3A7XA

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 45seconds)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7xA02
1NESE 5F03A 1TPAE 1GI4A 1G2MA 3LGVA 3PMHB 4ASHA 3BG4C 3BTQE 2XBYA 3MU8A 1GBFA 3RXHA 3GICB 1ETTH 1SGNE 1V2UT 1TALA 1XUKA 3STIA 2D8WA 2GX4A 3A84A 3RXJA 1BMLA 3R3GB 2VGCC 1WCZA 4XSKU 1IQEA 1HV7A 2BX4A 2OC7A 1GBDA 2A45B 5T6GA 1O3EA 8LPRA 3NK8A 3A8BA 4Y79A 3AAVA 1E36B 2I6SA 3SHAH 1F2SE 5I25A 3B23B 5IDKA 1EOJA 1Q3XA 3T25A 2HRVA 1Y3YA 3MYWA 1GHBF 1HYLA 1TX8A 5ESBA 1UTNA 1VZQH 2HNTE 2OC0A 3TNTA 1NROH 2M5TA 1TNKA 3BTEE 3MI4A 4UONA 4YM9A 3V7TA 5JB8S 2XCFA 1K2I1 3ZZ9A 1Z8RA 1HAVB 1QBVH 4TWWA 2YNBA 1SSXA 1D3QB 1GDUA 1GHAG 5EPNA 2H1UA 2A32A 2VH6A 1UTKA 1DY8A 1PPHE 1GJDB 1SVPA 4FUEA 1O36A 1THPB 3VXFH 1W11U 1QHRB 5EXLA 5GCHF 3KQDA 1DLEA 1W3CA 3VXEH 3Q00A 3C1KA 1YBWA 1BTUA 1WBGB 4I32A 1QR3E 1TBZH 1C2MA 3U1IB 3UNQA 1O2ZA 1IQFA 1DWEH 2P3FH 4NA7A 1RTFB 1H9IE 1SLUB 2BY8X 1TQ0B 1C2HA 2BOHB 2BQ7B 8ESTE 2BDBA 1C1PA 1GI1A 5FPSA 3LKWA 1IQJA 4K1SA 1MQ5A 3ATMA 1LPGB 2PR3A 3A7WA 2TPIZ 4O97A 3RXDA 1XKBC 1ZTKA 3PMBB 4MPUA 3A7XA 2FLRH 2B9LA 3A85A 1GBCA 4OS1A 1GHBG 3O8RA 2BD9A 1A5IA 5CMXH 4SGAE 1AD8H 2A5AA 4JZIA 3MWIU 3LGYA 4B1TA 1S5SA 3KQCA 2DE9A 3FP6E 4CRBA 4E7RG 4DT7B 1AIXH 4X8SH 1MTUA 1DUEA 3MTYA 3GCOA 4FUFA 4I8JA 4BOHA 4FXGH 4JK5A 3P8OA 1AWHB 1UMAH 1NM6A 2TIOA 1QTFA 1EAIA 2FOHA 3DUXH 1ZYOA 2EA3A 3M61U 2OQ5A 1A0HB 1HAGE 1THRH 3ZV9A 1GGDC 1BCUH 1AB9C 1QA7A 1Z8JB 1EAXA 1ELVA 1PPBH 3FAOA 5HYOA 4FU7A 5FHTA 5GCHG 1VCWA 1TABE 4IBLH 5LGOA 3F9GA 2F9VA 1J15A 3E91A 1J17T 1ELAA 2Y80A 1BJVA 1ABIH 3MNCA 1KDQA 5C20A 3KEEA 3PLBA 4D8NA 1JRSA 1VCQA 1TGNA 1UCYH 3Q76A 3S9CA 3P6ZB 3ZZAA 4FUJA 5A8XA 1V2PT 1YPHC 2P93A 4TYDA 1B0FA 3HPTB 1MBQA 1QCPA 2Z9IA 4NIWA 3GCTG 2PKSC 2HPPH 5JB9S 4B2AA 3SNBA 1GJ7B 1HRTH 3ZVBA 1S0QA 4FVBA 5EOKA 4XBBA 2WPKS 3RXAA 3W94A 1CA0C 1ELGA 1H9LB 1AVXA 4Y0ZE 2A7HA 2SGPE 3UR9A 3ZVDA 1G9IE 2ANMH 4BTIB 1DWCH 5GXPA 4ISNA 1TGSZ 3F6UH 3UWIA 2FI3E 2PTNA 7ESTE 2XWAA 1FXYA 2RDLA 3HATH 1D3DB 1EX3A 2UUKB 2GCTC 3TVJB 1T31A 3STJA 3T2NA 2GTBA 5HXFA 4JZEH 1ESTA 2AFQB 1EKBB 2SNVA 4QT8C 4Y8YA 2ILNA 3K6YA 2W7SA 1YGCH 1D6RA 1K1OA 1T8MA 4FUIA 2H5CA 3A80A 3AW0A 1LHEH 4NFFA 3ZVGA 1CVWH 1GDNA 2RG3A 1QBNA 3KN2A 1TLDA 1DITH 3A87A 2Q6DA 1P3EA 1VR1H 1C5MD 1C1UH 3E6PH 3PTNA 3ZVEA 3WY8A 5JBCS 1P10A 1P06A 3E0NB 3ZYEA 1NZQH 2BLOA 3GDSA 4IC5A 1DWBH 1P03A 1C2GA 1BT7A 4ZKRU 3EA9A 1ANCA 3FZDA 1HAIH 1T8LA 1F5LA 1PQ8A 1CQQA 3GY8A 4I33A 5CE1A 3R0FA 1ARCA 4NA9H 1GBEA 3BTGE 1HFDA 3M3SA 3Q77A 4MNYA 2OD3B 1QL8A 4NGAH 4B73A 5DG6A 3ITIA 3SOSA 4GSOA 3I78A 2ZTZA 1TNIA 2ZGJA 2OXSA 1FNIA 1TNHA 1BMAA 2QV1A 4I8KA 3SHCH 5EQSA 1C9PA 1ZSJA 2JETC 3ODDA 4ISOA 4B74A 1F5KU 2ZO3H 1XUIA 3TPIZ 4MNXA 3UTUH 2HGTH 1L4ZA 4XBDA 3KQBA 5FXLA 5EQQA 4TPYA 2F9BH 1YYY1 2FTMA 2BDYA 1AE5A 1U6QA 3RXPA 2YOLA 2BDCA 3GY4A 5EW2H 3U8RH 2EC9H 2GCHF 1FONA 3PTBA 2FOAA 1UTJA 2O8MA 1HJAC 1P9SA 1EUFA 2ZPQA 4NSYA 1S85A 9ESTA 1AE8H 1D3TB 1GJ8B 1LDTT 1Q2WA 1SGQE 2PHBA 1Z1IA 3ZV8A 1P2JA 2C3SA 4WF8A 2ZCKP 1AGJA 2SGEE 3GYMA 1INCA 1ZZZA 3A8DA 3I77A 4Q80A 5A0BA 1WSSH 4BXWA 3QK1A 1FI8A 2P3TB 2PSXA 1CE5A 2O9QA 4OS5A 1PFXC 1PPCE 1ZSLA 2FWWA 2RA3A 4O9VA 1V2KT 1E37B 4YOGA 1ZOMA 1N6XA 1YCPM 3P95A 1MTVA 1P02A 4AG1A 1ELCA 3DFJA 3NUMA 4LZ1H 4GLYA 3P8FA 1G3CA 1HB0B 2QXHA 1G30B 1FLEE 2GZ8A 2J9NA 2XC0A 1KLJH 5FX5A 2VU8E 3TJUA 1C5QA 1HJ9A 2ODYB 1P05A 4XBCA 5C1XA 1AKSB 1C4U2 1PQAA 2GVFA 3M36A 2ZU3A 3QDZB 1T4VH 4H6TA 2FXRA 4VGCB 5EW1H 3BTKE 3Q3XA 3RXFA 1IQIA 1MUEB 2CV3A 2NU0E 1HBTH 4BAHB 2CF9H 3QUMP 1NS3A 3A7ZA 5C5OA 1O35A 2Y82A 2ZDAH 2NWNA 1QNJA 1TMUH 2QAAA 1UTQA 1YPEH 1A1RA 4FUDA 1ID5H 2ZGHA 2BX3A 3UQOA 1O2OA 3VB3A 2ODQA 1UVPA 3M7TA 3BG8A 1CT2E 2GMTC 4X2YA 1HGTH 1IQKA 3HKJB 4X0WU 2BMGB 4NSVA 4X6PA 1NFUA 4B75A 1SGDE 1FDPA 1FN8A 3ATKA 2O8UA 4X6NA 1J9CH 3BEIB 1P2IA 4CRCA 4D76A 3DD2H 1S6FA 1O2HA 2ZNKH 1ZRBA 5L2ZH 1LVMA 1ZR0A 2A2XH 1ZHPA 1P2QA 5ESTE 1O3LA 4AB8A 5DP9A 4CBOA 1WYKA 2XXLA 3MNSA 3PM3A 2UUFB 4AYYB 5F8TA 1P2MA 3L6PA 4WXVA 4MLFB 7LPRA 1MKWK 2BVRH 1GMCG 1NTPA 1UJ1A 4DGJA 1KXFA 1DSUA 2GMTB 2ZGXH 1XUJA 5EGMA 3AAUA 1AB9B 1TA2A 3OTJE 5AHGH 1H8DH 2QY0B 2BD2A 3TIUA 4X1QU 4ABDA 3BTWE 5L2YH 2J95A 1QRXA 1SLXB 2C8YB 3GCHC 1O5AB 3RLWH 1HAZB 1J8AA 2VGCB 4IS5A 5L6NH 1LKAA 1O2NA 1Y3WA 4CR9A 1FMGA 2ZDMA 4TWYA 4Y6DA 1H8IH 1TNLA 4ZAEA 1O2QA 1C2LA 4WXIA 2GDEH 2GKVE 1QJ1B 3LPRA 5FBEA 4WY3A 1JWTA 1CA8B 5TCAA 1BBRE 2WPIS 1KDQB 2FX4A 4AZ2B 1UVTH 3RXKA 1G2LA 1DXWA 1GGDB 3SJKA 4X6OA 4OS6A 2VIQA 3TGKE 3HGPA 1P9UA 1ZMNA 1NRQH 4LXBH 1B7XB 1HCGA 2OC8A 4RKJB 3QX5H 3S69A 1K9OE 2GCTB 3ODFA 1WQSA 1QL7A 2WPHS 3EA7A 1TNGA 3RU4T 2AEIH 4XOJA 4ISLA 3F9HA 4K8BA 1UHBA 3TITA 5JPMH 3LC5A 1SGEE 1ORFA 1A5GH 1CGHA 2AH4X 1T7CA 2R0LA 2C93B 4B71A 1A0LA 3MU5A 1O0DH 3PWBA 4HTCH 4ZHLU 1A61H 2F9OA 1C2IA 2B8OH 2OTVA 3V12A 3LC3A 4UFDH 4DCDA 4OS7A 1BZXE 1LHFH 2AIQA 2R9PA 2H6MA 3NPSA 1NY22 1OWJA 2PFEA 2ULLA 5C67A 3GY5A 1Y5UT 2TGAA 2FLBH 3P17H 4JZDH 4RN6A 1VGCC 1GI5A 3TNSA 1BRUP 3HK3B 1WTHD 3FP7E 2ZU4A 2QIQA 5LPFA 1GJ6A 3BG4B 2UWLA 3M5LA 