3A7ZA

Crystal structure of trypsin complexed with (e)-4-((1-methylpiperidin-4-yloxyimino)methyl)benzimidamide (soaking 3hours)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7zA02
2P95A 2BMGB 3UNQA 2PUXB 5FX5A 4BAQB 3A88A 1C4Y2 1T32A 1S0QA 4B75A 3TJOA 3Q76A 3FP6E 1YM0A 3BF6H 2IN2A 3MMGA 1GL0E 1IQLA 3QGJA 2SGEE 4AGJA 1ZMNA 3ZZDA 3GY3A 1UCYH 1O38A 1AZ8A 3A8DA 1MKWK 1UVUH 1GBAA 1SGFG 1FN8A 3RXUA 1Y3XA 2A5IA 2P59A 3R0FA 2BD9A 1OXGA 4E7NA 1VGCB 3NXPA 1IQHA 3TU7H 1C5XB 1G2LA 1TNGA 3PV4A 3V7TA 2ZIQH 1G9IE 2YOLA 1NFWA 2XBXA 3DHKH 3SGBE 2BY7X 1AFEH 2SGFE 1O2RA 3FP8E 1OS8A 1ETSH 4RSPA 1WTGH 2FOHA 4TWWA 4X1RU 3PB1E 2Q1JA 1E37B 1C2IA 1V2ST 1GI7B 2JH0D 1C5VA 5DKMA 1ELEE 2DE9A 4KKDA 1H9HE 3E1XB 2Z7FE 2ZEBA 1D3PB 5CE1A 2C8ZB 2Z94A 3BTGE 4FUBA 1LHGH 1AGJA 3A7WA 1IQIA 2OP9A 2ANKH 1VITH 3M61U 2G51A 1P9SA 1TE0A 3ZV9A 4NIYA 4MG3A 4YESB 4I8JA 1GCDA 1OWDA 4J2YB 1O5DH 4J1YA 3GYMA 3KF2A 1O2NA 2ODPA 4D76A 1E36B 4TY7A 2ZHDA 1QFKH 3A85A 1V2LT 3EGKH 1LPGB 2BY6X 3B9FH 3PLBA 1C5OH 1ZRKA 4ZHAA 1QRXA 2QXHA 1C5WB 4AORA 2FOEA 1P10A 3KQBA 1BHXB 4B73A 2Z9GA 2STAE 1O34A 3TJVA 2P16A 3SNAA 2BDYA 2YNAA 3E91A 5DP4A 1K1JA 1Z6JH 3Q00A 1MU8B 4NA9H 3RM2H 2FOFA 4Y0YE 3PWBA 1DXPA 5AFYH 2J34A 3QTOH 3LH1A 1WYKA 2GCTC 1ESBA 3HGNA 2VIWA 2Y81A 3RXJA 2VB0A 3U1IB 1TOMH 1GJ8B 3TJUA 2THFB 4RN6A 3UNSA 1P0SH 2FPZA 1O2IA 2SGAA 4X6NA 4OGXA 1HGTH 5E2PA 1U6QA 3MH7A 4XBCA 1CA0C 1BTXA 2A7JA 2BYAX 4X8VH 2A31A 2BZ6H 3RXHA 4K69A 1IAUA 4ABJA 5E0HA 1F0UA 3MU0A 1K2I1 4MDSA 2BOKA 2Y82A 2H5CA 5FAHA 1H9LB 4Q7XA 1MKWH 3ZZBA 2Y6TA 1NRRH 3ZYDA 1O2UA 1QGFA 5CMXH 1GBLA 2AGGX 4OS1A 4FUIA 4LK4A 2BD5A 2A5KA 2ZPQA 1C2FA 1BTYA 1GHXH 1TMBH 2VWOA 1MCVA 5F03A 1ZJKA 3M37A 1MKXK 1GMDF 5CHAB 2HOBA 3TLOA 4NIXA 1G32B 2Z9LA 5GIBA 3RM0H 1ANBA 4IS5A 1TRNA 1HJAC 2BQ7B 1QTFA 2FI5E 3RUOA 1O3KA 1PPCE 3PWCA 1GJ9B 3PO1C 2C4FH 4WXVA 2NU2E 1Y3WA 3MFJA 2CXVA 5J4QA 1O2PA 1Y5UT 3HPTB 1D9IA 5LPEA 2TPIZ 3SV2H 3ZZAA 2PW8H 1OWIA 1SGTA 3CP7A 5DP9A 1QB1A 2ZU3A 1QJ6B 3P95A 4KTSA 3LT3A 1P2NA 2FLBH 3VGCB 1GHAG 1RIWB 4ABDA 1OP2A 1YPJH 3C27B 5HM9A 1L2EA 1IHTH 2R3YA 1QHRB 2R2WU 2ZDNA 3SV9A 2B0FA 1XM1A 1YKTA 1RFNA 5BRRE 1KTSB 1VJAU 2FEQH 4IN2A 3L6PA 5T6DA 1AE8H 2HWLB 4NZLA 1D3QB 4D7FA 1SGEE 2BLQA 2SFAA 3E0NB 3VFEA 1T4VH 4HZHA 4YZUA 1TMUH 1OWEA 1CA0B 3RLYH 4ABIA 4U32A 1N1LA 5LPRA 1FY3A 1BTZA 1GBJA 1TBRH 1O3FA 1GDQA 2PR3A 4OS6A 4DJZB 3QGNB 4IN1A 1ETTH 2ZPRA 2R0KA 1RTKA 1NZQH 4GCHG 1XUJA 1G30B 3F9FA 2Z9IA 4MVNA 2PLXA 1NU7B 4IC5A 3AASA 3W94A 3U98H 5AVDA 