4KN7C 3K6OA 2L5TA 2MO1A 4HJAA 2R61A 3C1EA 5DM73 1VQHA 1CT1D 1LTAD 1Q1BA 2LMCB 1XMQQ 1RODA 2F1MA 5J3BA 3A5UA 1KDAA 4WRDA 4R4OA 1HCZA 5E7NA 4ID6A 1TWGH 3TBIB 3K0YA 1HNXL 2FFKB 4NXMQ 1TU2B 4GN5A 4DN4M 1H9SA 1GOZA 4OXPA 1JMCA 5IYDH 1EOTA 5IGBA 3QR8A 2Q8IB 3T1HL 4B3ML 4YCVA 1CSPA 5IGFA 4BY1G 2F0KA 4IFDJ 4LF7Q 1VCIA 2RQXA 1H9RA 3HOZG 2B63G 4DR5Q 3G71A 4DA2A 1N36Q 4Z9CB 1W2BA 4DAPA 4DR4L 4CKEA 3MTSA 3Q24A 5KYLA 1QZHA 2DJGC 4JOIC 4BY7B 1NUCA 2CHBD 3BVZA 4XDXA 3D6WA 3RZDB 5JJIA 4RA8A 3G6EA 2EVBA 1PMRA 2XGTA 1QNKA 1K0SA 2AWOA 1Y1WH 2RKSA 4A3DB 1IBLQ 3HKZB 4TQUS 4A3EG 3NXWA 4DR2Q 2N55A 4MIUA 5IGEA 1DCZA 1E24A 2JA6G 1M4VA 1TVXA 1X65A 3FPUB 2DNCA 2PW7A 4HIOA 2R93H 5C44G 1YEZA 2KQ3A 2ZJPA 1ENAA 3PF4A 3T1YQ 3ULPA 1ASZA 1EY6A 5AJ3Q 3OIQA 3A55A 4X66Q 1HTLD 4IPGA 4OWWB 3H0GB 2HCIA 4R1JA 4JI7Q 2Q2IA 2EY2A 5JJZA 4L5TA 2CWAA 2F0EA 5EPKA 5CBEE 2PZUA 2XIWA 3KLWA 3KK7A 1EY0A 2WAQG 3QOJA 5C5MA 2KOLA 1X9NA 1BCPC 2B2UC 2IPKD 1LT3D 4A3CG 3JAML 1TS4A 2E2JH 2RBMA 2IY5B 3K7AH 3W1GA 1KLUD 4UPAA 4GKJL 2JA7G 1AN8A 5CC4A 2A73B 5L37A 4EGVA 3HOUB 4BY1H 4XT1B 2PYKA 4X64L 3R2IA 4IZ8A 4NXNQ 4RCNA 2B63H 4IFDG 4ZQ3A 4DUYQ 2ZXPA 4QIWB 4E6IA 1HNXQ 1PH5A 1X3PA 1K8GA 4EQ5A 4X6AH 3M7GA 2WB1G 2ZJRA 3S2HB 1U5KA 3PIOA 1FVIA 2K1BA 1UE1A 4DV1Q 1F9SA 1O80A 3T1HQ 2JA5H 5FJ8G 2JQOA 1GUNA 1SE2A 2XSCA 3J81i 2LY7A 1X54A 4A3EH 5CYUA 5JAVA 1YHBA 4JVZA 3A54A 1HZBA 2A6HC 2WKCA 1IKMA 1G6ZA 2F0MA 4KY7A 5BR8L 2JA6H 4DR4Q 4C3HG 4X65L 1BCPD 4BA1I 3I4NB 1BDOA 5C44H 4C3IG 3VR5A 2R7ZG 4TKOB 5JJKA 3F2DA 2KHJA 3GTJH 3K0XA 1NMFA 5IYCG 4B3SQ 3SK8A 2QW7A 1JQYD 3KLRA 5C3WA 2HT1A 1Z6HA 3K5NA 4KHZA 3BYYB 5C0XJ 1DJRD 3NQTA 4UP8A 2Z9HA 2K5NA 1I3QH 3ND8A 1PA6A 5ELFA 1DOLA 4A3CH 3FPPA 3OWFA 4JC0A 1VQNA 1H9KA 4K0KQ 3IL8A 2OWOA 2UUBL 2X6GA 2JA7H 3ONAB 4LMQD 4BS9A 1MKHA 1NBWA 2A68C 3NBIA 2PCFB 5DLQE 3KLSX 4XQQA 4CDCC 5C4XG 5K36G 1R4QB 2A6HD 1JE4A 1MIUA 4R8NA 4YY3L 1PTOD 1QE6A 4Q5VA 4IFDH 2KHSA 1XMOL 3PO3B 1EU4A 1MGSA 1GUTA 2UU9Q 4EQPA 1BCPB 2WACA 1PH1A 1MJCA 4C3JB 5DAUA 3HG9A 1BBUA 1XTDA 1UAPA 5FJ8H 3M3YB 1PZKD 1SJHD 1VQJA 3B6YA 3QIAA 2MGSA 4X64Q 1A62A 5G3LD 1EY8A 2L0CA 1B44D 1EUJA 1PFNA 1WCMB 4C3HH 4FF1A 2F4VL 5EPJA 5C3EG 1LLRD 4IUPA 3KOJA 1VQPA 2NVYB 4I65A 2NVQB 4YCUA 1VQMA 1PTOF 4L8JA 1ASYA 2E8GA 1KD1C 2PMZB 2F0JA 5KYIA 2A5HA 2E74C 2A68D 4MTNA 5IYCH 3HOWB 5HGTA 3J80E 1I50B 3F1ZA 2CKZB 3DMUA 2RHSB 2EYHA 5EBCA 2GVBA 3EBEA 5BR8Q 5EAYA 1I4PA 2HDMA 4X65Q 1XJVA 2G5DA 5C0XG 2P5ZX 2F3VA 1R9TB 1H9SB 1D6EC 1DXMA 2NUCA 2OCEA 4LF5L 1L0XB 1BQQT 1TS5A 4YHHL 1BVSA 4R4IA 4JBMA 2EYOA 4DU9A 3Q0AA 4A3FB 4AYBG 5DEHA 2MHVA 3HP3A 1I94L 4MHEA 3R3OA 1JR0D 1N9WA 5C4XH 3FRPB 5K36H 4ZCKA 3S16H 2B2TA 1T5XD 2F0OA 2VUMB 2XWBB 1L1OA 3D8GA 1EZ6A 2CCZA 1FNWA 3E9HA 1JOQA 3WDNA 3T53B 3FEWX 3STBC 1EFWA 1II3A 2Z6BA 3GTKB 1Q86C 1X55A 2JSOA 3VYTA 5E4WC 1LTID 1G2TA 2L9HA 3KF8A 2BA0A 2UUBQ 3M4PA 1I5FA 4RG1A 2MFIA 4JG2A 3EJIA 3L2PA 1ENCA 1EIFA 1OXSC 1SXTA 4JV5L 1CFMA 3SK6A 5BN5A 3NBHA 3BYTB 4QMGA 4JK1C 5IT9E 3RZOB 1XPOA 4KKTA 2CW0D 4A3MG 1XMOQ 4LF8L 4IQZA 1I4RA 3G6JB 4OIKA 5C3EH 5AFWA 4ALPA 5I6YA 4HCSA 4DV6Q 4CDDC 3A0JA 3OMGA 2F4IA 5J39A 5FK9C 1AP0A 1ICWA 3TP7A 1NR2A 2NN6I 2O5JC 2VL6A 5ELEA 5CV9A 4GLAC 2RA4A 5HURA 4DV7L 3STBD 5JEAJ 2H4OA 4IJLA 5ISRA 3KUPA 4DV3Q 1WFQA 3NTIA 5M5YB 1HQMC 3I3CA 1STBA 3MFGA 1EQRA 1TWFB 1RHPA 1RTNA 1KQSA 1N32Q 3PGZA 5IE8A 5ELDA 4ULLA 1XNRQ 2LXJA 2K32A 3CHBD 4G7ZC 2UUCL 4FXDA 3W2DA 4PQXA 1PH2A 4KHPL 1CQFA 1I4XA 1A6XA 4RGOS 1SDFA 4P2CB 2FJ2A 4K5XA 3VDYA 3E3XA 1SMYC 5M3MG 5TSSA 1VQ5A 4UAIA 1Y8OB 3K58A 1JT8A 4YHHQ 1TWHH 2R7DA 1A8VA 4KTAA 1N34L 1GO3E 2AQ1B 2KCNA 4LAAA 3CCVA 1JJ2A 3F2CA 4ME3A 2K5VA 2EJFC 4CGYB 4FF2A 1V8QA 1LV9A 4A3MH 4X3TA 5M5WH 1TWCB 4KI0A 2O5IC 2IX1A 2B8GA 2KECA 3LNNA 1YHQA 4U673 1Y14B 3FP9A 3J7A5 1YI2A 4LFBL 2RVLA 4HJ5A 1GUWA 3WOEA 1S4ZA 2IHEA 3BG3A 4ZAIA 1SFOB 2NZ1D 1XNQQ 4DV2L 4N8X1 4JV5Q 4XIGS 4JI4Q 3URYA 3PIP3 3KDFA 1YHAA 2X69A 5COYA 5CV4A 4CKCA 1UE7A 5GAGC 3S2DB 3HS0C 2B2TC 2ZTDA 1PFBA 2I5HA 1L1OC 2KCMA 2Z4HA 4DAVA 5KNCA 1K9MC 2KCTA 2LS01 5IT9c 1SMYD 4A3GG 3HRZC 3GTOB 1DM0B 2Z8LA 4GNXA 2HD3A 4IO9A 3HOVG 4B08A 5JEAG 4A4IA 1J6QA 4JYAL 1HRJA 1RTOA 3EA6A 4FYDA 3W1BA 2Q2TA 4WJWA 5C5LA 2OT2A 4PZ7A 1EFID 3NTHA 4PNYA 2EY5A 4K8IA 1Q1EA 1STYA 1U9RA 4DXFA 5I4DA 2QEXA 4DV7Q 1M1KC 1SYCA 1WTHA 5JJLA 1XYIA 5M3MH 4IOCA 3TMEA 2QA4A 1HPCA 4RKBA 3CC7A 1I6HB 4B3RQ 2Z4IA 1TWGB 2IX0A 4UY8C 1EYAA 1K8OA 5KGUA 1YJ9A 2L15A 1VDZA 1QUQA 4HR7B 4EQNA 1KHIA 4RAUC 2V1CC 3S9WA 3MAQA 1ZKOA 1IHZA 2RDFA 3BVGA 1D7QA 2EYJA 3UDIA 4KHPQ 3CMEA 4HSVA 1FR3A 2Y0SE 1JOKA 3H3VH 4DR5L 3AEVA 1CHQD 3PO2G 1N36L 2EJMA 4DR6L 4Q0FA 2YU9H 2F0GA 4DR1L 3T56B 3PMFA 3BVMA 1HUMA 5FO9B 3JAMi 5A2QE 3NWTA 4IUTA 4PMWA 1VS0A 3J81E 1I4HA 2CQAA 1CKOA 3H09A 1EZ8A 3IFTA 3L7ZC 3SVMA 4G7OC 2K33A 1D5ZC 4K2LA 1IBLL 4A3KH 3V05A 4J8QA 4DR2L 2MQHA 1JJCB 5C4HA 4K2KA 1Y1WB 3HKSA 4R4CA 4A3GH 1KNAA 1Q90A 1GJXA 1FD7D 4A3IG 5E4XA 3GTMH 1E2WA 1TWAH 1W6JA 4JI2L 4APVA 3QJYA 1K28A 3HOVH 4IOAA 3UDXA 3BU2A 5JEAH 3J7ZC 3CPFA 2A69C 2EYFA 5AJ3L 4HJ9A 4OONA 4RH6A 1W3SA 2DUDA 1XX8A 4IN3A 4X66L 1F2LA 1QWYA 1S5ED 1DYQA 3HOXG 2R3ZA 4P74A 4BBRB 1HR0Q 4AH6A 2ZT9C 1VQ7A 1D2BA 3MA2B 3Q6SA 1EEFD 4QJFA 2RSNA 2JK8A 1L1OB 5CGKA 2M2LA 4KKSA 3G48A 3G7LA 3GTLB 1HQRD 2YV5A 3CCQA 1SE4A 4ZKCB 3CCSA 3D3RA 1BBXC 1QVFA 3KF8B 1CHPD 4JYAQ 1E0BA 3R8BA 2ZTCA 4Y7NB 4OIJA 4GKKL 2MO0A 5I6WA 4O42A 2RF4A 4LUVA 3TN2A 3NBHB 1AE3A 4NXNL 2FMMA 4KJOA 1CK1A 4DUYL 3PO2H 3S1NH 3EQLC 2DGYA 3BDLA 2VQFL 4BY1B 2SNMA 2VQEL 2AUJD 1WVLA 5LL6X 1YJNA 3QB3A 4GNXC 3AU7A 1FNVA 2JA8G 1VMCA 5FLXc 2CH4A 1PHJA 4RGMA 2ALYB 4LNQA 1ML0D 3Q22A 2C9OA 5T1GA 4KV6A 4DV1L 3UI2A 4PG3A 4LF6Q
chains in the Genus database with same CATH topology
1E2ZA 2EPBA 4CBVA 4HEDA 2E2IB 1XXGA 4UDUC 2JA5B 1DZ1A 4A3EB 2RDHA 2F0FA 1PLFA 5LL6S 5CR3A 1Y8PB 3VYSA 2PO4A 3M4OB 2E2DC 5C44B 2L11A 4XXEA 3MEHA 2F0UA 2B2YA 2IWHA 1WTWA 4JBWA 2Q8RE 4A3BB 3N6RA 1LTBD 4K6DA 2KCCA 1G91A 2I07B 3NTKA 2NVXB 1I3QB 1TY2A 4NW2A 3J80L 1DOKA 3C46A 5KRUA 4R9WA 2JA7B 5CV8A 2H1EA 4DXGA 5M3FB 2F0WA 1F9QA 2M00A 1ILPA 1M8AA 3BDOA 1EWHA 1HA5A 3P7JA 4CJ1B 5C3XA 2JEAI 1B9NA 3GO5A 3QG1A 5D14A 4WORA 3MHBA 4BA2I 5CMDA 1WTQA 4G7HC 3OOCA 2D2CC 2BOSA 2IX3A 4L63B 1PYWD 1SJED 1X32A 4NKLA 4NP5A 5K5PA 2F3WA 4RCOA 4C3HB 1JWSD 1YNNC 3EVQA 1SNQA 1AZPA 2K7VA 3OHXC 1STNA 1T5EA 3K57A 2KA7A 2K6AA 4B9XA 3PIO3 3NE5B 4XT3B 1F77A 1JWUD 3AMUA 3D31A 1F2MA 3A8IE 3I8ZA 3PUZA 2NTSA 1LABA 3S1RB 4K8JA 2N88A 4H44C 3S1QB 1PZID 4RHRA 1SNCA 1JICA 1JWMD 2AUKA 3Q23A 3C3LA 3HEJA 4X3KA 1DD2A 3S16B 1O7YA 2PW5A 1BCPF 1MI2A 5EJWA 1FYCA 1K8MA 5JVG3 4CKBA 1SNMA 3PUVA 2NYZD 2DY8A 1AZQA 2B2YC 1EL0A 1LTTD 2KEEA 1KNEA 3U9SA 3DWQA 3A8KE 3DWAA 3MXPA 3RD4A 2FMCA 1UEAB 1ESFA 5C3EB 1IW7C 1EIHA 2QCPX 5KIXA 2K05A 1B1ZA 4KN4C 3W3AA 3DHQA 4ZLTF 1V1OA 1LTSD 5D3DA 1V43A 1CI3M 2L55A 1QOHA 4RHSA 4A93B 1HFNA 3K5MA 1O7ZA 3C2PA 