3A7XA

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 45seconds)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7xA02
1RTLA 4GLYA 2BXTH 7GCHG 5HXFA 1ZOMA 1HBTH 1RTFB 2UUKB 4Y71A 1QL7A 1HAOH 3LPRA 2BLWA 1C1RA 3KQCA 3A89A 3M36A 1CHOG 1FY5A 3E91A 4NIXA 2Q1JA 2G81E 2BX3A 4WWYA 3PMHB 4DIHH 2Z94A 1SGYE 1AB9C 6CHAB 4SGAE 4O3TA 2ZHWH 5FX5A 1DSTA 3T28A 2ZFQH 3ZZCA 3S7KB 2ZFPH 3ITIA 2CXVA 2VH0A 2QXJA 1KLTA 1TQ0B 2H2ZA 1K1LA 3S0NA 1SOTA 2NU0E 3SV8A 1A0JA 1K1OA 5E2PA 1HAVA 4NFFA 1GDUA 3SNBA 1EJNA 2FWWA 1VGCB 2Z9IA 1O2YA 1FY8E 1QB6A 2NU3E 4Q80A 5DP9A 1LKBA 1KDQA 1PPEE 4ISHH 3NUMA 3UNQA 5C20A 1K1MA 2HRVA 2CN0H 3GISB 4IC6A 2BVRH 1V2JT 1GHXH 4Q7XA 1FV9A 2Y5HA 2ZEBA 3BF6H 1TAWA 3QZQA 4THNH 1D9IA 4VGCB 1BBRK 3LH1A 3ZZAA 2ALPA 3PTNA 1C5ZB 2CGAA 5EW1H 1O5GH 4DOQA 2RA3A 1AI8H 1SSXA 4CBNA 3QN7A 2FLBH 1CBWB 1UHBB 3A7WA 4LK4A 3PROA 4NIYA 4RKJB 2ILNA 3A8CA 1ZHRA 3SNCA 1U6QA 2OQUA 1GJ6A 4AFZA 3BV9B 1GMCF 1CO7E 4JZEH 4Y0ZE 1V2LT 3HATH 4ZUHA 7GCHF 1ZTKA 2VIDA 3A8DA 1C5UA 2C8ZB 1K21H 4D9RA 1GHZA 1IQIA 2FOGA 3M3VA 4UDWH 1CHOF 1LHGH 2BVXH 4NWLA 2I6QA 2ZDLA 1MMJN 3PLKA 1GHWH 2AH4X 2QXHA 1TIOA 1O2KA 5L2YH 7LPRA 2G00A 2Y80A 5EXMA 1ELFA 1P9SA 2BXUH 2XXLA 1UTJA 1O0DH 3LH3A 1ZHPA 1DX5M 4DGJA 8GCHF 1T7CA 1QL9A 1BCUH 1S6HA 3F9GA 1D3QB 1CGJE 1NO9H 5GXPA 4LZ1H 3TK5A 4MNWA 1OYTH 4AGKA 1V6DA 4AFUA 1SGCA 1FIWA 4JYTA 3Q3YA 1MCVA 2STAE 2AERH 2XW9A 3RM0H 4NSVA 1NFUA 1SOZA 1XVMA 5T6DA 1XMNB 1TX8A 3QLPH 1C5XB 2ZFRH 3T5FH 1GVZA 4JZ1A 1C1SA 4I8HA 4E7NA 1FNIA 1LHFH 4ZHLU 1V2VT 4ZKRU 1AE5A 1O2PA 1IQJA 1PPCE 2QGRA 1DICA 1FUJA 2FOEA 2BZAA 2CMYA 3A8AA 4JYUH 3VXEH 1UTQA 2FTLE 1BTYA 4OS4A 2OC7A 1D3TB 1GBHA 1EQ9A 4YOJA 4XOJA 2D1JA 1GBMA 1DLKB 1O35A 1UVPA 5T6FA 3PLPA 1P2MA 1YPHC 3SU1A 2UUYA 3GY2A 3TJOA 3OX7U 1HDTH 1O32A 3C1KA 2BDHA 2Z7FE 3L3TA 4DG4A 1GBDA 1EAUA 4OS1A 4IS5A 2OQ5A 1SFQB 1AIXH 2A2QH 1PJPA 5E2OA 1HIAB 1PYTC 1YYY1 3PTBA 3UWIA 2ZGHA 3LU9B 3STJA 3SOSA 1TNHA 1GVLA 1YPMH 5A0AE 1S81A 1GDNA 2WV5A 1QURH 1UTKA 2PTNA 1X7AC 3CS7A 3P70B 1AVXA 1BBRH 2XC4A 1G3CA 3SZNA 4HI3A 3SNAA 1O5FH 2PR3A 1T32A 1J8AA 2V0BA 3GDSA 5FHTA 3RU4T 4NCYA 5BRRE 2P8OC 4O9VA 1W2KH 3SU0A 2UWOA 4AB9A 1GI2A 2FXRA 2PGBB 1ESBA 3E90B 1W13U 1Y3YA 3T25A 3MYWA 2BOKA 1O3OA 1C5RA 5CHAC 4K5ZA 1NY22 1YPEH 1ARBA 2P3FH 1C5TA 4WXIA 4HZHA 5DP3A 2ZDAH 3BSQA 1FN8A 1MCTA 1TB6H 2CF9H 1EZXC 1GBLA 2GX4A 1L1NA 1WSSH 2UUJB 4ZMAH 1P09A 4MG3A 2XNIA 1P3EA 3ZVGA 2EA3A 1UVUH 3ZVDA 4X8SH 1AGJA 4DIIH 3M3TA 2GCHG 2ZP0H 3SI4H 1LVBA 1KY9A 3A86A 1QTFA 1SMFE 3EE0B 1AD8H 1AMHA 1EAWA 2UWPA 1W0ZU 1ARCA 1FZZA 1ZSKA 2AIPA 2AMQA 1LPZB 3H5CB 3QGJA 3RU4D 4JCNA 5FPYA 1NPMA 1GBFA 3V0XA 2UUFB 3I77A 1T8OA 1AVWA 1AFQB 1C9TA 2BD8A 3AAVA 2ANMH 4XFQA 1Y5AT 1V2TT 1HPGA 3BG8A 4ZHAA 4FUHA 1VITG 1A0HB 1ZPCA 1C2HA 3M35A 2HNTF 2VGCB 1RGQA 1ELVA 1FJSA 3SUEA 1Q31A 5A09A 2OBOA 4B74A 4JZDH 4OGXA 1QJ7B 1FXYA 1NM6A 1IHTH 4U2WA 1OYQA 2ODPA 1OP8A 2Z3EA 4IMZA 3GY7A 1GI9B 1C1NA 3SHAH 1NRRH 4U01A 5A8ZA 2ZDMA 3F9FA 3KHVA 3S9BA 1BIOA 2VWMA 1ZSLA 4AG2A 5TJXA 1A3BH 1KSNA 2R3YA 3LGVA 1SGNE 1GJ4H 1RIWC 1DUEA 2Y6TA 2TGTA 5CE1A 3PB1E 1C5YB 5AF9H 1LVOA 2F9BH 3T62A 1ABIH 1IQNA 1O3CA 4NIWA 3VXFH 1O2JA 3A7XA 3SU2A 5JBAS 1MTUA 3A7VA 1GG6C 2HPPH 1VR1H 1MTVA 3E1XB 5C5OA 2ZZUH 1AY6H 1DPOA 1TA6A 1SGEE 1T8LA 1D6WA 1O2TA 2GCHF 2A5KA 1THSH 3VGCB 1GBEA 2WPLS 1P3CA 5BPEA 2PKSB 1DXWA 3QWCH 1WOFA 1EZUC 3ZZ3A 1DSUA 2HALA 4NSYA 1THRH 1BA8B 1XM1A 3M5MA 2IN2A 4LZ4B 3P8OA 4Q7ZA 3HK6B 4X6PA 2TGPZ 1NU7B 5DP4A 1O2LA 5F03A 4KGAA 4ABGA 2NU1E 1WQVH 4YOGA 5LPFA 2ZWLH 3V12A 2R3UA 3BEFB 2FI5E 1JRSA 5A0CA 1NROH 1VITF 4D7GA 3DA9B 2SGDE 3ELAH 1BOQA 2SGEE 2SFAA 3A7TA 3RMOH 1Y3XA 1HAGE 2EI7A 3VEQB 3PMAB 4DW2U 2O8TA 1WU1A 3TNSA 1GJBB 2A7JA 1KXAA 1JRTA 4MPUA 3B8JA 2PGQB 1O3MA 1SHYA 3A83A 1QGFA 2XCFA 4K60A 3MHWU 5JDUB 3TGJE 4YOIA 2BDGA 1K2I1 1UTNA 3LOXA 2Q6FA 1DE7H 2A7CA 1CA0B 2Y7XA 1WV7H 4FUDA 4KKDA 1HB0B 1ZJKA 1IQFA 2EI8A 1C2LA 1K22H 1TFXA 3NKKA 3DUXH 3JZ1B 3RP2A 1A7SA 5EW2H 1QQUA 3U8RH 2WUBA 1C1UH 1BTXA 3SGQE 3ATWA 2ODYB 2A31A 5L2ZH 4ZAEA 3NK8A 1AKSA 5FCRA 1IQHA 3VB3A 4X1PU 1AB9B 4LOYH 3RMNH 4MQAA 3ATLA 3G01A 3ATKA 1M9UA 1ZMLA 1XUHA 2LNCA 1C5OH 5HMAA 1EP5A 2G52A 2OTVA 2A5IA 4IC5A 3PO1C 2GZ9A 5LH8A 1W10U 1YLDA 4MNXA 2XCNA 3QX5H 2F83A 4ISOA 4GAWA 1LQDB 1GI6A 1H8IH 1TGCA 2NU4E 3RXEA 4BTIB 2TBSA 4XBCA 1G2LA 3RMMH 2GTBA 3NZIA 1P04A 1SGQE 3EAJA 3BTHE 1NFYA 4FU8A 1SL3A 2WPMS 1TABE 2HGTH 1GBCA 1PPFE 2VIPA 1C5MD 1HCGA 1CHGA 2F9UA 4X1QU 1DT2A 4O03A 2OP9A 2BD5A 2J38A 2ZECA 1A3EH 1UO6A 3ZVBA 1BRUP 2FI4E 1C4V2 3SJ9A 2QV1A 1OX1A 1QCPA 4I8GA 3GDVA 1F0TA 3RXJA 2C8XB 1TBZH 1TGNA 1CA8B 3L6PA 2PV9B 2BVSH 3MNBA 4XDEA 4U32A 4YO9A 1GBIA 4BOHA 4KTUA 3ZVCA 4K1EA 2O8UA 1TE0A 2XBYA 2CJIA 3MU8A 4K1SA 2BDYA 1ZRBA 3RLYH 3QUMP 5GDSH 2OD3B 2Q6DA 2R2WU 3MFJA 2ZFSA 4E7RG 1Q2WA 3LGUA 5FXLA 5EU8A 1QBNA 1VCQA 1Y3UA 5C3NA 1FN6A 5GJ4B 3SJOA 3MU4A 3MH4A 2BY5X 4HTCH 1HAZB 1RXPA 3QTVH 3EYDA 4FUGA 3K6ZA 1QBOA 1TQ7B 5EXNA 3FAOA 2B8OH 3FP8E 2SGPE 4X8UH 3SQHE 1J9CH 3BTTE 1A5GH 3ATIA 2FX4A 1MD7A 3LC5A 3Q3XA 2TGAA 