1ZZZA 2FP7B 1QJ7B 3FZZA 2A4QA 1XKBC 2KAIB 1SGDE 2XBYA 4OS5A 2AH4X 1QNJA 1NC6A 1O0DH 1KLIH 1AUJA 4MPXA 4THNH 1EJNA 1KXCA 1YBWA 1E34B 4D8NA 1BTPA 1P03A 5FPSA 1GMCG 1O3IA 4MNVA 5TCCA 4GPGA 3UR6A 2VINA 1K1OA 3NWUA 1UTKA 1V2VT 1EOJA 1GHVH 2ZFQH 2ZU5A 2ZDMA 3VXFH 4H6SB 1FY5A 3KNXA 4ASHA 5F6MA 1KXDA 1P2KA 2WV4A 2EI7A 3LJOA 5L2ZH 1AVWA 1HAHH 2XW9A 1MKXH 4FUFA 1HDTH 2O9QA 2V0BA 4VGCB 4AFQA 3MI4A 4I8LA 4IW4E 5G4BA 4WF8A 2NU0E 3SW2B 1LHEH 3PM3A 4MQAA 1YCPH 1XUIA 3BG4C 1O3OA 1ELCA 2FX4A 1AI8H 2XYAA 4K8YA 2WINI 3LH3A 2Z3CA 1O3PB 2QIQA 2XWBI 2C3SA 3E0PB 3D65E 1LKBA 2GCTB 4F4OC 2A1DB 4CRDA 1SLUB 2BLOA 4TPYA 4B2BA 1GBHA 2OC8A 2PGBB 3TNTA 1QB9A 3PTNA 1JWTA 3BSQA 2G00A 1QJ1B 5LPFA 1TPSA 4Q2KA 2QN5T 5E0GA 1KTTB 3SV6A 2WV5A 4MNWA 4ISLA 1GBFA 1C5TA 3KL6A 3LGVA 1TGNA 3A83A 3AVZA 1LDTT 2GX4A 3UUZA 1GHYH 1NTPA 5A0AE 3S9BA 5T6FA 1O33A 2VNTA 4NFFA 1NRQH 2CF8H 4JZDH 2HNTE 4A5TS 4IBLH 1C2GA 1T8NA 2R2MB 4ABFA 3RU4T 1IOEA 3MTYA 2ZKSA 1BRAA 5FPTA 4BTIB 5JBAS 1N8OC 1OP0A 3P8FA 4LOYH 3LC3A 5E0JA 2AMQA 2GV6A 1KYNA 1GJ4H 3R3GB 1KXFA 4MTBA 1O39A 2OC7A 3ATKA 3SU1A 1SPJA 1SR5C 1J16A 1ARCA 4IGDA 1P8VC 3UQOA 1T8MA 1QR3E 5EXMA 1VR1H 2W3KA 4ISHH 4DIIH 1GBDA 1NPMA 1O3CA 3OY6U 1BHXF 2A4OA 1QL8A 2FMJA 4NGAH 4NSYA 1F0SA 1JXPA 7LPRA 3SBKA 1L1NA 4CH8B 1A46H 1BMNH 1O2VA 1T8LA 4ZHLU 1QCPA 4Y79A 1SQTA 3M35A 4X8SH 5EU8A 3SU6A 1AWFH 3LC5A 1LVMA 1BTWA 1PPBH 4YM9A 2I6QA 1V2KT 1S83A 2HGTH 2HLCA 4DW2U 1CT0E 2D1JA 3VGCC 7KMEH 1XXDA 1MAYA 2PUQH 3QTVH 3RLWH 1O2LA 1VITG 2QC2A 4M7GA 3GCHC 2CJIA 1Z6EA 2O8MA 1VZQH 1GJBB 2C8XB 3A84A 3P8OA 3ZZ9A 2VGCB 5C1UA 4JK6A 4Y8YA 4X2WA 3SU3A 1MBQA 1J9CH 2VIPA 2CHAB 4JZEH 4CH2B 3LGWA 3ZZCA 2VWMA 1TRMA 1ANDA 3A86A 1A2CH 4FUCA 3JZ1B 1UVTH 1HAZB 2P3UB 1B7XB 3ESTA 2ESTE 5FPYA 1F0RA 1C5YB 4AB9A 3SI4H 4CRCA 1YPEH 3RXIA 4ZKRU 3FAOA 3FP7E 4ABGA 4K60A 2ZFSA 1C5UA 3EE0B 2ZC9H 3BV9B 1BDAA 1GI4A 2DE8A 3M5MA 4IC6A 3U9AH 3U8TH 1N6YA 2NU1E 5ESTE 1G36A 1TGBA 1KSNA 1AHTH 1GCTB 3IG6B 3EYDA 5C3NA 3UFAA 1HAVB 2G81E 2W7SA 2BOHB 3QN7A 1AD8H 3ODDA 1MTVA 4YOGA 2ZTZA 1K22H 2JKHA 1Q3XA 2TRMA 4GUXA 3ITIA 4DY7B 3KQDA 3CS7A 3UTUH 3V0XA 5A8YA 3P8NA 1C1NA 4FUJA 3SNEA 3GYLB 3TGKE 3V12A 3V3MA 1IHSH 4RKJB 1BB0B 1Z1JA 2ZP0H 4AFZA 1HAPH 3P6ZB 4H4FA 2ZFPH 1BRBE 1Z7KA 3A80A 3D62A 2GZ7A 2ZHWH 1LQEA 4AG2A 1ETRH 1TA6A 2WPHS 3RXEA 4B2CA 1LHDH 2F9BH 1VJ9U 1UTQA 4KTCA 4QT8C 1Y5BT 1AQ7A 1ACBE 1MTNC 2A5AA 3M5OA 1IQNA 2BVRH 1DSTA 3MNXA 1W14U 1CGHA 2EEKA 2G8TA 3QLPH 1W7XH 4GHQA 1EP5A 1W10U 1TPPA 1ZHMA 3PMAB 