4V190 2F0IA 4ME5A 4N9PA 1E2VA 3OMCA 2D62A 1EQVA 3HGBA 4C3JG 1ET9A 4AYBB 2PPBC 3H3VC 3NPPA 1D5XC 1SNDA 5G3LF 3GP7A 1V1PA 1UUPA 4IURA 1IW7D 1NSNS 2ZXRA 2O4XA 1TQOA 3DEOA 4F7XA 1TWHB 2SDFA 2E76C 2EYLA 3LX0A 5FO8B 1B4OA 4A3MB 5M5WB 1VF5C 1TS3A 1SBBB 3MZ5A 4DGZA 2K5DA 1STEA 1HHVA 4FP5D 2C5CA 4B9WA 1SYEA 1ONLA 2DNEA 2K5QA 2V4DA 1PRTC 2HCCA 2BDNA 5A2QL 5EKIA 3NSWA 3TSSA 2L4NA 4EQOA 4EVOA 5IGCA 3D6CA 1B50A 2PNRC 2F0LA 1U4PA 1QCBD 5C4JB 5M5XB 5CBAE 1HTPA 1Q12A 3GV3A 5D3IB 5C0XH 2XWJB 3VYUA 5NUCA 3VR6A 1WD0A 2GA4B 2NN6G 4FXKC 5M3MB 1CM9A 4FNFA 1F9PA 1JORA 1OXUA 2K5WA 3A56A 2MPMA 1HFGA 3A7AB 4F8MA 3H94A 4DF7A 1LT5D 1TS2A 5CV7A 1LTRD 3V2TA 1Q3LA 5IGDA 2CVRA 2NWGA 3ITPA 3TP6A 4KD4A 2YU9B 4OO1I 1PTOH 3KLSA 1G8ZD 5JPNC 1ESRA 4LK1C 4CHTB 5JPMC 1WTOA 1SNPA 2G9DA 4L6TB 4DAYA 1CTMA 4A3KB 3N52A 4KD3A 1JB3A 4HMJA 4DK1A 1VF7A 2MJ8A 5BN3A 3BDCA 3GTMB 1TWAB 3HOVB 2EXZA 1RD9D 4R8IA 1EYDA 2E2HB 2EY1A 3ND9A 3D4DA 4X3UA 2JP1A 3TZDA 1KABA 4FF3A 3HOYB 1PRTB 2NN6H 4BBSB 3GTQB 4M8AA 4G57A 2Z1CA 1OXTA 3MC0B 1Z7TA 1ZYRC 1I6VC 1Y8NB 4ZRZA 1ET6A 5FLXE 1TT2A 1SYBA 1B3AA 1F2YA 3PO2B 1S5BD 1XTCD 2ENBA 5I9PA 3NK9A 2Y0SB 2BCOA 4KY5A 1KTKA 1YNJC 3H91A 4QCLA 4K5VA 3NHHA 2SNSA 3V96A 1GUGA 2OXPA 4IALA 2BDOA 2JEBI 1OXVA 2BE5C 2XVSA 3VR3A 5D65A 3VR2A 4A3IB 5JVH3 2NB0A 4U68A 1G2SA 5J22A 4KHVA 1SE3A 5E3FA 2OF1A 2ZXOA 2E75C 3E5SA 1C48A 2VXWA 3K59A 1C4QA 1HUNA 3TZUA 1RCVD 2R93B 2TMPA 3VR4A 1O7LA 3T16A 3DWPA 2MUYA 3SK4A 1YNJD 3E0JA 3I90A 2J4XA 1A2UA 3SXHA 2BE5D 3U9OA 1A3UA 4K6LA 5EQ0A 3DM1A 2JA8B 4GZYC 2PZWA 1SYGA 1UNSA 2E2JB 3K7AB 2EDGA 2TSSA 5EPLA 1EEID 2J0TD 1WTVA 2PZTA 1WD1A 2AQ3B 3NQIA 1STHA 2XRQD 2F03A 1STGA 3HOZB 2L1BA 2HQEA 4OL7A 2B63B 2OEOA 5J1ZA 1GUOA 3IFDA 4NDXA 2A69D 3M4YA 1I4GA 2M9VA 2WV6D 1A2TA 1AFPA 3FKIB 2R6GA 4KK7A 3HZXA 4C1NK 3S17B 4J6HA 1GUSA 3K5OA 2VB3X 4DK0A 1C8CA 1EY9A 2F0VA 2EZVA 2JA6B 4FF4A 3SR1A 4I7ZC 2EE1A 2QKIC 4HN7A 5T1IA 1IKLA 4J1MA 3GTJB 5C4ZA 2X6LA 5IIFA 4V0BA 4CJ2C 3KBXA 4H0LC 3FVQA 3OIPA 2WAQB 1RKNA 5EKLA 2JYOA 5EKKA 5CV5A 3MVVA 2NVTB 3NP8A 3BS1A 5CV6A 3QOLA 3QWNA 1IL8A 1JC7A 4C2MB 2DY7A 2AWNA 2QF7A 1O78A 3MWYW 3MFYA 3ZYYX 3SK5A 2K03A 4X3SA 2O2LD 3SE0A 1W6KA 2WB1B 2NBFA 1OXXK 5KEEA 5I9OA 2XRSD 2B2VA 1QB5D 2IT1A 1FNUA 4IFDI 4ZK9B 5FO7B 1EY5A 1EU3A 4TSSA 4M1UB 1U4RA 2EY6A 1F9RA 3VYRA 1MSHA 4HTHA 4C3IB 1STAA 4QF4A 4ILWA 2R7ZB 3S15B 5IT9L 1BOSA 1LT4D 2MP1A 3IKJA 3J7YW 2B8FA 1KLGD 2FINB 1Z47A 1QJOA 1GXDC 3D4WA 3FMCA 4MN3A 3IAYA 4DFAA 3I72A 4C1NI 1PTOC 2A74C 5ELBA 1TKWB 1EQTA 1LO5D 3TDQA 1QG7A 1A3TA 2VNUD 1TIID 4ABNA 3DUZA 5C4XB 1Q8IA 1H9JA 3VA7A 1G291 2KVMA 4F88A 1TY0A 1B53A 1AW7A 1YNND 3L9AX 3LWEA 1QILA 2WIIB 5IGGA 4FVMA 5JOBA 3SDZA 4RGTA 4ODGA 4S3SA 3RMHA 3I4MB 5A35A 3EFXD 1ZEQX 1LT6D 2LFNA 2QILA 3ERQA 1CA6A 4WFN3 2IJ0A 4DNTB 1B9MA 3T4AC 4C56C 4IUQA 3GD7A 4ZKBB 3DXJC 2K01A 1PXUA 4KY6A 3H6MA 3CU7A 4G4KA 3M7NA 2YYZA 2XN9C 4F87A 3OW7A 4HCEA 3D4RA 1U4MA 2F0TA 2B2VC 5F2DA 2QDBA 4K14A 2F0NA 1BF4A 3C1FA 1CZGA 4HAEA 1ENFA 4IUVA 1VMPA 3OWEB 5DM63 5C0XI 1Y69U 2IW3A 4N9TA 2BA1A 1SYFA 4HSPA 3VA5A 5M9OA 5E1FA 4CJ0B 2SOBA 1OO9B 1RF2D 3GTGB 4XTCS 3A8JE 3AB9A 3S1MB 4H7BA 3J7AV 2CW0C 1S5CD 4RGNA 1PTOB 5FLXL 1I4QA 3JAME 1KDCA 2QEJC 2EYMA 1PZJD 1SSOA 1SYDA 4FXGC 1B2TA 2JXMB 2DN8A 2SEBD 4BWGB 4KMUC 1CZWA 4RFBA 2EYPA 3KBGA 1U4LA 5KNDA 4PV1C 4DNRB 2AQ2B 4ZYSA 1AEXA 2NTTA 4KJNA 1PDQA 1NAPA 2KJXA 2D9UA 3MXUA 3GV6A 5ELCA 2F0HA 3J81L 1D1KA 1R4PB 1EYCA 4TRDA 1EWCA 3S14B 4LJZC 4XQNA 1FGBD 2B2WA 2WKDA 2KEDA 3E6ZX 4O1NA 2RSOA 1NR4A 2A6EC 4KKUA 4H13C 3CRKC 3O13A 4RKLA 5IODA 3MXGA 5FKAC 4NMZA 2J7ZA 3GTPB 1CQVA 1SEBD 1KAAA 1PRTD 3TP8A 4XYQA 1DOMA 2EJGC 2ICEC 3I4LA 3OSOA 3RUZA 3P75A 4OHJA 2PQEA 1JCKB 3SHLA 3F2UA 2F0DA 2K04A 1GHKA 3L3OC 4PMCA 2LKVA 1S5DD 2ICIA 1MD2D 4OO1G 1D1IA 3I73A 4A3GB 3PUXA 2G9HD 2A6ED 3BZDB 3GQBA 1BNZA 4K5WA 1PRTF 3X3MA 5BN4A 1SAPA 2EOTA 3M85A 4XQJA 1PFMA 5EBDA 4PMBA 1A3VA 1BUVT 2HDLA 3X3NA 1J9OA 3A7LA 4ZUJA 1X3QA 1IYVA 1Y1VB 4YIJA 3QO2A 3FDTA 1RDPD 2ID0A 2K28A 2F0SA 1XWEA 2F0QA 3NWSA 5KNBA 3S1NB 1NCVA 4RWSC 1ZXTA 1KDBA 3I91A 4QB4A 1A15A 5LHY1 2JE6I 3P1HA 3J7AF 3SEBA 3WOFA 1EIGA 4XYOA 5I2YA 4QUFA 2B2WC 2F0PA 1WTXA 4IUUA 1TR5A 2D5DA 3RLFA 2HUGA 2Q8TA 4OO1H 5C6AA 2FHTA 2WP8J 5CORA 1HXYD 2L12A 1L0YB 4IUNA 1CA5A 1RJTA 2KUMA 1DONA 3PV0A 5EGTA 3EROA 3LWUA 3R2TA 1F2ZA 1EY7A 1ZYRD 3PUWA 1H9MA 1EY4A 1J8IA 3HOXB 3OPOA 1ILQA 4OGQC 3PUYA 3MXNA 5FOBB 3P20A 4QUCA 1BR9A 1V1PB 1S5FD 3NUCA 1MSGA 1MBYA 2RDGA 3T13A 1IYUA 1HA6A 3CQZB 3K5LA 1D5MC 3CKIB 1WTPA 2B2UA 4ZUIA 1GHJA 5IOCA 1BO0A 2VB2X 1WTRA 1LTGD 3CRLC 2IL8A 2I46A 3I70A 4HMIA 2B39A 4A3JB 2R92B 5I2XA 1QNUA 3R93A 2XNAC 1K83B 5DNFA 3TP5A 3DEPA 1JOOA 1LACA 1BXTA 3T51B 1SNOA 2WINB 4FO2A 4KN7C 3K6OA 2L5TA 2R61A 3C1EA 5DM73 1CT1D 1LTAD 1Q1BA 2LMCB 1RODA 2F1MA 1KDAA 4WRDA 1HCZA 4ID6A 3TBIB 3K0YA 2FFKB 1TU2B 4DN4M 1H9SA 1GOZA 1EOTA 5IGBA 2Q8IB 5IGFA 2F0KA 4IFDJ 1VCIA 2RQXA 1H9RA 4DA2A 4Z9CB 4DAPA 4CKEA 3MTSA 3Q24A 5KYLA 4BY7B 1NUCA 2CHBD 3BVZA 4XDXA 3D6WA 3RZDB 4RA8A 2EVBA 1PMRA 1QNKA 2AWOA 2RKSA 4A3DB 3HKZB 4TQUS 3NXWA 2N55A 4MIUA 5IGEA 1DCZA 1M4VA 1TVXA 3FPUB 2DNCA 2PW7A 2KQ3A 1ENAA 1EY6A 3OIQA 3A55A 1HTLD 3H0GB 2HCIA 2EY2A 5JJZA 2F0EA 5EPKA 5CBEE 2PZUA 2XIWA 3KK7A 1EY0A 3QOJA 5C5MA 2KOLA 1BCPC 2B2UC 2IPKD 1LT3D 3JAML 1TS4A 2RBMA 1KLUD 1AN8A 5CC4A 2A73B 4EGVA 3HOUB 4XT1B 2PYKA 3R2IA 4IZ8A 4RCNA 4IFDG 4ZQ3A 2ZXPA 4QIWB 4E6IA 1X3PA 3M7GA 3S2HB 2K1BA 1F9SA 1O80A 1GUNA 1SE2A 2XSCA 2LY7A 5CYUA 5JAVA 3A54A 2A6HC 2WKCA 1IKMA 1G6ZA 2F0MA 4KY7A 4C3HG 1BCPD 4BA1I 3I4NB 1BDOA 4C3IG 3VR5A 4TKOB 3SK8A 1JQYD 3KLRA 5C3WA 1Z6HA 3K5NA 4KHZA 3BYYB 5C0XJ 1DJRD 3NQTA 3ND8A 5ELFA 1DOLA 3FPPA 3OWFA 1H9KA 3IL8A 2X6GA 3ONAB 4LMQD 4BS9A 2A68C 3NBIA 2PCFB 3KLSX 4XQQA 5K36G 1R4QB 2A6HD 1JE4A 4R8NA 1PTOD 1QE6A 4Q5VA 4IFDH 2KHSA 3PO3B 1EU4A 1MGSA 1GUTA 4EQPA 1BCPB 2WACA 4C3JB 5DAUA 3HG9A 1UAPA 3M3YB 1PZKD 1SJHD 3QIAA 2MGSA 5G3LD 1EY8A 2L0CA 1B44D 1PFNA 1WCMB 4FF1A 5EPJA 1LLRD 4IUPA 2NVYB 4I65A 2NVQB 1PTOF 4L8JA 2PMZB 2F0JA 5KYIA 2A5HA 2E74C 2A68D 3HOWB 5HGTA 3J80E 1I50B 3DMUA 2EYHA 5EBCA 1I4PA 2HDMA 5C0XG 2F3VA 1R9TB 1H9SB 1D6EC 1DXMA 2NUCA 1L0XB 1BQQT 1TS5A 2EYOA 4DU9A 3Q0AA 4A3FB 5DEHA 2MHVA 3HP3A 4MHEA 3R3OA 1JR0D 3FRPB 5K36H 2B2TA 1T5XD 2F0OA 2VUMB 2XWBB 3D8GA 1EZ6A 1FNWA 1JOQA 3WDNA 3T53B 3FEWX 1II3A 3GTKB 2JSOA 3VYTA 5E4WC 1LTID 1G2TA 2L9HA 3KF8A 2BA0A 3EJIA 1ENCA 1OXSC 1SXTA 1CFMA 3SK6A 5BN5A 3NBHA 3BYTB 4QMGA 4JK1C 5IT9E 3RZOB 4KKTA 2CW0D 4IQZA 1I4RA 3G6JB 4OIKA 5AFWA 5I6YA 4HCSA 3OMGA 2F4IA 5J39A 5FK9C 1AP0A 1ICWA 3TP7A 1NR2A 2NN6I 2O5JC 5ELEA 5CV9A 2RA4A 5HURA 5JEAJ 2H4OA 5ISRA 3KUPA 3NTIA 5M5YB 1HQMC 3I3CA 1STBA 3MFGA 1TWFB 1RHPA 1RTNA 5ELDA 4ULLA 4G7ZC 2K32A 3CHBD 4FXDA 3W2DA 4PQXA 1CQFA 1I4XA 1A6XA 4RGOS 1SDFA 4P2CB 2FJ2A 4K5XA 1SMYC 5TSSA 4UAIA 1Y8OB 3K58A 4KTAA 2AQ1B 2KCNA 4LAAA 2EJFC 4CGYB 4FF2A 1V8QA 1LV9A 4X3TA 