3C27B 1TRMA 3ZZ6A 1Z8RA 1C2DA 4YM9A 1IQEA 1XKAC 2IOTA 3GCOA 2DE9A 2C90B 1T4UH 3LDXH 1NT1A 3R0FA 4KTSA 1EOJA 5TCAA 3KQEA 3ZV9A 2A2XH 2A4QA 1P2IA 1A2CH 3M7TA 1O33A 1YBWA 3TLOA 1K9OE 3SUFA 1UJ1A 4WJG2 1TNGA 3R3GB 2R9PA 2J4IA 3T2NA 2HWLB 3PLBA 1SC8U 1QRZA 1QRXA 1GI3A 3EA9A 3EA8A 1MBQA 4H4FA 1AZZA 1EZQA 2XC5A 4CRAA 3FP7E 1HFDA 1ETRH 4BTUB 1P03A 2H9TH 1XUIA 1ETTH 1N6YA 2BDAA 2H5CA 3UR6A 2H9HA 3A7ZA 3M5NA 3ZZ8A 4ESTE 5AVDA 4FUJA 1T4VH 1YLCA 2VWLA 1MTNB 3P8NA 5DGJA 3V13A 5E0GA 1LO6A 1S0QA 1TNKA 1ZTJA 1DLEA 3TJVA 1ZR0A 2OC8A 1L4DA 4ISLA 3OY5U 4R8TB 5L6NH 1HAVB 4JYVH 1ID5H 1DM4B 1WAYB 1ELTA 5JBCS 3EQ0H 1GI5A 3RXIA 4NZLA 8LPRA 1AVGH 4GSOA 1QB1A 3MOCA 1Q3XA 1TALA 1HXEH 1Y3VA 2IJOB 3RXVA 1KDQB 2GV6A 1E34B 3RC5A 4Q2KA 1O3IA 2GZ8A 3SJ8A 1WQSA 1EASA 2HNTC 2PUXB 3SU3A 1RS0A 1EJAA 3GCHC 1ELEE 4CR5A 3TGIE 2HPQH 2WINI 4DURA 1B0EA 1V2RT 4A6LA 3A80A 2FI3E 3BTFE 2UWLA 1VJAU 3DFJA 3OTJE 1HRTH 1KXFA 1C2MA 3P95A 3HK3B 5A0BA 2FYRA 2Y82A 1G30B 4HGCA 1DOJA 1QA0A 2BHGA 3UWJH 2OLGA 1DITH 4XBBA 1PYTD 3SNDA 2J92A 4KTCA 3BIVH 1FLEE 1O5CB 2A7HA 2W7SA 5A8YA 5DO4H 1ZJDA 2J95A 1ELAA 1B5GH 2WPJS 1J14A 2JETC 1YPLH 1THPB 2P8OB 3U98H 1K1PA 1C5LH 4CH8B 4B1TA 1BMAA 1A46H 2V3OH 4X6NA 1O2SA 2XBVA 5CHAB 4FXGH 3FVFB 1O2QA 1SLUB 2F9VA 5DK1A 2TPIZ 1P10A 1Y59T 2FOBA 2BD4A 3KQDA 1VCPA 1GJ8B 4J1YA 2VH6A 2VVCA 1FPHH 3MNXA 4O97A 1VZQH 2G4UA 2G8TA 3CP7A 2ZGCA 3MU1A 4AGJA 4I8LA 1QB9A 4B76A 1YP9A 1LMWB 1O2WA 3GY6A 4DVAU 5E0JA 4MNVA 2F9OA 3I29A 3SV9A 3P8FA 1EXFA 1GHYH 3E6PH 4MDSA 3RUOA 1GHAG 1MH0A 1ORFA 1UVTH 3RXCA 4F4OC 1XXDA 1OSSA 1QA7A 1FMGA 3SV6A 5E8EH 2W3IA 3KIDU 2ZU3A 2TGDA 1A5IA 2V3HH 4NA9H 2BQWB 1O2RA 3BEIB 3TH4H 1BT7A 1P2OA 1UTLM 1BTHH 1ZGIA 4X1RU 2PFEA 5B6OA 8KME2 4MTBA 2FDAA 3BTQE 3DT0H 1MQ6A 1TNIA 3H7TA 5EPYA 1CQQA 5GWZA 1C1TA 1O37A 1GI4A 1V2QT 2RDLA 1XUGA 1LVYA 2HVXA 1C1QA 2Z3CA 3URCA 3AASA 2RG3A 3ZYDA 3LJJA 5SGAE 1P12E 3RC6A 4MPWA 1T8MA 5LPEA 1DUAA 4UFEH 5A8XA 1QL8A 5T3HA 5FAHA 3MO9A 3OY6U 1O2UA 1BB0B 2ZFTA 4OS5A 3AW1A 1L1GA 5JB8S 2PKAA 1K1JA 1TOMH 3D49H 3NWUA 1OP0A 4H6SB 2YOLA 1Z8JB 2ZI2H 5G4BA 1P11E 1J16A 1HJ8A 4ZH8A 1O3NA 4UEHH 3BG4C 2AFQB 2ULLA 1C2JA 2GP9B 3SJKA 1BHXB 1VITH 4CRFA 1W7XH 2ZGJA 3UPEA 2BLOA 1ZPZA 1RIWB 1UK4A 1O3JA 2BX4A 3VPKA 2CF8H 5C2ZA 1ZPBA 2V35A 3E16B 1WUNH 1QJ6B 4JMYA 4R0IA 2BY8X 4Y11E 1AZ8A 3P92A 1C5NH 3SQEE 2ZA5A 1WBGB 3SORA 1ZMNA 3O8CA 1H4WA 4GCHG 1KLJH 4RKOB 3SU5A 3T29A 1SGFG 1F7ZA 4CRCA 1H1BA 2VNTA 1GCTB 2VVUA 4GPGA 3IITA 2Z9KA 4DY7B 4AZ2B 2BY6X 2CHAC 1LHDH 1HGTH 4ZXYH 1P57B 4QT8C 1ZMJA 2VVVA 1QIXB 1GHAF 2A1DB 3VB4A 2EEKA 1H9LB 3AAUA 4ZKOU 2P94A 2J9NA 2BTCE 3SHCH 2PSYA 4UE7H 4B75A 1O2HA 3MI4A 5EXLA 1P0SH 1FI8A 3MH7A 2ODQA 1V3XA 4FUFA 3EA7A 2GD4B 1SGTA 2ZQ1A 4X6MA 4NWKA 1TGTA 3PV4A 1Z8IB 3F1SB 4TWWA 2BD2A 1AO5A 4TY7A 1ETSH 4FUEA 1D3DB 3SUDA 1W3CA 4A7IB 1LHEH 3HKJB 1P2JA 1O2OA 3BTWE 1MBMA 2BZ6H 1S84A 3MU0A 5T6GA 3Q00A 1O3EA 2O9QA 3RXKA 3RXPA 3N7OA 4MLFB 4X8TH 1O34A 4B2BA 2J34A 1TX6A 3M37A 4ABAA 2FMJA 3NPSA 4GVUA 1QY6A 5L30H 1GGDC 4BTTB 1YPGH 4BANB 2AGEX 3V7TA 3NXPA 1CVWH 1CU1A 1P2KA 1NRSH 2ZU5A 2YNBA 2QIQA 1TMTH 4B2CA 4FUBA 3UOPA 3O8RA 4X2VA 4YZUA 1MKXK 4D7FA 3QDZB 1FAKH 3PWBA 2SGAA 1O2GH 2PWXA 3RU4E 3SU6A 1ZRKA 1SI5H 1TRNA 2ZPRA 3RM2H 4X1NU 4CHAC 3ZZBA 1TPAE 1IQLA 1SFIA 1PPHE 1GL1A 1UTOA 1GJ5H 1KTTB 3PO1B 1HAPH 3A85A 1N6XA 2QAAA 1DWBH 2ZF0H 1MZAA 4Q7YA 2OC0A 1NTPA 2ZTXA 3LJOA 4K1TA 2VWOA 2QF0A 1JMOH 2Z9GA 2RA0A 1MZDA 2PLXA 4A5TS 1KYNA 1FPCH 4FVDA 1SLWB 1O3BA 3PM3A 4I8KA 2ZU4A 3URDA 3UTUH 2AMPA 1ZYOA 2ANYA 2GV7A 3Q3KA 3TH3H 1G37A 2FS9A 1MAYA 2GMTC 2C93B 2XBWA 4ZROA 4WMEA 4FUIA 4WF8A 2ZDNA 3AVZA 1ZLRA 2C4FH 3TNTA 1EOLA 3BTKE 1O5DH 3U8TH 1AU8A 1ELCA 1IQGA 1KXCA 2F91A 4AFQA 1P06A 4WY3A 2Q6GA 1PQAA 4OS6A 1O2MA 4AOQA 2B5TB 4UONA 5C1UA 2A45B 2VIOA 2D8WA 1GPZA 4X0WU 3EGKH 1T8NA 5EQQA 3P8GA 1C1VH 3RXGA 7KMEH 4TPYA 3KGPA 1LHCH 1F5LA 1TRYA 2ZGXH 2WPHS 1ESAA 2BD3A 2J94A 4DJZB 1OKXA 5GPIB 1DFPA 3O8DA 4GUXA 2XRCA 2ZKSA 1GBTA 1TA2A 4ZKSU 1HJAC 2P16A 5EPNA 1BMNH 2P3TB 3W95A 4A1TA 1O2XA 2M5TA 2ZCKP 4NA8A 1Z6EA 2BLQA 1FY4A 1FIZA 3A88A 1C2EA 2QA9E 2ZU1A 4YESB 1CT4E 1GL0E 4I7YH 3LGYA 4AFSA 4D9QA 2AMDA 3QGNB 2C3SA 2B7DH 2GCTC 3E0NB 1MAXA 2GGVB 3OU0A 1MQ5A 2G5NA 2BDCA 5IDKA 1H9HE 1G32B 5C67A 1HUTH 1BITA 5ABWA 1HV7A 2FOHA 4BNRA 1EAIA 2XYAA 4D76A 1SGPE 2Z6BD 1V2NT 2ESTE 2FX6A 1A1RA 2JH5D 1IHSH 2PTCE 5AHGH 1Y5BT 1C1OA 2ZPSA 3BIUH 5I25A 1V2MT 1TGBA 2BD9A 1SLVB 1DDJA 1CT2E 1OWKA 1E0FD 1BDAA 2FP7B 2WV4A 2KAIA 5DP5A 1ELDE 1A5HA 1C5QA 2H1UA 2JH0D 5I46H 1AKSB 5ETXA 4BXSA 1LPKB 1MKXH 3F6UH 1O3PB 1YM0A 2OINA 1SGRE 1UK3A 1QHRB 3UOUA 1CSOE 5HM2A 4AYVB 4WH8A 2QY0B 2F9PA 1BRCE 1GJAB 1TMBH 1ELBA 1Z6JH 1EAXA 2ZHFH 3HPTB 2A5AA 3LGIA 3FANA 2NWNA 4UD9H 5FBIA 2J2UA 2WPKS 9ESTA 2PW8H 1P9UA 5JBTA 1SR5C 2OXSA 1F0UA 3K6YA 4I33A 1O39A 1OXGA 1N8OC 1BTPA 1MU6B 3KN2A 1YC0A 1GMDG 3A7YA 1GJ7B 3TIUA 1EB1H 4WVPE 2BOHB 2BDBA 1O3AA 2AYWA 4Y8XA 1Y5UT 1JBUH 3GY8A 3SU4A 3GCHB 2FTMA 1OPHB 1P02A 1E37B 1HJ9A 2EC9H 1KIGH 1TONA 3ODFA 1AWHB 1C1PA 1DWCH 1L1JA 1P01A 2BDIA 