1BJUA 1CU1A 1EAWA 4JYVH 1Q31A 5AFZH 5DP5A 1THSH 1P02A 2PGQB 1K1LA 4BXWA 1S6FA 1CO7E 1O36A 1DY8A 1A5IA 4WMDA 1UTPA 1YC0A 1OWHA 3MH6A 1HUTH 5F8TA 1C1TA 3RXPA 3PMJA 4O97A 4I8KA 1GVLA 4X1QU 1EZUC 5HXFA 1UK2A 2IPHA 1SQOA 5SGAE 1PYTC 3SNCA 2VH0A 2ZTYA 5C20A 1BBRK 1SC8U 2AS9A 1O37A 3I78A 1O2HA 2O8WA 1TOCB 4I31A 1MTSA 2QXGA 3O8DA 2EA3A 4NIWA 1C1SA 1Z71A 5DP7A 4ISIH 3QK1A 7GCHG 5C5OA 1NRNH 3GISB 2J95A 1HJ8A 1E0FD 3M5NA 3BIUH 2P8OB 2XC5A 2XC4A 2F91A 1SBWA 3UWIA 1L1JA 1XVMA 4KTUA 3ZZ4A 4WMEA 1AKSB 6GCHG 3GOVB 1EATA 2G5VA 4D7GA 5C1XA 3RXVA 1B5GH 1F5RA 3P92A 3MH5A 3BTFE 4X8TH 5JBBS 2BXUH 1ZHPA 2Y7ZA 1CBWB 2FS8A 2V6NA 3MU4A 1JBUH 1AIXH 1HB0B 1EKBB 4XE4A 1ZGVA 1QRWA 1P04A 1QIXB 2ZQ1A 2FESH 1PQ5A 1F5KU 1YCPM 3T62A 2OLGA 4NSVA 1HYLA 5FBEA 1RTLA 1QA7A 5K0HA 4DT7B 1YF4A 2F3CE 1B0FA 1W0ZU 4IMQA 1CHOG 1O2GH 4Y76A 1W3CA 1MZAA 4HI3A 2AMPA 3O8CA 4MNXA 1EZSC 4FU7A 4XBBA 3S7HB 1BUIA 1AFQB 3SZNA 2O8LA 1TONA 3ZVCA 3BTDE 1EJMA 3E16B 3OY5U 3LGIA 1GBEA 4X2YA 5FCKA 4K1TA 1GBCA 1TBQH 4VGCC 1QRZA 3H7OA 3Q3XA 1TAWA 1TIOA 4WH8A 3UOPA 4O03A 1O2WA 3N7OA 4CRAA 3VXEH 4JCNA 1QY6A 3QZRA 3URCA 2JH6D 3SHAH 1RTFB 1C2DA 1DLKB 1INCA 1SLXB 4ZKOU 1C5SA 1TNJA 2ZTXA 1N6XA 4O3TA 3AAUA 4I7YH 3V13A 1TX8A 2BQ6B 1F7ZA 1TPAE 4MPVA 1FJSA 2BDHA 5FXLA 4GAWA 1O32A 3A8BA 3ZYEA 1TGSZ 2BD2A 2ZECA 1JIRA 1BIOA 2A45B 1VITF 1SLWB 1BZXE 2GCHF 2OCVB 2RA0A 3KCGH 4HFPB 6ESTA 3B23B 3F1SB 4TPIZ 4GSOA 5EXLA 3MU5A 2QAAA 5AF9H 1AVXA 5A2MH 3BG8A 3BTKE 3AW0A 1OP8A 1VCQA 5JBTA 4LZ4B 1DX5M 3TNSA 1CGJE 2CGAA 1OX1A 1JOUB 3MNSA 1KY9A 1DT2A 2ZHEH 5HM2A 2GV7A 3MWIU 4Z0KA 1P09A 3IITA 3ATLA 3TJNA 1ABJH 1QA0A 1FLEE 4Y8XA 1P05A 2ZHFH 1O3NA 1V2UT 3M7TA 1LVOA 1S81A 1SGYE 4AOQA 1DXWA 4A1TA 1UCYE 1LCYA 2IJOB 3ATMA 3ZZ3A 1D6RA 2FODA 1GL1A 3FFGA 4WMFA 3MH4A 1HAYB 3PO1B 1C1RA 4GLYA 1JMOH 1WCZA 1TB6H 3VEQB 4DIHH 1Y3YA 3I29A 3EA8A 4KELA 4BXSA 3ATWA 1IQMA 3OX7U 1P2IA 3CS0A 3BIVH 2ZO3H 3SO3A 1QL9A 1A1RA 1ZSLA 2FOCA 4IMZA 3SUEA 1SGPE 2V3OH 1FXYA 3BG4B 3MNBA 9LPRA 1RXPA 3RMLH 3KN2A 2BXTH 3BEIB 1TALA 1ELGA 1MH0A 3QO6A 2UUYA 4JYUH 1PPGE 1C1PA 3T26A 2UWOA 3HK6B 3Q3KA 4JZIA 1HXEH 3SHCH 1A0LA 1P3CA 1ESAA 3QZQA 1AMHA 2J4IA 2W26A 1AVGH 3T2NA 3K65B 1T8OA 1ZSKA 1YPHC 4XDEA 2GZ9A 3RXRA 2F9PA 3SNDA 3RXFA 2TGDA 2GMTC 4NZQA 2ZFTA 3C1KA 2QA9E 3F68H 3P17H 3T29A 1MTUA 2H5DA 4X6OA 2B5TB 1O3DA 2I6SA 1NFXA 1SQAA 1UVPA 2G52A 2XCFA 3EA7A 4GHTA 4X6MA 1ANCA 1P2OA 3BTWE 4WXIA 2ZQ2A 2P3FH 2AIPA 8LPRA 3LONA 1GJ5H 5T6GA 1HLTH 1GGDB 4K5ZA 1P01A 4TY6A 3ZV8A 3SGAE 2QY0B 