4AFUA 1RRKA 4UFEH 4IGDA 3VB4A 1EJMA 4AB9A 6ESTA 1NRNH 2BLWA 1NFXA 5HGGA 3T28A 1LVBA 1QFKH 1ELTA 5PTPA 2QCYA 3CP7A 1LVOA 1SGPE 2VNTA 1SI5H 2G5VA 5SGAE 1SLWB 2J34A 3EGKH 3GDUA 3P8GA 2KAIA 2FOEA 1MBMA 5EPYA 4WMFA 1K1NA 1GJ5H 1CHGA 1P57B 4R0IA 3K6ZA 4WH6A 4U30A 2G4UA 5DK1A 5B6OA 4GPGA 4FUBA 4K1TA 4MQAA 1V2TT 3A8CA 1O3IA 1IQHA 4X2VA 4NZQA 1GCTC 2OQUA 4OGXA 1GJCB 1WTGH 4DG4A 3AVZA 5DGJA 1GBKA 3BSQA 4BXSA 4JZ1A 1C5UA 1NC6A 3UY9A 2PSYA 1C9TA 1C5LH 1MH0A 1G3BA 1YCPK 2A7JA 3AASA 1TOMH 1OYQA 1ZTJA 5GDSH 3TK9A 1OWHA 1BMMH 2WUBA 3QWCH 2BOKA 4K3JA 1BMNH 2V6NA 3KNXA 1MKXK 4ISIH 2AMPA 5EXMA 4OS2A 2SFAA 2A1DB 1GI3A 3RMLH 1C1TA 1O2GH 2D1JA 3VB5A 1GI7B 4KELA 1CBWB 1OSSA 5F6MA 3T29A 6CHAC 3TU7H 1YPMH 2UUJB 3KCGH 1UTLM 3T26A 1LPZB 1A0JA 2KAIB 3MH5A 3O8CA 1O3KA 4MNWA 1GMDG 4ZXXH 1TRMA 2H2ZA 3KQEA 3N7OA 3SGBE 1NU7B 1GBIA 1F5RA 1FPHH 3SV9A 2ANKH 3LGIA 2LPRA 4KGAA 4Y11E 5FCRA 1K1PA 2ZFSA 3S7KB 1XM1A 3FVFB 3UPEA 1TGCA 2R3UA 1NRPH 2VWMA 2ZU2A 1NRSH 1QGFA 1UK4A 1KY9A 2ZHFH 4A6LA 3BIUH 3OX7U 2VWNA 1EQ9A 4JYVH 4DJZB 3M5MA 1GG6C 1YLCA 2VJ1A 2ZHWH 3DFLA 5F8XA 1MD7A 3MO9A 1ZLRA 2BD7A 3RM0H 1BTZA 1EJAA 4MPXA 1MD8A 3U8TH 1AUJA 1ESBA 1QA0A 1TPPA 2FM2A 1GMHG 1O5CB 5F8ZA 7GCHG 1KXAA 3M7QA 1PYTD 4X8VH 2VWOA 1PPFE 2BB4A 1P01A 1P11E 1DFPA 1P04A 3BN9A 3A8AA 1HIAB 3TGJE 1GJ9B 3SQHE 2W3IA 1RJXB 1CA0B 2VB0A 1TX6A 3A83A 4LZ4B 1ETRH 1C5YB 4FUHA 1NU9A 3SJOA 3SV7A 1GBMA 3UFAA 2PV9B 2ANWA 2FOBA 1G3DA 3ZZDA 2CGAA 1S6HA 1SQOA 1O3NA 1GWAA 3MOCA 1BA8B 4OGYA 5AVDA 3SQEE 1GCTB 2FOCA 4AGKA 3RXQA 3RXSA 5FCKA 2BZ6H 1XX9A 1YKTA 5I46H 1HPGA 5DP5A 2CXVA 1KIGH 5DP3A 1O2WA 7KMEH 1O5FH 3OYPA 1DPOA 1HJ8A 2P3UB 3SI4H 1P2NA 1EASA 3PLPA 1D3PB 4TY7A 1Z71A 2Q1JA 1SR5C 5CHAC 2WPMS 1PQ5A 4Y76A 1GDQA 2XC5A 3ZZ5A 1Z8GA 1GMHF 3CENA 5A0AE 2FDAA 2BY5X 4ZMAH 1SBWA 3VGCC 3SUFA 1TFXA 1GBAA 2Q6GA 1N1LA 1O3PB 1QB6A 2B7DH 3SNAA 1A3BH 1OYTH 3RMMH 4MTBA 2V3OH 1K1IA 3RP2A 1C1SA 1O3GA 1PPZA 4JCNA 1F0SA 1F0UA 2G51A 2XBXA 2A5KA 4A7IB 2W26A 4CRFA 3RDZA 1IQLA 3RXOA 1KXDA 2ZG0H 5DP7A 3SV8A 4AOQA 2H9HA 2G5NA 2Y7XA 4MNVA 2ALVA 1HAHH 1T4UH 1SHHB 3SU4A 3LIWA 1C2FA 3PO1C 4AYVB 3SUEA 1GJBB 1BRCE 1YPGH 3RXRA 3MU1A 1C2KA 2O8TA 4BTTB 4ABJA 2XWBI 3EAJA 2CHAB 1HDTH 3NCLA 2WPJS 1C1WH 2OBQA 4MVNA 4IN1A 2F91A 2IPHA 4GHTA 2GP9B 4Q7XA 1S83A 2PLXA 3NKKA 3OSYA 1BJUA 4AFZA 4YZUA 3BTFE 1UK2A 2VH0A 2JH6D 3M3VA 1HXFH 1V2VT 1O3JA 2ZHDA 2FPZA 3CS0A 1A5HA 1ETSH 1EZQA 4U2WA 1ZTLA 1TGBA 2Z9LA 3RLYH 3SU3A 3S9AA 4I8HA 1GJ4H 2ZF0H 2Z3DA 1OX1A 2BY6X 2FI5E 1AVWA 1F7ZA 1TMBH 2HPQH 2Z3EA 3FFGA 3UR6A 4BTUB 4A92A 1QQ4A 2C8XB 4YO9A 3ZZ6A 1GHVH 2GZ7A 3ZZBA 3TJVA 6LPRA 2H9TH 3EDXB 3SUGA 1MCVA 4DW2U 8GCHF 1DSTA 1C2DA 3LGUA 2V35A 1UCYE 1XMNB 4A1VA 1PQ7A 1LVYA 3KHVA 1ESAA 1Q31A 4AN7A 1CT4E 1NO9H 1SGFA 3RXBA 2G52A 1AMHA 1OPHB 1TMTH 2FEQH 2QA9E 1ABJH 1YPJH 4NIYA 4UEHH 1YPHE 3A81A 4VGCC 4NIXA 1F0TA 3NWUA 4YLQH 2XNIA 4SGBE 5HM2A 1ZJKA 3ZYDA 1SFQB 2G55A 1ELDE 3RM2H 4DIHH 3U1JB 4YESB 1XKAC 1LHGH 3QO6A 5A0CA 2C8ZB 2XYAA 4XDEA 1DY9A 3O8BA 2R2WU 3QGJA 4H4FA 5H4IB 2TRMA 2OUAA 3ATWA 4A5TS 1CGIE 4ABAA 1OWDA 4A1XA 2ZQ2A 1MTNB 1MKWH 3PB1E 2ZC9H 2ZFRH 3BV9B 4K69A 1IHSH 4ABGA 1YC0A 2O8WA 2BQWB 3F68H 2FO9A 3A7TA 5TJXA 1V2MT 1BBRK 2PGQB 5C5NA 1ANDA 5E0GA 1VJ9U 2STBE 1ZJDA 1UVSH 2QC2A 2UUYA 4X6MA 2K1QA 1UO6A 1O2PA 1JRTA 2Y81A 2B0FA 1O2JA 2CMYA 2FP7B 2V0BA 1GPZA 1O2KA 2BD4A 1GBJA 2PKAB 3A7VA 1OWKA 2AS9A 4I31A 2P59A 5T6DA 3SW2B 1ELEE 2SGQE 2Z94A 4UE7H 1V2RT 4UFFH 1TNJA 2ZHQH 3D49H 2AERH 4KTUA 1MU8B 3Q3YA 2F83A 5JBBS 2GGVB 1ACBE 1GBBA 1THSH 1VGCB 1AZ8A 4J1YA 2XCNA 3TH3H 1EPTA 4FUCA 1C5OH 1BTHH 4JK6A 4X1PU 1A3EH 1DS2E 1W0YH 2ALPA 1HAOH 1KXBA 1YPKH 3EE0B 5DKMA 2OINA 1N8OC 5G4BA 3AW1A 3BF6H 1RD3B 2AGIX 2ZFQH 4J2YB 3G01A 1EPTC 1YPLH 2EI7A 3FANA 1YCPH 1KLIH 3NXPA 1UVUH 2JKHA 2UWOA 2EI8A 2ZU1A 2A31A 3MH7A 1C1VH 1ELFA 5FBIA 5E2OA 1OP8A 3TH2H 4FU9A 1O39A 1ZPBA 4HFPB 3RC6A 5K0HA 1SQAA 2ZKSA 5JBTA 3TJOA 4NG9H 2QN5T 3LJJA 1E38B 1GBLA 1P0SH 5BPEA 4GAWA 3OY5U 2ZI2H 4XFQA 2BY7X 2OC1A 3PYHA 3URCA 2RA0A 3E3TA 1EB2A 4BAOB 1SHYA 2W7UA 3UQVA 1O2LA 4F49A 1QJ7B 1Y59T 2GDDA 4I7YH 1TRNA 2BD3A 1C4V2 1UVOA 1BBRH 1HIAA 2SGAA 3EA8A 2A7CA 1C5TA 1V2JT 3RXEA 1TQ7B 1QURH 3IITA 2YNAA 2FODA 3P92A 3LJOA 1WOFA 4DVAU 5J4QA 1EAWA 3B9FH 4CHAC 3S0NA 3VPKA 1O37A 2TGDA 1HAXB 2HNTF 1GBTA 1ANEA 1Y5BT 2CF8H 2VVUA 3SNDA 1O2YA 1Z6JH 4D7GA 5EQRA 2FX6A 4MPVA 3RXCA 4IC6A 1OWEA 1DDJA 3PWCA 1K22H 1TONA 3GY2A 2OCVB 4O3TA 1W12U 2BDIA 4JZFH 3A89A 2ZHEH 3CS7A 4YTAA 4KTSA 2OLGA 3W95A 1FUJA 1KYNA 1RTLA 3MH4A 3LDXH 1V6DA 1P8VC 3V3MA 3GCTF 3MO6A 2B5TB 1T32A 4D9RA 1GHXH 1RGQA 6GCHG 4WH8A 1Z8IB 1O2UA 1A46H 5K7RA 2OP9A 1O3FA 4GCHG 1WQVH 2PKSB 2QYIA 3GY6A 3UUZA 1WUNH 2F9NA 1L1NA 4XE4A 1SPJA 1W7XH 2ZQ1A 1C2EA 1TB6H 2VVCA 3TLOA 1FY5A 1HXEH 1DICA 2BD5A 2ZFFH 4CR5A 5E8EH 4KP0A 3M3TA 2BVXH 3GOVB 2VINA 3MO3A 1X7AC 1C1MA 2F3CE 2O8LA 3C27B 1V2QT 2CHAC 1DOJA 3A86A 4FUGA 1S84A 4CH8B 2XTTB 4GVUA 1QRZA 1XVMA 2A2QH 1AUTC 2Y5HA 3MNXA 1IOEA 2R2MB 3TK6A 1UTPA 2NU3E 4TPIZ 3SZNA 4IN2A 1GI8B 3PMJA 1HLTH 2VIOA 4BAMB 1ZPZA 