3RXMA 2ZQ2A 4ABEA 2IPHA 1JXPA 3SV2H 5C1YA 3HKIB 1GBJA 3Q76A 1D4PB 1IQMA 3UR9A 6LPRA 1V2PT 4FVBA 2PKSC 2EI6A 2R0KA 1G3BA 1GI8B 1DVAH 2FLRH 5LPRA 1F5KU 1E36B 4MPVA 1O38A 2W5EA 4Y7BA 2JETB 3D62A 3UIRA 5CMXH 4MNYA 5DPAA 1WCZA 2BMGB 1J17T 2WYJA 4Y8YA 2I6SA 5EQSA 1UVSH 2XBXA 1TNLA 5JB9S 4UFGH 5FPTA 1EX3A 1SGIB 1C5SA 4TY6A 1CE5A 5FX6A 3E3TA 1EKBB 1TLDA 1C5PA 4AN7A 1CGHA 3RXOA 3AW0A 1DXPA 1SLXB 1EPTA 1S83A 4IW4E 5FBEA 1SB1H 3LIWA 5F8TA 2R0LA 5ESBA 3HGNA 1GCDA 1W0YH 5LGOA 1C5WB 1OWHA 2FYQA 3KNXA 3KQBA 1GBKA 5FPSA 4YLQH 4XSKU 2BYAX 1JIRA 3GCTG 4CR9A 3IG6B 2P95A 2TIOA 2BY7X 2GT7A 1FAXA 1HAXB 3WY8A 4BAQB 3K65B 1O30A 2PUQH 2ZCLP 1TGSZ 2ANWA 4GHQA 4DT7B 3MNCA 1C4U2 1Z8GA 5C1XA 3SO3A 1O2VA 1Z71A 2BQ7B 2ZHQH 2AEIH 2GZ7A 1BHXF 2HLCA 3ZVAA 1GMDF 1XKBC 2Z9LA 3VFEA 4E06H 1C2KA 4NG9H 5GIBA 3M3SA 1UVOA 1BRBE 1O2IA 2O8MA 2WUCA 1IQKA 3CENA 3SUGA 1Y3WA 3LC3A 1HAHH 4WXVA 2R2MB 3FP6E 3EDXB 2QF3A 2ZHEH 1QRWA 4INKA 1EP6A 3RXHA 4J2YB 3M7QA 8GCHG 1GMHG 1S85A 2FOAA 1O36A 2H9EH 3GYMA 1BMMH 1C1WH 3D65E 2WYGA 1BJUA 1F2SE 1T31A 3ENSB 4FU9A 3STIA 5F6MA 1TPOA 4H6TA 2ZHDA 3BG4B 1DS2E 1RFNA 3NCLA 1KXDA 4FUCA 3LONA 4M7GA 4X8VH 4AB8A 2HOBA 1VJ9U 2O8LA 1FDPA 1UHBA 1O5AB 3MO6A 3RXBA 3SNEA 2FM2A 1O2NA 4GHTA 1L0ZA 2H5DA 1O3FA 3V3MA 1EZSC 2Y5GA 3S69A 2ZGBH 3RXTA 3RC4A 4OS2A 4K8BA 2G51A 2SGQE 1ANDA 2OUAA 4ZXXH 1BBRE 1RJXB 2CHAB 5JBBS 2AIQA 3GCTF 2AGIX 1GVKB 1DANH 2VB0A 1EJMA 3S9AA 2GDDA 1YPHE 1ABJH 1P8VC 1IOEA 5EGMA 2H6MA 1NFWA 1QBVH 4E05H 2VU8E 1AFEH 2XTTB 3MNSA 1AQ7A 3QTOH 1XX9A 3A87A 3MH6A 4NA7A 1SG8B 1WYKA 1S6FA 1BUIA 1PPBH 2WPIS 3JZ2B 4YLUA 5DP7A 3ZVEA 3A82A 3T27A 2FPZA 2JH6D 1F5RA 1ELGA 1JIMA 4ABBA 3BN9A 4D8NA 5K0HA 1GI1A 1NRQH 4Y8ZA 2W7UA 4MPXA 1EPTC 3M61U 2QC2A 4NIVA 4ABFA 1G3EA 1ANCA 2P59A 3UY9A 5DG6A 4ASHA 1A0LA 1LQEA 3SI3H 3RXRA 4OS7A 2ZO3H 2STBE 3B9FH 3BTME 5H4IB 2ASUB 5ESTE 1TX7A 3FZDA 4JZIA 1GMHF 2B0FA 3RMLH 3ZV8A 3M5LA 1Y8TA 2Z3DA 1ZZZA 3ZZ9A 2FODA 1GGDB 1YKTA 3VB7A 2FS8A 2Y7ZA 5JYIA 5C5NA 3E8LA 3UREA 5DP8A 5K7RA 1OS8A 4Y7AA 3KL6A 2ZDKA 5F8XA 2ZFFH 6CHAC 1UCYK 1FQ3A 2OBQA 2FOMB 2THFB 2K1QA 1C1MA 4Z6AH 2G55A 9LPRA 1YCPK 4X1SU 2VIVA 1FONA 4DCDA 1E38B 1UCYE 1IAUA 1NRNH 3RXUA 3T26A 4BAMB 3PMBB 3MTYA 2D2DA 1A61H 2ANKH 1TBRH 4WMDA 1MTNC 1DY9A 4CHAB 1VGCC 3GOVB 4PROA 1YGCH 3F68H 1LVMA 1TMUH 2PKAB 4Z0KA 2ZG0H 1C2GA 3SBKA 1LTOA 1LCYA 3K2UA 4AG1A 1E35B 1HIAA 3MH5A 1YPJH 2QXGA 1FY1A 3OYPA 4I32A 1A4WH 4XBDA 1TBQH 5AFYH 4HFPB 1OWEA 3TK9A 4INHA 4VGCC 1V2OT 1O3HA 3OSYA 4NGAH 1MTWA 1BJVA 1GHVH 1AUTC 3TH2H 1W14U 1TPPA 3UNRA 2QYIA 2BLVA 3U1IB 2A4GA 1GG6B 4I8JA 1CT0E 1CBWC 2ALVA 2Y81A 1L2EA 1GBBA 2BD7A 5AFZH 1S0RA 3F9HA 3ODDA 1G3DA 2GMTB 1P2QA 1O2ZA 3LGTA 3SN8A 1HNEE 1ANBA 3VB6A 4I31A 1OWIA 1VCWA 2LPRA 1GJ9B 3DHKH 1O5EH 1D3PB 3S9CA 3RXSA 3GCNA 2P93A 1V2WT 3E0PB 3SGAE 1G36A 3DFLA 1O3KA 1SQTA 2Z9JA 3ESTA 3GY4A 4A1VA 2GKVE 3MU5A 4MVNA 4X2YA 1K1NA 2F3CE 2PHBA 4XE4A 3GICB 4WH6A 3GYLB 1LDTT 4LXBH 4Y0YE 3ATMA 1PPZA 1MD8A 3SGBE 3BTGE 2AGGX 2DUCA 3FZZA 1BMLA 4O3UA 1YF4A 2B9LA 1NC6A 2BM2A 3K9XB 2GDEH 1BQYA 5HGGA 1HJAB 3TVJB 4OGYA 5IYTA 1OWDA 2SNWA 1GI0A 4K69A 1HLTH 1NN6A 1QR3E 6ESTA 3GY5A 4ISNA 2V6NA 1XUFA 1C2IA 1MU8B 1TOCB 3GDUA 5PTPA 1ZGVA 2GCTB 5HM9A 1KLIH 3B23B 3U9AH 1F0SA 2AS9A 3BEUA 4H42U 1D6RA 4YT6H 4Y10E 2W26A 7ESTE 2VIWA 3LT3A 4NFEA 1EB2A 1HXFH 1Z1JA 2ZPQA 3F9EA 2A4OA 4RN6A 2XWAA 4K8YA 1O3DA 3D23A 1QJ1B 2JKHA 4GCHF 1GBAA 1GWAA 1S82A 2FZZA 1C9PA 4CRDA 3A84A 1HAIH 5DJ7A 4KELA 4IMQA 5EG4A 2OCVB 1UCYH 5FCKA 2OC1A 2XC0A 3M5OA 1AHTH 3M7UA 1W7GH 1UTPA 3RXDA 3ZZ5A 1J15A 1SQOA 1K1IA 2BY9X 1CGIE 1UTMA 3TK6A 1YCPH 1W8BH 2ZU2A 4B73A 3LGWA 3ZZ7A 1PQ8A 1O31A 2C8YB 6GCHG 1HYLA 2XWBI 3U8OH 1NESE 2ZC9H 3A81A 5GCHG 2PSXA 1MKWK 4RSPA 4WMFA 3RXAA 3A8BA 2GVFA 3H7OA 3SV7A 4ABIA 3MWIU 3PMJA 3RXLA 4JK6A 2QCYA 5J4QA 3PWCA 4BAOB 1B0FA 1BTWA 3KF2A 4K3JA 3MMGA 1N8OB 1GI7B 1KXBA 1Z7KA 4SGBE 1OP2A 2FOFA 3MO3A 4TPIZ 3TGKE 3RLWH 4Y79A 3BTDE 1TWXB 2FO9A 3P6ZB 3SJIA 2F9NA 3LKWA 5A2MH 2CV3A 1GCTC 1QFKH 4CBOA 1G9IE 1DY8A 2O8WA 4IN1A 1V2UT 4UFFH 2ZTZA 4A1XA 4JK5A 1WTGH 1W12U 1L4ZA 1N1LA 4K2YA 3ZZDA 1RD3B 1B7XB 5F8ZA 2A4RA 4F49A 2W3KA 3KEEA 4INLA 5DP6A 3VB5A 1BRAA 8ESTE 1UMAH 1H9IE 5EQRA 1O3GA 1GJCB 4ZHMU 1Z1IA 1YPKH 3SW2B 4AORA 3Q77A 3IWMA 4X6OA 2ZNKH 1KXEA 1AN1E 1HAYB 2FESH 1MTSA 4ISIH 2G5VA 4BAHB 1GHBG 1ZSJA 3GY3A 2DE8A 1QQ4A 1SHHB 1ESTA 3FFGA 1G2MA 3HGPA 1ZHMA 3UQVA 1EATA 1TPSA 2ZDVH 3S7HB 2TRMA 2VWNA 3ZYEA 3W94A 1QNJA 5EODA 1LPGB 3KCGH 1AFQC 5J4SA 6GCHF 2FOCA 1SPJA 1YCPM 1RRKA 2QXIA 1TNJA 1OWJA 4YT7H 5GCHF 5JPMH 2BB4A 2VJ1A 2VGCC 4U30A 1O3LA 4YTAA 3P17H 4TYDA 4AX9H 2NU2E 3UUZA 1XXFA 2QN5T 1JWTA 2ZIQH 1PQ7A 1ZTLA 1C5VA 4X2WA 1SBWA 3RDZA 2KAIB 5E0HA 3TJUA 4UFDH 5HYOA 2RCEA 3TU7H 1JOUB 1V2ST 2ZTYA 1MUEB 1GDQA 4ABHA 4CRGA 4ZKNU 3CS0A 1V2KT 3I78A 1PQ5A 3RXFA 2A32A 4B71A 3TPIZ 4BAKB 1NU9A 1TYNA 3UQOA 1O5BB 1GJDB 1C4Y2 4Y6DA 3TITA 1AWFH 1AE8H 1LKAA 2P3UB 2BQ6B 2VIQA 1BTZA 4IGDA 1MKWH 1SGFA 2SGFE 1FY3A 1INCA 4B2AA 2FEQH 4IN2A 1XVOA 3PYHA 3ZVFA 3VGCC 1GHBF 3ZZ4A 1DWDH 2A0QB 4JZFH 2GT8A 1EUFA 1UK2A 1C2FA 3BTEE 3L33A 2D26C 2FIRH 1DWEH 1NFXA 1ACBE 1WTHD 2YNAA 1SGDE 4IBLH 3QZRA 4TWYA 3DD2H 5EOKA 4BXWA 1NZQH 1XUJA 5DKMA 4AYYB 1K28D 4CRBA 1F92A 1OOKB 1SQAA 1PFXC 1XUKA 3RXQA 4CH2B 1ANEA 1P2NA 1NRPH 4FU7A 1AUJA 2VINA 3QO6A 1F0RA 5TCCA 3UFAA 4Y76A 1SVPA 4X2XA 4ABDA 2G4TA 2HNTE 4CREA 1PPGE 4KP0A 1BZXE 2SNVA 3TJNA 3O8BA 2ZCHP 1KTSB 1W11U 1BTUA 1P05A 1H8DH 1RTKA 2Y5FA 3UNSA 1EPTB 4A92A 3QK1A 1NS3A 1S5SA 4ABJA 4NZQA 3U1JB 1GMCG 2C8WB 3U69H 1CA0C