3SI3H 3VB4A 3KGPA 1GG6C 2FS9A 1OWJA 3LKWA 2HPPH 1O31A 1ZTLA 1ZGIA 4X1SU 3SV7A 1WV7H 3PMBB 5A8XA 1ID5H 1O2OA 1LKAA 2ZCKP 3T27A 1XMNB 1EPTC 3S0NA 2QCYA 1LO6A 3WY8A 5EQSA 1TA2A 2WUCA 3FVFB 1GHZA 1Z1IA 2XWAA 2RDLA 1J15A 1J14A 4Q7ZA 1VCWA 1IQJA 1SSXA 2OTVA 1GI8B 1O2XA 1QBNA 4PROA 2PTNA 1OYTH 4MPWA 2H1UA 2EC9H 2HNTF 1BJVA 2YNBA 2R9PA 4FUHA 1JRTA 4Z6AH 1LHCH 5IYTA 4Y6DA 2SNWA 1O35A 1PJPA 2H9HA 2J9NA 1S6HA 1UTLM 1C2KA 2XTTB 1YPMH 1A7SA 2ODYB 4ABHA 5GXPA 2F9OA 2AYWA 4D9QA 2BDIA 2OBQA 3SUFA 1MUEB 4YTAA 2RCEA 1SGNE 2TGPZ 2H6MA 2CN0H 1EPTB 1Z8IB 3LOXA 5C67A 1QQUA 1LPZB 2VIVA 2BY5X 2ASUB 2GT7A 3OU0A 1D3TB 1TQ7B 5TCAA 1O5FH 4R8TB 1A5GH 1HAGE 4K1SA 5TJXA 2XCNA 3GICB 1GCTC 1F0TA 2OC0A 2V3HH 1EZXC 2ZF0H 1H8DH 2ALPA 1DVAH 4K2YA 1BTHH 1CBWC 4INLA 1QB6A 3LIWA 5JDUB 1DWCH 1FUJA 1OYQA 2BY8X 1O2TA 2GMTB 1Z8GA 4Y8ZA 2V35A 4NWLA 2WYJA 1ZOMA 2BVSH 1SLVB 1TMTH 3K6YA 5C2ZA 5DP8A 1HIAB 1NFYA 1MQ6A 1DWDH 4B76A 4CHAC 5F8ZA 3SUGA 3L33A 1UVSH 1TPOA 5GCHF 5H4IB 4WJG2 3SV8A 1NROH 1TABE 3DFJA 4FU8A 1BCUH 2HVXA 1EB1H 1EAIA 1YPGH 3PTBA 3SJ8A 5EW1H 3RXQA 3JZ2B 1BITA 4Q7YA 2NWNA 4AYVB 5DG6A 4YT7H 2BTCE 3EA9A 2ANWA 8GCHG 4WVPE 2PWXA 1O3GA 1SG8B 1XUFA 2FYQA 2R3UA 2BD8A 1EASA 3M5LA 4X8UH 2LPRA 2FIRH 2ZNKH 3TK6A 2FTMA 2FO9A 3LGYA 1FAKH 1VCPA 2UWPA 1FDPA 1PYTD 2FOBA 1KDQA 2PKAA 1FPHH 3RXMA 4CHAB 2DUCA 5L30H 1UVOA 1QURH 3U8OH 1C5PA 2BLVA 1ORFA 2OINA 4OS4A 1BMAA 2P3TB 2VJ1A 4BAHB 2GDEH 2Z3EA 2BLWA 4FXGH 3GCOA 3QDZB 4OS2A 3M7QA 4NFEA 3MYWA 3VB5A 2ZZUH 4X1NU 4AGKA 3RXTA 1NRSH 1C2HA 1ZSJA 2BDGA 1XXFA 5JB9S 1A4WH 3ELAH 3LGUA 4CREA 1EOLA 1HAXB 1GPZA 1CHOF 4FVBA 4UFFH 7GCHF 3BTTE 2ZGHA 3UNRA 1W0YH 3A89A 3MU8A 4NWKA 4HTCH 2F9NA 2K1QA 1C5ZB 5E2OA 3SJKA 3P8GA 2FOGA 1EJAA 2D8WA 1BBRH 3UPEA 1LQDB 4GVUA 1OOKB 1NRPH 2C93B 3BTME 1GBIA 8KME2 2BDBA 3GY8A 4ZHMU 5EW2H 3S7KB 3HKJB 3A7VA 3KQCA 2WYGA 5A0BA 2Q6GA 1O3MA 1SGIB 4ZXYH 1SFIA 1S0RA 2WUBA 1GJ7B 1YGCH 1GI2A 1ELDE 3UWJH 1FI8A 1DITH 1SB1H 1GDUA 4XOJA 1P12E 1RD3B 1ZTJA 3ZZ5A 1FIWA 2Z9JA 1W2KH 3LU9B 1DM4B 4NCYA 1KXBA 4TYDA 1CVWH 2VWNA 2ZGCA 4E7RG 3KEEA 1FQ3A 2VIDA 4X1PU 1CQQA 2ZU4A 4BAMB 5L2YH 4B1TA 1QBOA 1NESE 4BNRA 2ZFFH 1OKXA 1G3BA 1UJ1A 2O8UA 2QXJA 1P2JA 1TBZH 1EQ9A 2ZCHP 1ZRBA 1G2MA 2Y5GA 4ISNA 2OBOA 4UDWH 1O3EA 4U2WA 1BRCE 1C1VH 1OSSA 1G3EA 3A8CA 4CBNA 3TK5A 1UTMA 2OQ5A 1FIZA 1K1NA 1EPTA 1FY8E 4HGCA 4AG1A 4SGBE 1ELVA 4CBOA 1IQKA 2PSYA 4A6LA 1G3DA 1MQ5A 2W3IA 2BDCA 1F5LA 1PPFE 5JB8S 2G4TA 4X6PA 1HJ9A 2ZPSA 1DPOA 1C4U2 2D2DA 1ABIH 1TQ0B 1X7AC 2VVUA 