1TWCB 4KI0A 2O5IC 2IX1A 2B8GA 2KECA 3LNNA 4U673 2RVLA 1GUWA 3WOEA 1S4ZA 3BG3A 4ZAIA 1SFOB 2NZ1D 4XIGS 3URYA 3PIP3 2X69A 5COYA 5CV4A 4CKCA 3S2DB 3HS0C 2B2TC 1PFBA 2Z4HA 4DAVA 5KNCA 2LS01 1SMYD 3HRZC 3GTOB 1DM0B 2Z8LA 4B08A 5JEAG 1HRJA 1RTOA 3EA6A 4FYDA 4WJWA 5C5LA 2OT2A 1EFID 3NTHA 4PNYA 4K8IA 2EY5A 1Q1EA 5I4DA 4DXFA 1STYA 1U9RA 1SYCA 1XYIA 3TMEA 1HPCA 4RKBA 1I6HB 2Z4IA 1TWGB 2IX0A 1EYAA 1K8OA 5KGUA 1VDZA 4HR7B 4EQNA 4RAUC 3S9WA 3MAQA 1ZKOA 1IHZA 2RDFA 3BVGA 2EYJA 4HSVA 1FR3A 1JOKA 1CHQD 2EJMA 4Q0FA 2F0GA 3T56B 3PMFA 3BVMA 1HUMA 5FO9B 5A2QE 3NWTA 4IUTA 4PMWA 3J81E 1I4HA 2CQAA 3H09A 3IFTA 1EZ8A 3L7ZC 3SVMA 4G7OC 2K33A 1D5ZC 4K2LA 3V05A 4J8QA 5C4HA 4K2KA 1Y1WB 1GJXA 1KNAA 1Q90A 1FD7D 5E4XA 1E2WA 1W6JA 3QJYA 5JEAH 2A69C 2EYFA 4RH6A 1XX8A 4IN3A 1S5ED 1F2LA 1QWYA 1DYQA 2R3ZA 4BBRB 2ZT9C 1D2BA 3MA2B 3Q6SA 1EEFD 2RSNA 5CGKA 2M2LA 4KKSA 3G7LA 3GTLB 1HQRD 1SE4A 4ZKCB 3D3RA 1BBXC 1CHPD 1E0BA 3R8BA 4Y7NB 4OIJA 5I6WA 4O42A 3TN2A 2FMMA 4KJOA 1CK1A 3EQLC 3BDLA 4BY1B 2SNMA 2AUJD 1WVLA 5LL6X 3QB3A 3AU7A 1FNVA 1VMCA 4RGMA 1ML0D 3Q22A 2C9OA 5T1GA 4KV6A 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Z A;  4TQU S;  3SE0 A;  1H9S B;  1Q12 A;  1ZYR C;  2EDG A;  1OXX K;  1DXM A;  2K7V A;  3M85 A;  3MXU A;  2EJM A;  1I6V C;  1IYU A;  1Y8N B;  5C0X H;  1T5E A;  1Y8O B;  3VR6 A;  2KA7 A;  1DCZ A;  3KLR A;  2IT1 A;  1Z6H A;  2NN6 G;  3T56 B;  2DNC A;  4DNT B;  4KHZ A;  1B9M A;  1E2V A;  1GHJ A;  5K36 H;  2D62 A;  3HGB A;  3NE5 B;  3IFT A;  4LJZ C;  3CRL C;  1GUO A;  3GD7 A;  1OXU A;  3ND8 A;  3L7Z C;  1Y8P B;  2A69 D;  3DXJ C;  4G7O C;  2EJF C;  2K33 A;  3D31 A;  3M4Y A;  3WDN A;  3A7A B;  3FPP A;  3T53 B;  2PPB C;  1V8Q A;  3A8I E;  3PUZ A;  1YNJ C;  1H9K A;  3H94 A;  3A7L A;  4KI0 A;  2O5I C;  2B8G A;  1LAB A;  1IYV A;  3M7N A;  2R6G A;  3LNN A;  2BA0 A;  2A68 C;  1GUG A;  2YYZ A;  1GJX A;  1Q90 A;  2PCF B;  1LAC A;  1IW7 D;  4JBW A;  4H44 C;  1GUS A;  2BDO A;  2JEB I;  3OW7 A;  3T51 B;  1OXS C;  3D4R A;  5K36 G;  1OXV A;  2BE5 C;  3N6R A;  1CFM A;  1E2W A;  2A6H D;  4KN7 C;  4DK0 A;  2KCC A;  3IKJ A;  2A6E C;  2L5T A;  3BG3 A;  5BN5 A;  3QJY A;  4IFD H;  3VR3 A;  5KNB A;  2AUK A;  4KKU A;  4H13 C;  4JK1 C;  4XIG S;  5JEA H;  3VR2 A;  2A69 C;  2B8F A;  3CRK C;  2E76 C;  4LK1 C;  2JE6 I;  4KKT A;  1GUT A;  1Q1B A;  1DD2 A;  2LMC B;  1QJO A;  4IQZ A;  4I7Z C;  2F1M A;  5KNC A;  3FMC A;  2ZT9 C;  1Y69 U;  3I72 A;  1CTM A;  1HCZ A;  1FYC A;  1K8M A;  1VF5 C;  2BA1 A;  3PUV A;  4RCN A;  2E75 C;  4DK1 A;  4KKS A;  3QIA A;  2D5D A;  1VF7 A;  4IFD G;  1TU2 B;  3RLF A;  5JEA G;  1TKW B;  1H9S A;  4XTC S;  3A8J E;  2NN6 I;  3AB9 A;  3TZU A;  5BN3 A;  3BDO A;  2O5J C;  4OO1 H;  2EJG C;  2CW0 C;  1EWH A;  3I4L A;  2Q8I B;  3U9S A;  4H0L C;  3VR4 A;  1O7L A;  2JEA I;  1H9J A;  1ONL A;  1B9N A;  2DNE A;  3A8K E;  3PV0 A;  3QG1 A;  2V4D A;  4L8J A;  1VCI A;  1G29 1;  3VA7 A;  3ND9 A;  1H9R A;  1Q1E A;  4BA2 I;  3LWU A;  1GUN A;  4G7H C;  1GHK A;  1HQM C;  1IW7 C;  3OOC A;  3PUW A;  2E74 C;  2A68 D;  1H9M A;  1HPC A;  2D2C C;  3EQL C;  2JXM B;  2DN8 A;  2A6H C;  2AUJ D;  4OO1 G;  4KMU C;  3OPO A;  2BE5 D;  4OGQ C;  1K8O A;  3I73 A;  1SMY C;  2K32 A;  3PUX A;  3PUY A;  3W3A A;  4KN4 C;  4G7Z C;  2PNR C;  2A6E D;  2NN6 H;  3GQB A;  1VDZ A;  3SDZ A;  5KND A;  2QF7 A;  3P20 A;  4HR7 B;  4PV1 C;  4BA1 I;  1BDO A;  1O78 A;  1A6X A;  5A35 A;  1ZKO A;  4DNR B;  2EVB A;  3VR5 A;  1PMR A;  3MFY A;  1OXT A;  5BN4 A;  1V43 A;  4TKO B;  1FR3 A;  1CI3 M;  2AWO A;  5C0X G;  4GZY C;  1YNN C;  1HTP A;  1Z7T A; 
#chains in the Genus database with same CATH topology
 1E2Z A;  2EPB A;  4LF9 L;  4CBV A;  2VZA A;  4HED A;  1YIJ A;  1HNW L;  2E2I B;  1XXG A;  4UDU C;  4MNO A;  2JA5 B;  3RNU A;  4DR6 Q;  1DZ1 A;  4A3E B;  4A3I H;  4DR1 Q;  2RDH A;  1RL2 A;  3FKI G;  2I0Q A;  2F0F A;  1PLF A;  5LL6 S;  4JI1 L;  5CR3 A;  1Y8P B;  3VYS A;  2PO4 A;  3M4O B;  2E2D C;  5C44 B;  5H1S E;  1H95 A;  3J81 c;  3Q8D A;  2L11 A;  4B3S L;  4XXE A;  3MEH A;  3HOX H;  2F0U A;  1KAW A;  2B2Y A;  4DV0 Q;  2IWH A;  3I7F A;  1WTW A;  4JBW A;  2Q8R E;  5IP7 G;  1G51 A;  4A3B B;  3N6R A;  1LTB D;  4K6D A;  1LUZ A;  2KCC A;  2C35 B;  1YBY A;  1G91 A;  2I07 B;  3JC6 6;  4JI2 Q;  4JI5 L;  3NTK A;  4K0K L;  2NVX B;  1I3Q B;  1GVP A;  2WAQ E;  4HIM A;  1TY2 A;  2UXC Q;  4BY7 G;  4GLX A;  4NW2 A;  3J80 L;  1DOK A;  3C46 A;  5KRU A;  1FJG L;  1O7I A;  4R9W A;  2JA7 B;  5CV8 A;  2H1E A;  2GN5 A;  4DXG A;  3KYH C;  5M3F B;  2F0W A;  1F9Q A;  2M00 A;  2HIX A;  1M8A A;  5GRO A;  1ILP A;  3BDO A;  1EWH A;  1HA5 A;  2JA8 H;  1K83 H;  3ICE A;  2UU9 L;  3P7J A;  4CJ1 B;  5C3X A;  2JEA I;  1B9N A;  3GO5 A;  3QG1 A;  5D14 A;  4WOR A;  3MHB A;  4BA2 I;  2ASB A;  5CMD A;  1WTQ A;  4POF A;  4G7H C;  2WB1 E;  4GKK Q;  3OOC A;  3HOZ H;  3KDF B;  2D2C C;  2BOS A;  2HHH Q;  2IX3 A;  4L63 B;  1PYW D;  5IYB G;  2VQF Q;  1SJE D;  2VQE Q;  1X32 A;  4NKL A;  4NP5 A;  3H0G G;  5K5P A;  3M4Q A;  3FKI H;  4GNX B;  2UXB Q;  1IBM Q;  2ZM6 L;  2F3W A;  4RCO A;  4C3H B;  1JWS D;  1YNN C;  3EVQ A;  3AQQ A;  3S17 H;  1SNQ A;  1AZP A;  3OHX C;  2K7V A;  4GLV B;  1STN A;  4LF9 Q;  1T5E A;  4DPG A;  3CCE A;  3K57 A;  2KA7 A;  1HNW Q;  5HGQ A;  4CDF C;  4A75 A;  5IP7 H;  3TRZ A;  2K6A A;  2HIV A;  4B9X A;  3PIO 3;  3NE5 B;  4XT3 B;  1F77 A;  1JWU D;  3AMU A;  1LM0 A;  3U58 A;  1N33 L;  2JJQ A;  4DUZ Q;  3D31 A;  4L5R C;  1F2M A;  1B70 B;  4JI1 Q;  3A8I E;  3I8Z A;  3PUZ A;  1NNX A;  2NTS A;  1LAB A;  1QUQ B;  3S1R B;  4K8J A;  4BY7 H;  4MTK A;  2N88 A;  4H44 C;  3S1Q B;  1PZI D;  4RHR A;  1P16 A;  1SNC A;  1JIC A;  2ZTE A;  1IL2 A;  1JWM D;  2AUK A;  3Q23 A;  3C3L A;  3HEJ A;  4X3K A;  1DD2 A;  3S16 B;  1WI5 A;  4POG A;  3WWV A;  4JI5 Q;  1O7Y A;  2PW5 A;  2NVT H;  2F52 A;  1KIX A;  1BCP F;  1MI2 A;  5EJW A;  1FYC A;  1K8M A;  3MXN B;  5JVG 3;  4CKB A;  1SNM A;  3PUV A;  2NYZ D;  4P75 A;  3PSI A;  4C2M H;  1K73 C;  2DY8 A;  1AZQ A;  2B2Y C;  1FJG Q;  1EL0 A;  1LTT D;  2KEE A;  4NPS A;  5IYB H;  2GVA A;  1VQE A;  1KNE A;  3U9S A;  3I2Z A;  3DWQ A;  3A8K E;  3DWA A;  1SRO A;  3MXP A;  3RD4 A;  4DV6 L;  2FMC A;  4DR7 L;  1UEA B;  1ESF A;  5C3E B;  1IW7 C;  4HJ7 A;  1EIH A;  1N8R C;  3I4M G;  2QCP X;  5KIX A;  1IZ6 A;  2K05 A;  1B1Z A;  4KN4 C;  1IBK L;  3TS2 A;  3W3A A;  5GQO A;  3DHQ A;  1K3R A;  4ZLT F;  1V1O A;  2E5L Q;  1A0I A;  1LTS D;  4A76 A;  2RHQ B;  4WJ4 A;  5D3D A;  1V43 A;  1XPR A;  1CI3 M;  2L55 A;  3TQY A;  4DV3 L;  4C3I H;  4X62 L;  2I5L X;  1QOH A;  4RHS A;  4A93 B;  2R7Z H;  2ZM6 Q;  3S15 H;  3ER0 A;  1N32 L;  1HFN A;  3K5M A;  3F8T A;  1O7Z A;  2QDL A;  3C2P A;  4V19 0;  1XNR L;  3S2H H;  2F0I A;  1EIY B;  1YVC A;  1HZC A;  4ME5 A;  4N9P A;  1E2V A;  3OMC A;  4AIM A;  2D62 A;  1EQV A;  3HGB A;  4C3J