chains in the Genus database with same CATH superfamily
1S6LA 1RTLA 4GLYA 2BXTH 1WXRA 7GCHG 5HXFA 1ZOMA 1HBTH 1RTFB 2UUKB 4Y71A 1QL7A 1HAOH 3LPRA 2YMSD 2BLWA 1C1RA 3KQCA 3A89A 3M36A 5F53A 1CHOG 1FY5A 3E91A 2WHXA 4NIXA 2LP6A 2Q1JA 2G81E 2BX3A 4WWYA 3PMHB 4DIHH 2Z94A 1SGYE 1AB9C 6CHAB 4SGAE 4O3TA 2ZHWH 5FX5A 5CHBA 1DSTA 3T28A 2ZFQH 3ZZCA 3KQ5A 3S7KB 2ZFPH 3F2HA 3ITIA 2CXVA 2VH0A 2QXJA 1KLTA 1TQ0B 2H2ZA 1K1LA 3S0NA 1SOTA 2NU0E 3SV8A 1A0JA 1K1OA 5E2PA 1HAVA 4NFFA 1GDUA 3SNBA 1EJNA 2FWWA 1VGCB 2Z9IA 1O2YA 1FY8E 1QB6A 2NU3E 4Q80A 5DP9A 1LKBA 1KDQA 1PPEE 4ISHH 3NUMA 3UNQA 5C20A 1K1MA 2HRVA 2CN0H 3GISB 4IC6A 2BVRH 1V2JT 1GHXH 4Q7XA 1FV9A 2Y5HA 3DCLA 2ZEBA 3U28C 3BF6H 1TAWA 3QZQA 4THNH 1D9IA 4VGCB 1BBRK 3LH1A 3ZZAA 2ALPA 3PTNA 1C5ZB 2CGAA 5EW1H 1O5GH 4DOQA 2RA3A 1AI8H 1SSXA 4TT3D 4CBNA 3QN7A 2FLBH 1CBWB 1UHBB 3A7WA 4LK4A 3PROA 4NIYA 4RKJB 2ILNA 3A8CA 1ZHRA 3F3BA 3SNCA 1U6QA 2OQUA 1GJ6A 4AFZA 3BV9B 1GMCF 1CO7E 4JZEH 4Y0ZE 1V2LT 3HATH 4ZUHA 7GCHF 1ZTKA 2VIDA 3A8DA 1C5UA 2C8ZB 1K21H 5T1VA 4D9RA 1GHZA 1IQIA 2FOGA 3M3VA 4UDWH 1CHOF 1LHGH 4F55A 2BVXH 4NWLA 2I6QA 2ZDLA 1MMJN 3PLKA 1GHWH 2AH4X 2QXHA 1TIOA 1O2KA 5L2YH 7LPRA 2G00A 2Y80A 5EXMA 1ELFA 1P9SA 2BXUH 2XXLA 1UTJA 1O0DH 3LH3A 1ZHPA 1DX5M 4DGJA 8GCHF 1T7CA 1QL9A 1BCUH 1S6HA 3F9GA 1D3QB 1CGJE 1NO9H 4Z1MD 5GXPA 4LZ1H 3TK5A 4MNWA 1OYTH 4AGKA 1V6DA 4AFUA 1SGCA 1FIWA 4JYTA 2AHME 1MCVA 3Q3YA 2STAE 2AERH 2XW9A 3RM0H 4NSVA 5C94A 1NFUA 1SOZA 1XVMA 5T6DA 1XMNB 1TX8A 2HVYB 3QLPH 1C5XB 2ZFRH 3T5FH 1GVZA 4JZ1A 4FETA 1C1SA 4I8HA 4E7NA 1FNIA 1LHFH 4ZHLU 1V2VT 4ZKRU 1AE5A 1O2PA 1IQJA 1PPCE 2QGRA 5CDFE 1DICA 1FUJA 1W0KD 2FOEA 2BZAA 2CMYA 3A8AA 4JYUH 3VXEH 1UTQA 2FTLE 1BTYA 4OS4A 2OC7A 1D3TB 1GBHA 1EQ9A 4YOJA 4XOJA 2D1JA 1GBMA 1DLKB 1O35A 1UVPA 5T6FA 3PLPA 1P2MA 1YPHC 3SU1A 2UUYA 3GY2A 3TJOA 3OX7U 1HDTH 1O32A 3C1KA 3UB0A 2BDHA 2Z7FE 3L3TA 4DG4A 1GBDA 1EAUA 4OS1A 4IS5A 2OQ5A 1SFQB 4RT0A 1AIXH 2A2QH 1PJPA 2OK5A 5E2OA 1HIAB 1PYTC 1YYY1 3PTBA 3UWIA 2KCOA 2ZGHA 3LU9B 3STJA 3SOSA 1TNHA 1GVLA 1YPMH 1W0JD 5A0AE 1S81A 1GDNA 2WV5A 1QURH 2KFWA 1UTKA 2PTNA 1X7AC 3CS7A 3P70B 1AVXA 1BBRH 2XC4A 1G3CA 3SZNA 4HI3A 3SNAA 1O5FH 2PR3A 1T32A 1J8AA 2V0BA 3GDSA 5FHTA 3RU4T 4NCYA 5BRRE 2P8OC 4O9VA 1W2KH 3SU0A 2UWOA 4AB9A 1GI2A 2FXRA 2PGBB 1ESBA 3E90B 1W13U 1Y3YA 3T25A 3MYWA 2BOKA 1O3OA 1C5RA 5CHAC 4K5ZA 1NY22 1YPEH 1ARBA 2P3FH 1C5TA 4WXIA 4HZHA 5DP3A 2ZDAH 3BSQA 1FN8A 1MCTA 1TB6H 2CF9H 1EZXC 1GBLA 2GX4A 1L1NA 1WSSH 2UUJB 4ZMAH 1P09A 2RDEA 4MG3A 3OEHD 2XNIA 1P3EA 3ZVGA 2EA3A 1UVUH 3ZVDA 4X8SH 1AGJA 4DIIH 1SQRA 3M3TA 2GCHG 2ZP0H 3SI4H 1LVBA 1KY9A 3A86A 1QTFA 1SMFE 3EE0B 1AD8H 1AMHA 1EAWA 2UWPA 1W0ZU 1ARCA 1FZZA 1ZSKA 2AIPA 2AMQA 1LPZB 3H5CB 3QGJA 3RU4D 4JCNA 2WPDD 5FPYA 1NPMA 1GBFA 3V0XA 2UUFB 3I77A 1H8HD 1T8OA 1AVWA 1AFQB 1C9TA 2BD8A 3AAVA 2ANMH 3N7DA 4XFQA 1Y5AT 4ACBA 1V2TT 1HPGA 3BG8A 4ZHAA 4FUHA 1VITG 1A0HB 1ZPCA 1C2HA 3M35A 2HNTF 2VGCB 1RGQA 1ELVA 1FJSA 3SUEA 4HG6A 1Q31A 1YWUA 5A09A 2OBOA 4B74A 4JZDH 4OGXA 1QJ7B 1FXYA 1NM6A 1IHTH 4U2WA 2V7QD 1OYQA 2ODPA 1OP8A 2Z3EA 4IMZA 3MQKC 3GY7A 1GI9B 1C1NA 3SHAH 1NRRH 4U01A 5A8ZA 2ZDMA 3F9FA 3KHVA 3S9BA 1K0HA 5FL7D 1BIOA 2VWMA 1ZSLA 4AG2A 5TJXA 1A3BH 1KSNA 2R3YA 3LGVA 5KGOA 1SGNE 1GJ4H 1RIWC 1DUEA 2Y6TA 2TGTA 5HIYA 5CE1A 3PB1E 1C5YB 5AF9H 1LVOA 2F9BH 3T62A 1ABIH 1IQNA 1O3CA 4NIWA 3VXFH 1O2JA 3A7XA 3SU2A 5JBAS 1MTUA 3A7VA 1GG6C 2HPPH 1VR1H 1MTVA 3E1XB 4TSFD 5C5OA 2ZZUH 1AY6H 1DPOA 1TA6A 1SGEE 1T8LA 1D6WA 1O2TA 2GCHF 2A5KA 1THSH 3VGCB 1GBEA 2WPLS 1P3CA 5BPEA 2PKSB 1DXWA 3QWCH 1WOFA 1EZUC 3ZZ3A 1DSUA 2HALA 4NSYA 1THRH 1BA8B 2W6JD 1XM1A 3M5MA 2IN2A 4LZ4B 3P8OA 4Q7ZA 3HK6B 4X6PA 4ZCNA 2TGPZ 1NU7B 5DP4A 1O2LA 5F03A 4KGAA 4ABGA 2NU1E 1WQVH 4YOGA 5LPFA 2ZWLH 3V12A 2R3UA 3BEFB 2FI5E 1JRSA 5A0CA 1NROH 1VITF 4D7GA 3DA9B 2SGDE 3ELAH 1BOQA 2SGEE 2KX4A 2SFAA 3A7TA 3RMOH 1Y3XA 1HAGE 2EI7A 3VEQB 3PMAB 4DW2U 2O8TA 1WU1A 3TNSA 1GJBB 2A7JA 1KXAA 1JRTA 4MPUA 3B8JA 3N7EA 2PGQB 1O3MA 1SHYA 3A83A 1QGFA 2XCFA 4K60A 3MHWU 5JDUB 3PV5A 4YOIA 2BDGA 1K2I1 3TGJE 1UTNA 3LOXA 2Q6FA 1DE7H 2A7CA 1CA0B 2EQNA 2Y7XA 1WV7H 4FUDA 4KKDA 1HB0B 1ZJKA 1IQFA 4XD7D 2EI8A 1C2LA 1K22H 1TFXA 3NKKA 3DUXH 3JZ1B 3RP2A 1A7SA 5EW2H 1QQUA 3U8RH 2WUBA 1C1UH 1BTXA 3SGQE 3ATWA 2ODYB 3DSGA 2A31A 4F48B 5L2ZH 4ZAEA 3NK8A 1AKSA 5FCRA 2KCPA 1IQHA 3VB3A 4X1PU 1AB9B 4LOYH 3RMNH 4MQAA 3ATLA 3G01A 3ATKA 1M9UA 1ZMLA 1XUHA 2LNCA 1C5OH 5HMAA 1EP5A 2G52A 2OTVA 2A5IA 4IC5A 3PO1C 2GZ9A 5LH8A 4M9FA 1W10U 1YLDA 4MNXA 2XCNA 3QX5H 2F83A 4ISOA 4GAWA 1LQDB 1GI6A 1H8IH 