1T8OA 1O2XA 1OKXA 1ELBA 2QGRA 2VIPA 3BEFB 1O5GH 1SFIA 4ZUHA 3MHWU 3VEQB 5C3NA 1LHCH 4Y71A 2RCEA 5C2ZA 1ANBA 4CRGA 3H7OA 2TGPZ 3SU2A 1AY6H 3UNRA 4NWKA 2NU2E 4WVPE 2Y5GA 1Y3UA 1SGFG 1AU8A 2ZP0H 4F4OC 8KME2 3E16B 2THFB 2FTLE 1ARBA 2ZIQH 4X2WA 4ZKNU 1RXPA 2BXUH 3JZ1B 1D6WA 5T3HA 1SGCA 1SGRE 2FYQA 3DT0H 3GCNA 1EXFA 3RXLA 1V2WT 4ABHA 2IJOB 2PGBB 2VWLA 1N8OB 2WUCA 7GCHF 1O30A 3ENSB 3BTTE 3SGQE 3TK5A 4AORA 1RIWC 1L1JA 3OU0A 3HGNA 1OP2A 1LMWB 2ODPA 1NFWA 4OS4A 1O5BB 3M35A 2W3KA 4FU8A 2BQ6B 4DOQA 1BRBE 1JXPA 1J16A 1VITH 3QTOH 1QB9A 1DVAH 1TAWA 1W10U 1A4WH 3JZ2B 3QGNB 4DURA 2ZPSA 1LKBA 3V13A 1GVKB 3I29A 2PWXA 5DPAA 2P16A 2C8WB 1O5DH 3UNSA 1C1RA 4NWLA 5JBAS 4Y8ZA 2ANYA 3IWMA 3DHKH 4JMYA 4D9QA 4X1SU 1EP5A 5FPYA 3RU4D 2UWPA 4M7GA 3QTVH 5GPIB 1QL9A 4E05H 8GCHG 1S82A 1L0ZA 1NFYA 4O3UA 1TWXB 1C5PA 1JIRA 5LPEA 3FP8E 3U8OH 3UOUA 3FZZA 3IG6B 5C1YA 3VFEA 5DO4H 2ZECA 1UTMA 2ZDLA 1FY3A 1YLDA 1TA6A 4TY6A 1D4PB 5ETXA 1TPOA 2VIDA 5JDUB 2QXIA 1HAYB 1WU1A 3PV4A 4LOYH 1EZSC 1LQEA 3RU4E 3RMNH 3VB7A 1H1BA 1G36A 1P09A 2Z9GA 1ZHMA 1TX7A 1TGTA 5FAHA 2AIPA 1PYTC 3H5CB 2JETB 1MTWA 1Z6EA 3SJIA 4ISHH 4YLUA 4UD9H 1DANH 2GT8A 3ELAH 3SI3H 1EATA 3BTHE 1AFEH 1Y3XA 4GHQA 4H42U 3RXVA 2ZFPH 2G4TA 4K8YA 2Z3CA 3H7TA 1PPEE 1XXDA 2BDAA 3M5NA 1K21H 1OS8A 2R3YA 3GCHB 1C5NH 1LTOA 1MU6B 1TBRH 1OP0A 1RFNA 1O3HA 3SU1A 1LHDH 1M9UA 6CHAB 4INHA 1OOKB 3MH6A 1FQ3A 1O2RA 2A0QB 3MU0A 1ZMJA 1S81A 4B76A 1BTYA 2ZCLP 1UK3A 4ZHAA 3D23A 4AFQA 1BIOA 4BANB 4RKOB 4Y10E 4X1NU 1O3AA 1XUHA 1CT0E 2HLCA 3RXIA 1UCYK 2Z9KA 3KGPA 1Z1JA 3BTME 3EQ0H 2Y7ZA 4GUXA 1GI2A 1BQYA 1SG8B 1LCYA 4IMQA 1AWFH 1BUIA 2P8OC 1NT1A 1V2OT 3EYDA 1FZZA 1DT2A 4K1EA 4X1RU 2CN0H 1AFQB 4IW4E 2GT7A 1GG6B 4WWYA 2PUQH 1SQTA 1Z7KA 1C1QA 1O3CA 1V2LT 1XUGA 3SJ8A 4AX9H 1PJPA 3PMAB 3RXTA 2PKAA 1KLTA 5FX6A 1KSNA 1FY1A 1DUAA 3K9XB 1Y8TA 1QY6A 1MQ6A 4CRAA 1EP6A 5EG4A 3VB6A 1DWDH 1KXCA 3TH4H 4Q2KA 4R8TB 4DIIH 3RXMA 1GMCF 5C1UA 3GY3A 2ZU5A 3V0XA 3LT3A 3QZRA 3SORA 5DP4A 2WYJA 2ZCHP 1FAXA 1W0ZU 2J38A 1JBUH 4JYUH 1FAKH 5GWZA 1FN6A 2OBOA 3RMOH 3U9AH 1G3EA 2CJIA 2ZTXA 2BVSH 1O32A 1AN1E 1B0EA 1CBWC 3SU5A 2VVVA 1EZXC 1V2NT 2PUXB 3RUOA 1SLVB 3SUDA 2BYAX 1GCDA 1TE0A 1E34B 1LO6A 1DXPA 1ZSKA 1SMFE 2J2UA 2ASUB 2ZDNA 2G81E 5AFYH 1C5SA 1FY8E 2BDHA 1EB1H 5DP6A 1O3DA 1Y3VA 3HK6B 1W14U 1O2TA 4AFSA 5E0JA 4ZHMU 2H9EH 2XRCA 3ZVAA 1IAUA 1O31A 2XW9A 1E0FD 3UREA 4GCHF 1QBOA 5FPTA 1VCPA 3BEUA 1N6YA 1JMOH 1QRWA 2QXJA 1IQGA 3KF2A 1UTOA 4ABFA 3RC4A 1QIXB 1DM4B 4NZLA 1AHTH 1YP9A 1BITA 1ZGVA 1P12E 5ABWA 4X8TH 1C1OA 2Z9JA 2H5DA 1LPKB 4ZROA 4BAKB 3BTDE 3ZVFA 4MDSA 3SN8A 1WV7H 5A8YA 2AGGX 1K1LA 3KIDU 1L1GA 5JYIA 1EJNA 1L4DA 2WV4A 1SOTA 2BZAA 4X8UH 2Q6FA 3M37A 4CBNA 1TOCB 2STAE 2V3HH 1L2EA 2GV7A 3UWJH 2WPLS 4YT6H 5HM9A 3RXUA 4BAQB 1SC8U 2P8OB 2ZZUH 3ZZ3A 4MPWA 1RTKA 4DY7B 2BY9X 2J4IA 2GZ9A 1AI8H 5L30H 2IN2A 3K2UA 1BTPA 4WJG2 1FPCH 1FIWA 3GY7A 1G37A 2JH0D 2BHGA 1O3MA 3URDA 3M7UA 2DUCA 2FMJA 1HAPH 1HAVA 1QJ6B 3A82A 2TBSA 1SB1H 3T62A 4ABIA 1GI9B 1YM0A 3L33A 4RSPA 3T5FH 4YT7H 1F0RA 2IOTA 4YOJA 4ABBA 2F9PA 2SGFE 2PW8H 1MZAA 2FS9A 5GIBA 4HI3A 2FOFA 5IYTA 1ZHRA 1C5WB 3PROA 1W7GH 3SJ9A 4Y7AA 3SU6A 1GHAF 3SNCA 3ESTA 1O2IA 1V2ST 4WMEA 4NFEA 1EPTB 3B8JA 3KL6A 2QXGA 4B2CA 3MMGA 5EODA 1AVGH 3U98H 1FIZA 2LNCA 4HGCA 1J14A 2D26C 4Y0YE 2BTCE 4FVDA 1NRRH 2WINI 1MAYA 3S9BA 1A2CH 1OWIA 2ZWLH 1JIMA 2NU4E 3D62A 2J92A 1DLKB 1JOUB 1XUFA 3U69H 5HMAA 4LK4A 2EEKA 4A1TA 1UHBB 1BHXF 2EI6A 4ESTE 1FJSA 4WMDA 2Y6TA 2QF0A 5A09A 1C4Y2 1D9IA 2Z7FE 4KKDA 1GVLA 1KXEA 2WV5A 3O8DA 1YF4A 4Q7ZA 3QZQA 4ZKSU 4JYTA 1BRAA 2I6QA 1IQMA 6GCHF 3E0PB 3SNEA 3HKIB 1GMDF 3MNBA 3LONA 1O34A 4IMZA 2HNTC 1MTSA 1MKXH 1AZZA 3DA9B 3MU4A 1C2JA 2SGDE 4YOIA 1AQ7A 2W5EA 1CU1A 1XVOA 1CO7E 1GI0A 1DX5M 1P2KA 2F9UA 2QF3A 3ZZ4A 2XBWA 5BRRE 3MFJA 4X2XA 2HVXA 1KTSB 1OXGA 3LGTA 5E0HA 1GBHA 5AFZH 1AO5A 4E06H 1C5ZB 3P8NA 2BM2A 1IQNA 2BLQA 1BTWA 1BOQA 5TCCA 1PPGE 1TBQH 4O03A 1RS0A 1O33A 2JH5D 2P95A 2FZZA 1NPMA 1NN6A 3T27A 1P2OA 4ZKOU 2GCHG 3E90B 1SOZA 4H6SB 1W2KH 2GD4B 1VJAU 4NCYA 5DP8A 4ZH8A 5DJ7A 3SBKA 1DE7H 3E8LA 3PO1B 3K65B 3RXGA 1GJAB 2HOBA 4NA8A 4Z6AH 3ATIA 1SL3A 4THNH 4I8LA 1GI6A 2BLVA 2FIRH 5T6FA 4ZXYH 4Q7YA 3QLPH 1O5EH 5LPRA 9LPRA 2VIWA 1ZPCA 5J4SA 5A2MH 3SO3A 3ATLA 2SNWA 1GHYH 1BTXA 1C5RA 2AMQA 1WAYB 2J94A 4K2YA 1S0RA 3NZIA 1RIWB 2AGEX 1HUTH 4CREA 3LGWA 2P94A 3P70B 1AFQC 1SGYE 2ZDKA 4I8GA 1EZUC 1QQUA 3VGCB 1MTNC 4Z0KA 2ZGBH 1MCTA 1ZRKA 2G00A 3SGAE 1W13U 5GJ4B 1IHTH 2BDGA 2ESTE 2ZDVH 1GL0E 4D7FA 1GVZA 3BIVH 3F1SB 2ZTYA 2A4RA 1F92A 2GV6A 2A4QA 3LOXA 1VITF 4CH2B 4NIVA 2FI4E 3ZZCA 3ZZ8A 4INLA 3Q3KA 4U01A 1GL1A 1EAUA 4BNRA 2NU1E 2ZPRA 3TJNA 1QB1A 1ZGIA 1TPSA 3ZVCA 5EU8A 2XC4A 1A7SA 4E7NA 2FOGA 1HNEE 4K60A 3A88A 1MAXA 2ZFTA 1GHZA 3F9EA 4AGJA 1O2VA 2WYGA 2AYWA 1LQDB 1BHXB 2BD8A 1TRYA 3S7HB 2A4GA 3PLKA 3TGIE 2PTCE 1C1NA 1CHOF 1O2SA 2C90B 1O3BA 2FESH 1BB0B 3SV6A 4UFGH 1AKSA 2DE8A 2VIVA 5A8ZA 2C4FH 1TIOA 5AF9H 1K28D 1H9HE 1HJAB 3OY6U 4ABEA 4CRDA 2FOMB 2FYRA 1FY4A 1C5VA 2AMDA 2BXTH 1SGIB 1O38A 3F9FA 1MMJN 3UIRA 1ZMLA 3LH1A 4PROA 1TYNA 1KTTB 2ZEBA 1K1JA 4CHAB 5E2PA 1O2MA 1VITG 2A4OA 1B5GH 1CGJE 5CHAB 1EOLA 1V3XA 2A5IA 3SU0A 2TGTA 1E35B 3LH3A 3A7YA 1Y5AT 1W8BH 3QN7A 1T8NA 4Y8XA 1C5XB 3E1XB 4UDWH 1XXFA 1G32B 1MZDA 2R0KA 4MG3A 1BDAA 3LU9B 1O3OA 1SGTA 4KTCA 2HWLB 3UOPA 2HALA 4Y7BA 1FV9A 1K1MA 2ZA5A 2FS8A 3GISB 1GHWH 3SV2H 4AG2A 4K5ZA 2XBVA 3RC5A 3ZZ7A 2Z6BD 3L3TA 1CHOG 4INKA 2Y5FA 3GYLB 2D2DA 3GDVA 2ZGCA 4HZHA 3M5OA 4U32A 5EXNA 4B2BA 2G8TA 1CSOE 3D65E 1H4WA 5LH8A 1P3CA