1V2QT 3MO9A 1ANEA 2FWWA 2XC0A 1XUGA 1SGRE 2ZDVH 1L1GA 3TPIZ 4Y71A 3M7UA 1WOFA 5JBCS 1TWXB 1SHYA 1K1IA 1P11E 1O3HA 4ZKSU 4A7IB 2F9VA 1TLDA 4ZAEA 1O2KA 5EG4A 1TGTA 1K21H 2QXIA 1Q2WA 4H6TA 1G37A 5E8EH 2ZDKA 5EOKA 4WY3A 4UONA 2Z9KA 1Y5AT 3H5CB 2TBSA 1AB9C 2G5NA 3MHWU 1GBMA 4K1EA 1SGCA 4I33A 1UTJA 3W95A 2BD3A 5HGGA 8ESTE 1DICA 1KDQB 3RXAA 3KQEA 1GBTA 4ZXXH 1V6DA 2BD7A 3TH2H 1YYY1 1XX9A 2A32A 4OS7A 5DP6A 1M9UA 5GPIB 3GCNA 3M3VA 1RS0A 1HAOH 1GMHF 5FCRA 1DUEA 1GJCB 1TRYA 1ESTA 4MLFB 2H9TH 3MOCA 1AB9B 1LTOA 2XBVA 2FI4E 1DLEA 1J17T 3SNBA 1MTWA 1EB2A 5EPYA 3SOSA 3RXGA 4XSKU 6CHAC 4CRBA 4OGYA 2A2QH 3S69A 1P9UA 1O5AB 1O2YA 1NT1A 2ZHQH 1EP6A 1AWHB 3RC5A 4A1XA 1FY4A 1FAXA 1LPKB 4YT6H 3F9HA 3GCTG 3NKKA 2Q6DA 3UY9A 2ZA5A 1L4ZA 1BOQA 1T4UH 4FUEA 1GI9B 4Y0ZE 1K1MA 1O3JA 5GWZA 5GCHG 2QF3A 1SL3A 1TGCA 4WWYA 4FVDA 2A7HA 3SN8A 1NO9H 4DGJA 3RC4A 4E06H 1HAVA 4YOIA 1A3BH 3O8BA 1AY6H 2SGPE 2Y80A 4ZKNU 3D23A 1KXAA 1PQAA 1O2ZA 1DE7H 1A61H 5PTPA 3E3TA 5DPAA 3A87A 2PTCE 2WPLS 1H1BA 2ZG0H 1GWAA 4RKOB 1FV9A 4ESTE 1Y3VA 5C5NA 2VVVA 6LPRA 4Y10E 3PLPA 1BTUA 3TK9A 1V2TT 1YP9A 2ZI2H 3K6ZA 5EPNA 1UMAH 1EAUA 3A82A 1P57B 2GT8A 3SQEE 6GCHF 3DUXH 4D9RA 1TYNA 4AZ2B 1GBBA 3FZDA 1C1OA 2VH6A 1ZHRA 4ABAA 1IQFA 3RXCA 1V2OT 2UUJB 1O30A 1DSUA 2SGQE 3HATH 3S9AA 1B0EA 1ZMJA 1WUNH 1ZPZA 1AE5A 5FHTA 1C5LH 5DP3A 3ZVEA 2Y5FA 1UTOA 1ZLRA 1CE5A 2FI3E 3S9CA 3RMMH 1JRSA 2PFEA 1DFPA 2PKSB 4JK5A 1AN1E 2OD3B 4F49A 3T5FH 2FXRA 2F83A 2PKAB 3MNCA 1BQYA 1GVZA 3P70B 1AKSA 2BX4A 3RXDA 5I25A 5K7RA 1DOJA 4ZROA 2FOMB 4JYTA 4H42U 1PPHE 2VU8E 2ZWLH 3SJIA 1C1QA 3PMHB 3F9EA 2AEIH 2QGRA 2AERH 2CMYA 1BMMH 1YPLH 3BEUA 1FZZA 3GDUA 2KAIA 1W7GH 3SORA 4NA7A 1GVKB 1DDJA 1C2EA 2FX6A 2NU4E 1O3AA 1V2JT 8GCHF 2ZDLA 1SHHB 1A0JA 2ULLA 3HGPA 3LDXH 2EI6A 4B74A 1DY9A 5ESBA 1ELBA 2Z6BD 2TGAA 2J92A 5AHGH 3MO3A 2NU3E 3VPKA 1Z8RA 4KGAA 1GHWH 2STBE 5A09A 3EAJA 1FY1A 3KIDU 1EXFA 4ISOA 2WPJS 2GVFA 2AGEX 1GMDG 1THRH 3F6UH 1UHBA 2J38A 1GJAB 1SMFE 3E8LA 1A0HB 2B7DH 1FONA 2D26C 3U8RH 2ILNA 2Q6FA 3ZVBA 4X0WU 3SGQE 3ZVFA 4AX9H 1YLDA 1NFUA 2GZ8A 1O2JA 1D6WA 5EGMA 5LH8A 1O3BA 1HFDA 3RXOA 1W8BH 2WPMS 2AMDA 4I8HA 2OXSA 1D3DB 3BTEE 1QQ4A 2HRVA 2ZGXH 2CF9H 4BANB 7ESTE 1HRTH 1A3EH 1NM6A 1O5EH 1KLTA 3OYPA 1H4WA 1PPEE 1DUAA 2G4UA 2A4GA 3SU0A 1OPHB 2OC1A 3RDZA 1L0ZA 1O5GH 4AN7A 1AZZA 3AW1A 2P93A 4WH6A 2A4RA 1WSSH 1GI0A 3H7TA 1NU9A 1FN6A 1O2MA 2G55A 1ELFA 1RJXB 3A7ZA 4E05H 2Y7XA 3NK8A 3SU5A 1HNEE 2XXLA 2C8YB 1RGQA 1O2SA 4NG9H 1WQVH 1C9PA 2TIOA 2ODQA 3A7TA 