G;  1VQI A;  1ET9 A;  4AYB B;  1YJW A;  4AYB E;  2PPB C;  3H3V C;  4YCW A;  3NPP A;  1D5X C;  4QY7 A;  1VQF A;  1N33 Q;  5LMN W;  1SND A;  5G3L F;  3DLL A;  3GP7 A;  1V1P A;  1UUP A;  4IUR A;  1IW7 D;  1NY4 A;  5LMU Q;  1NSN S;  2ZXR A;  2OTL A;  2O4X A;  1TQO A;  3DEO A;  4F7X A;  1TWH B;  2SDF A;  2E76 C;  2EYL A;  1HZA A;  3LX0 A;  4UHV A;  2XTI A;  5FO8 B;  1B4O A;  4A3M B;  5M5W B;  1VF5 C;  1TS3 A;  1SBB B;  2AMC B;  3MZ5 A;  1GKH A;  1Z9F A;  1XNQ L;  4DGZ A;  4JI4 L;  2K5D A;  2K5H A;  3I4M H;  4B3T Q;  1STE A;  1VQ8 A;  1HHV A;  4FP5 D;  2C5C A;  1M90 C;  2ATW A;  1HR0 W;  4A3F G;  4B9W A;  2OQK A;  1SYE A;  1ONL A;  4IPC A;  2DNE A;  2K5Q A;  2EIF A;  2V4D A;  1XPU A;  1PRT C;  2HCC A;  2BDN A;  3D0F A;  5A2Q L;  5EKI A;  3NSW A;  3TSS A;  4IPH A;  4DR7 Q;  3U4Z A;  2L4N A;  3ERS X;  4EQO A;  4EVO A;  5IGC A;  3D6C A;  1SN8 A;  4I7A A;  1B50 A;  2PNR C;  2F0L A;  4JPB W;  1U4P A;  1QCB D;  3GDE A;  1IBK Q;  2PNH A;  5C4J B;  4C3J H;  5M5X B;  4L5Q A;  5CBA E;  3ULL A;  1HTP A;  1Q12 A;  4HID A;  3GV3 A;  5D3I B;  5C0X H;  2XWJ B;  4DV5 L;  4X62 Q;  3VYU A;  4B3R L;  5NUC A;  3VR6 A;  4JI0 L;  2Z0S A;  2GA4 B;  3EIV A;  1WD0 A;  2NN6 G;  4FXK C;  5M3M B;  1CM9 A;  3W5O A;  4FNF A;  1F9P A;  1JOR A;  1CKN A;  1OXU A;  2K5W A;  3A56 A;  2MPM A;  1HFG A;  3A7A B;  4F8M A;  3H94 A;  1JE5 A;  4DF7 A;  1LT5 D;  1TS2 A;  5LMN L;  1YZ6 A;  1SRU A;  1I50 H;  2KHI A;  5CV7 A;  3GTG H;  1LTR D;  4YWL A;  3V2T A;  1Q3L A;  5IGD A;  3S1M H;  2CVR A;  2NWG A;  4LWC A;  2CWP A;  3ITP A;  3TP6 A;  4KD4 A;  2YU9 B;  2ZJQ A;  1BKB A;  4BXX G;  4OO1 I;  1PTO H;  2N78 A;  3KLS A;  4LFC Q;  3OYY A;  1G8Z D;  1PH7 A;  5JPN C;  1ESR A;  4JW0 A;  4LK1 C;  4CHT B;  5JPM C;  1ICF B;  1WTO A;  3CF5 A;  2IHF A;  3H3V I;  3FHW A;  4A3F H;  1SNP A;  2G9D A;  4L6T B;  1IXR A;  4DAY A;  1B7Y B;  1CTM A;  3UE0 A;  4A3K B;  2BH8 A;  3N52 A;  4KD3 A;  1JB3 A;  3JAM c;  4HMJ A;  4DK1 A;  4JI6 Q;  1VF7 A;  2BH2 A;  4DKA C;  2MJ8 A;  5BN3 A;  1VQK A;  3BDC A;  2R7F A;  3GTM B;  1TWA B;  3GTK H;  4JBJ A;  2EXZ A;  3HOV B;  1RD9 D;  4LF4 L;  2VW9 A;  4KLK A;  4R8I A;  1EYD A;  2E2H B;  1HR0 L;  2EY1 A;  2JA9 A;  1HH2 P;  3ND9 A;  2VS1 A;  4GN3 B;  3D4D A;  3MEF A;  4X3U A;  4GN4 B;  2JP1 A;  2UXD L;  3TZD A;  1KAB A;  4OX9 L;  4FF3 A;  3HOY B;  3S14 H;  1PRT B;  2PI2 E;  2NN6 H;  4BBS B;  4Y52 H;  3GTQ B;  4M8A A;  1SE8 A;  2LSS A;  4G57 A;  2Z1C A;  2YTV A;  1OXT A;  2RCF A;  3MC0 B;  1Z7T A;  1ZYR C;  1OTC A;  4A3L G;  1I6V C;  1Y8N B;  1PH9 A;  4ZRZ A;  1UWV A;  1ET6 A;  5FLX E;  4CDE C;  1TT2 A;  5IP9 G;  4DV5 Q;  1SYB A;  1B3A A;  2Z6K A;  1F2Y A;  3PO2 B;  4JI0 Q;  1QVC A;  1S5B D;  1XTC D;  2ENB A;  4OWT B;  5I9P A;  3NK9 A;  1PV4 A;  4BXX H;  4LF6 L;  1NTG A;  1Y1V G;  3GTP H;  2Y0S B;  5GAH C;  2BCO A;  4KY5 A;  1KTK A;  1VQG A;  1YNJ C;  3J80 i;  3H91 A;  4QCL A;  4K5V A;  3NHH A;  1P8L A;  2SNS A;  3V96 A;  1GUG A;  2OXP A;  4IAL A;  2BDO A;  1A63 A;  2JEB I;  1MJE A;  5LMN Q;  1K8A C;  1OXV A;  2BE5 C;  3DM3 A;  2XVS A;  3VR3 A;  5D65 A;  5FLM G;  3VR2 A;  4A3I B;  5JVH 3;  2NB0 A;  4U68 A;  1G2S A;  1T9H A;  5J22 A;  4DNI A;  4H02 A;  1JJG A;  4KHV A;  4DV0 L;  1SE3 A;  5E3F A;  2OTJ A;  3CCM A;  2OF1 A;  2ZXO A;  2LXK A;  2OQ0 A;  4P71 A;  3CXC A;  1VQO A;  5IYD G;  2E75 C;  3KF6 A;  3E5S A;  1C48 A;  2VXW A;  3K59 A;  1PYS B;  1C4Q A;  1HUN A;  3TZU A;  5GAD C;  1RCV D;  4HJ8 A;  2B3G A;  2R93 B;  4QL5 A;  2TMP A;  3VR4 A;  1O7L A;  3T16 A;  2UXC L;  1KRS A;  2HQL A;  3DWP A;  2MUY A;  3SK4 A;  3M9B A;  4LF4 Q;  2N3S A;  1YNJ D;  3E0J A;  1HJP A;  3I90 A;  1U0L A;  2J4X A;  1A2U A;  1SFO H;  4A3L H;  2UXD Q;  3SXH A;  2BE5 D;  4DK3 C;  4OX9 Q;  1VQ4 A;  1Q46 A;  2KBN A;  3U50 C;  3U9O A;  1A3U A;  4K6L A;  3GTO H;  5EQ0 A;  3DM1 A;  4WJ3 M;  2JA8 B;  4GZY C;  2PZW A;  1SYG A;  1UNS A;  1Y1V H;  2E2J B;  5ELN A;  3K7A B;  2EDG A;  2TSS A;  5EPL A;  2PQA A;  1LTL A;  1EEI D;  2HHH L;  2J0T D;  1WTV A;  2PZT A;  3K80 C;  1WD1 A;  4LFA Q;  2AQ3 B;  3NQI A;  1STH A;  4JI8 L;  2XRQ D;  2F03 A;  4A3J G;  1STG A;  2R92 G;  3AFP A;  1QZG A;  3HOZ B;  4O2D A;  4BBR G;  2L1B A;  2HQE A;  3E9I A;  4OL7 A;  2B63 B;  2OEO A;  5J1Z A;  1GUO A;  3IFD A;  4NDX A;  2UXB L;  1IBM L;  5FLM H;  2A69 D;  3M4Y A;  1I4G A;  2M9V A;  2WV6 D;  1A2T A;  1AFP A;  3FKI B;  2CQO A;  4J15 A;  1I6H H;  4DAM A;  4OEL B;  2R6G A;  4KK7 A;  4YWM A;  3HZX A;  4C1N K;  3S17 B;  4J6H A;  5IY0 A;  1GUS A;  1X56 A;  4AQY L;  3K5O A;  1JB7 A;  4QQB X;  2VB3 X;  4DK0 A;  3RN5 A;  1KXL A;  2EXD A;  2FXQ A;  1C8C A;  1EY9 A;  4DUZ L;  2Z6K C;  2F0V A;  1UE5 A;  5HY6 A;  2EZV A;  1WJJ A;  3CCR A;  2JA6 B;  4FF4 A;  2K52 A;  5IWA L;  1SLJ A;  1PFS A;  3SR1 A;  4I7Z C;  2EE1 A;  3IRB A;  2QKI C;  4HN7 A;  5T1I A;  1IKL A;  1V1Q A;  1E1O A;  2B29 A;  1CKN B;  1K3B C;  4J1M A;  3GTJ B;  3L0O A;  5C4Z A;  3NEM A;  2X6L A;  5IIF A;  4V0B A;  4CJ2 C;  3KBX A;  4H0L C;  2JA5 G;  3FVQ A;  3OIP A;  2NZH A;  2WAQ B;  1RKN A;  5EKL A;  2JYO A;  5EKK A;  3CQZ H;  5CV5 A;  3HKZ E;  3MVV A;  2NVT B;  3NP8 A;  2AKW B;  3BS1 A;  2KEN A;  1B3Q A;  3QOL A;  5CV6 A;  3QWN A;  1IL8 A;  1TXY A;  1JC7 A;  4C2M B;  2A8V A;  2DY7 A;  4A3J H;  2R92 H;  2AWN A;  2QF7 A;  3HKZ G;  4DAY B;  4A3D G;  1O78 A;  3MWY W;  4BBR H;  2UUA L;  3MFY A;  3ZYY X;  3SK5 A;  4A3B G;  1E22 A;  1LYL A;  2K03 A;  4X3S A;  3CCL A;  2O2L D;  3SE0 A;  1W6K A;  2WB1 B;  2NBF A;  3E0E A;  5ELO A;  1OXX K;  5KEE A;  5I9O A;  1HNZ L;  3GTL H;  2XRS D;  2B2V A;  4IJH A;  1QB5 D;  2IT1 A;  3PF5 A;  2AHO B;  1FNU A;  4IFD I;  4ZK9 B;  5FO7 B;  1EY5 A;  4JI8 Q;  3RLO A;  2E5L L;  2JN4 A;  4Y7N H;  1EU3 A;  3CC4 A;  4TSS A;  1PH8 A;  5M3F G;  4M1U B;  2K4K A;  1U4R A;  1X3F A;  2EY6 A;  1F9R A;  3VYR A;  1MSH A;  4HTH A;  4C3I B;  1STA A;  3CW2 C;  4QF4 A;  4ILW A;  2R7Z B;  3S15 B;  5IT9 L;  1BOS A;  1LT4 D;  2MP1 A;  3BZK A;  3IKJ A;  4QIW E;  3J7Y W;  4AQY Q;  2K50 A;  3RLN A;  2B8F A;  3OTO L;  1KLG D;  2YTX A;  2FIN B;  3HOU G;  1Z47 A;  1QJO A;  1GXD C;  3D4W A;  2E2I H;  3FMC A;  4B3M Q;  3UDF A;  4MN3 A;  5IWA Q;  3IAY A;  4DFA A;  3I72 A;  4C1N I;  5LMU L;  4QGU A;  3G4S A;  1S72 A;  1EQQ A;  1PTO C;  2A74 C;  4LW1 A;  1TKW B;  1EQT A;  5ELB A;  1LO5 D;  3RZD H;  3TDQ A;  3M4O H;  1QG7 A;  2Q2U A;  4DV4 L;  1A3T A;  1SR3 A;  2VNU D;  4OWX B;  3KJO A;  1TII D;  4TVA B;  4ABN A;  3DUZ A;  4A3D H;  5C4X B;  2PI2 A;  2DJF C;  1NMG A;  1Q8I A;  1H9J A;  3A5Z B;  3VA7 A;  1G29 1;  2KVM A;  4F88 A;  1TY0 A;  1B53 A;  1AW7 A;  1YNN D;  3L9A X;  4A3B H;  3LWE A;  1QIL A;  1FGU A;  2WII B;  2A19 A;  5IGG A;  3CC2 A;  3I4N G;  1GD7 A;  3H15 A;  4FVM A;  4B3T L;  3RR5 A;  5JOB A;  3SDZ A;  2NVX H;  3AFQ A;  4ODG A;  