chains in the Genus database with same CATH superfamily
1NESE 5F03A 1TPAE 1GI4A 1G2MA 3LGVA 3PMHB 4ASHA 3BG4C 3BTQE 2XBYA 3MU8A 4Z1MD 1GBFA 3RXHA 3GICB 4P02A 5FL7D 1ETTH 1SGNE 1V2UT 1TALA 1XUKA 3STIA 2D8WA 2GX4A 3A84A 3RXJA 1BMLA 3R3GB 2VGCC 1WCZA 4XSKU 1IQEA 1HV7A 2BX4A 2OC7A 1GBDA 2A45B 5T6GA 1O3EA 8LPRA 3NK8A 3A8BA 4Y79A 3AAVA 1E36B 2I6SA 3SHAH 1F2SE 5I25A 3B23B 5IDKA 1EOJA 1Q3XA 3T25A 2HRVA 1Y3YA 3MYWA 1GHBF 1HYLA 4Q4LA 1TX8A 5ESBA 1UTNA 1VZQH 4OM9A 2HNTE 2OC0A 3TNTA 1NROH 2M5TA 1TNKA 3BTEE 3DCLA 3MI4A 4UONA 4YM9A 3V7TA 5JB8S 2XCFA 1K2I1 3ZZ9A 1Z8RA 1HAVB 1QBVH 4TWWA 2YNBA 1SSXA 1D3QB 1GDUA 3SZEA 1GHAG 5EPNA 2H1UA 2A32A 2VH6A 1UTKA 1DY8A 1PPHE 1GJDB 1SVPA 4FUEA 1O36A 1THPB 3VXFH 1W11U 1QHRB 5EXLA 3N7EA 5GCHF 3KQDA 1DLEA 1W3CA 3VXEH 3Q00A 3C1KA 1YBWA 1BTUA 1WBGB 4I32A 1QR3E 1TBZH 1C2MA 3U1IB 3UNQA 1O2ZA 1IQFA 1DWEH 2P3FH 4NA7A 1RTFB 1H9IE 1SLUB 2BY8X 1TQ0B 1C2HA 2BOHB 3FKSD 5C0TA 2BQ7B 8ESTE 2BDBA 1C1PA 1GI1A 5FPSA 3LKWA 1IQJA 4K1SA 1MQ5A 3ATMA 1LPGB 4ASUD 2PR3A 2KCAA 3A7WA 2TPIZ 4O97A 3RXDA 1XKBC 1ZTKA 3PMBB 4MPUA 3A7XA 2FLRH 2B9LA 3A85A 1GBCA 4OS1A 1GHBG 3O8RA 3WWFA 2BD9A 1A5IA 5CMXH 4SGAE 1AD8H 2A5AA 4JZIA 3MWIU 3LGYA 4B1TA 1S5SA 3KQCA 2DE9A 3FP6E 4CRBA 2J5UA 4E7RG 4DT7B 1AIXH 4X8SH 1MTUA 1DUEA 3MTYA 3GCOA 4FUFA 4I8JA 4BOHA 4FXGH 4JK5A 3P8OA 1AWHB 1UMAH 1NM6A 2TIOA 1QTFA 1EAIA 2FOHA 3DUXH 1ZYOA 2EA3A 3M61U 2OQ5A 1A0HB 1HAGE 1THRH 3ZV9A 1GGDC 3F2FA 1BCUH 1AB9C 1QA7A 1Z8JB 1EAXA 1ELVA 1PPBH 3FAOA 5HYOA 4FU7A 5FHTA 5GCHG 1VCWA 1TABE 4IBLH 5LGOA 3F9GA 2F9VA 1J15A 3E91A 1J17T 1ELAA 2Y80A 1BJVA 1ABIH 3MNCA 1KDQA 5C20A 3KEEA 3PLBA 4D8NA 1JRSA 1VCQA 1TGNA 1UCYH 3Q76A 3S9CA 3P6ZB 3ZZAA 4FUJA 5A8XA 1V2PT 1YPHC 2P93A 4TYDA 1B0FA 3HPTB 1MBQA 1QCPA 2Z9IA 2PP6A 3UAIC 4NIWA 3GCTG 2PKSC 2HPPH 5JB9S 3DSPA 4B2AA 3SNBA 1GJ7B 1HRTH 3ZVBA 1S0QA 4FVBA 5EOKA 4XBBA 2WPKS 3RXAA 3W94A 1CA0C 1ELGA 1H9LB 1AVXA 4Y0ZE 2A7HA 2SGPE 3UR9A 3ZVDA 1G9IE 2ANMH 4BTIB 1DWCH 5GXPA 4ISNA 1TGSZ 3F6UH 3UWIA 2FI3E 2PTNA 7ESTE 2XWAA 1FXYA 2RDLA 3HATH 1D3DB 1EX3A 2UUKB 2GCTC 3TVJB 1T31A 3STJA 3T2NA 2GTBA 5HXFA 4JZEH 1ESTA 2AFQB 1EKBB 2SNVA 4QT8C 4Y8YA 2ILNA 3K6YA 2W7SA 1YGCH 1D6RA 1K1OA 1T8MA 4FUIA 2H5CA 3A80A 3AW0A 1LHEH 4NFFA 3ZVGA 3KQ5A 1CVWH 1GDNA 2RG3A 1QBNA 3KN2A 2EQNA 1TLDA 2KCPA 1DITH 3A87A 2Q6DA 1P3EA 1VR1H 1C5MD 1C1UH 3E6PH 3PTNA 3ZVEA 3WY8A 5JBCS 1P10A 3NRLA 1P06A 3E0NB 3ZYEA 1NZQH 2BLOA 3GDSA 4IC5A 4TT3D 1DWBH 1P03A 1C2GA 1BT7A 4ZKRU 3EA9A 1ANCA 3FZDA 1HAIH 1T8LA 1F5LA 1PQ8A 1CQQA 3GY8A 4I33A 5CE1A 3R0FA 1ARCA 4NA9H 1GBEA 3BTGE 1HFDA 3M3SA 3Q77A 4MNYA 2OD3B 1QL8A 5HIZA 5T1VA 4NGAH 4ACAA 4B73A 5DG6A 3KYFA 2HVYB 3ITIA 3SOSA 4GSOA 3I78A 2ZTZA 1TNIA 2ZGJA 2OXSA 1FNIA 1TNHA 1BMAA 2QV1A 4I8KA 3SHCH 5EQSA 1C9PA 1ZSJA 2JETC 3ODDA 4ISOA 4B74A 1F5KU 2ZO3H 1XUIA 3TPIZ 4MNXA 3UTUH 2LP6A 2HGTH 1L4ZA 3H09A 4XBDA 3KQBA 2WSSD 5FXLA 5EQQA 4TPYA 2F9BH 1YYY1 2FTMA 2BDYA 1WXRA 4RI0A 1AE5A 1U6QA 3RXPA 2YOLA 2BDCA 3GY4A 5EW2H 3U8RH 2EC9H 2GCHF 1FONA 3PTBA 2FOAA 1UTJA 2O8MA 1HJAC 3OAAD 1P9SA 1EUFA 2ZPQA 1SQRA 4NSYA 1S85A 9ESTA 1AE8H 2IPQX 1D3TB 1GJ8B 1LDTT 1Q2WA 1SGQE 2PHBA 2KR7A 3N99A 1Z1IA 2XOKD 1P2JA 3ZV8A 2C3SA 4WF8A 2ZCKP 1AGJA 2SGEE 3GYMA 1INCA 1ZZZA 3A8DA 3I77A 4Q80A 3W1EA 5A0BA 1WSSH 4BXWA 3QK1A 1FI8A 2P3TB 2PSXA 1CE5A 2O9QA 1W0KD 4OS5A 4HG6A 1PFXC 1PPCE 1ZSLA 2FWWA 2RA3A 4O9VA 1V2KT 4M9FA 1E37B 2JJ1D 4YOGA 1ZOMA 1N6XA 1YCPM 3P95A 1MTVA 1P02A 4AG1A 1ELCA 3DFJA 3NUMA 4LZ1H 4GLYA 3P8FA 1G3CA 1HB0B 5F53A 2QXHA 1G30B 1FLEE 2GZ8A 2J9NA 2XC0A 1KLJH 2W6JD 5FX5A 2VU8E 3TJUA 1C5QA 1HJ9A 2ODYB 1P05A 4XBCA 5C1XA 1AKSB 1C4U2 1PQAA 2GVFA 3M36A 2ZU3A 3QDZB 1T4VH 4H6TA 2FXRA 4VGCB 5EW1H 3BTKE 3Q3XA 3RXFA 1IQIA 1MUEB 2CV3A 2NU0E 1HBTH 4BAHB 2CF9H 3F2GA 3QUMP 1NS3A 3A7ZA 5C5OA 1O35A 2Y82A 2ZDAH 2NWNA 1QNJA 1TMUH 2QAAA 1UTQA 1YY3A 1YPEH 1A1RA 4FUDA 3DSGA 1ID5H 2ZGHA 3UB0A 2BX3A 3UQOA 1O2OA 3VB3A 2ODQA 1UVPA 3M7TA 3BG8A 2KFWA 1CT2E 2GMTC 4X2YA 1HGTH 1IQKA 3HKJB 4XRNA 4X0WU 2BMGB 4NSVA 4X6PA 1NBMD 1NFUA 4B75A 1SGDE 1FDPA 1FN8A 3ATKA 2O8UA 4X6NA 1J9CH 3BEIB 1E1RD 1P2IA 5C17A 4CRCA 4D76A 3DD2H 1S6FA 1O2HA 2ZNKH 1ZRBA 5L2ZH 1LVMA 1ZR0A 2A2XH 1ZHPA 1P2QA 5ESTE 1O3LA 4AB8A 5DP9A 4CBOA 1WYKA 2XXLA 3MNSA 3PM3A 5HIYA 2UUFB 4AYYB 5F8TA 1P2MA 2W6ID 3L6PA 4WXVA 4MLFB 7LPRA 1MKWK 2BVRH 4XD7D 1GMCG 1NTPA 1UJ1A 4DGJA 1KXFA 1DSUA 2GMTB 2ZGXH 1XUJA 5EGMA 3AAUA 3KYGA 1AB9B 1TA2A 3OTJE 5AHGH 1H8DH 2QY0B 2BD2A 3TIUA 4X1QU 4ABDA 3F0OA 3BTWE 5L2YH 2J95A 1QRXA 1SLXB 2C8YB 3GCHC 1O5AB 3RLWH 1HAZB 1J8AA 2VGCB 4IS5A 