3GY4A 3L3TA 4XFQA 1GHBF 4ABEA 1ZJDA 2AGIX 3STIA 4UEHH 1GI3A 1C5RA 3RXKA 2ZGBH 2FOAA 1MU6B 1LVBA 1C5MD 5EQQA 1P3EA 2A2XH 1MCTA 2BVXH 3M36A 4YLUA 1HV7A 3NZIA 1S84A 1TX7A 1V2MT 2ZCLP 3GY2A 1PQ8A 2BM2A 4GCHF 2A7CA 1H8IH 3K2UA 2GDDA 1V3XA 1GG6B 3E6PH 1HBTH 1WAYB 1D4PB 1ARBA 4DVAU 2AIQA 2GKVE 3DT0H 1UTNA 4A92A 4INHA 4BTTB 1YPKH 2AFQB 1T7CA 1P2QA 5FBIA 3DD2H 2FZZA 2ZU1A 3RXLA 1MD8A 1K28D 1MTNB 2CHAC 1PPZA 3TH3H 1GDNA 3UQVA 4BOHA 3ZZ7A 1MAXA 3AAVA 5DJ7A 1G3CA 1WQSA 1SVPA 1KIGH 2BX3A 2GTBA 1C2MA 1DS2E 1QBVH 3HKIB 3O8RA 1KLJH 2F9UA 1C2JA 1F2SE 3SUDA 1GI1A 2GCHG 4BAKB 1V2WT 3F9GA 2BB4A 2ZFRH 5I46H 2BD4A 1EAXA 1W13U 4Q80A 4YLQH 3PYHA 1P06A 3VB6A 1FMGA 1XUHA 4YOJA 5C1YA 5F8XA 3TVJB 2BZAA 1A5HA 1EX3A 1ZPBA 2ANYA 1NN6A 3RU4D 5B6OA 2C90B 2PKSC 1ZMLA 3KHVA 4FUGA 4K8BA 2B8OH 5T3HA 2IOTA 3U69H 4I32A 3GDSA 3M3SA 1S82A 1YCPK 1RRKA 2HPQH 2ZU2A 5DGJA 1BMLA 3LPRA 1VGCC 1H9IE 2FTLE 1XVOA 2BQWB 3A7YA 2WPIS 4K3JA 4BAOB 3STJA 4B2AA 1HAIH 4CR9A 4NA8A 3RMOH 1O3LA 3ZVDA 1YPHE 3GY6A 2UUKB 2TGTA 3SQHE 1C1UH 2QYIA 1N8OB 3B8JA 2Y5HA 1E38B 4X2XA 1K1PA 3ZVAA 4UFDH 1BT7A 4I8GA 5IDKA 4CR5A 3UREA 3TIUA 1GGDC 4AYYB 1DWBH 2R0LA 1O2QA 5A0CA 2ZGJA 3U1JB 1WBGB 2M5TA 1UK3A 2UWLA 3EQ0H 5DK1A 3NPSA 4UD9H 1TNLA 4ZMAH 1Y59T 3GY5A 3HK3B 1HPGA 1C9TA 2P8OC 2BY9X 2ALVA 3TGJE 4FU9A 4JZFH 1EZQA 1GJDB 1TNKA 2OUAA 2QV1A 1C4V2 1TNIA 3UIRA 1DWEH 3Q3YA 1HCGA 4UFEH 2FDAA 3UR9A 1C1WH 1W11U 3ENSB 1V2RT 1CT2E 3URDA 3DA9B 1BRUP 2VIQA 1XUKA 1GMCF 4KP0A 4SGAE 1C5NH 1LVYA 5BPEA 1FPCH 2JETB 2ANMH 2C8WB 1FNIA 2XNIA 1MZDA 3OSYA 3IWMA 1L4DA 1AFQC 3RP2A 3SJOA 2B9LA 4LZ1H 3A8AA 2P94A 1CGIE 3EDXB 2ZDAH 5JPMH 1MMJN 1SFQB 2XRCA 3G01A 3SJ9A 3ODFA 4DCDA 5JYIA 1GI6A 1UHBB 3RC6A 3ATIA 2FLRH 3LJJA 1QL7A 6CHAB 4JMYA 2J2UA 1C5QA 5GJ4B 1DANH 4DURA 3MU1A 1EUFA 3TGIE 4Y7BA 1O5CB 1IQEA 1HJAB 2CV3A 5A8ZA 3GDVA 3ZVGA 3RXBA 2PHBA 3TH4H 3E90B 1LHFH 2BDAA 2HALA 4U01A 4AFSA 2WPKS 5FX6A 5CHAC 1TX6A 2Z3DA 1TNHA 1W12U 3OTJE 5GDSH 4AFUA 1AUTC 4XBDA 1TFXA 1Y8TA 4INKA 1ZPCA 3VB7A 9ESTA 2RA3A 3T28A 1J8AA 1SGQE 1CHGA 4U30A 1GHAF 3ZZ8A 4FUDA 3DFLA 1UCYK 4CRFA 1AO5A 5DO4H 1GBKA 4AB8A 1T31A 1WTHD 3RMNH 1BBRE 2W7UA 3ZZ6A 4ABBA 3NCLA 4O9VA 1GMHG 1YLCA 1O5BB 3LGTA 1BA8B 1WU1A 4YO9A 2SGDE 1V2NT 1GHBG 1NS3A 1SOTA 3A7XA 5EODA 4Y11E 3PLKA 2OQUA 4A1VA 1ELTA 1HXFH 1SGFA 3QUMP 5EXNA 4ZH8A 5L6NH 2GD4B 5J4SA 1RIWC 3GCTF 1LMWB 4UE7H 2QF0A 2HNTC 3BN9A 3RU4E 4B71A 1CA8B 1Z8JB 1SI5H 1GI5A 1JIMA 1ZYOA 2JH5D 1NY22 3BTHE 4UFGH 5HYOA 4O3UA 2GGVB 1K9OE 2PV9B 