4RGT A;  4S3S A;  3RMH A;  3I4M B;  5A35 A;  3EFX D;  1ZEQ X;  1HZ9 A;  1UE6 A;  1LT6 D;  1SMX A;  3H0G H;  2UUA Q;  3KF6 B;  2LFN A;  2QIL A;  3ERQ A;  5M3F H;  3BZC A;  1CA6 A;  4WFN 3;  1X6O A;  1UEB A;  1HNZ Q;  2IJ0 A;  1KC8 C;  4DNT B;  4JCV E;  1B9M A;  1C9O A;  3T4A C;  4GOP A;  4C56 C;  4EX5 A;  4IUQ A;  1V9P A;  3GD7 A;  3KFU A;  1B8A A;  4ZKB B;  3DXJ C;  1IYJ B;  2RCN A;  3CPW A;  2K01 A;  3ULJ A;  1PXU A;  3HOU H;  2K75 A;  1EWI A;  4KY6 A;  4GKJ Q;  3H6M A;  3CU7 A;  4G4K A;  3M7N A;  2YYZ A;  1KL9 A;  3SGI A;  3PO3 G;  2XN9 C;  4F87 A;  4FDB A;  3OW7 A;  4HCE A;  3D4R A;  1U4M A;  2F0T A;  1PH3 A;  1J5E L;  2B2V C;  2CFM A;  3S24 A;  3J81 j;  5F2D A;  2QDB A;  4K14 A;  2F0N A;  1BF4 A;  2H5X A;  2PQA B;  3C1F A;  1CZG A;  4HAE A;  3OTO Q;  1ENF A;  4IUV A;  1VMP A;  3OWE B;  5DM6 3;  1DGS A;  5C0X I;  2PMZ E;  1Y69 U;  2IW3 A;  4N9T A;  2BA1 A;  1SYF A;  4HSP A;  3VA5 A;  5M9O A;  1WCM G;  5E1F A;  4CJ0 B;  2SOB A;  1OO9 B;  1RF2 D;  3AYH B;  2K14 A;  3KJP A;  3I4N H;  4LFC L;  3GTG B;  4XTC S;  3A8J E;  3AB9 A;  1YNX A;  4DR3 L;  3S1M B;  4H7B A;  4A93 G;  3J7A V;  2CW0 C;  1FL0 A;  1S5C D;  4DV4 Q;  4RGN A;  1PTO B;  1G6P A;  3TS0 A;  3S1R H;  5FLX L;  1I4Q A;  3JAM E;  3HOW G;  4HIK A;  1KDC A;  2QEJ C;  1PH4 A;  3S1Q H;  3U4V A;  2EYM A;  1PZJ D;  1SSO A;  1SYD A;  4JI6 L;  4FXG C;  1B2T A;  2JXM B;  2DN8 A;  2SEB D;  4BWG B;  4KMU C;  1CZW A;  2D0O A;  3CCJ A;  4RFB A;  2EYP A;  3KBG A;  1U4L A;  5KND A;  4PV1 C;  3K81 C;  1RIP A;  4DNR B;  2AQ2 B;  3UE1 A;  4ZYS A;  1AEX A;  2NTT A;  4KJN A;  1E7Z A;  1PDQ A;  1NAP A;  2KJX A;  2D9U A;  3MXU A;  3A74 A;  3GV6 A;  4P73 A;  2VUM G;  5ELC A;  2F0H A;  3J81 L;  1D1K A;  1R4P B;  1EYC A;  3PO3 H;  3I56 A;  1X3E A;  4TRD A;  1EWC A;  3S14 B;  4YY3 Q;  2EQS A;  4LJZ C;  2Q2H A;  3NEL A;  4XQN A;  1FGB D;  1EOV A;  2B2W A;  2WKD A;  3M3Y H;  2KED A;  4JBK A;  3E6Z X;  1E1T A;  4O1N A;  1WYD A;  2RSO A;  4R4T A;  1NR4 A;  3I55 A;  1WCM H;  1EYG A;  2A6E C;  4PZ6 A;  4YWK A;  4KKU A;  4H13 C;  1J5E Q;  2NVY H;  3CRK C;  2NVQ H;  1GM5 A;  4GOP C;  3O13 A;  4A93 H;  4RKL A;  5IOD A;  3MXG A;  5FKA C;  4NMZ A;  2J7Z A;  2F4V Q;  1VQA A;  2I5M X;  4LUO A;  1Q82 C;  3BJU A;  3GTP B;  3HFZ B;  4O0A A;  1CQV A;  4DK6 C;  3HOW H;  1AH9 A;  1SEB D;  1KAA A;  1PRT D;  1L0W A;  3TP8 A;  1Q8K A;  4XYQ A;  2N49 A;  1DOM A;  2QGQ A;  1PH6 A;  4LUZ A;  1Q7Y C;  2EJG C;  2ICE C;  3I4L A;  3OSO A;  3RUZ A;  4DR3 Q;  1VQ9 A;  1X3G A;  3J80 c;  3P75 A;  4OHJ A;  1R9T H;  2PQE A;  2VY3 A;  1D8L A;  4JI3 L;  1YIT A;  1JCK B;  3SHL A;  3F2U A;  3CP0 A;  2F0D A;  2K04 A;  1GHK A;  3L3O C;  4PMC A;  2LKV A;  3K8A A;  4LF5 Q;  3EN2 A;  1S5D D;  2ICI A;  1MD2 D;  4OO1 G;  1D1I A;  2VUM H;  2MNA A;  3I73 A;  1I94 Q;  3PUX A;  2G9H D;  4A3G B;  2A6E D;  3BZD B;  3GQB A;  1BNZ A;  4K5W A;  1PRT F;  3X3M A;  3NEN A;  3PIP A;  1CUK A;  5BN4 A;  1VQL A;  1C7Y A;  1SAP A;  1K0R A;  4R4Q A;  2EOT A;  1S3O A;  3M85 A;  4GS3 A;  4XQJ A;  1PFM A;  3I4O A;  5EBD A;  4PMB A;  1VQ6 A;  3RZO H;  3K7U C;  1A3V A;  1E3P A;  1AE2 A;  1CSQ A;  3LGJ A;  4A3K G;  1BUV T;  2HDL A;  3CD6 A;  3X3N A;  4LF8 Q;  1J9O A;  1S40 A;  3A7L A;  4ZUJ A;  2ES2 A;  1X3Q A;  3PQI A;  4LFA L;  1IYV A;  1NJI C;  1Y1V B;  4YIJ A;  1NE3 A;  3QO2 A;  3FDT A;  3UDG A;  1RDP D;  2ID0 A;  1PVO A;  4MZ9 A;  3TRE A;  2K28 A;  5C4J H;  2F0S A;  1XWE A;  2F0Q A;  3NWS A;  5KNB A;  5M5X H;  3S1N B;  1NCV A;  4RWS C;  1ZXT A;  4L5S A;  1KDB A;  3I91 A;  4QB4 A;  1A15 A;  5LHY 1;  1XMQ L;  2JE6 I;  3P1H A;  1L2F A;  4RMF A;  3J7A F;  2WFW A;  1Q81 C;  3SEB A;  5M5Y H;  3F2B A;  3HOY G;  3WOF A;  1EIG A;  1TWF H;  3RN2 A;  1CKM A;  4XYO A;  4GOP B;  1PYB A;  5I2Y A;  4BBS G;  4QUF A;  2B2W C;  2F0P A;  1WTX A;  4NXM L;  4PZ8 A;  4IUU A;  4JOI A;  1TR5 A;  2D5D A;  3RLF A;  1VQC A;  2HUG A;  2Q8T A;  4OO1 H;  4P72 A;  5C6A A;  2FHT A;  2WP8 J;  4UP7 A;  2UUC Q;  5COR A;  3PCO B;  1HXY D;  2L12 A;  1L0Y B;  4IUN A;  1CA5 A;  4LF7 L;  2A1A A;  1RJT A;  2KUM A;  1VQD A;  1DON A;  3PV0 A;  3TEH B;  5EGT A;  3ERO A;  1WOC A;  3LWU A;  4IPD A;  1QVG A;  3R2T A;  1F2Z A;  4JI3 Q;  1EY7 A;  1ZYR D;  3PUW A;  1H9M A;  1EY4 A;  1J8I A;  2Y0S G;  3HOX B;  2YTY A;  3OPO A;  1ILQ A;  4OGQ C;  3PUY A;  3MXN A;  2N8N A;  5FOB B;  3P20 A;  1N34 Q;  4QUC A;  1TWC H;  3CMA A;  4N8F A;  1BR9 A;  1V1P B;  4NB3 A;  1S5F D;  3NUC A;  1BBW A;  5GAE C;  1MSG A;  1MHW C;  3OW2 A;  1MBY A;  2RDG A;  3T13 A;  1IYU A;  1HA6 A;  3CQZ B;  2F3I A;  3K5L A;  1D5M C;  3CKI B;  1WTP A;  2B2U A;  4ZUI A;  4OEM B;  1GHJ A;  3CAM A;  5IOC A;  1C0A A;  1BO0 A;  2VB2 X;  3T1Y L;  4LFB Q;  3S2D H;  5IP9 H;  2E2H H;  1WTR A;  1LTG D;  3CRL C;  2IL8 A;  2I46 A;  3I70 A;  4DV2 Q;  4HMI A;  1Y1W G;  2B39 A;  4A3J B;  2R92 B;  5I2X A;  1QNU A;  3R93 A;  2NZO A;  4JI7 L;  2CH4 W;  2XNA C;  1K83 B;  5DNF A;  2D0P A;  3HOY H;  3CCU A;  3DEP A;  1VQB A;  3TP5 A;  1JOO A;  1LAC A;  3ZJY C;  1BXT A;  3T51 B;  2R93 G;  1SNO A;  4UP9 A;  4BBS H;  3GTQ H;  2WIN B;  4FO2 A;  1KRT A;  4KN7 C;  3K6O A;  2L5T A;  2MO1 A;  4HJA A;  2R61 A;  3C1E A;  5DM7 3;  1VQH A;  1CT1 D;  1LTA D;  1Q1B A;  2LMC B;  1XMQ Q;  1ROD A;  2F1M A;  5J3B A;  3A5U A;  1KDA A;  4WRD A;  4R4O A;  1HCZ A;  5E7N A;  4ID6 A;  1TWG H;  3TBI B;  3K0Y A;  1HNX L;  2FFK B;  4NXM Q;  1TU2 B;  4GN5 A;  4DN4 M;  1H9S A;  1GOZ A;  4OXP A;  1JMC A;  5IYD H;  1EOT A;  5IGB A;  3QR8 A;  2Q8I B;  3T1H L;  4B3M L;  4YCV A;  1CSP A;  5IGF A;  4BY1 G;  2F0K A;  4IFD J;  4LF7 Q;  1VCI A;  2RQX A;  1H9R A;  3HOZ G;  2B63 G;  4DR5 Q;  3G71 A;  4DA2 A;  1N36 Q;  4Z9C B;  1W2B A;  4DAP A;  4DR4 L;  4CKE A;  3MTS A;  3Q24 A;  5KYL A;  1QZH A;  2DJG C;  4JOI C;  4BY7 B;  1NUC A;  2CHB D;  3BVZ A;  4XDX A;  3D6W A;  3RZD B;  5JJI A;  4RA8 A;  3G6E A;  2EVB A;  1PMR A;  2XGT A;  1QNK A;  1K0S A;  2AWO A;  1Y1W H;  2RKS A;  4A3D B;  1IBL Q;  3HKZ B;  4TQU S;  4A3E G;  3NXW A;  4DR2 Q;  2N55 A;  4MIU A;  5IGE A;  1DCZ A;  1E24 A;  2JA6 G;  1M4V A;  1TVX A;  1X65 A;  3FPU B;  2DNC A;  2PW7 A;  4HIO A;  2R93 H;  5C44 G;  1YEZ A;  2KQ3 A;  2ZJP A;  1ENA A;  3PF4 A;  3T1Y Q;  3ULP A;  1ASZ A;  1EY6 A;  5AJ3 Q;  3OIQ A;  3A55 A;  4X66 Q;  1HTL D;  4IPG A;  4OWW B;  3H0G B;  2HCI A;  4R1J A;  4JI7 Q;  2Q2I A;  2EY2 A;  5JJZ A;  4L5T A;  2CWA A;  2F0E A;  5EPK A;  5CBE E;  2PZU A;  2XIW A;  3KLW A;  3KK7 A;  1EY0 A;  2WAQ G;  3QOJ A;  5C5M A;  2KOL A;  1X9N A;  1BCP C;  2B2U C;  2IPK D;  1LT3 D;  4A3C G;  3JAM L;  1TS4 A;  2E2J H;  2RBM A;  2IY5 B;  3K7A H;  3W1G A;  1KLU D;  4UPA A;  4GKJ L;  2JA7 G;  1AN8 A;  5CC4 A;  2A73 B;  5L37 A;  4EGV A;  3HOU B;  4BY1 H;  4XT1 B;  2PYK A;  4X64 L;  3R2I A;  4IZ8 A;  4NXN Q;  4RCN A;  