5L6NH 1LKAA 1O2NA 1Y3WA 4CR9A 1FMGA 2ZDMA 4TWYA 4Y6DA 1H8IH 1TNLA 4ZAEA 1O2QA 1C2LA 4WXIA 2OK5A 2GDEH 2GKVE 1QJ1B 3LPRA 5FBEA 4WY3A 1JWTA 1CA8B 1H8HD 5TCAA 1BBRE 2WPIS 1KDQB 2FX4A 4AZ2B 1UVTH 3RXKA 1G2LA 1DXWA 1GGDB 3SJKA 4X6OA 4OS6A 2VIQA 3TGKE 3HGPA 1P9UA 2JJ2D 1ZMNA 1NRQH 4LXBH 1B7XB 1HCGA 2OC8A 4RKJB 3QX5H 3S69A 1K9OE 2GCTB 3ODFA 1WQSA 1QL7A 2WPHS 3EA7A 1TNGA 3RU4T 2AEIH 4XOJA 4ISLA 3F9HA 4K8BA 1UHBA 3TITA 5JPMH 3LC5A 1SGEE 3ZIAD 5KEDA 1ORFA 1A5GH 1CGHA 2AH4X 1T7CA 2R0LA 2C93B 4B71A 1A0LA 3MU5A 1O0DH 3PWBA 4HTCH 4ZHLU 1A61H 2F9OA 1C2IA 2B8OH 2OTVA 3V12A 3LC3A 4UFDH 4DCDA 4OS7A 1BZXE 1LHFH 2AIQA 2R9PA 2H6MA 3NPSA 1NY22 1OWJA 2PFEA 2ULLA 5C67A 3GY5A 1YLNA 1Y5UT 2TGAA 2FLBH 3P17H 4JZDH 4RN6A 1VGCC 1GI5A 3TNSA 1BRUP 3HK3B 1WTHD 3FP7E 2ZU4A 2QIQA 5LPFA 1GJ6A 1BMFD 3BG4B 2UWLA 3M5LA 4AFUA 1RRKA 4UFEH 4IGDA 3VB4A 1EJMA 4AB9A 6ESTA 1NRNH 2BLWA 1NFXA 5HGGA 3T28A 1LVBA 1QFKH 1ELTA 5PTPA 2QCYA 3CP7A 1LVOA 1SGPE 2VNTA 1SI5H 2G5VA 5SGAE 4DT4A 1SLWB 2J34A 3EGKH 3GDUA 3P8GA 2KAIA 2FOEA 3MQKC 1MBMA 5EPYA 4WMFA 1K1NA 1GJ5H 1CHGA 1P57B 4R0IA 3K6ZA 4WH6A 4U30A 2G4UA 5DK1A 5B6OA 4GPGA 4FUBA 4K1TA 3FN8A 4MQAA 1V2TT 3A8CA 1O3IA 1IQHA 4X2VA 4NZQA 1GCTC 2OQUA 4OGXA 1GJCB 1WTGH 4DG4A 3AVZA 5DGJA 1GBKA 3BSQA 4BXSA 2WHXA 4JZ1A 1C5UA 1NC6A 3UY9A 2PSYA 1C9TA 1C5LH 1MH0A 1G3BA 1YCPK 2A7JA 3AASA 1TOMH 1OYQA 1ZTJA 5GDSH 3TK9A 1OWHA 1BMMH 2WUBA 3QWCH 2BOKA 4K3JA 1BMNH 2V6NA 3KNXA 1MKXK 4ISIH 2AMPA 5EXMA 4OS2A 5EJ1A 2SFAA 2A1DB 1GI3A 3RMLH 1C1TA 1O2GH 2D1JA 3VB5A 1GI7B 4KELA 1CBWB 1OSSA 5F6MA 3T29A 3N7DA 6CHAC 3TU7H 1YPMH 2UUJB 3KCGH 1UTLM 3T26A 1LPZB 1A0JA 2KAIB 3MH5A 3O8CA 1O3KA 4MNWA 1GMDG 4ZXXH 1TRMA 2H2ZA 3KQEA 3N7OA 3SGBE 2RDEA 1NU7B 1GBIA 1F5RA 1FPHH 3SV9A 2ANKH 3LGIA 2LPRA 4KGAA 4Y11E 5FCRA 1K1PA 2ZFSA 3S7KB 4B6EA 1XM1A 3FVFB 3UPEA 1TGCA 2R3UA 1NRPH 2VWMA 2ZU2A 1NRSH 4AC9A 1QGFA 1UK4A 1KY9A 2ZHFH 4A6LA 3BIUH 3OX7U 1EQ9A 2VWNA 4JYVH 4DJZB 3M5MA 1GG6C 1YLCA 2VJ1A 2ZHWH 3DFLA 5F8XA 1MD7A 3MO9A 1ZLRA 2BD7A 3PRDA 1BTZA 3RM0H 1EJAA 4MPXA 1MD8A 3U8TH 1AUJA 1ESBA 1QA0A 1TPPA 2FM2A 1GMHG 1O5CB 3F0PA 5F8ZA 7GCHG 1KXAA 3M7QA 1PYTD 4X8VH 2VWOA 1PPFE 2BB4A 1P01A 1P11E 1DFPA 1P04A 3BN9A 3A8AA 1HIAB 3TGJE 1GJ9B 3SQHE 2W3IA 1RJXB 1CA0B 2VB0A 1TX6A 3A83A 4LZ4B 1ETRH 1C5YB 4FUHA 1NU9A 3SJOA 3SV7A 1GBMA 3UFAA 2PV9B 2ANWA 2FOBA 3AK5A 1G3DA 3ZZDA 2CGAA 1S6HA 1SQOA 1O3NA 1GWAA 3MOCA 1BA8B 3DSOA 4OGYA 5AVDA 2VBCA 3SQEE 1GCTB 2FOCA 4AGKA 2V7QD 3RXQA 3RXSA 5FCKA 2BZ6H 1XX9A 1YKTA 5I46H 1HPGA 5DP5A 2CXVA 1KIGH 5DP3A 2F43B 1O2WA 7KMEH 3F2HA 1O5FH 3OYPA 1DPOA 1HJ8A 2P3UB 3SI4H 1P2NA 1EASA 3PLPA 1D3PB 4TY7A 1Z71A 2Q1JA 1SR5C 5CHAC 2WPMS 1PQ5A 4Y76A 1GDQA 2XC5A 3ZZ5A 1Z8GA 3EE7A 1GMHF 3CENA 5A0AE 2FDAA 2BY5X 4ZMAH 1SBWA 3VGCC 3SUFA 1TFXA 1GBAA 2Q6GA 1N1LA 1O3PB 1QB6A 2B7DH 3SNAA 2QF5A 1A3BH 1OYTH 3RMMH 4MTBA 2V3OH 1K1IA 3RP2A 1C1SA 1O3GA 1PPZA 4JCNA 1F0SA 1F0UA 3WWBA 2G51A 2XBXA 2A5KA 4A7IB 2W26A 4CRFA 3RDZA 1IQLA 3RXOA 1KXDA 2ZG0H 5DP7A 3SV8A 4AOQA 2V3MA 2H9HA 2G5NA 2Y7XA 5EJLA 4MNVA 2ALVA 1HAHH 1T4UH 1SHHB 3SU4A 3LIWA 1C2FA 3PO1C 4AYVB 3SUEA 1GJBB 1BRCE 1YPGH 3RXRA 3MU1A 1C2KA 2O8TA 4BTTB 4ABJA 2XWBI 3EAJA 2CHAB 1HDTH 3NCLA 2WPJS 1C1WH 2OBQA 4MVNA 4IN1A 2F91A 2IPHA 4GHTA 2GP9B 4Q7XA 1S83A 2PLXA 3NKKA 3OSYA 1BJUA 4AFZA 4YZUA 3BTFE 1UK2A 4ACBA 2VH0A 2JH6D 3M3VA 1HXFH 1V2VT 1O3JA 2ZHDA 2FPZA 3CS0A 1A5HA 1ETSH 1EZQA 4U2WA 1ZTLA 1TGBA 2Z9LA 3RLYH 3SU3A 3S9AA 4I8HA 1GJ4H 2ZF0H 2Z3DA 1OX1A 2BY6X 2FI5E 1AVWA 1F7ZA 1TMBH 2HPQH 2Z3EA 3FFGA 3UR6A 3U28C 4A92A 1QQ4A 2C8XB 4YO9A 3ZZ6A 1GHVH 2GZ7A 3ZZBA 3TJVA 6LPRA 2H9TH 3EDXB 3SUGA 1MCVA 4DW2U 8GCHF 1DSTA 1C2DA 3LGUA 2V35A 1UCYE 1XMNB 4A1VA 1PQ7A 1LVYA 3KHVA 1ESAA 1Q31A 4AN7A 1CT4E 1NO9H 1SGFA 3RXBA 2G52A 1AMHA 1OPHB 1TMTH 2FEQH 2QA9E 1ABJH 1YPJH 4NIYA 4UEHH 1YPHE 3A81A 4VGCC 4NIXA 1F0TA 3NWUA 4YLQH 2XNIA 4SGBE 5HM2A 1ZJKA 3ZYDA 1SFQB 2G55A 1ELDE 2K0QA 3RM2H 4DIHH 3U1JB 4YESB 1XKAC 1LHGH 5DSFA 3QO6A 5A0CA 2C8ZB 2XYAA 4XDEA 1COWD 1DY9A 3O8BA 2R2WU 3QGJA 4H4FA 5H4IB 2TRMA 2OUAA 3ATWA 4A5TS 1CGIE 4ABAA 1OWDA 4A1XA 2ZQ2A 1MTNB 1MKWH 2WZQA 3PB1E 2ZC9H 2ZFRH 3BV9B 4K69A 1IHSH 4ABGA 1YC0A 2O8WA 2BQWB 3F68H 2FO9A 3A7TA 5TJXA 1V2MT 1BBRK 2PGQB 5C5NA 1ANDA 5E0GA 1VJ9U 2STBE 1ZJDA 2L74A 1UVSH 2QC2A 2UUYA 4X6MA 2K1QA 1UO6A 1O2PA 1JRTA 2Y81A 2B0FA 1O2JA 2CMYA 2FP7B 2V0BA 1GPZA 1O2KA 2BD4A 1GBJA 2PKAB 3A7VA 1OWKA 2AS9A 4FOUC 4I31A 2P59A 5T6DA 3SW2B 1ELEE 2SGQE 2Z94A 4UE7H 1V2RT 4UFFH 1TNJA 2ZHQH 3D49H 2AERH 4KTUA 2QE7D 1MU8B 3Q3YA 2F83A 5JBBS 2GGVB 1ACBE 1GBBA 1THSH 1VGCB 1AZ8A 4J1YA 2XCNA 3TH3H 1EPTA 4FUCA 1C5OH 1BTHH 4JK6A 4X1PU 1A3EH 1DS2E 1W0YH 2ALPA 1HAOH 1KXBA 2YMSC 1YPKH 3EE0B 5DKMA 2OINA 1N8OC 5G4BA 3AW1A 3BF6H 1RD3B 2AGIX 2ZFQH 4J2YB 3G01A 1EPTC 1YPLH 2EI7A 3FANA 1MABB 1YCPH 1KLIH 3NXPA 1UVUH 2JKHA 2UWOA 2EI8A 2ZU1A 2A31A 3MH7A 1C1VH 1ELFA 5FBIA 5E2OA 1OP8A 3TH2H 4FU9A 1O39A 1ZPBA 4HFPB 3RC6A 5IK2D 5K0HA 1SQAA 1NBME 2ZKSA 5JBTA 3TJOA 4NG9H 2QN5T 5B6LA 3LJJA 1E38B 1GBLA 1P0SH 5BPEA 4GAWA 3OY5U 2ZI2H 4XFQA 