1CSOE 4Y7AA 3M3TA 1THPB 3PROA 4LXBH 4TWYA 3A81A 2PSXA 1AU8A 3VB3A 2FM2A 5LGOA 3GY7A 1PQ7A 4ZUHA 3NUMA 1Y3UA 1IQGA 5EQRA 1P2MA 2GP9B 4BTUB 3I77A 1HIAA 2RG3A 3CENA 2VGCC 3RXSA 2VVCA 4MNYA 1ZR0A 3QWCH 1GJ6A 2UUFB 3GCHB 5HMAA 2LNCA 1V2PT 1MD7A 5ETXA 1MBMA 1XKAC 1UO6A 3MO6A 1ELAA 1E35B 2JETC 2FYRA 2VIOA 4NIVA 2A0QB 2SNVA 2EI8A 2H9EH 2J94A 3SU2A 3Q77A 1C2LA 1CT4E 4CRGA 1KXEA 2VWLA 1F92A 2BHGA 3T25A 3K9XB 3TITA 1SOZA 3D49H 1S85A 2O8TA 1OWKA 1UK4A 1C1MA 1ZTKA 3BTQE 4JZ1A 3BEFB 3UOUA 2W5EA 2XBWA 4DOQA 4X2VA 4MPUA 3QX5H 2H2ZA 3FANA 5ABWA 1S5SA 1PFXC 4DG4A 3SU4A 4R0IA
chains in the Genus database with same CATH superfamily
2P95A 2BMGB 3UNQA 2PUXB 5FX5A 4BAQB 3A88A 1C4Y2 1T32A 1S0QA 4B75A 3TJOA 3Q76A 3FP6E 1YM0A 3BF6H 2IN2A 3MMGA 1GL0E 1IQLA 3QGJA 2SGEE 4AGJA 1ZMNA 3ZZDA 3GY3A 1UCYH 1O38A 1AZ8A 3A8DA 1MKWK 1UVUH 1GBAA 1SGFG 1FN8A 3RXUA 2KX4A 1Y3XA 2A5IA 2IPQX 2P59A 3R0FA 2BD9A 1OHHD 1OXGA 4E7NA 1VGCB 3NXPA 1IQHA 3TU7H 1C5XB 1G2LA 1TNGA 3CNRA 3PV4A 3V7TA 2ZIQH 1G9IE 2YOLA 1NFWA 2XBXA 3DHKH 3SGBE 2BY7X 1AFEH 2SGFE 1O2RA 3FP8E 1OS8A 1ETSH 4OM9A 1WTGH 2FOHA 4RSPA 4TWWA 3PB1E 4X1RU 2Q1JA 1E37B 4RT1A 1C2IA 1V2ST 1GI7B 2JH0D 1C5VA 5DKMA 1ELEE 2DE9A 4KKDA 1H9HE 3E1XB 2Z7FE 2ZEBA 1D3PB 5CE1A 2C8ZB 2Z94A 3BTGE 4FUBA 1LHGH 1AGJA 3A7WA 1IQIA 2OP9A 2ANKH 1VITH 3M61U 2G51A 1P9SA 1TE0A 3ZV9A 4NIYA 4MG3A 4YESB 4I8JA 1GCDA 1OWDA 4J2YB 1O5DH 4J1YA 3GYMA 3DSGA 3KF2A 1O2NA 2ODPA 4B6EA 4D76A 1E36B 4TY7A 2ZHDA 1QFKH 3A85A 1V2LT 3EGKH 1LPGB 2BY6X 3B9FH 3PLBA 1C5OH 1ZRKA 4ZHAA 1QRXA 2QXHA 1C5WB 4AORA 2FOEA 1P10A 2WSSD 3KQBA 1BHXB 4B73A 2Z9GA 2STAE 1O34A 3TJVA 2P16A 3SNAA 2BDYA 2YNAA 3E91A 5DP4A 1K1JA 3WWBA 1Z6JH 3Q00A 1MU8B 4NA9H 3RM2H 2FOFA 3WWFA 4Y0YE 3PWBA 1DXPA 5AFYH 2J34A 3QTOH 3LH1A 1WYKA 2GCTC 1ESBA 3HGNA 2VIWA 2Y81A 3RXJA 3F2GA 2VB0A 2XOKD 3U1IB 1TOMH 1GJ8B 3TJUA 2THFB 4RN6A 3UNSA 1P0SH 2FPZA 1O2IA 2SGAA 4X6NA 4OGXA 1HGTH 5E2PA 1U6QA 2QE7D 3MH7A 4XBCA 1CA0C 1BTXA 2A7JA 2BYAX 4X8VH 2A31A 2BZ6H 5EIYA 3RXHA 4K69A 3F0OA 1IAUA 4ABJA 1UW7A 5E0HA 1F0UA 3MU0A 4FOUC 1K2I1 4MDSA 2BOKA 5C0UA 2Y82A 2H5CA 5FAHA 1H9LB 4Q7XA 1MKWH 3ZZBA 2Y6TA 1NRRH 3ZYDA 1O2UA 1QGFA 5CMXH 1GBLA 2AGGX 3DCLA 4OS1A 4FUIA 4LK4A 2BD5A 2A5KA 2ZPQA 1C2FA 1BTYA 1GHXH 1TMBH 2VWOA 1MCVA 3N7EA 5F03A 1E1QD 1ZJKA 3M37A 1MKXK 3UAIC 1GMDF 5CHAB 4YXWD 2HOBA 3TLOA 3EE7A 4NIXA 1G32B 2Z9LA 5GIBA 3RM0H 1ANBA 3PRBA 4IS5A 1TRNA 1HJAC 2BQ7B 1QTFA 2FI5E 3RUOA 1O3KA 1PPCE 3PWCA 1GJ9B 3PO1C 2C4FH 4WXVA 2NU2E 1Y3WA 3MFJA 2CXVA 