2EY4C 1TGCA 2NU4E 3RXEA 4BTIB 2TBSA 4XBCA 1G2LA 3RMMH 2GTBA 3NZIA 2WSSD 1P04A 1SGQE 3EAJA 3BTHE 1NFYA 4FU8A 1SL3A 2WPMS 1TABE 2HGTH 4DT4A 1GBCA 1PPFE 2VIPA 1C5MD 1HCGA 1CHGA 2F9UA 4X1QU 1DT2A 4O03A 2OP9A 2BD5A 2J38A 2ZECA 1A3EH 1UO6A 3ZVBA 2J98B 1BRUP 2FI4E 1C4V2 3SJ9A 2QV1A 1OX1A 1QCPA 4I8GA 3GDVA 1F0TA 1QZ8A 3RXJA 2C8XB 1TBZH 1TGNA 1CA8B 3L6PA 2PV9B 2BVSH 3MNBA 4XDEA 4U32A 3OFND 4YO9A 1GBIA 4BOHA 4KTUA 3ZVCA 4K1EA 2O8UA 1TE0A 2XBYA 2CJIA 3MU8A 4K1SA 2BDYA 5KEDA 1ZRBA 3RLYH 3QUMP 5GDSH 2OD3B 2Q6DA 1BMFD 2R2WU 3MFJA 5HIZA 2ZFSA 4E7RG 1Q2WA 3LGUA 5FXLA 5EU8A 1QBNA 1VCQA 1Y3UA 3SYJA 5C3NA 1FN6A 5GJ4B 3SJOA 3MU4A 3MH4A 2BY5X 4HTCH 1HAZB 1RXPA 3QTVH 3EYDA 4FUGA 4RI0A 3K6ZA 1QBOA 1TQ7B 5EXNA 3FAOA 2B8OH 3FP8E 2SGPE 4X8UH 3SQHE 1J9CH 3BTTE 1A5GH 3ATIA 2FX4A 1MD7A 3LC5A 3Q3XA 2TGAA 3C27B 1TRMA 3ZZ6A 1Z8RA 1C2DA 4YM9A 1IQEA 1XKAC 2IOTA 3GCOA 2DE9A 2C90B 5C0UA 1T4UH 3LDXH 1NT1A 3R0FA 4KTSA 1EOJA 3CNRA 5TCAA 3KQEA 3ZV9A 2A2XH 2A4QA 1P2IA 1A2CH 3M7TA 1O33A 1YBWA 3TLOA 1K9OE 3SUFA 1UJ1A 4WJG2 1TNGA 3R3GB 2R9PA 2J4IA 3T2NA 2HWLB 3PLBA 1SC8U 1QRZA 1QRXA 1GI3A 3EA9A 3EA8A 1MBQA 4H4FA 1AZZA 1EZQA 2XC5A 4CRAA 3FP7E 1HFDA 1ETRH 4BTUB 1P03A 2H9TH 1XUIA 1ETTH 1N6YA 2BDAA 2H5CA 3UR6A 2H9HA 3A7ZA 3M5NA 3ZZ8A 4ESTE 5AVDA 4FUJA 1T4VH 1YLCA 2VWLA 1MTNB 1YLNA 3P8NA 5DGJA 3V13A 5E0GA 1LO6A 1S0QA 1TNKA 1ZTJA 1DLEA 3TJVA 1ZR0A 1L4DA 2OC8A 4ISLA 3OY5U 4R8TB 5L6NH 1HAVB 4JYVH 1ID5H 1DM4B 1WAYB 1ELTA 5JBCS 3EQ0H 1GI5A 3RXIA 4NZLA 8LPRA 1AVGH 4GSOA 1QB1A 3MOCA 1Q3XA 1TALA 1HXEH 1Y3VA 2IJOB 3RXVA 1KDQB 2GV6A 1E34B 3OTPA 3RC5A 4Q2KA 1O3IA 2GZ8A 3SJ8A 2JJ2D 1WQSA 1EASA 2HNTC 2PUXB 3SU3A 1RS0A 1EJAA 3GCHC 1ELEE 4CR5A 5KECA 2HPQH 2WINI 4DURA 3TGIE 1B0EA 1V2RT 4A6LA 3A80A 4ACAA 2FI3E 3BTFE 2UWLA 1VJAU 3DFJA 3OTJE 1HRTH 1KXFA 1C2MA 3P95A 3HK3B 5A0BA 2FYRA 2Y82A 1G30B 4HGCA 1DOJA 1QA0A 2BHGA 3UWJH 2OLGA 1DITH 4XBBA 1PYTD 3SNDA 2J92A 4KTCA 3BIVH 1FLEE 1O5CB 2A7HA 2W7SA 5A8YA 5DO4H 1ZJDA 2J95A 1ELAA 1B5GH 2WPJS 1J14A 2JETC 1YPLH 1THPB 2P8OB 3U98H 1K1PA 1C5LH 4CH8B 4B1TA 1BMAA 1A46H 2V3OH 3FOAA 4X6NA 1O2SA 2XBVA 5CHAB 4FXGH 3FVFB 1O2QA 1SLUB 2F9VA 5DK1A 2TPIZ 1P10A 1Y59T 2FOBA 2BD4A 3KQDA 1VCPA 1GJ8B 2KCYA 4J1YA 2VH6A 2VVCA 1FPHH 3MNXA 4O97A 1VZQH 2G4UA 2G8TA 3CP7A 2ZGCA 3MU1A 4AGJA 2KZ4A 4I8LA 1QB9A 4B76A 1YP9A 1LMWB 1O2WA 3GY6A 3PV2A 4DVAU 3PRDA 5E0JA 4MNVA 2F9OA 3I29A 3SV9A 3P8FA 1EXFA 1GHYH 3E6PH 4MDSA 3RUOA 1GHAG 1MH0A 1ORFA 1UVTH 3RXCA 4F4OC 1XXDA 1OSSA 1NBMD 1QA7A 1FMGA 3SV6A 5E8EH 2W3IA 3KIDU 2ZU3A 2TGDA 1A5IA 2V3HH 4NA9H 2BQWB 1O2RA 3BEIB 3H09A 3TH4H 1BT7A 1P2OA 1UTLM 1BTHH 1ZGIA 4X1RU 2PFEA 5B6OA 8KME2 4MTBA 2FDAA 3BTQE 2IPQX 3DT0H 1MQ6A 1TNIA 3H7TA 5EPYA 1CQQA 5GWZA 1C1TA 1O37A 1GI4A 1V2QT 2RDLA 1XUGA 1LVYA 2HVXA 1C1QA 2Z3CA 3EE7A 3URCA 3AASA 2RG3A 3ZYDA 3LJJA 5SGAE 1P12E 3RC6A 4MPWA 1T8MA 5LPEA 1DUAA 4UFEH 5A8XA 1QL8A 5T3HA 5FAHA 3MO9A 3OY6U 1O2UA 1BB0B 2ZFTA 3DSOA 4OS5A 3AW1A 1L1GA 5JB8S 2PKAA 1K1JA 1TOMH 3D49H 2J97A 3NWUA 1OP0A 4H6SB 2YOLA 1Z8JB 2ZI2H 5G4BA 1P11E 1J16A 1HJ8A 3F2GA 4ZH8A 1O3NA 4UEHH 3BG4C 2AFQB 3KYGA 2ULLA 1C2JA 2GP9B 3SJKA 1BHXB 1VITH 4CRFA 1W7XH 2ZGJA 3UPEA 2BLOA 1ZPZA 2L6OA 1RIWB 1UK4A 1O3JA 2BX4A 3VPKA 2CF8H 5C2ZA 1ZPBA 1WDIA 2V35A 3E16B 1WUNH 1QJ6B 4JMYA 4R0IA 2BY8X 4Y11E 1AZ8A 3P92A 1C5NH 3SQEE 2ZA5A 1WBGB 3SORA 1ZMNA 3O8CA 1H4WA 4GCHG 1KLJH 4RKOB 3SU5A 3T29A 1SGFG 1F7ZA 4CRCA 1H1BA 2VNTA 1GCTB 2VVUA 4GPGA 3IITA 2Z9KA 4DY7B 4AZ2B 2BY6X 2CHAC 1LHDH 1HGTH 4ZXYH 1P57B 4QT8C 1ZMJA 2VVVA 1QIXB 1GHAF 2A1DB 3VB4A 2EEKA 1H9LB 3AAUA 4ZKOU 2P94A 2J9NA 2BTCE 3SHCH 2PSYA 4UE7H 4B75A 1O2HA 3MI4A 5EXLA 4P02A 1P0SH 1FI8A 4FOUC 3MH7A 2ODQA 1V3XA 4FUFA 3EA7A 2GD4B 1SGTA 2ZQ1A 4X6MA 4NWKA 1TGTA 3PV4A 1Z8IB 3F1SB 4TWWA 2BD2A 1AO5A 4TY7A 1ETSH 4FUEA 1D3DB 3SUDA 1W3CA 4A7IB 1LHEH 3HKJB 1P2JA 1O2OA 3BTWE 1MBMA 2BZ6H 1S84A 3MU0A 5T6GA 3Q00A 1O3EA 2O9QA 3RXKA 3RXPA 3N7OA 4MLFB 4X8TH 1O34A 4B2BA 2J34A 1TX6A 3M37A 4ABAA 2FMJA 3NPSA 3UAIC 4GVUA 1QY6A 5L30H 1GGDC 4BTTB 1YPGH 4BANB 2AGEX 3V7TA 3NXPA 1CVWH 1CU1A 1P2KA 1NRSH 2ZU5A 3DSPA 2YNBA 2QIQA 1TMTH 4B2CA 4FUBA 3KYFA 3FKSD 3UOPA 3O8RA 4X2VA 2KM0A 4YZUA 1MKXK 5DN6D 4D7FA 1FX0B 3QDZB 1FAKH 3PWBA 2SGAA 2WV9A 1O2GH 2PWXA 3RU4E 3SU6A 1ZRKA 1SI5H 1TRNA 2ZPRA 3RM2H 4X1NU 4CHAC 3ZZBA 1TPAE 1IQLA 1SFIA 1PPHE 1GL1A 1UTOA 1GJ5H 4B6FA 1KTTB 3PO1B 1HAPH 3A85A 1N6XA 2QAAA 1DWBH 2ZF0H 1MZAA 4Q7YA 2OC0A 1NTPA 2ZTXA 3LJOA 4K1TA 2VWOA 2QF0A 1JMOH 2Z9GA 2RA0A 1MZDA 2PLXA 4A5TS 1KYNA 1FPCH 1VKYA 4FVDA 1SLWB 1O3BA 3PM3A 4I8KA 2ZU4A 3URDA 2L74A 3UTUH 2AMPA 1ZYOA 2ANYA 2GV7A 3Q3KA 3TH3H 1G37A 2FS9A 1MAYA 2GMTC 2C93B 2XBWA 4ZROA 4WMEA 4FUIA 4WF8A 2ZDNA 3AVZA 1ZLRA 2C4FH 3TNTA 1EOLA 3BTKE 1O5DH 3U8TH 1AU8A 1ELCA 1IQGA 1KXCA 2F91A 4AFQA 1P06A 4WY3A 3NRLA 2Q6GA 1PQAA 4OS6A 1O2MA 4AOQA 2B5TB 4UONA 5C1UA 2A45B 2VIOA 2D8WA 1GPZA 4X0WU 3EGKH 1T8NA 5EQQA 3P8GA 1C1VH 3RXGA 7KMEH 4TPYA 4RT1A 3KGPA 1LHCH 1F5LA 1TRYA 2ZGXH 2WPHS 1ESAA 2BD3A 2J94A 4DJZB 1OKXA 5GPIB 1DFPA 3O8DA 4GUXA 2XRCA 2ZKSA 1GBTA 1TA2A 