2BY7X 2OC1A 3PYHA 3URCA 2RA0A 3E3TA 1EB2A 4BAOB 1SHYA 2HLDD 2W7UA 3UQVA 1O2LA 4F49A 1QJ7B 1Y59T 2GDDA 4I7YH 1TRNA 2BD3A 1C4V2 1UVOA 1BBRH 1HIAA 4I86A 2SGAA 3EA8A 2A7CA 1C5TA 1V2JT 3RXEA 1TQ7B 1QURH 3IITA 2YNAA 2FODA 1S6LA 3P92A 3LJOA 1WOFA 4DVAU 2WPDD 5J4QA 1EAWA 3B9FH 4CHAC 3S0NA 3VPKA 1O37A 2TGDA 1HAXB 2HNTF 1GBTA 1ANEA 1Y5BT 2CF8H 2VVUA 3SNDA 1O2YA 1Z6JH 4D7GA 5EQRA 2FX6A 4MPVA 3RXCA 2KCYA 4IC6A 5EJZA 2QF4A 1OWEA 1DDJA 3PWCA 1K22H 1TONA 3GY2A 2OCVB 4O3TA 1FX0B 1W12U 2BDIA 4JZFH 3A89A 2ZHEH 3CS7A 4YTAA 4KTSA 2OLGA 3W95A 1FUJA 1KYNA 1RTLA 3MH4A 3LDXH 1V6DA 4RT0A 1P8VC 3V3MA 3GCTF 2XNDD 3MO6A 2B5TB 1T32A 4D9RA 1GHXH 1RGQA 6GCHG 4WH8A 1Z8IB 1O2UA 1A46H 5K7RA 2OP9A 1O3FA 4GCHG 1WQVH 2PKSB 2QYIA 3GY6A 4P00A 3UUZA 1WUNH 2F9NA 4BTUB 1L1NA 1YWUA 4XE4A 1SPJA 1W7XH 2ZQ1A 2YMSB 1C2EA 1TB6H 2VVCA 3TLOA 1FY5A 1HXEH 1DICA 2BD5A 2ZFFH 3F3BA 4CR5A 5E8EH 4KP0A 3M3TA 2BVXH 3GOVB 2VINA 3MO3A 1X7AC 1C1MA 2F3CE 2O8LA 3C27B 1V2QT 2CHAC 1DOJA 3A86A 4FUGA 1S84A 4CH8B 2XTTB 4GVUA 1QRZA 1XVMA 2A2QH 1AUTC 2Y5HA 2KCOA 3MNXA 1IOEA 2R2MB 3TK6A 1UTPA 2NU3E 4TPIZ 3SZNA 4IN2A 1GI8B 3PMJA 1HLTH 2VIOA 4BAMB 1ZPZA 1T8OA 1O2XA 1OKXA 1ELBA 2QGRA 2VIPA 3BEFB 1O5GH 1SFIA 4ZUHA 3MHWU 3VEQB 5C3NA 1LHCH 4Y71A 2RCEA 5C2ZA 1ANBA 4CRGA 3H7OA 3PV2A 2TGPZ 3SU2A 1AY6H 3UNRA 4NWKA 4F48B 2NU2E 4WVPE 2Y5GA 1Y3UA 1SGFG 1AU8A 2ZP0H 4F4OC 8KME2 3E16B 2THFB 2FTLE 1ARBA 2ZIQH 4X2WA 4ZKNU 1RXPA 2BXUH 3JZ1B 1D6WA 5T3HA 1SGCA 1SGRE 2FYQA 3DT0H 3GCNA 1EXFA 3RXLA 1V2WT 4ABHA 2IJOB 2PGBB 2VWLA 1N8OB 2WUCA 7GCHF 1O30A 3ENSB 3OEHD 3BTTE 3SGQE 4Q63A 3TK5A 4AORA 1RIWC 1L1JA 3OU0A 3HGNA 1OP2A 1LMWB 2ODPA 1NFWA 4OS4A 1O5BB 3M35A 2W3KA 3OEED 4FU8A 2BQ6B 4DOQA 1BRBE 1JXPA 1J16A 1VITH 3QTOH 1QB9A 1DVAH 1TAWA 1W10U 1A4WH 3JZ2B 3QGNB 4DURA 2ZPSA 1LKBA 3V13A 1GVKB 3I29A 2PWXA 5DPAA 2P16A 2C8WB 1O5DH 3UNSA 1C1RA 4NWLA 5JBAS 4Y8ZA 2ANYA 3IWMA 3DHKH 4JMYA 4D9QA 4X1SU 1EP5A 5FPYA 3RU4D 2UWPA 4M7GA 3QTVH 5GPIB 1QL9A 4E05H 3OTPA 8GCHG 1S82A 1L0ZA 1NFYA 4O3UA 1TWXB 1C5PA 1JIRA 4FETA 3FP8E 5LPEA 3U8OH 3UOUA 3FZZA 3IG6B 5C1YA 3VFEA 5DO4H 2IJD1 2ZECA 1UTMA 2ZDLA 1FY3A 1YLDA 1TA6A 4TY6A 1D4PB 5ETXA 1TPOA 2VIDA 5JDUB 2QXIA 1HAYB 1WU1A 1VKYA 3PV4A 4LOYH 1EZSC 1LQEA 3RU4E 3RMNH 3VB7A 1H1BA 1G36A 1P09A 2Z9GA 1EFRD 1ZHMA 1TX7A 1TGTA 5FAHA 2AIPA 1PYTC 3H5CB 2JETB 1MTWA 1Z6EA 3SJIA 4ISHH 4YLUA 4UD9H 1DANH 2GT8A 3ELAH 3SI3H 1OHHD 1EATA 3BTHE 1AFEH 1Y3XA 4GHQA 4H42U 3RXVA 2ZFPH 2G4TA 4K8YA 2Z3CA 3H7TA 1PPEE 1XXDA 2BDAA 3M5NA 1K21H 1OS8A 2R3YA 3GCHB 1C5NH 1LTOA 1MU6B 2AHME 1TBRH 1UW7A 1OP0A 1RFNA 2KZ4A 1O3HA 3SU1A 1LHDH 1M9UA 6CHAB 4INHA 1OOKB 3MH6A 1FQ3A 1O2RA 2A0QB 3MU0A 1ZMJA 1S81A 4B76A 1BTYA 2ZCLP 1UK3A 4ZHAA 3D23A 4AFQA 1BIOA 4BANB 4RKOB 4Y10E 4X1NU 1O3AA 1XUHA 1CT0E 2HLCA 3RXIA 1UCYK 2Z9KA 3KGPA 1Z1JA 3BTME 3EQ0H 2Y7ZA 4GUXA 1GI2A 1BQYA 1SG8B 1LCYA 2JDID 1AWFH 4IMQA 1BUIA 2P8OC 1NT1A 2KM0A 1V2OT 3EYDA 1FZZA 1DT2A 4K1EA 4X1RU 2CN0H 1AFQB 4IW4E 2GT7A 1GG6B 4WWYA 2PUQH 1SQTA 1Z7KA 1C1QA 1O3CA 1V2LT 1XUGA 3SJ8A 4AX9H 1PJPA 1E1QD 3PMAB 3RXTA 2CK3D 2PKAA 1KLTA 5FX6A 1KSNA 1FY1A 1DUAA 2LELA 3K9XB 1Y8TA 1QY6A 1MQ6A 2GJGA 1QZ8A 4CRAA 1EP6A 5EG4A 3VB6A 1DWDH 1KXCA 3TH4H 4Q2KA 4R8TB 4DIIH 3RXMA 5C0UA 1GMCF 5C1UA 3GY3A 2ZU5A 3V0XA 3LT3A 3QZRA 3SORA 5DP4A 2WYJA 2ZCHP 1FAXA 1W0ZU 2J38A 1JBUH 4JYUH 1FAKH 5GWZA 1FN6A 2OBOA 3RMOH 3U9AH 1G3EA 2CJIA 2ZTXA 2WV9A 2BVSH 1O32A 1AN1E 1B0EA 1CBWC 3SU5A 2VVVA 1EZXC 1V2NT 2PUXB 3RUOA 1SLVB 3SUDA 2BYAX 1GCDA 1TE0A 1E34B 1LO6A 1DXPA 4ZCNA 2F4LA 1ZSKA 1SMFE 2J2UA 2ASUB 2ZDNA 3GS9A 4TSFD 2G81E 1K0HA 5AFYH 1C5SA 1FY8E 2BDHA 1EB1H 5DP6A 1O3DA 1Y3VA 2K8IA 3HK6B 1W14U 1O2TA 4AFSA 5E0JA 4ZHMU 2H9EH 2JIZD 2XRCA 3PRBA 3ZVAA 1IAUA 1O31A 2XW9A 1E0FD 3UREA 4GCHF 5C94A 1QBOA 5FPTA 1VCPA 3BEUA 1N6YA 1JMOH 1QRWA 2QXJA 1IQGA 3KF2A 1UTOA 4ABFA 3RC4A 1QIXB 1DM4B 4NZLA 1AHTH 1YP9A 1BITA 1ZGVA 1P12E 5ABWA 4X8TH 1C1OA 2Z9JA 2H5DA 1LPKB 4ZROA 4BAKB 3BTDE 3ZVFA 4MDSA 3SN8A 1WV7H 5A8YA 2AGGX 5KECA 1K1LA 3KIDU 1L1GA 5JYIA 1EJNA 1L4DA 1SOTA 2BZAA 2WV4A 4X8UH 2Q6FA 3M37A 4CBNA 1TOCB 2STAE 2V3HH 1L2EA 2GV7A 3UWJH 2WPLS 4YT6H 5HM9A 3RXUA 1WDIA 4BAQB 1SC8U 2P8OB 2ZZUH 3ZZ3A 4YXWD 4MPWA 1RTKA 4DY7B 2BY9X 2J4IA 3CNRA 2GZ9A 1AI8H 5L30H 2IN2A 3K2UA 1BTPA 4WJG2 1FPCH 1FIWA 3GY7A 1G37A 2JH0D 2BHGA 1O3MA 2J97A 3URDA 3M7UA 2DUCA 2L6OA 2FMJA 1HAPH 1HAVA 1QJ6B 3A82A 2TBSA 1SB1H 3T62A 4ABIA 1GI9B 1YM0A 3L33A 4RSPA 2M2AA 3T5FH 5CHBA 1F0RA 4YT7H 2IOTA 4YOJA 4ABBA 2F9PA 2SGFE 2PW8H 1MZAA 2FS9A 5GIBA 1W0JD 2FOFA 4HI3A 5IYTA 1ZHRA 1C5WB 5DN6D 3PROA 1W7GH 3SJ9A 4Y7AA 3SU6A 1GHAF 3SNCA 3ESTA 1O2IA 1V2ST 1KMHB 4WMEA 4NFEA 1EPTB 3B8JA 3KL6A 2QXGA 4B2CA 3MMGA 5KGOA 5EODA 1AVGH 3U98H 1FIZA 2LNCA 4HGCA 1J14A 2D26C 4Y0YE 2BTCE 4FVDA 1NRRH 2WINI 1MAYA 3S9BA 1A2CH 1OWIA 2ZWLH 1JIMA 2NU4E 3D62A 2J92A 1DLKB 1JOUB 1XUFA 3SYJA 3U69H 5HMAA 4LK4A 2EEKA 2KX4A 4A1TA 1UHBB 1BHXF 2EI6A 4ESTE 1FJSA 4WMDA 2Y6TA 2QF0A 5A09A 1C4Y2 1D9IA 2Z7FE 4KKDA 1GVLA 1KXEA 2WV5A 3O8DA 1YF4A 4Q7ZA 3QZQA 4ZKSU 4JYTA 1BRAA 2I6QA 