2B63 H;  4IFD G;  4ZQ3 A;  4DUY Q;  2ZXP A;  4QIW B;  4E6I A;  1HNX Q;  1PH5 A;  1X3P A;  1K8G A;  4EQ5 A;  4X6A H;  3M7G A;  2WB1 G;  2ZJR A;  3S2H B;  1U5K A;  3PIO A;  1FVI A;  2K1B A;  1UE1 A;  4DV1 Q;  1F9S A;  1O80 A;  3T1H Q;  2JA5 H;  5FJ8 G;  2JQO A;  1GUN A;  1SE2 A;  2XSC A;  3J81 i;  2LY7 A;  1X54 A;  4A3E H;  5CYU A;  5JAV A;  1YHB A;  4JVZ A;  3A54 A;  1HZB A;  2A6H C;  2WKC A;  1IKM A;  1G6Z A;  2F0M A;  4KY7 A;  5BR8 L;  2JA6 H;  4DR4 Q;  4C3H G;  4X65 L;  1BCP D;  4BA1 I;  3I4N B;  1BDO A;  5C44 H;  4C3I G;  3VR5 A;  2R7Z G;  4TKO B;  5JJK A;  3F2D A;  2KHJ A;  3GTJ H;  3K0X A;  1NMF A;  5IYC G;  4B3S Q;  3SK8 A;  2QW7 A;  1JQY D;  3KLR A;  5C3W A;  2HT1 A;  1Z6H A;  3K5N A;  4KHZ A;  3BYY B;  5C0X J;  1DJR D;  3NQT A;  4UP8 A;  2Z9H A;  2K5N A;  1I3Q H;  3ND8 A;  1PA6 A;  5ELF A;  1DOL A;  4A3C H;  3FPP A;  3OWF A;  4JC0 A;  1VQN A;  1H9K A;  4K0K Q;  3IL8 A;  2OWO A;  2UUB L;  2X6G A;  2JA7 H;  3ONA B;  4LMQ D;  4BS9 A;  1MKH A;  1NBW A;  2A68 C;  3NBI A;  2PCF B;  5DLQ E;  3KLS X;  4XQQ A;  4CDC C;  5C4X G;  5K36 G;  1R4Q B;  2A6H D;  1JE4 A;  1MIU A;  4R8N A;  4YY3 L;  1PTO D;  1QE6 A;  4Q5V A;  4IFD H;  2KHS A;  1XMO L;  3PO3 B;  1EU4 A;  1MGS A;  1GUT A;  2UU9 Q;  4EQP A;  1BCP B;  2WAC A;  1PH1 A;  1MJC A;  4C3J B;  5DAU A;  3HG9 A;  1BBU A;  1XTD A;  1UAP A;  5FJ8 H;  3M3Y B;  1PZK D;  1SJH D;  1VQJ A;  3B6Y A;  3QIA A;  2MGS A;  4X64 Q;  1A62 A;  5G3L D;  1EY8 A;  2L0C A;  1B44 D;  1EUJ A;  1PFN A;  1WCM B;  4C3H H;  4FF1 A;  2F4V L;  5EPJ A;  5C3E G;  1LLR D;  4IUP A;  3KOJ A;  1VQP A;  2NVY B;  4I65 A;  2NVQ B;  4YCU A;  1VQM A;  1PTO F;  4L8J A;  1ASY A;  2E8G A;  1KD1 C;  2PMZ B;  2F0J A;  5KYI A;  2A5H A;  2E74 C;  2A68 D;  4MTN A;  5IYC H;  3HOW B;  5HGT A;  3J80 E;  1I50 B;  3F1Z A;  2CKZ B;  3DMU A;  2RHS B;  2EYH A;  5EBC A;  2GVB A;  3EBE A;  5BR8 Q;  5EAY A;  1I4P A;  2HDM A;  4X65 Q;  1XJV A;  2G5D A;  5C0X G;  2P5Z X;  2F3V A;  1R9T B;  1H9S B;  1D6E C;  1DXM A;  2NUC A;  2OCE A;  4LF5 L;  1L0X B;  1BQQ T;  1TS5 A;  4YHH L;  1BVS A;  4R4I A;  4JBM A;  2EYO A;  4DU9 A;  3Q0A A;  4A3F B;  4AYB G;  5DEH A;  2MHV A;  3HP3 A;  1I94 L;  4MHE A;  3R3O A;  1JR0 D;  1N9W A;  5C4X H;  3FRP B;  5K36 H;  4ZCK A;  3S16 H;  2B2T A;  1T5X D;  2F0O A;  2VUM B;  2XWB B;  1L1O A;  3D8G A;  1EZ6 A;  2CCZ A;  1FNW A;  3E9H A;  1JOQ A;  3WDN A;  3T53 B;  3FEW X;  3STB C;  1EFW A;  1II3 A;  2Z6B A;  3GTK B;  1Q86 C;  1X55 A;  2JSO A;  3VYT A;  5E4W C;  1LTI D;  1G2T A;  2L9H A;  3KF8 A;  2BA0 A;  2UUB Q;  3M4P A;  1I5F A;  4RG1 A;  2MFI A;  4JG2 A;  3EJI A;  3L2P A;  1ENC A;  1EIF A;  1OXS C;  1SXT A;  4JV5 L;  1CFM A;  3SK6 A;  5BN5 A;  3NBH A;  3BYT B;  4QMG A;  4JK1 C;  5IT9 E;  3RZO B;  1XPO A;  4KKT A;  2CW0 D;  4A3M G;  1XMO Q;  4LF8 L;  4IQZ A;  1I4R A;  3G6J B;  4OIK A;  5C3E H;  5AFW A;  4ALP A;  5I6Y A;  4HCS A;  4DV6 Q;  4CDD C;  3A0J A;  3OMG A;  2F4I A;  5J39 A;  5FK9 C;  1AP0 A;  1ICW A;  3TP7 A;  1NR2 A;  2NN6 I;  2O5J C;  2VL6 A;  5ELE A;  5CV9 A;  4GLA C;  2RA4 A;  5HUR A;  4DV7 L;  3STB D;  5JEA J;  2H4O A;  4IJL A;  5ISR A;  3KUP A;  4DV3 Q;  1WFQ A;  3NTI A;  5M5Y B;  1HQM C;  3I3C A;  1STB A;  3MFG A;  1EQR A;  1TWF B;  1RHP A;  1RTN A;  1KQS A;  1N32 Q;  3PGZ A;  5IE8 A;  5ELD A;  4ULL A;  1XNR Q;  2LXJ A;  2K32 A;  3CHB D;  4G7Z C;  2UUC L;  4FXD A;  3W2D A;  4PQX A;  1PH2 A;  4KHP L;  1CQF A;  1I4X A;  1A6X A;  4RGO S;  1SDF A;  4P2C B;  2FJ2 A;  4K5X A;  3VDY A;  3E3X A;  1SMY C;  5M3M G;  5TSS A;  1VQ5 A;  4UAI A;  1Y8O B;  3K58 A;  1JT8 A;  4YHH Q;  1TWH H;  2R7D A;  1A8V A;  4KTA A;  1N34 L;  1GO3 E;  2AQ1 B;  2KCN A;  4LAA A;  3CCV A;  1JJ2 A;  3F2C A;  4ME3 A;  2K5V A;  2EJF C;  4CGY B;  4FF2 A;  1V8Q A;  1LV9 A;  4A3M H;  4X3T A;  5M5W H;  1TWC B;  4KI0 A;  2O5I C;  2IX1 A;  2B8G A;  2KEC A;  3LNN A;  1YHQ A;  4U67 3;  1Y14 B;  3FP9 A;  3J7A 5;  1YI2 A;  4LFB L;  2RVL A;  4HJ5 A;  1GUW A;  3WOE A;  1S4Z A;  2IHE A;  3BG3 A;  4ZAI A;  1SFO B;  2NZ1 D;  1XNQ Q;  4DV2 L;  4N8X 1;  4JV5 Q;  4XIG S;  4JI4 Q;  3URY A;  3PIP 3;  3KDF A;  1YHA A;  2X69 A;  5COY A;  5CV4 A;  4CKC A;  1UE7 A;  5GAG C;  3S2D B;  3HS0 C;  2B2T C;  2ZTD A;  1PFB A;  2I5H A;  1L1O C;  2KCM A;  2Z4H A;  4DAV A;  5KNC A;  1K9M C;  2KCT A;  2LS0 1;  5IT9 c;  1SMY D;  4A3G G;  3HRZ C;  3GTO B;  1DM0 B;  2Z8L A;  4GNX A;  2HD3 A;  4IO9 A;  3HOV G;  4B08 A;  5JEA G;  4A4I A;  1J6Q A;  4JYA L;  1HRJ A;  1RTO A;  3EA6 A;  4FYD A;  3W1B A;  2Q2T A;  4WJW A;  5C5L A;  2OT2 A;  4PZ7 A;  1EFI D;  3NTH A;  4PNY A;  2EY5 A;  4K8I A;  1Q1E A;  1STY A;  1U9R A;  4DXF A;  5I4D A;  2QEX A;  4DV7 Q;  1M1K C;  1SYC A;  1WTH A;  5JJL A;  1XYI A;  5M3M H;  4IOC A;  3TME A;  2QA4 A;  1HPC A;  4RKB A;  3CC7 A;  1I6H B;  4B3R Q;  2Z4I A;  1TWG B;  2IX0 A;  4UY8 C;  1EYA A;  1K8O A;  5KGU A;  1YJ9 A;  2L15 A;  1VDZ A;  1QUQ A;  4HR7 B;  4EQN A;  1KHI A;  4RAU C;  2V1C C;  3S9W A;  3MAQ A;  1ZKO A;  1IHZ A;  2RDF A;  3BVG A;  1D7Q A;  2EYJ A;  3UDI A;  4KHP Q;  3CME A;  4HSV A;  1FR3 A;  2Y0S E;  1JOK A;  3H3V H;  4DR5 L;  3AEV A;  1CHQ D;  3PO2 G;  1N36 L;  2EJM A;  4DR6 L;  4Q0F A;  2YU9 H;  2F0G A;  4DR1 L;  3T56 B;  3PMF A;  3BVM A;  1HUM A;  5FO9 B;  3JAM i;  5A2Q E;  3NWT A;  4IUT A;  4PMW A;  1VS0 A;  3J81 E;  1I4H A;  2CQA A;  1CKO A;  3H09 A;  1EZ8 A;  3IFT A;  3L7Z C;  3SVM A;  4G7O C;  2K33 A;  1D5Z C;  4K2L A;  1IBL L;  4A3K H;  3V05 A;  4J8Q A;  4DR2 L;  2MQH A;  1JJC B;  5C4H A;  4K2K A;  1Y1W B;  3HKS A;  4R4C A;  4A3G H;  1KNA A;  1Q90 A;  1GJX A;  1FD7 D;  4A3I G;  5E4X A;  3GTM H;  1E2W A;  1TWA H;  1W6J A;  4JI2 L;  4APV A;  3QJY A;  1K28 A;  3HOV H;  4IOA A;  3UDX A;  3BU2 A;  5JEA H;  3J7Z C;  3CPF A;  2A69 C;  2EYF A;  5AJ3 L;  4HJ9 A;  4OON A;  4RH6 A;  1W3S A;  2DUD A;  1XX8 A;  4IN3 A;  4X66 L;  1F2L A;  1QWY A;  1S5E D;  1DYQ A;  3HOX G;  2R3Z A;  4P74 A;  4BBR B;  1HR0 Q;  4AH6 A;  2ZT9 C;  1VQ7 A;  1D2B A;  3MA2 B;  3Q6S A;  1EEF D;  4QJF A;  2RSN A;  2JK8 A;  1L1O B;  5CGK A;  2M2L A;  4KKS A;  3G48 A;  3G7L A;  3GTL B;  1HQR D;  2YV5 A;  3CCQ A;  1SE4 A;  4ZKC B;  3CCS A;  3D3R A;  1BBX C;  1QVF A;  3KF8 B;  1CHP D;  4JYA Q;  1E0B A;  3R8B A;  2ZTC A;  4Y7N B;  4OIJ A;  4GKK L;  2MO0 A;  5I6W A;  4O42 A;  2RF4 A;  4LUV A;  3TN2 A;  3NBH B;  1AE3 A;  4NXN L;  2FMM A;  4KJO A;  1CK1 A;  4DUY L;  3PO2 H;  3S1N H;  3EQL C;  2DGY A;  3BDL A;  2VQF L;  4BY1 B;  2SNM A;  2VQE L;  2AUJ D;  1WVL A;  5LL6 X;  1YJN A;  3QB3 A;  4GNX C;  3AU7 A;  1FNV A;  2JA8 G;  1VMC A;  5FLX c;  2CH4 A;  1PHJ A;  4RGM A;  2ALY B;  4LNQ A;  1ML0 D;  3Q22 A;  2C9O A;  5T1G A;  4KV6 A;  4DV1 L;  3UI2 A;  4PG3 A;  4LF6 Q; 
#chains in the Genus database with same CATH homology