2F4LA 4ZKSU 1HJAC 2P16A 5EPNA 1BMNH 2P3TB 3W95A 4A1TA 1O2XA 1COWD 2M5TA 2ZCKP 4NA8A 1Z6EA 2BLQA 1FY4A 1FIZA 2QF4A 3A88A 1C2EA 2QA9E 2XNDD 2ZU1A 4YESB 1CT4E 1GL0E 4I7YH 3LGYA 4AFSA 4D9QA 2AMDA 3QGNB 2C3SA 2B7DH 2GCTC 3E0NB 1MAXA 2GGVB 3OU0A 1MQ5A 2G5NA 2BDCA 5IDKA 1H9HE 1G32B 5C67A 1HUTH 1BITA 5ABWA 1HV7A 2FOHA 4BNRA 1EAIA 2XYAA 4D76A 1SGPE 2Z6BD 1V2NT 2ESTE 2FX6A 1A1RA 3SZEA 2JH5D 1IHSH 2PTCE 2JIZD 5AHGH 1Y5BT 1C1OA 3PRBA 2ZPSA 3BIUH 5I25A 3F0OA 1V2MT 1TGBA 2BD9A 1SLVB 5DSFA 3OE7D 1DDJA 1CT2E 1OWKA 1E0FD 1BDAA 2FP7B 2WV4A 2KAIA 5DP5A 1ELDE 1A5HA 1C5QA 2H1UA 2JH0D 5I46H 1AKSB 5ETXA 4BXSA 1LPKB 1MKXH 3F6UH 1O3PB 1YM0A 4I86A 2OINA 1SGRE 1UK3A 1QHRB 3UOUA 1CSOE 5HM2A 4AYVB 4WH8A 2QY0B 2F9PA 1BRCE 1GJAB 1TMBH 1ELBA 1Z6JH 1EAXA 2ZHFH 3HPTB 2A5AA 3LGIA 2CK3D 3FANA 2NWNA 4UD9H 5FBIA 2J2UA 2WPKS 3FN8A 9ESTA 2PW8H 1P9UA 5JBTA 1SR5C 2OXSA 3FO8D 1F0UA 3K6YA 4I33A 1O39A 1OXGA 1N8OC 1BTPA 1MU6B 3KN2A 1YC0A 1GMDG 3A7YA 1GJ7B 3TIUA 1EB1H 4WVPE 2BOHB 1E79D 2BDBA 3ZIAD 1O3AA 2AYWA 2JDID 4OM9A 4Y8XA 1Y5UT 5EJ1A 1JBUH 3GY8A 3SU4A 3GCHB 2FTMA 1OPHB 1P02A 1E37B 1HJ9A 2EC9H 1KIGH 1TONA 3ODFA 1E1QD 1AWHB 1C1PA 1DWCH 1L1JA 1P01A 2BDIA 3RXMA 2ZQ2A 4ABEA 2IPHA 1JXPA 3SV2H 5C1YA 3HKIB 1GBJA 3Q76A 1D4PB 1IQMA 3UR9A 5EJLA 6LPRA 1V2PT 4FVBA 2PKSC 2EI6A 2R0KA 1G3BA 1GI8B 1DVAH 2FLRH 5LPRA 1F5KU 1E36B 4MPVA 1O38A 2W5EA 4Y7BA 2JETB 3D62A 3UIRA 5CMXH 4MNYA 5DPAA 1WCZA 2BMGB 1J17T 2WYJA 5EIYA 4Y8YA 2I6SA 5EQSA 1UVSH 2XBXA 1TNLA 2K0QA 5JB9S 4UFGH 3WWFA 5FPTA 1EX3A 1SGIB 1C5SA 4TY6A 1CE5A 5FX6A 3E3TA 1EKBB 1TLDA 1C5PA 4AN7A 1CGHA 3RXOA 3AW0A 1DXPA 1SLXB 1EPTA 1S83A 4IW4E 5FBEA 1SB1H 3LIWA 5F8TA 2R0LA 5ESBA 3HGNA 1GCDA 1E1RD 1W0YH 5LGOA 1C5WB 1OWHA 2FYQA 3KNXA 3KQBA 1GBKA 5FPSA 4YLQH 4XSKU 2BYAX 1JIRA 3GCTG 4CR9A 3IG6B 4Q4LA 2P95A 2TIOA 2BY7X 2GT7A 1FAXA 1HAXB 3WY8A 4BAQB 1YY3A 3K65B 5C0TA 5C17A 1O30A 2PUQH 2ZCLP 2ANWA 1TGSZ 4GHQA 4DT7B 3MNCA 1C4U2 1Z8GA 2WZQA 5C1XA 3SO3A 1O2VA 1Z71A 2BQ7B 2ZHQH 2AEIH 2GZ7A 1BHXF 2HLCA 3ZVAA 1GMDF 1XKBC 2Z9LA 3VFEA 4E06H 1C2KA 4NG9H 3OAAD 5GIBA 3M3SA 1UVOA 1BRBE 1O2IA 2O8MA 2WUCA 1IQKA 3CENA 3SUGA 1Y3WA 3LC3A 1HAHH 4WXVA 2R2MB 3FP6E 3F0PA 3EDXB 2QF3A 2ZHEH 1QRWA 4INKA 1EP6A 3RXHA 4J2YB 3M7QA 3W1EA 5IK2D 8GCHG 1GMHG 1S85A 2FOAA 1O36A 2H9EH 2XOKD 3GYMA 1BMMH 1C1WH 3D65E 2WYGA 1BJUA 1F2SE 1T31A 3ENSB 4FU9A 3STIA 5F6MA 1TPOA 4H6TA 2ZHDA 3BG4B 1DS2E 1RFNA 3NCLA 1KXDA 4FUCA 3LONA 2LELA 4M7GA 4X8VH 4B6EA 4AB8A 2HOBA 1VJ9U 2O8LA 1FDPA 1UHBA 1O5AB 3MO6A 3RXBA 3SNEA 2FM2A 1O2NA 4GHTA 1L0ZA 2H5DA 1O3FA 3V3MA 3AK5A 1EZSC 2Y5GA 3OEED 3S69A 2ZGBH 3RXTA 1EFRD 3RC4A 4OS2A 4K8BA 2G51A 2V3MA 2SGQE 1ANDA 2PP6A 2OUAA 4ZXXH 1BBRE 1RJXB 2CHAB 5JBBS 2AIQA 3GCTF 2AGIX 1GVKB 4P00A 1DANH 3VG8A 2VB0A 2JJ1D 1EJMA 3S9AA 2GDDA 1YPHE 1ABJH 1P8VC 1IOEA 5EGMA 2H6MA 1NFWA 1QBVH 4E05H 2VU8E 1AFEH 2XTTB 3MNSA 1AQ7A 3QTOH 1XX9A 3A87A 3MH6A 4NA7A 1SG8B 1WYKA 4Q63A 1S6FA 1BUIA 1KMHB 1PPBH 2WPIS 3JZ2B 4YLUA 5DP7A 3ZVEA 1OHHD 3A82A 3T27A 2FPZA 2JH6D 1F5RA 1ELGA 1JIMA 4ABBA 3BN9A 4D8NA 5K0HA 1GI1A 1NRQH 4Y8ZA 2W7UA 4MPXA 2YMSC 3WWBA 1EPTC 3M61U 2QC2A 4NIVA 4ABFA 1G3EA 1ANCA 2P59A 3UY9A 5DG6A 4ASHA 1A0LA 1LQEA 3SI3H 3RXRA 2QE7D 4OS7A 2ZO3H 2STBE 3B9FH 3BTME 5H4IB 2ASUB 5ESTE 1TX7A 3FZDA 4JZIA 1GMHF 2B0FA 3RMLH 3N99A 3ZV8A 3M5LA 1Y8TA 2Z3DA 1ZZZA 3ZZ9A 2FODA 1GGDB 1YKTA 3VB7A 2FS8A 2Y7ZA 5JYIA 5C5NA 3E8LA 3UREA 5DP8A 5K7RA 1OS8A 4Y7AA 3KL6A 2ZDKA 5F8XA 2ZFFH 5EJZA 1UCYK 6CHAC 1FQ3A 2OBQA 1NBME 2FOMB 2THFB 2K1QA 1C1MA 4Z6AH 2G55A 9LPRA 1YCPK 4X1SU 2VIVA 1FONA 4DCDA 1E38B 1UCYE 1IAUA 1NRNH 3RXUA 3T26A 4BAMB 3PMBB 3MTYA 2D2DA 1A61H 2ANKH 1TBRH 4WMDA 1MTNC 1DY9A 4CHAB 1VGCC 3GOVB 4PROA 1YGCH 3F68H 1LVMA 1TMUH 2PKAB 4Z0KA 2ZG0H 1C2GA 3SBKA 1LTOA 1LCYA 3K2UA 4AG1A 1E35B 1HIAA 3MH5A 1YPJH 2QXGA 1FY1A 3OYPA 4I32A 1A4WH 4XBDA 1TBQH 5AFYH 2KR7A 4HFPB 1OWEA 3TK9A 4INHA 4VGCC 1V2OT 1O3HA 3OSYA 4NGAH 1MTWA 1BJVA 1GHVH 1AUTC 3TH2H 1W14U 1TPPA 3UNRA 2QYIA 2BLVA 3U1IB 2A4GA 1GG6B 4I8JA 1CT0E 1CBWC 2ALVA 2Y81A 1L2EA 1GBBA 2BD7A 5AFZH 1S0RA 3F9HA 3ODDA 1G3DA 2GMTB 1H8ED 1P2QA 1O2ZA 3LGTA 3SN8A 1HNEE 1ANBA 3VB6A 4I31A 1OWIA 1VCWA 2LPRA 1GJ9B 3DHKH 1O5EH 1D3PB 3S9CA 3RXSA 3GCNA 2P93A 1V2WT 3E0PB 3SGAE 1G36A 3DFLA 1O3KA 1SQTA 2Z9JA 3ESTA 3GY4A 4A1VA 2GKVE 3MU5A 4MVNA 4X2YA 1K1NA 2F3CE 2PHBA 4XE4A 3GICB 4WH6A 3GYLB 1LDTT 4LXBH 4Y0YE 3ATMA 1PPZA 1MD8A 3SGBE 3BTGE 2AGGX 2DUCA 3FZZA 1BMLA 4O3UA 1YF4A 2B9LA 1NC6A 1MABB 2BM2A 4AC9A 4ASUD 3K9XB 2GDEH 1BQYA 5HGGA 1HJAB 3TVJB 4OGYA 1UW7A 5IYTA 1OWDA 2SNWA 1GI0A 2J5UA 4K69A 1HLTH 1NN6A 1QR3E 6ESTA 3GY5A 4ISNA 2V6NA 1XUFA 1C2IA 1MU8B 2W6ID 1TOCB 3GDUA 5PTPA 1ZGVA 2GCTB 5HM9A 1KLIH 3B23B 3U9AH 1F0SA 2AS9A 3BEUA 4H42U 1D6RA 4YT6H 4Y10E 2W26A 7ESTE 2VIWA 3LT3A 4NFEA 1EB2A 1HXFH 1Z1JA 2ZPQA 3F9EA 2A4OA 4RN6A 2XWAA 4K8YA 1O3DA 3D23A 1QJ1B 2JKHA 4GCHF 1GBAA 1GWAA 1S82A 2FZZA 1C9PA 4CRDA 3A84A 1HAIH 5DJ7A 4KELA 4IMQA 5EG4A 2F43B 2OCVB 1UCYH 5FCKA 2OC1A 2XC0A 3M5OA 1AHTH 3M7UA 1W7GH 1UTPA 3RXDA 3ZZ5A 1J15A 1SQOA 1K1IA 