1IQMA 6GCHF 3E0PB 3SNEA 3HKIB 1GMDF 3MNBA 2J98B 3LONA 1O34A 4IMZA 2HNTC 1MTSA 1MKXH 1AZZA 3DA9B 3MU4A 1C2JA 2SGDE 4YOIA 1AQ7A 2W5EA 1CU1A 1XVOA 1CO7E 1GI0A 1DX5M 1P2KA 2F9UA 2QF3A 3ZZ4A 2XBWA 5BRRE 3MFJA 3PV5A 4X2XA 2HVXA 1KTSB 1OXGA 3LGTA 5E0HA 1GBHA 5AFZH 1AO5A 4E06H 1C5ZB 3P8NA 2BM2A 5HKKD 3VG8A 1IQNA 3FO8D 2BLQA 1BTWA 1BOQA 5TCCA 1PPGE 1TBQH 4O03A 1RS0A 1O33A 2JH5D 2P95A 2FZZA 1NPMA 1NN6A 3T27A 1P2OA 4ZKOU 2GCHG 3E90B 1SOZA 4H6SB 1W2KH 2GD4B 1VJAU 4NCYA 5DP8A 4ZH8A 5DJ7A 3SBKA 1DE7H 3E8LA 3PO1B 3K65B 3RXGA 1GJAB 2HOBA 4NA8A 4Z6AH 3ATIA 1SL3A 4THNH 4I8LA 1GI6A 2BLVA 2FIRH 5T6FA 4ZXYH 4Q7YA 3QLPH 1O5EH 1H8ED 4RT1A 5LPRA 9LPRA 2VIWA 5CDFE 1ZPCA 5J4SA 5A2MH 3SO3A 3ATLA 2SNWA 1GHYH 1BTXA 2J98A 1C5RA 2AMQA 1WAYB 2J94A 4K2YA 1S0RA 3NZIA 1RIWB 2AGEX 1HUTH 4CREA 3LGWA 2P94A 3P70B 1AFQC 1SGYE 2ZDKA 4I8GA 1EZUC 1QQUA 3VGCB 1MTNC 4Z0KA 2ZGBH 1MCTA 1ZRKA 2G00A 3SGAE 1W13U 5GJ4B 1IHTH 2BDGA 2ESTE 2ZDVH 1GL0E 4D7FA 1GVZA 5EIYA 3BIVH 3F1SB 2ZTYA 2A4RA 1F92A 2GV6A 2A4QA 4B6FA 3LOXA 1VITF 4CH2B 4NIVA 2FI4E 3ZZCA 3ZZ8A 4INLA 3Q3KA 4U01A 1GL1A 1EAUA 4BNRA 2NU1E 2ZPRA 3TJNA 1QB1A 1ZGIA 1TPSA 3ZVCA 5EU8A 2XC4A 1A7SA 4E7NA 2FOGA 1HNEE 4K60A 3A88A 1MAXA 2ZFTA 1GHZA 3F9EA 4AGJA 1O2VA 2WYGA 2AYWA 1LQDB 2YMSD 1BHXB 2BD8A 1TRYA 3S7HB 2A4GA 3PLKA 3TGIE 2PTCE 1C1NA 1CHOF 1O2SA 2C90B 1O3BA 2FESH 1BB0B 3SV6A 4UFGH 1AKSA 2DE8A 2VIVA 1E79D 2RFKC 5A8ZA 4F55A 2C4FH 1TIOA 5AF9H 1K28D 1H9HE 1HJAB 3OY6U 3OE7D 4ABEA 4CRDA 2FOMB 2FYRA 1FY4A 1C5VA 2AMDA 2BXTH 1SGIB 1O38A 3F9FA 1MMJN 3UIRA 1ZMLA 3LH1A 4PROA 1TYNA 1KTTB 2ZEBA 1K1JA 4CHAB 5GNDA 5E2PA 1O2MA 1VITG 2A4OA 1B5GH 1CGJE 5CHAB 1EOLA 1V3XA 2A5IA 3SU0A 2TGTA 1E35B 3LH3A 3A7YA 1Y5AT 1W8BH 3QN7A 1T8NA 4Y8XA 1C5XB 3E1XB 4UDWH 2EY4C 1XXFA 1G32B 1MZDA 2R0KA 4MG3A 1BDAA 3LU9B 1O3OA 1SGTA 4KTCA 2HWLB 3UOPA 2HALA 4Y7BA 1FV9A 1K1MA 2ZA5A 2FS8A 3GISB 1GHWH 3SV2H 4AG2A 4K5ZA 3OFND 2XBVA 3RC5A 3WW7A 3ZZ7A 2Z6BD 3L3TA 1CHOG 4INKA 2Y5FA 3GYLB 2D2DA 3GDVA 2ZGCA 4HZHA 3FOAA 3M5OA 4U32A 5EXNA 4B2BA 2G8TA 1CSOE 3D65E 1H4WA 1SKYE 5LH8A 1P3CA
chains in the Genus database with same CATH topology
1NESE 5F03A 1TPAE 1GI4A 1G2MA 3LGVA 3PMHB 4ASHA 3BG4C 3BTQE 2XBYA 3MU8A 1GBFA 3RXHA 3GICB 1ETTH 1SGNE 1V2UT 1TALA 1XUKA 3STIA 2D8WA 2GX4A 3A84A 3RXJA 1BMLA 3R3GB 2VGCC 1WCZA 4XSKU 1IQEA 1HV7A 2BX4A 2OC7A 1GBDA 2A45B 5T6GA 1O3EA 8LPRA 3NK8A 3A8BA 4Y79A 3AAVA 1E36B 2I6SA 3SHAH 1F2SE 5I25A 3B23B 5IDKA 1EOJA 1Q3XA 3T25A 2HRVA 1Y3YA 3MYWA 1GHBF 1HYLA 1TX8A 5ESBA 1UTNA 1VZQH 2HNTE 2OC0A 3TNTA 1NROH 2M5TA 1TNKA 3BTEE 3MI4A 4UONA 4YM9A 3V7TA 5JB8S 2XCFA 1K2I1 3ZZ9A 1Z8RA 1HAVB 1QBVH 4TWWA 2YNBA 1SSXA 1D3QB 1GDUA 1GHAG 5EPNA 2H1UA 2A32A 2VH6A 1UTKA 1DY8A 1PPHE 1GJDB 1SVPA 4FUEA 1O36A 1THPB 3VXFH 1W11U 1QHRB 5EXLA 5GCHF 3KQDA 1DLEA 1W3CA 3VXEH 3Q00A 3C1KA 1YBWA 1BTUA 1WBGB 4I32A 1QR3E 1TBZH 1C2MA 3U1IB 3UNQA 1O2ZA 1IQFA 1DWEH 2P3FH 4NA7A 1RTFB 1H9IE 1SLUB 2BY8X 1TQ0B 1C2HA 2BOHB 2BQ7B 8ESTE 2BDBA 1C1PA 1GI1A 5FPSA 3LKWA 1IQJA 4K1SA 1MQ5A 3ATMA 1LPGB 2PR3A 3A7WA 2TPIZ 4O97A 3RXDA 1XKBC 1ZTKA 3PMBB 4MPUA 3A7XA 2FLRH 2B9LA 3A85A 1GBCA 4OS1A 1GHBG 3O8RA 2BD9A 1A5IA 5CMXH 4SGAE 1AD8H 2A5AA 4JZIA 3MWIU 3LGYA 4B1TA 1S5SA 3KQCA 2DE9A 3FP6E 4CRBA 4E7RG 4DT7B 1AIXH 4X8SH 1MTUA 1DUEA 3MTYA 3GCOA 4FUFA 4I8JA 4BOHA 4FXGH 4JK5A 3P8OA 1AWHB 1UMAH 1NM6A 2TIOA 1QTFA 1EAIA 2FOHA 3DUXH 1ZYOA 2EA3A 3M61U 2OQ5A 1A0HB 1HAGE 1THRH 3ZV9A 1GGDC 1BCUH 1AB9C 1QA7A 1Z8JB 1EAXA 1ELVA 1PPBH 3FAOA 5HYOA 4FU7A 5FHTA 5GCHG 1VCWA 1TABE 4IBLH 5LGOA 3F9GA 2F9VA 1J15A 3E91A 1J17T 1ELAA 2Y80A 1BJVA 1ABIH 3MNCA 1KDQA 5C20A 3KEEA 3PLBA 4D8NA 1JRSA 1VCQA 1TGNA 1UCYH 3Q76A 3S9CA 3P6ZB 3ZZAA 4FUJA 5A8XA 1V2PT 1YPHC 2P93A 4TYDA 1B0FA 3HPTB 1MBQA 1QCPA 2Z9IA 4NIWA 3GCTG 2PKSC 2HPPH 5JB9S 4B2AA 3SNBA 1GJ7B 1HRTH 3ZVBA 1S0QA 4FVBA 5EOKA 4XBBA 2WPKS 3RXAA 3W94A 1CA0C 1ELGA 1H9LB 1AVXA 4Y0ZE 2A7HA 2SGPE 3UR9A 3ZVDA 1G9IE 2ANMH 4BTIB 1DWCH 5GXPA 4ISNA 1TGSZ 3F6UH 3UWIA 2FI3E 2PTNA 7ESTE 2XWAA 1FXYA 2RDLA 3HATH 1D3DB 1EX3A 2UUKB 2GCTC 3TVJB 1T31A 3STJA 3T2NA 2GTBA 5HXFA 4JZEH 1ESTA 2AFQB 1EKBB 2SNVA 4QT8C 4Y8YA 2ILNA 3K6YA 2W7SA 1YGCH 1D6RA 1K1OA 1T8MA 4FUIA 2H5CA 3A80A 3AW0A 1LHEH 4NFFA 3ZVGA 1CVWH 1GDNA 2RG3A 1QBNA 3KN2A 1TLDA 1DITH 3A87A 2Q6DA 1P3EA 1VR1H 1C5MD 1C1UH 3E6PH 3PTNA 3ZVEA 3WY8A 5JBCS 1P10A 1P06A 3E0NB 3ZYEA 1NZQH 2BLOA 3GDSA 4IC5A 1DWBH 1P03A 1C2GA 1BT7A 4ZKRU 3EA9A 1ANCA 3FZDA 1HAIH 1T8LA 1F5LA 1PQ8A 1CQQA 3GY8A 4I33A 5CE1A 3R0FA 1ARCA 4NA9H 1GBEA 3BTGE 1HFDA 3M3SA 3Q77A 4MNYA 2OD3B 1QL8A 4NGAH 4B73A 5DG6A 3ITIA 3SOSA 4GSOA 3I78A 2ZTZA 1TNIA 2ZGJA 2OXSA 1FNIA 1TNHA 1BMAA 2QV1A 4I8KA 3SHCH 5EQSA 1C9PA 1ZSJA 2JETC 3ODDA 4ISOA 4B74A 1F5KU 2ZO3H 1XUIA 3TPIZ 4MNXA 3UTUH 2HGTH 1L4ZA 4XBDA 3KQBA 5FXLA 5EQQA 4TPYA 2F9BH 1YYY1 2FTMA 2BDYA 1AE5A 1U6QA 3RXPA 2YOLA 2BDCA 3GY4A 5EW2H 3U8RH 2EC9H 2GCHF 1FONA 3PTBA 2FOAA 1UTJA 2O8MA 1HJAC 1P9SA 1EUFA 2ZPQA 4NSYA 1S85A 9ESTA 1AE8H 1D3TB 1GJ8B 1LDTT 1Q2WA 1SGQE 2PHBA 1Z1IA 3ZV8A 1P2JA 2C3SA 4WF8A 2ZCKP 1AGJA 