 1E2Z A;  2EPB A;  4CBV A;  4HED A;  2E2I B;  1XXG A;  4UDU C;  2JA5 B;  1DZ1 A;  4A3E B;  2RDH A;  2F0F A;  1PLF A;  5LL6 S;  5CR3 A;  1Y8P B;  3VYS A;  2PO4 A;  3M4O B;  2E2D C;  5C44 B;  2L11 A;  4XXE A;  3MEH A;  2F0U A;  2B2Y A;  2IWH A;  1WTW A;  4JBW A;  2Q8R E;  4A3B B;  3N6R A;  1LTB D;  4K6D A;  2KCC A;  1G91 A;  2I07 B;  3NTK A;  2NVX B;  1I3Q B;  1TY2 A;  4NW2 A;  3J80 L;  1DOK A;  3C46 A;  5KRU A;  4R9W A;  2JA7 B;  5CV8 A;  2H1E A;  4DXG A;  5M3F B;  2F0W A;  1F9Q A;  2M00 A;  1ILP A;  1M8A A;  3BDO A;  1EWH A;  1HA5 A;  3P7J A;  4CJ1 B;  5C3X A;  2JEA I;  1B9N A;  3GO5 A;  3QG1 A;  5D14 A;  4WOR A;  3MHB A;  4BA2 I;  5CMD A;  1WTQ A;  4G7H C;  3OOC A;  2D2C C;  2BOS A;  2IX3 A;  4L63 B;  1PYW D;  1SJE D;  1X32 A;  4NKL A;  4NP5 A;  5K5P A;  2F3W A;  4RCO A;  4C3H B;  1JWS D;  1YNN C;  3EVQ A;  1SNQ A;  1AZP A;  2K7V A;  3OHX C;  1STN A;  1T5E A;  3K57 A;  2KA7 A;  2K6A A;  4B9X A;  3PIO 3;  3NE5 B;  4XT3 B;  1F77 A;  1JWU D;  3AMU A;  3D31 A;  1F2M A;  3A8I E;  3I8Z A;  3PUZ A;  2NTS A;  1LAB A;  3S1R B;  4K8J A;  2N88 A;  4H44 C;  3S1Q B;  1PZI D;  4RHR A;  1SNC A;  1JIC A;  1JWM D;  2AUK A;  3Q23 A;  3C3L A;  3HEJ A;  4X3K A;  1DD2 A;  3S16 B;  1O7Y A;  2PW5 A;  1BCP F;  1MI2 A;  5EJW A;  1FYC A;  1K8M A;  5JVG 3;  4CKB A;  1SNM A;  3PUV A;  2NYZ D;  2DY8 A;  1AZQ A;  2B2Y C;  1EL0 A;  1LTT D;  2KEE A;  1KNE A;  3U9S A;  3DWQ A;  3A8K E;  3DWA A;  3MXP A;  3RD4 A;  2FMC A;  1UEA B;  1ESF A;  5C3E B;  1IW7 C;  1EIH A;  2QCP X;  5KIX A;  2K05 A;  1B1Z A;  4KN4 C;  3W3A A;  3DHQ A;  4ZLT F;  1V1O A;  1LTS D;  5D3D A;  1V43 A;  1CI3 M;  2L55 A;  1QOH A;  4RHS A;  4A93 B;  1HFN A;  3K5M A;  1O7Z A;  3C2P A;  4V19 0;  2F0I A;  4ME5 A;  4N9P A;  1E2V A;  3OMC A;  2D62 A;  1EQV A;  3HGB A;  4C3J G;  1ET9 A;  4AYB B;  2PPB C;  3H3V C;  3NPP A;  1D5X C;  1SND A;  5G3L F;  3GP7 A;  1V1P A;  1UUP A;  4IUR A;  1IW7 D;  1NSN S;  2ZXR A;  2O4X A;  1TQO A;  3DEO A;  4F7X A;  1TWH B;  2SDF A;  2E76 C;  2EYL A;  3LX0 A;  5FO8 B;  1B4O A;  4A3M B;  5M5W B;  1VF5 C;  1TS3 A;  1SBB B;  3MZ5 A;  4DGZ A;  2K5D A;  1STE A;  1HHV A;  4FP5 D;  2C5C A;  4B9W A;  1SYE A;  1ONL A;  2DNE A;  2K5Q A;  2V4D A;  1PRT C;  2HCC A;  2BDN A;  5A2Q L;  5EKI A;  3NSW A;  3TSS A;  2L4N A;  4EQO A;  4EVO A;  5IGC A;  3D6C A;  1B50 A;  2PNR C;  2F0L A;  1U4P A;  1QCB D;  5C4J B;  5M5X B;  5CBA E;  1HTP A;  1Q12 A;  3GV3 A;  5D3I B;  5C0X H;  2XWJ B;  3VYU A;  5NUC A;  3VR6 A;  1WD0 A;  2GA4 B;  2NN6 G;  4FXK C;  5M3M B;  1CM9 A;  4FNF A;  1F9P A;  1JOR A;  1OXU A;  2K5W A;  3A56 A;  2MPM A;  1HFG A;  3A7A B;  4F8M A;  3H94 A;  4DF7 A;  1LT5 D;  1TS2 A;  5CV7 A;  1LTR D;  3V2T A;  1Q3L A;  5IGD A;  2CVR A;  2NWG A;  3ITP A;  3TP6 A;  4KD4 A;  2YU9 B;  4OO1 I;  1PTO H;  3KLS A;  1G8Z D;  5JPN C;  1ESR A;  4LK1 C;  4CHT B;  5JPM C;  1WTO A;  1SNP A;  2G9D A;  4L6T B;  4DAY A;  1CTM A;  4A3K B;  3N52 A;  4KD3 A;  1JB3 A;  4HMJ A;  4DK1 A;  1VF7 A;  2MJ8 A;  5BN3 A;  3BDC A;  3GTM B;  1TWA B;  3HOV B;  2EXZ A;  1RD9 D;  4R8I A;  1EYD A;  2E2H B;  2EY1 A;  3ND9 A;  3D4D A;  4X3U A;  2JP1 A;  3TZD A;  1KAB A;  4FF3 A;  3HOY B;  1PRT B;  2NN6 H;  4BBS B;  3GTQ B;  4M8A A;  4G57 A;  2Z1C A;  1OXT A;  3MC0 B;  1Z7T A;  1ZYR C;  1I6V C;  1Y8N B;  4ZRZ A;  1ET6 A;  5FLX E;  1TT2 A;  1SYB A;  1B3A A;  1F2Y A;  3PO2 B;  1S5B D;  1XTC D;  2ENB A;  5I9P A;  3NK9 A;  2Y0S B;  2BCO A;  4KY5 A;  1KTK A;  1YNJ C;  3H91 A;  4QCL A;  4K5V A;  3NHH A;  2SNS A;  3V96 A;  1GUG A;  2OXP A;  4IAL A;  2BDO A;  2JEB I;  1OXV A;  2BE5 C;  2XVS A;  3VR3 A;  5D65 A;  3VR2 A;  4A3I B;  5JVH 3;  2NB0 A;  4U68 A;  1G2S A;  5J22 A;  4KHV A;  1SE3 A;  5E3F A;  2OF1 A;  2ZXO A;  2E75 C;  3E5S A;  1C48 A;  2VXW A;  3K59 A;  1C4Q A;  1HUN A;  3TZU A;  1RCV D;  2R93 B;  2TMP A;  3VR4 A;  1O7L A;  3T16 A;  3DWP A;  2MUY A;  3SK4 A;  1YNJ D;  3E0J A;  3I90 A;  2J4X A;  1A2U A;  3SXH A;  2BE5 D;  3U9O A;  1A3U A;  4K6L A;  5EQ0 A;  3DM1 A;  2JA8 B;  4GZY C;  2PZW A;  1SYG A;  1UNS A;  2E2J B;  3K7A B;  2EDG A;  2TSS A;  5EPL A;  1EEI D;  2J0T D;  1WTV A;  2PZT A;  1WD1 A;  2AQ3 B;  3NQI A;  1STH A;  2XRQ D;  2F03 A;  1STG A;  3HOZ B;  2L1B A;  2HQE A;  4OL7 A;  2B63 B;  2OEO A;  5J1Z A;  1GUO A;  3IFD A;  4NDX A;  2A69 D;  3M4Y A;  1I4G A;  2M9V A;  2WV6 D;  1A2T A;  1AFP A;  3FKI B;  2R6G A;  4KK7 A;  3HZX A;  4C1N K;  3S17 B;  4J6H A;  1GUS A;  3K5O A;  2VB3 X;  4DK0 A;  1C8C A;  1EY9 A;  2F0V A;  2EZV A;  2JA6 B;  4FF4 A;  3SR1 A;  4I7Z C;  2EE1 A;  2QKI C;  4HN7 A;  5T1I A;  1IKL A;  4J1M A;  3GTJ B;  5C4Z A;  2X6L A;  5IIF A;  4V0B A;  4CJ2 C;  3KBX A;  4H0L C;  3FVQ A;  3OIP A;  2WAQ B;  1RKN A;  5EKL A;  2JYO A;  5EKK A;  5CV5 A;  3MVV A;  2NVT B;  3NP8 A;  3BS1 A;  5CV6 A;  3QOL A;  3QWN A;  1IL8 A;  1JC7 A;  4C2M B;  2DY7 A;  2AWN A;  2QF7 A;  1O78 A;  3MWY W;  3MFY A;  3ZYY X;  3SK5 A;  2K03 A;  4X3S A;  2O2L D;  3SE0 A;  1W6K A;  2WB1 B;  2NBF A;  1OXX K;  5KEE A;  5I9O A;  2XRS D;  2B2V A;  1QB5 D;  2IT1 A;  1FNU A;  4IFD I;  4ZK9 B;  5FO7 B;  1EY5 A;  1EU3 A;  4TSS A;  4M1U B;  1U4R A;  2EY6 A;  1F9R A;  3VYR A;  1MSH A;  4HTH A;  4C3I B;  1STA A;  4QF4 A;  4ILW A;  2R7Z B;  3S15 B;  5IT9 L;  1BOS A;  1LT4 D;  2MP1 A;  3IKJ A;  3J7Y W;  2B8F A;  1KLG D;  2FIN B;  1Z47 A;  1QJO A;  1GXD C;  3D4W A;  3FMC A;  4MN3 A;  3IAY A;  4DFA A;  3I72 A;  4C1N I;  1PTO C;  2A74 C;  5ELB A;  1TKW B;  1EQT A;  1LO5 D;  3TDQ A;  1QG7 A;  1A3T A;  2VNU D;  1TII D;  4ABN A;  3DUZ A;  5C4X B;  1Q8I A;  1H9J A;  3VA7 A;  1G29 1;  2KVM A;  4F88 A;  1TY0 A;  1B53 A;  1AW7 A;  1YNN D;  3L9A X;  3LWE A;  1QIL A;  2WII B;  5IGG A;  4FVM A;  5JOB A;  3SDZ A;  4RGT A;  4ODG A;  4S3S A;  3RMH A;  3I4M B;  5A35 A;  3EFX D;  1ZEQ X;  1LT6 D;  2LFN A;  2QIL A;  3ERQ A;  1CA6 A;  4WFN 3;  2IJ0 A;  4DNT B;  1B9M A;  3T4A C;  4C56 C;  4IUQ A;  3GD7 A;  4ZKB B;  3DXJ C;  2K01 A;  1PXU A;  4KY6 A;  3H6M A;  3CU7 A;  4G4K A;  3M7N A;  2YYZ A;  2XN9 C;  4F87 A;  3OW7 A;  4HCE A;  3D4R A;  1U4M A;  2F0T A;  2B2V C;  5F2D A;  2QDB A;  4K14 A;  2F0N A;  1BF4 A;  3C1F A;  1CZG A;  4HAE A;  1ENF A;  4IUV A;  1VMP A;  3OWE B;  5DM6 3;  5C0X I;  1Y69 U;  2IW3 A;  4N9T A;  2BA1 A;  1SYF A;  4HSP A;  3VA5 A;  5M9O A;  5E1F A;  4CJ0 B;  2SOB A;  1OO9 B;  1RF2 D;  3GTG B;  4XTC S;  3A8J E;  3AB9 A;  3S1M B;  4H7B A;  3J7A V;  2CW0 C;  1S5C D;  4RGN A;  1PTO B;  5FLX L;  1I4Q A;  3JAM E;  1KDC A;  2QEJ C;  2EYM A;  1PZJ D;  1SSO A;  1SYD A;  4FXG C;  1B2T A;  2JXM B;  2DN8 A;  2SEB D;  4BWG B;  4KMU C;  1CZW A;  4RFB A;  2EYP A;  3KBG A;  1U4L A;  5KND A;  4PV1 C;  4DNR B;  2AQ2 B;  4ZYS A;  1AEX A;  2NTT A;  4KJN A;  1PDQ A;  1NAP A;  2KJX A;  2D9U A;  3MXU A;  3GV6 A;  5ELC A;  2F0H A;  3J81 L;  1D1K A;  1R4P B;  1EYC A;  4TRD