2BY9X 1CGIE 1UTMA 3TK6A 1YCPH 1W8BH 2ZU2A 5HKKD 4B73A 3LGWA 3ZZ7A 1PQ8A 1O31A 2C8YB 6GCHG 1HYLA 2XWBI 3U8OH 2GJGA 1NESE 2ZC9H 3A81A 5GCHG 2PSXA 1MKWK 4RSPA 4WMFA 3RXAA 3A8BA 2GVFA 3H7OA 3SV7A 4ABIA 3MWIU 3PMJA 3RXLA 4JK6A 4XRNA 2QCYA 5J4QA 3PWCA 4BAOB 1B0FA 1BTWA 3KF2A 4K3JA 3MMGA 1N8OB 1GI7B 1KXBA 1Z7KA 4SGBE 1OP2A 2FOFA 3MO3A 4TPIZ 3TGKE 3RLWH 3F2FA 4Y79A 3BTDE 1TWXB 2FO9A 2IJD1 3P6ZB 3SJIA 2F9NA 3LKWA 5A2MH 2CV3A 1GCTC 1QFKH 4CBOA 1G9IE 1DY8A 2O8WA 4IN1A 1V2UT 4UFFH 2ZTZA 4A1XA 4JK5A 1WTGH 1W12U 1L4ZA 1N1LA 4K2YA 3ZZDA 1RD3B 1B7XB 5F8ZA 2A4RA 4F49A 2W3KA 3KEEA 4INLA 5DP6A 3VB5A 1BRAA 2VBCA 1UMAH 8ESTE 1H9IE 5EQRA 1O3GA 1GJCB 4ZHMU 1Z1IA 1YPKH 3SW2B 4AORA 3Q77A 3IWMA 4X6OA 2ZNKH 1KXEA 1AN1E 1HAYB 2FESH 1MTSA 4ISIH 2G5VA 4BAHB 1GHBG 1ZSJA 3GY3A 2DE8A 1QQ4A 1SHHB 1ESTA 3FFGA 1G2MA 3HGPA 1ZHMA 3UQVA 1EATA 1TPSA 2ZDVH 3S7HB 2TRMA 2VWNA 3ZYEA 3W94A 1QNJA 5EODA 1LPGB 3KCGH 1AFQC 5J4SA 6GCHF 2FOCA 1SPJA 1YCPM 1RRKA 2QXIA 1TNJA 1OWJA 4YT7H 5GCHF 5JPMH 2BB4A 2VJ1A 2VGCC 4U30A 1O3LA 4YTAA 3P17H 4TYDA 4AX9H 2K8IA 4YXWD 2NU2E 3UUZA 1XXFA 2QN5T 1SKYE 1JWTA 2ZIQH 1PQ7A 1ZTLA 1C5VA 2HLDD 4X2WA 3GS9A 1SBWA 3RDZA 2KAIB 5E0HA 3TJUA 2M2AA 4UFDH 5HYOA 2RCEA 3TU7H 1JOUB 1V2ST 2ZTYA 1MUEB 1GDQA 4ABHA 4CRGA 2QF5A 4ZKNU 3CS0A 1V2KT 3I78A 1PQ5A 3RXFA 2A32A 4B71A 3TPIZ 4BAKB 1NU9A 1TYNA 3UQOA 1O5BB 1GJDB 5B6LA 1C4Y2 4Y6DA 3TITA 1AWFH 1AE8H 5GNDA 1LKAA 2P3UB 2BQ6B 2VIQA 2J98A 1BTZA 4IGDA 1MKWH 1SGFA 2SGFE 1FY3A 1INCA 4B2AA 2FEQH 4IN2A 1XVOA 3PYHA 3ZVFA 3VGCC 1GHBF 3ZZ4A 1DWDH 2A0QB 4JZFH 2GT8A 1EUFA 1UK2A 1C2FA 3BTEE 3L33A 2D26C 2FIRH 1DWEH 1NFXA 1ACBE 1WTHD 2YNAA 1SGDE 4IBLH 3QZRA 4TWYA 3DD2H 5EOKA 4BXWA 1NZQH 1XUJA 5DKMA 4AYYB 1K28D 4CRBA 1F92A 1OOKB 1SQAA 1PFXC 1XUKA 3RXQA 4CH2B 1ANEA 1P2NA 1NRPH 4FU7A 1AUJA 2VINA 2KCAA 1F0RA 3QO6A 3WW7A 5TCCA 3UFAA 4Y76A 1SVPA 4X2XA 4ABDA 2G4TA 2HNTE 4CREA 1PPGE 4KP0A 1BZXE 2SNVA 3TJNA 3O8BA 2ZCHP 1KTSB 1W11U 1BTUA 1P05A 1H8DH 1RTKA 2Y5FA 2YMSB 3UNSA 1EPTB 4A92A 3QK1A 1NS3A 1S5SA 2RFKC 4ABJA 4NZQA 3U1JB 1GMCG 2C8WB 3U69H 1CA0C
chains in the Genus database with same CATH topology
1RTLA 4GLYA 2BXTH 7GCHG 5HXFA 1ZOMA 1HBTH 1RTFB 2UUKB 4Y71A 1QL7A 1HAOH 3LPRA 2BLWA 1C1RA 3KQCA 3A89A 3M36A 1CHOG 1FY5A 3E91A 4NIXA 2Q1JA 2G81E 2BX3A 4WWYA 3PMHB 4DIHH 2Z94A 1SGYE 1AB9C 6CHAB 4SGAE 4O3TA 2ZHWH 5FX5A 1DSTA 3T28A 2ZFQH 3ZZCA 3S7KB 2ZFPH 3ITIA 2CXVA 2VH0A 2QXJA 1KLTA 1TQ0B 2H2ZA 1K1LA 3S0NA 1SOTA 2NU0E 3SV8A 1A0JA 1K1OA 5E2PA 1HAVA 4NFFA 1GDUA 3SNBA 1EJNA 2FWWA 1VGCB 2Z9IA 1O2YA 1FY8E 1QB6A 2NU3E 4Q80A 5DP9A 1LKBA 1KDQA 1PPEE 4ISHH 3NUMA 3UNQA 5C20A 1K1MA 2HRVA 2CN0H 3GISB 4IC6A 2BVRH 1V2JT 1GHXH 4Q7XA 1FV9A 2Y5HA 2ZEBA 3BF6H 1TAWA 3QZQA 4THNH 1D9IA 4VGCB 1BBRK 3LH1A 3ZZAA 2ALPA 3PTNA 1C5ZB 2CGAA 5EW1H 1O5GH 4DOQA 2RA3A 1AI8H 1SSXA 4CBNA 3QN7A 2FLBH 1CBWB 1UHBB 3A7WA 4LK4A 3PROA 4NIYA 4RKJB 2ILNA 3A8CA 1ZHRA 3SNCA 1U6QA 2OQUA 1GJ6A 4AFZA 3BV9B 1GMCF 1CO7E 4JZEH 4Y0ZE 1V2LT 3HATH 4ZUHA 7GCHF 1ZTKA 2VIDA 3A8DA 1C5UA 2C8ZB 1K21H 4D9RA 1GHZA 1IQIA 2FOGA 3M3VA 4UDWH 1CHOF 1LHGH 2BVXH 4NWLA 2I6QA 2ZDLA 1MMJN 3PLKA 1GHWH 2AH4X 2QXHA 1TIOA 1O2KA 5L2YH 7LPRA 2G00A 2Y80A 5EXMA 1ELFA 1P9SA 2BXUH 2XXLA 1UTJA 1O0DH 3LH3A 1ZHPA 1DX5M 4DGJA 8GCHF 1T7CA 1QL9A 1BCUH 1S6HA 3F9GA 1D3QB 1CGJE 1NO9H 5GXPA 4LZ1H 3TK5A 4MNWA 1OYTH 4AGKA 1V6DA 4AFUA 1SGCA 1FIWA 4JYTA 3Q3YA 1MCVA 2STAE 2AERH 2XW9A 3RM0H 4NSVA 1NFUA 1SOZA 1XVMA 5T6DA 1XMNB 1TX8A 3QLPH 1C5XB 2ZFRH 3T5FH 1GVZA 4JZ1A 1C1SA 4I8HA 4E7NA 1FNIA 1LHFH 4ZHLU 1V2VT 4ZKRU 1AE5A 1O2PA 1IQJA 1PPCE 2QGRA 1DICA 1FUJA 2FOEA 2BZAA 2CMYA 3A8AA 4JYUH 3VXEH 1UTQA 2FTLE 1BTYA 4OS4A 2OC7A 1D3TB 1GBHA 1EQ9A 4YOJA 4XOJA 2D1JA 1GBMA 1DLKB 1O35A 1UVPA 5T6FA 3PLPA 1P2MA 1YPHC 3SU1A 2UUYA 3GY2A 3TJOA 3OX7U 1HDTH 1O32A 3C1KA 2BDHA 2Z7FE 3L3TA 4DG4A 1GBDA 1EAUA 4OS1A 4IS5A 2OQ5A 1SFQB 1AIXH 2A2QH 1PJPA 5E2OA 1HIAB 1PYTC 1YYY1 3PTBA 3UWIA 2ZGHA 3LU9B 3STJA 3SOSA 1TNHA 1GVLA 1YPMH 5A0AE 1S81A 1GDNA 2WV5A 1QURH 1UTKA 2PTNA 1X7AC 3CS7A 3P70B 1AVXA 1BBRH 2XC4A 1G3CA 3SZNA 4HI3A 3SNAA 1O5FH 2PR3A 1T32A 1J8AA 2V0BA 3GDSA 5FHTA 3RU4T 4NCYA 5BRRE 2P8OC 4O9VA 1W2KH 3SU0A 2UWOA 4AB9A 1GI2A 2FXRA 2PGBB 1ESBA 3E90B 1W13U 1Y3YA 3T25A 3MYWA 2BOKA 1O3OA 1C5RA 5CHAC 4K5ZA 1NY22 1YPEH 1ARBA 2P3FH 1C5TA 4WXIA 4HZHA 5DP3A 2ZDAH 3BSQA 1FN8A 1MCTA 1TB6H 2CF9H 1EZXC 1GBLA 2GX4A 1L1NA 1WSSH 2UUJB 4ZMAH 1P09A 4MG3A 2XNIA 1P3EA 3ZVGA 2EA3A 1UVUH 3ZVDA 4X8SH 1AGJA 4DIIH 3M3TA 2GCHG 2ZP0H 3SI4H 1LVBA 1KY9A 3A86A 1QTFA 1SMFE 3EE0B 1AD8H 1AMHA 1EAWA 2UWPA 1W0ZU 1ARCA 1FZZA 1ZSKA 2AIPA 2AMQA 1LPZB 3H5CB 3QGJA 3RU4D 4JCNA 5FPYA 1NPMA 1GBFA 3V0XA 2UUFB 3I77A 1T8OA 1AVWA 1AFQB 1C9TA 2BD8A 3AAVA 2ANMH 4XFQA 1Y5AT 1V2TT 1HPGA 3BG8A 4ZHAA 4FUHA 1VITG 1A0HB 1ZPCA 1C2HA 3M35A 2HNTF 2VGCB 1RGQA 1ELVA 1FJSA 3SUEA 1Q31A 5A09A 2OBOA 4B74A 4JZDH 4OGXA 1QJ7B 1FXYA 1NM6A 1IHTH 4U2WA 1OYQA 2ODPA 1OP8A 2Z3EA 4IMZA 3GY7A 1GI9B 1C1NA 3SHAH 1NRRH 4U01A 5A8ZA 2ZDMA 3F9FA 3KHVA 3S9BA 1BIOA 2VWMA 1ZSLA 4AG2A 5TJXA 1A3BH 1KSNA 