2SGEE 3GYMA 1INCA 1ZZZA 3A8DA 3I77A 4Q80A 5A0BA 1WSSH 4BXWA 3QK1A 1FI8A 2P3TB 2PSXA 1CE5A 2O9QA 4OS5A 1PFXC 1PPCE 1ZSLA 2FWWA 2RA3A 4O9VA 1V2KT 1E37B 4YOGA 1ZOMA 1N6XA 1YCPM 3P95A 1MTVA 1P02A 4AG1A 1ELCA 3DFJA 3NUMA 4LZ1H 4GLYA 3P8FA 1G3CA 1HB0B 2QXHA 1G30B 1FLEE 2GZ8A 2J9NA 2XC0A 1KLJH 5FX5A 2VU8E 3TJUA 1C5QA 1HJ9A 2ODYB 1P05A 4XBCA 5C1XA 1AKSB 1C4U2 1PQAA 2GVFA 3M36A 2ZU3A 3QDZB 1T4VH 4H6TA 2FXRA 4VGCB 5EW1H 3BTKE 3Q3XA 3RXFA 1IQIA 1MUEB 2CV3A 2NU0E 1HBTH 4BAHB 2CF9H 3QUMP 1NS3A 3A7ZA 5C5OA 1O35A 2Y82A 2ZDAH 2NWNA 1QNJA 1TMUH 2QAAA 1UTQA 1YPEH 1A1RA 4FUDA 1ID5H 2ZGHA 2BX3A 3UQOA 1O2OA 3VB3A 2ODQA 1UVPA 3M7TA 3BG8A 1CT2E 2GMTC 4X2YA 1HGTH 1IQKA 3HKJB 4X0WU 2BMGB 4NSVA 4X6PA 1NFUA 4B75A 1SGDE 1FDPA 1FN8A 3ATKA 2O8UA 4X6NA 1J9CH 3BEIB 1P2IA 4CRCA 4D76A 3DD2H 1S6FA 1O2HA 2ZNKH 1ZRBA 5L2ZH 1LVMA 1ZR0A 2A2XH 1ZHPA 1P2QA 5ESTE 1O3LA 4AB8A 5DP9A 4CBOA 1WYKA 2XXLA 3MNSA 3PM3A 2UUFB 4AYYB 5F8TA 1P2MA 3L6PA 4WXVA 4MLFB 7LPRA 1MKWK 2BVRH 1GMCG 1NTPA 1UJ1A 4DGJA 1KXFA 1DSUA 2GMTB 2ZGXH 1XUJA 5EGMA 3AAUA 1AB9B 1TA2A 3OTJE 5AHGH 1H8DH 2QY0B 2BD2A 3TIUA 4X1QU 4ABDA 3BTWE 5L2YH 2J95A 1QRXA 1SLXB 2C8YB 3GCHC 1O5AB 3RLWH 1HAZB 1J8AA 2VGCB 4IS5A 5L6NH 1LKAA 1O2NA 1Y3WA 4CR9A 1FMGA 2ZDMA 4TWYA 4Y6DA 1H8IH 1TNLA 4ZAEA 1O2QA 1C2LA 4WXIA 2GDEH 2GKVE 1QJ1B 3LPRA 5FBEA 4WY3A 1JWTA 1CA8B 5TCAA 1BBRE 2WPIS 1KDQB 2FX4A 4AZ2B 1UVTH 3RXKA 1G2LA 1DXWA 1GGDB 3SJKA 4X6OA 4OS6A 2VIQA 3TGKE 3HGPA 1P9UA 1ZMNA 1NRQH 4LXBH 1B7XB 1HCGA 2OC8A 4RKJB 3QX5H 3S69A 1K9OE 2GCTB 3ODFA 1WQSA 1QL7A 2WPHS 3EA7A 1TNGA 3RU4T 2AEIH 4XOJA 4ISLA 3F9HA 4K8BA 1UHBA 3TITA 5JPMH 3LC5A 1SGEE 1ORFA 1A5GH 1CGHA 2AH4X 1T7CA 2R0LA 2C93B 4B71A 1A0LA 3MU5A 1O0DH 3PWBA 4HTCH 4ZHLU 1A61H 2F9OA 1C2IA 2B8OH 2OTVA 3V12A 3LC3A 4UFDH 4DCDA 4OS7A 1BZXE 1LHFH 2AIQA 2R9PA 2H6MA 3NPSA 1NY22 1OWJA 2PFEA 2ULLA 5C67A 3GY5A 1Y5UT 2TGAA 2FLBH 3P17H 4JZDH 4RN6A 1VGCC 1GI5A 3TNSA 1BRUP 3HK3B 1WTHD 3FP7E 2ZU4A 2QIQA 5LPFA 1GJ6A 3BG4B 2UWLA 3M5LA 4AFUA 1RRKA 4UFEH 4IGDA 3VB4A 1EJMA 4AB9A 6ESTA 1NRNH 2BLWA 1NFXA 5HGGA 3T28A 1LVBA 1QFKH 1ELTA 5PTPA 2QCYA 3CP7A 1LVOA 1SGPE 2VNTA 1SI5H 2G5VA 5SGAE 1SLWB 2J34A 3EGKH 3GDUA 3P8GA 2KAIA 2FOEA 1MBMA 5EPYA 4WMFA 1K1NA 1GJ5H 1CHGA 1P57B 4R0IA 3K6ZA 4WH6A 4U30A 2G4UA 5DK1A 5B6OA 4GPGA 4FUBA 4K1TA 4MQAA 1V2TT 3A8CA 1O3IA 1IQHA 4X2VA 4NZQA 1GCTC 2OQUA 4OGXA 1GJCB 1WTGH 4DG4A 3AVZA 5DGJA 1GBKA 3BSQA 4BXSA 4JZ1A 1C5UA 1NC6A 3UY9A 2PSYA 1C9TA 1C5LH 1MH0A 1G3BA 1YCPK 2A7JA 3AASA 1TOMH 1OYQA 1ZTJA 5GDSH 3TK9A 1OWHA 1BMMH 2WUBA 3QWCH 2BOKA 4K3JA 1BMNH 2V6NA 3KNXA 1MKXK 4ISIH 2AMPA 5EXMA 4OS2A 2SFAA 2A1DB 1GI3A 3RMLH 1C1TA 1O2GH 2D1JA 3VB5A 1GI7B 4KELA 1CBWB 1OSSA 5F6MA 3T29A 6CHAC 3TU7H 1YPMH 2UUJB 3KCGH 1UTLM 3T26A 1LPZB 1A0JA 2KAIB 3MH5A 3O8CA 1O3KA 4MNWA 1GMDG 4ZXXH 1TRMA 2H2ZA 3KQEA 3N7OA 3SGBE 1NU7B 1GBIA 1F5RA 1FPHH 3SV9A 2ANKH 3LGIA 2LPRA 4KGAA 4Y11E 5FCRA 1K1PA 2ZFSA 3S7KB 1XM1A 3FVFB 3UPEA 1TGCA 2R3UA 1NRPH 2VWMA 2ZU2A 1NRSH 1QGFA 1UK4A 1KY9A 2ZHFH 4A6LA 3BIUH 3OX7U 2VWNA 1EQ9A 4JYVH 4DJZB 3M5MA 1GG6C 1YLCA 2VJ1A 2ZHWH 3DFLA 5F8XA 1MD7A 3MO9A 1ZLRA 2BD7A 3RM0H 1BTZA 1EJAA 4MPXA 1MD8A 3U8TH 1AUJA 1ESBA 1QA0A 1TPPA 2FM2A 1GMHG 1O5CB 5F8ZA 7GCHG 1KXAA 3M7QA 1PYTD 4X8VH 2VWOA 1PPFE 2BB4A 1P01A 1P11E 1DFPA 1P04A 3BN9A 3A8AA 1HIAB 3TGJE 1GJ9B 3SQHE 2W3IA 1RJXB 1CA0B 2VB0A 1TX6A 3A83A 4LZ4B 1ETRH 1C5YB 4FUHA 1NU9A 3SJOA 3SV7A 1GBMA 3UFAA 2PV9B 2ANWA 2FOBA 1G3DA 3ZZDA 2CGAA 1S6HA 1SQOA 1O3NA 1GWAA 3MOCA 1BA8B 4OGYA 5AVDA 3SQEE 1GCTB 2FOCA 4AGKA 3RXQA 3RXSA 5FCKA 2BZ6H 1XX9A 1YKTA 5I46H 1HPGA 5DP5A 2CXVA 1KIGH 5DP3A 1O2WA 7KMEH 1O5FH 3OYPA 1DPOA 1HJ8A 2P3UB 3SI4H 1P2NA 1EASA 3PLPA 1D3PB 4TY7A 1Z71A 2Q1JA 1SR5C 5CHAC 2WPMS 1PQ5A 4Y76A 1GDQA 2XC5A 3ZZ5A 1Z8GA 1GMHF 3CENA 5A0AE 2FDAA 2BY5X 4ZMAH 1SBWA 3VGCC 3SUFA 1TFXA 1GBAA 2Q6GA 1N1LA 1O3PB 1QB6A 2B7DH 3SNAA 1A3BH 1OYTH 3RMMH 4MTBA 2V3OH 1K1IA 3RP2A 1C1SA 1O3GA 1PPZA 4JCNA 1F0SA 1F0UA 2G51A 2XBXA 2A5KA 4A7IB 2W26A 4CRFA 3RDZA 1IQLA 3RXOA 1KXDA 2ZG0H 5DP7A 3SV8A 4AOQA 2H9HA 2G5NA 2Y7XA 4MNVA 2ALVA 1HAHH 1T4UH 1SHHB 3SU4A 3LIWA 1C2FA 3PO1C 4AYVB 3SUEA 1GJBB 1BRCE 1YPGH 3RXRA 3MU1A 1C2KA 2O8TA 4BTTB 4ABJA 2XWBI 3EAJA 2CHAB 1HDTH 3NCLA 2WPJS 1C1WH 2OBQA 4MVNA 4IN1A 2F91A 2IPHA 4GHTA 2GP9B 4Q7XA 1S83A 2PLXA 3NKKA 3OSYA 1BJUA 4AFZA 4YZUA 3BTFE 1UK2A 2VH0A 2JH6D 3M3VA 1HXFH 1V2VT 1O3JA 2ZHDA 2FPZA 3CS0A 1A5HA 1ETSH 1EZQA 4U2WA 1ZTLA 1TGBA 2Z9LA 3RLYH 3SU3A 3S9AA 4I8HA 1GJ4H 2ZF0H 2Z3DA 1OX1A 2BY6X 2FI5E 1AVWA 1F7ZA 1TMBH 2HPQH 2Z3EA 3FFGA 3UR6A 4BTUB 4A92A 1QQ4A 2C8XB 4YO9A 3ZZ6A 1GHVH 2GZ7A 3ZZBA 3TJVA 6LPRA 2H9TH 3EDXB 3SUGA 1MCVA 4DW2U 8GCHF 1DSTA 1C2DA 3LGUA 2V35A 1UCYE 1XMNB 4A1VA 1PQ7A 1LVYA 3KHVA 1ESAA 1Q31A 4AN7A 1CT4E 1NO9H 1SGFA 3RXBA 2G52A 1AMHA 1OPHB 1TMTH 2FEQH 2QA9E 1ABJH 1YPJH 4NIYA 4UEHH 1YPHE 3A81A 4VGCC 4NIXA 1F0TA 3NWUA 4YLQH 2XNIA 4SGBE 5HM2A 1ZJKA 3ZYDA 1SFQB 2G55A 1ELDE 3RM2H 4DIHH 3U1JB 4YESB 1XKAC 1LHGH 3QO6A 5A0CA 2C8ZB 2XYAA 4XDEA 1DY9A 3O8BA 2R2WU 3QGJA 4H4FA 5H4IB 2TRMA