A;  1EWC A;  3S14 B;  4LJZ C;  4XQN A;  1FGB D;  2B2W A;  2WKD A;  2KED A;  3E6Z X;  4O1N A;  2RSO A;  1NR4 A;  2A6E C;  4KKU A;  4H13 C;  3CRK C;  3O13 A;  4RKL A;  5IOD A;  3MXG A;  5FKA C;  4NMZ A;  2J7Z A;  3GTP B;  1CQV A;  1SEB D;  1KAA A;  1PRT D;  3TP8 A;  4XYQ A;  1DOM A;  2EJG C;  2ICE C;  3I4L A;  3OSO A;  3RUZ A;  3P75 A;  4OHJ A;  2PQE A;  1JCK B;  3SHL A;  3F2U A;  2F0D A;  2K04 A;  1GHK A;  3L3O C;  4PMC A;  2LKV A;  1S5D D;  2ICI A;  1MD2 D;  4OO1 G;  1D1I A;  3I73 A;  4A3G B;  3PUX A;  2G9H D;  2A6E D;  3BZD B;  3GQB A;  1BNZ A;  4K5W A;  1PRT F;  3X3M A;  5BN4 A;  1SAP A;  2EOT A;  3M85 A;  4XQJ A;  1PFM A;  5EBD A;  4PMB A;  1A3V A;  1BUV T;  2HDL A;  3X3N A;  1J9O A;  3A7L A;  4ZUJ A;  1X3Q A;  1IYV A;  1Y1V B;  4YIJ A;  3QO2 A;  3FDT A;  1RDP D;  2ID0 A;  2K28 A;  2F0S A;  1XWE A;  2F0Q A;  3NWS A;  5KNB A;  3S1N B;  1NCV A;  4RWS C;  1ZXT A;  1KDB A;  3I91 A;  4QB4 A;  1A15 A;  5LHY 1;  2JE6 I;  3P1H A;  3J7A F;  3SEB A;  3WOF A;  1EIG A;  4XYO A;  5I2Y A;  4QUF A;  2B2W C;  2F0P A;  1WTX A;  4IUU A;  1TR5 A;  2D5D A;  3RLF A;  2HUG A;  2Q8T A;  4OO1 H;  5C6A A;  2FHT A;  2WP8 J;  5COR A;  1HXY D;  2L12 A;  1L0Y B;  4IUN A;  1CA5 A;  1RJT A;  2KUM A;  1DON A;  3PV0 A;  5EGT A;  3ERO A;  3LWU A;  3R2T A;  1F2Z A;  1EY7 A;  1ZYR D;  3PUW A;  1H9M A;  1EY4 A;  1J8I A;  3HOX B;  3OPO A;  1ILQ A;  4OGQ C;  3PUY A;  3MXN A;  5FOB B;  3P20 A;  4QUC A;  1BR9 A;  1V1P B;  1S5F D;  3NUC A;  1MSG A;  1MBY A;  2RDG A;  3T13 A;  1IYU A;  1HA6 A;  3CQZ B;  3K5L A;  1D5M C;  3CKI B;  1WTP A;  2B2U A;  4ZUI A;  1GHJ A;  5IOC A;  1BO0 A;  2VB2 X;  1WTR A;  1LTG D;  3CRL C;  2IL8 A;  2I46 A;  3I70 A;  4HMI A;  2B39 A;  4A3J B;  2R92 B;  5I2X A;  1QNU A;  3R93 A;  2XNA C;  1K83 B;  5DNF A;  3TP5 A;  3DEP A;  1JOO A;  1LAC A;  1BXT A;  3T51 B;  1SNO A;  2WIN B;  4FO2 A;  4KN7 C;  3K6O A;  2L5T A;  2R61 A;  3C1E A;  5DM7 3;  1CT1 D;  1LTA D;  1Q1B A;  2LMC B;  1ROD A;  2F1M A;  1KDA A;  4WRD A;  1HCZ A;  4ID6 A;  3TBI B;  3K0Y A;  2FFK B;  1TU2 B;  4DN4 M;  1H9S A;  1GOZ A;  1EOT A;  5IGB A;  2Q8I B;  5IGF A;  2F0K A;  4IFD J;  1VCI A;  2RQX A;  1H9R A;  4DA2 A;  4Z9C B;  4DAP A;  4CKE A;  3MTS A;  3Q24 A;  5KYL A;  4BY7 B;  1NUC A;  2CHB D;  3BVZ A;  4XDX A;  3D6W A;  3RZD B;  4RA8 A;  2EVB A;  1PMR A;  1QNK A;  2AWO A;  2RKS A;  4A3D B;  3HKZ B;  4TQU S;  3NXW A;  2N55 A;  4MIU A;  5IGE A;  1DCZ A;  1M4V A;  1TVX A;  3FPU B;  2DNC A;  2PW7 A;  2KQ3 A;  1ENA A;  1EY6 A;  3OIQ A;  3A55 A;  1HTL D;  3H0G B;  2HCI A;  2EY2 A;  5JJZ A;  2F0E A;  5EPK A;  5CBE E;  2PZU A;  2XIW A;  3KK7 A;  1EY0 A;  3QOJ A;  5C5M A;  2KOL A;  1BCP C;  2B2U C;  2IPK D;  1LT3 D;  3JAM L;  1TS4 A;  2RBM A;  1KLU D;  1AN8 A;  5CC4 A;  2A73 B;  4EGV A;  3HOU B;  4XT1 B;  2PYK A;  3R2I A;  4IZ8 A;  4RCN A;  4IFD G;  4ZQ3 A;  2ZXP A;  4QIW B;  4E6I A;  1X3P A;  3M7G A;  3S2H B;  2K1B A;  1F9S A;  1O80 A;  1GUN A;  1SE2 A;  2XSC A;  2LY7 A;  5CYU A;  5JAV A;  3A54 A;  2A6H C;  2WKC A;  1IKM A;  1G6Z A;  2F0M A;  4KY7 A;  4C3H G;  1BCP D;  4BA1 I;  3I4N B;  1BDO A;  4C3I G;  3VR5 A;  4TKO B;  3SK8 A;  1JQY D;  3KLR A;  5C3W A;  1Z6H A;  3K5N A;  4KHZ A;  3BYY B;  5C0X J;  1DJR D;  3NQT A;  3ND8 A;  5ELF A;  1DOL A;  3FPP A;  3OWF A;  1H9K A;  3IL8 A;  2X6G A;  3ONA B;  4LMQ D;  4BS9 A;  2A68 C;  3NBI A;  2PCF B;  3KLS X;  4XQQ A;  5K36 G;  1R4Q B;  2A6H D;  1JE4 A;  4R8N A;  1PTO D;  1QE6 A;  4Q5V A;  4IFD H;  2KHS A;  3PO3 B;  1EU4 A;  1MGS A;  1GUT A;  4EQP A;  1BCP B;  2WAC A;  4C3J B;  5DAU A;  3HG9 A;  1UAP A;  3M3Y B;  1PZK D;  1SJH D;  3QIA A;  2MGS A;  5G3L D;  1EY8 A;  2L0C A;  1B44 D;  1PFN A;  1WCM B;  4FF1 A;  5EPJ A;  1LLR D;  4IUP A;  2NVY B;  4I65 A;  2NVQ B;  1PTO F;  4L8J A;  2PMZ B;  2F0J A;  5KYI A;  2A5H A;  2E74 C;  2A68 D;  3HOW B;  5HGT A;  3J80 E;  1I50 B;  3DMU A;  2EYH A;  5EBC A;  1I4P A;  2HDM A;  5C0X G;  2F3V A;  1R9T B;  1H9S B;  1D6E C;  1DXM A;  2NUC A;  1L0X B;  1BQQ T;  1TS5 A;  2EYO A;  4DU9 A;  3Q0A A;  4A3F B;  5DEH A;  2MHV A;  3HP3 A;  4MHE A;  3R3O A;  1JR0 D;  3FRP B;  5K36 H;  2B2T A;  1T5X D;  2F0O A;  2VUM B;  2XWB B;  3D8G A;  1EZ6 A;  1FNW A;  1JOQ A;  3WDN A;  3T53 B;  3FEW X;  1II3 A;  3GTK B;  2JSO A;  3VYT A;  5E4W C;  1LTI D;  1G2T A;  2L9H A;  3KF8 A;  2BA0 A;  3EJI A;  1ENC A;  1OXS C;  1SXT A;  1CFM A;  3SK6 A;  5BN5 A;  3NBH A;  3BYT B;  4QMG A;  4JK1 C;  5IT9 E;  3RZO B;  4KKT A;  2CW0 D;  4IQZ A;  1I4R A;  3G6J B;  4OIK A;  5AFW A;  5I6Y A;  4HCS A;  3OMG A;  2F4I A;  5J39 A;  5FK9 C;  1AP0 A;  1ICW A;  3TP7 A;  1NR2 A;  2NN6 I;  2O5J C;  5ELE A;  5CV9 A;  2RA4 A;  5HUR A;  5JEA J;  2H4O A;  5ISR A;  3KUP A;  3NTI A;  5M5Y B;  1HQM C;  3I3C A;  1STB A;  3MFG A;  1TWF B;  1RHP A;  1RTN A;  5ELD A;  4ULL A;  4G7Z C;  2K32 A;  3CHB D;  4FXD A;  3W2D A;  4PQX A;  1CQF A;  1I4X A;  1A6X A;  4RGO S;  1SDF A;  4P2C B;  2FJ2 A;  4K5X A;  1SMY C;  5TSS A;  4UAI A;  1Y8O B;  3K58 A;  4KTA A;  2AQ1 B;  2KCN A;  4LAA A;  2EJF C;  4CGY B;  4FF2 A;  1V8Q A;  1LV9 A;  4X3T A;  1TWC B;  4KI0 A;  2O5I C;  2IX1 A;  2B8G A;  2KEC A;  3LNN A;  4U67 3;  2RVL A;  1GUW A;  3WOE A;  1S4Z A;  3BG3 A;  4ZAI A;  1SFO B;  2NZ1 D;  4XIG S;  3URY A;  3PIP 3;  2X69 A;  5COY A;  5CV4 A;  4CKC A;  3S2D B;  3HS0 C;  2B2T C;  1PFB A;  2Z4H A;  4DAV A;  5KNC A;  2LS0 1;  1SMY D;  3HRZ C;  3GTO B;  1DM0 B;  2Z8L A;  4B08 A;  5JEA G;  1HRJ A;  1RTO A;  3EA6 A;  4FYD A;  4WJW A;  5C5L A;  2OT2 A;  1EFI D;  3NTH A;  4PNY A;  4K8I A;  2EY5 A;  1Q1E A;  5I4D A;  4DXF A;  1STY A;  1U9R A;  1SYC A;  1XYI A;  3TME A;  1HPC A;  4RKB A;  1I6H B;  2Z4I A;  1TWG B;  2IX0 A;  1EYA A;  1K8O A;  5KGU A;  1VDZ A;  4HR7 B;  4EQN A;  4RAU C;  3S9W A;  3MAQ A;  1ZKO A;  1IHZ A;  2RDF A;  3BVG A;  2EYJ A;  4HSV A;  1FR3 A;  1JOK A;  1CHQ D;  2EJM A;  4Q0F A;  2F0G A;  3T56 B;  3PMF A;  3BVM A;  1HUM A;  5FO9 B;  5A2Q E;  3NWT A;  4IUT A;  4PMW A;  3J81 E;  1I4H A;  2CQA A;  3H09 A;  3IFT A;  1EZ8 A;  3L7Z C;  3SVM A;  4G7O C;  2K33 A;  1D5Z C;  4K2L A;  3V05 A;  4J8Q A;  5C4H A;  4K2K A;  1Y1W B;  1GJX A;  1KNA A;  1Q90 A;  1FD7 D;  5E4X A;  1E2W A;  1W6J A;  3QJY A;  5JEA H;  2A69 C;  2EYF A;  4RH6 A;  1XX8 A;  4IN3 A;  1S5E D;  1F2L A;  1QWY A;  1DYQ A;  2R3Z A;  4BBR B;  2ZT9 C;  1D2B A;  3MA2 B;  3Q6S A;  1EEF D;  2RSN A;  5CGK A;  2M2L A;  4KKS A;  3G7L A;  3GTL B;  1HQR D;  1SE4 A;  4ZKC B;  3D3R A;  1BBX C;  1CHP D;  1E0B A;  3R8B A;  4Y7N B;  4OIJ A;  5I6W A;  4O42 A;  3TN2 A;  2FMM A;  4KJO A;  1CK1 A;  3EQL C;  3BDL A;  4BY1 B;  2SNM A;  2AUJ D;  1WVL A;  5LL6 X;  3QB3 A;  3AU7 A;  1FNV A;  1VMC A;  4RGM A;  1ML0 D;  3Q22 A;  2C9O A;  5T1G A;  4KV6 A;  3UI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...