2R3YA 3LGVA 1SGNE 1GJ4H 1RIWC 1DUEA 2Y6TA 2TGTA 5CE1A 3PB1E 1C5YB 5AF9H 1LVOA 2F9BH 3T62A 1ABIH 1IQNA 1O3CA 4NIWA 3VXFH 1O2JA 3A7XA 3SU2A 5JBAS 1MTUA 3A7VA 1GG6C 2HPPH 1VR1H 1MTVA 3E1XB 5C5OA 2ZZUH 1AY6H 1DPOA 1TA6A 1SGEE 1T8LA 1D6WA 1O2TA 2GCHF 2A5KA 1THSH 3VGCB 1GBEA 2WPLS 1P3CA 5BPEA 2PKSB 1DXWA 3QWCH 1WOFA 1EZUC 3ZZ3A 1DSUA 2HALA 4NSYA 1THRH 1BA8B 1XM1A 3M5MA 2IN2A 4LZ4B 3P8OA 4Q7ZA 3HK6B 4X6PA 2TGPZ 1NU7B 5DP4A 1O2LA 5F03A 4KGAA 4ABGA 2NU1E 1WQVH 4YOGA 5LPFA 2ZWLH 3V12A 2R3UA 3BEFB 2FI5E 1JRSA 5A0CA 1NROH 1VITF 4D7GA 3DA9B 2SGDE 3ELAH 1BOQA 2SGEE 2SFAA 3A7TA 3RMOH 1Y3XA 1HAGE 2EI7A 3VEQB 3PMAB 4DW2U 2O8TA 1WU1A 3TNSA 1GJBB 2A7JA 1KXAA 1JRTA 4MPUA 3B8JA 2PGQB 1O3MA 1SHYA 3A83A 1QGFA 2XCFA 4K60A 3MHWU 5JDUB 3TGJE 4YOIA 2BDGA 1K2I1 1UTNA 3LOXA 2Q6FA 1DE7H 2A7CA 1CA0B 2Y7XA 1WV7H 4FUDA 4KKDA 1HB0B 1ZJKA 1IQFA 2EI8A 1C2LA 1K22H 1TFXA 3NKKA 3DUXH 3JZ1B 3RP2A 1A7SA 5EW2H 1QQUA 3U8RH 2WUBA 1C1UH 1BTXA 3SGQE 3ATWA 2ODYB 2A31A 5L2ZH 4ZAEA 3NK8A 1AKSA 5FCRA 1IQHA 3VB3A 4X1PU 1AB9B 4LOYH 3RMNH 4MQAA 3ATLA 3G01A 3ATKA 1M9UA 1ZMLA 1XUHA 2LNCA 1C5OH 5HMAA 1EP5A 2G52A 2OTVA 2A5IA 4IC5A 3PO1C 2GZ9A 5LH8A 1W10U 1YLDA 4MNXA 2XCNA 3QX5H 2F83A 4ISOA 4GAWA 1LQDB 1GI6A 1H8IH 1TGCA 2NU4E 3RXEA 4BTIB 2TBSA 4XBCA 1G2LA 3RMMH 2GTBA 3NZIA 1P04A 1SGQE 3EAJA 3BTHE 1NFYA 4FU8A 1SL3A 2WPMS 1TABE 2HGTH 1GBCA 1PPFE 2VIPA 1C5MD 1HCGA 1CHGA 2F9UA 4X1QU 1DT2A 4O03A 2OP9A 2BD5A 2J38A 2ZECA 1A3EH 1UO6A 3ZVBA 1BRUP 2FI4E 1C4V2 3SJ9A 2QV1A 1OX1A 1QCPA 4I8GA 3GDVA 1F0TA 3RXJA 2C8XB 1TBZH 1TGNA 1CA8B 3L6PA 2PV9B 2BVSH 3MNBA 4XDEA 4U32A 4YO9A 1GBIA 4BOHA 4KTUA 3ZVCA 4K1EA 2O8UA 1TE0A 2XBYA 2CJIA 3MU8A 4K1SA 2BDYA 1ZRBA 3RLYH 3QUMP 5GDSH 2OD3B 2Q6DA 2R2WU 3MFJA 2ZFSA 4E7RG 1Q2WA 3LGUA 5FXLA 5EU8A 1QBNA 1VCQA 1Y3UA 5C3NA 1FN6A 5GJ4B 3SJOA 3MU4A 3MH4A 2BY5X 4HTCH 1HAZB 1RXPA 3QTVH 3EYDA 4FUGA 3K6ZA 1QBOA 1TQ7B 5EXNA 3FAOA 2B8OH 3FP8E 2SGPE 4X8UH 3SQHE 1J9CH 3BTTE 1A5GH 3ATIA 2FX4A 1MD7A 3LC5A 3Q3XA 2TGAA 3C27B 1TRMA 3ZZ6A 1Z8RA 1C2DA 4YM9A 1IQEA 1XKAC 2IOTA 3GCOA 2DE9A 2C90B 1T4UH 3LDXH 1NT1A 3R0FA 4KTSA 1EOJA 5TCAA 3KQEA 3ZV9A 2A2XH 2A4QA 1P2IA 1A2CH 3M7TA 1O33A 1YBWA 3TLOA 1K9OE 3SUFA 1UJ1A 4WJG2 1TNGA 3R3GB 2R9PA 2J4IA 3T2NA 2HWLB 3PLBA 1SC8U 1QRZA 1QRXA 1GI3A 3EA9A 3EA8A 1MBQA 4H4FA 1AZZA 1EZQA 2XC5A 4CRAA 3FP7E 1HFDA 1ETRH 4BTUB 1P03A 2H9TH 1XUIA 1ETTH 1N6YA 2BDAA 2H5CA 3UR6A 2H9HA 3A7ZA 3M5NA 3ZZ8A 4ESTE 5AVDA 4FUJA 1T4VH 1YLCA 2VWLA 1MTNB 3P8NA 5DGJA 3V13A 5E0GA 1LO6A 1S0QA 1TNKA 1ZTJA 1DLEA 3TJVA 1ZR0A 2OC8A 1L4DA 4ISLA 3OY5U 4R8TB 5L6NH 1HAVB 4JYVH 1ID5H 1DM4B 1WAYB 1ELTA 5JBCS 3EQ0H 1GI5A 3RXIA 4NZLA 8LPRA 1AVGH 4GSOA 1QB1A 3MOCA 1Q3XA 1TALA 1HXEH 1Y3VA 2IJOB 3RXVA 1KDQB 2GV6A 1E34B 3RC5A 4Q2KA 1O3IA 2GZ8A 3SJ8A 1WQSA 1EASA 2HNTC 2PUXB 3SU3A 1RS0A 1EJAA 3GCHC 1ELEE 4CR5A 3TGIE 2HPQH 2WINI 4DURA 1B0EA 1V2RT 4A6LA 3A80A 2FI3E 3BTFE 2UWLA 1VJAU 3DFJA 3OTJE 1HRTH 1KXFA 1C2MA 3P95A 3HK3B 5A0BA 2FYRA 2Y82A 1G30B 4HGCA 1DOJA 1QA0A 2BHGA 3UWJH 2OLGA 1DITH 4XBBA 1PYTD 3SNDA 2J92A 4KTCA 3BIVH 1FLEE 1O5CB 2A7HA 2W7SA 5A8YA 5DO4H 1ZJDA 2J95A 1ELAA 1B5GH 2WPJS 1J14A 2JETC 1YPLH 1THPB 2P8OB 3U98H 1K1PA 1C5LH 4CH8B 4B1TA 1BMAA 1A46H 2V3OH 4X6NA 1O2SA 2XBVA 5CHAB 4FXGH 3FVFB 1O2QA 1SLUB 2F9VA 5DK1A 2TPIZ 1P10A 1Y59T 2FOBA 2BD4A 3KQDA 1VCPA 1GJ8B 4J1YA 2VH6A 2VVCA 1FPHH 3MNXA 4O97A 1VZQH 2G4UA 2G8TA 3CP7A 2ZGCA 3MU1A 4AGJA 4I8LA 1QB9A 4B76A 1YP9A 1LMWB 1O2WA 3GY6A 4DVAU 5E0JA 4MNVA 2F9OA 3I29A 3SV9A 3P8FA 1EXFA 1GHYH 3E6PH 4MDSA 3RUOA 1GHAG 1MH0A 1ORFA 1UVTH 3RXCA 4F4OC 1XXDA 1OSSA 1QA7A 1FMGA 3SV6A 5E8EH 2W3IA 3KIDU 2ZU3A 2TGDA 1A5IA 2V3HH 4NA9H 2BQWB 1O2RA 3BEIB 3TH4H 1BT7A 1P2OA 1UTLM 1BTHH 1ZGIA 4X1RU 2PFEA 5B6OA 8KME2 4MTBA 2FDAA 3BTQE 3DT0H 1MQ6A 1TNIA 3H7TA 5EPYA 1CQQA 5GWZA 1C1TA 1O37A 1GI4A 1V2QT 2RDLA 1XUGA 1LVYA 2HVXA 1C1QA 2Z3CA 3URCA 3AASA 2RG3A 3ZYDA 3LJJA 5SGAE 1P12E 3RC6A 4MPWA 1T8MA 5LPEA 1DUAA 4UFEH 5A8XA 1QL8A 5T3HA 5FAHA 3MO9A 3OY6U 1O2UA 1BB0B 2ZFTA 4OS5A 3AW1A 1L1GA 5JB8S 2PKAA 1K1JA 1TOMH 3D49H 3NWUA 1OP0A 4H6SB 2YOLA 1Z8JB 2ZI2H 5G4BA 1P11E 1J16A 1HJ8A 4ZH8A 1O3NA 4UEHH 3BG4C 2AFQB 2ULLA 1C2JA 2GP9B 3SJKA 1BHXB 1VITH 4CRFA 1W7XH 2ZGJA 3UPEA 2BLOA 1ZPZA 1RIWB 1UK4A 1O3JA 2BX4A 3VPKA 2CF8H 5C2ZA 1ZPBA 2V35A 3E16B 1WUNH 1QJ6B 4JMYA 4R0IA 2BY8X 4Y11E 1AZ8A 3P92A 1C5NH 3SQEE 2ZA5A 1WBGB 3SORA 1ZMNA 3O8CA 1H4WA 4GCHG 1KLJH 4RKOB 3SU5A 3T29A 1SGFG 1F7ZA 4CRCA 1H1BA 2VNTA 1GCTB 2VVUA 4GPGA 3IITA 2Z9KA 4DY7B 4AZ2B 2BY6X 2CHAC 1LHDH 1HGTH 4ZXYH 1P57B 4QT8C 1ZMJA 2VVVA 1QIXB 1GHAF 2A1DB 3VB4A 2EEKA 1H9LB 3AAUA 4ZKOU 2P94A 2J9NA 2BTCE 3SHCH 2PSYA 4UE7H 4B75A 1O2HA 3MI4A 5EXLA 1P0SH 1FI8A 3MH7A 2ODQA 1V3XA 4FUFA 3EA7A 2GD4B 1SGTA 2ZQ1A 4X6MA 4NWKA 1TGTA 3PV4A 1Z8IB 3F1SB 4TWWA 2BD2A 1AO5A 4TY7A 1ETSH 4FUEA 1D3DB 3SUDA 1W3CA 4A7IB 1LHEH 3HKJB 1P2JA 1O2OA 3BTWE 1MBMA 2BZ6H 1S84A 3MU0A 5T6GA 3Q00A 1O3EA 2O9QA 3RXKA 3RXPA 3N7OA 4MLFB 4X8TH 1O34A 4B2BA 2J34A 1TX6A 3M37A 4ABAA 2FMJA 3NPSA 4GVUA 1QY6A 5L30H 1GGDC 4BTTB 1YPGH 4BANB