5J4QA 1O2PA 1Y5UT 3HPTB 1D9IA 5LPEA 2YMSD 2TPIZ 3SV2H 3ZZAA 4Q4LA 2PW8H 1OWIA 1SGTA 3CP7A 5DP9A 1QB1A 2ZU3A 1QJ6B 3P95A 4KTSA 3LT3A 1P2NA 2FLBH 3VGCB 1GHAG 1RIWB 4ABDA 1OP2A 1YPJH 3C27B 5HM9A 1L2EA 1IHTH 2R3YA 1QHRB 2R2WU 2ZDNA 3SV9A 2B0FA 1XM1A 1YKTA 1RFNA 5BRRE 1KTSB 1VJAU 2FEQH 4IN2A 3L6PA 5T6DA 1AE8H 2HWLB 4NZLA 1D3QB 4D7FA 1SGEE 2BLQA 2JDID 2SFAA 3E0NB 3VFEA 1T4VH 4HZHA 4YZUA 1TMUH 1OWEA 1CA0B 3RLYH 4ABIA 4U32A 1N1LA 5LPRA 1FY3A 1BTZA 1GBJA 1TBRH 1O3FA 1GDQA 2PR3A 1COWD 4OS6A 4DJZB 3QGNB 4IN1A 1ETTH 2ZPRA 2R0KA 1RTKA 1H8HD 1NZQH 4GCHG 1XUJA 1G30B 3F9FA 2Z9IA 4MVNA 4TT3D 2PLXA 1NU7B 4IC5A 3AASA 3W94A 4HG6A 5AVDA 1ZZZA 2FP7B 1QJ7B 3U98H 3FZZA 2A4QA 1XKBC 4ASUD 2KAIB 1SGDE 2XBYA 4OS5A 2AH4X 1QNJA 1NC6A 1E1RD 1O0DH 1KLIH 1AUJA 4MPXA 4THNH 1EJNA 1KXCA 1YBWA 1E34B 4D8NA 1BTPA 1P03A 5FPSA 1GMCG 1O3IA 4MNVA 2V3MA 5TCCA 4GPGA 3UR6A 1BMFD 2VINA 1K1OA 3NWUA 1UTKA 1V2VT 1EOJA 1GHVH 3OEED 2ZFQH 2ZU5A 2ZDMA 3VXFH 4H6SB 1FY5A 3KNXA 4ASHA 5F6MA 1KXDA 1P2KA 2WV4A 2EI7A 1KMHB 2IJD1 3LJOA 5L2ZH 1AVWA 1HAHH 2XW9A 1MKXH 4FUFA 1HDTH 2O9QA 2V0BA 4VGCB 4AFQA 3MI4A 4I8LA 4IW4E 5G4BA 4WF8A 2NU0E 3SW2B 1LHEH 3PM3A 4MQAA 1YCPH 4Q63A 1XUIA 3BG4C 1O3OA 1ELCA 2FX4A 2J97A 3FOAA 1AI8H 2XYAA 4K8YA 2WINI 3LH3A 2Z3CA 1O3PB 2QIQA 2XWBI 2C3SA 3E0PB 3D65E 1LKBA 2GCTB 4F4OC 2A1DB 4CRDA 1SLUB 2BLOA 4TPYA 4B2BA 1GBHA 2OC8A 2PGBB 3TNTA 1QB9A 3PTNA 1JWTA 3BSQA 2G00A 1QJ1B 5LPFA 1TPSA 4Q2KA 2QN5T 5E0GA 1KTTB 3SV6A 2WV5A 4MNWA 3DSOA 1E79D 4ISLA 1GBFA 1C5TA 3KL6A 3LGVA 1TGNA 3A83A 3AVZA 1LDTT 2GX4A 2K0QA 3UUZA 1GHYH 1NTPA 5A0AE 3S9BA 5T6FA 3ZIAD 1O33A 2VNTA 4NFFA 1NRQH 2CF8H 4JZDH 2HNTE 4A5TS 4IBLH 1C2GA 1T8NA 2R2MB 4ABFA 3RU4T 1IOEA 3MTYA 2ZKSA 1BRAA 5FPTA 4BTIB 5JBAS 5DSFA 1N8OC 1OP0A 3P8FA 4LOYH 3LC3A 5E0JA 2AMQA 2GV6A 1KYNA 1GJ4H 3R3GB 1KXFA 4MTBA 1O39A 2OC7A 3ATKA 3SU1A 1SPJA 1SR5C 1J16A 1ARCA 4IGDA 1P8VC 3UQOA 1T8MA 1QR3E 5EXMA 1VR1H 2W3KA 4ISHH 4DIIH 1GBDA 1NPMA 2CK3D 1O3CA 3OY6U 1BHXF 2A4OA 1QL8A 2FMJA 4NGAH 4NSYA 1F0SA 1YY3A 1JXPA 7LPRA 3SBKA 1L1NA 4CH8B 1A46H 1BMNH 5HIZA 1O2VA 1T8LA 4ZHLU 2J98B 1QCPA 4Y79A 1SQTA 3M35A 4X8SH 5EU8A 3SU6A 1AWFH 3LC5A 1LVMA 1BTWA 1PPBH 4YM9A 2I6QA 1V2KT 1S83A 2HGTH 2HLCA 4DW2U 1CT0E 2D1JA 3VGCC 7KMEH 1XXDA 5C17A 1MAYA 2PUQH 3QTVH 3RLWH 1O2LA 1VITG 2QC2A 4M7GA 3GCHC 2CJIA 1Z6EA 2L74A 2O8MA 1VZQH 1GJBB 2C8XB 3A84A 3P8OA 3ZZ9A 2VGCB 5C1UA 4JK6A 4Y8YA 4X2WA 3SU3A 1MBQA 1J9CH 2VIPA 2CHAB 4JZEH 4CH2B 3LGWA 3ZZCA 2VWMA 1TRMA 1ANDA 3A86A 1A2CH 4FUCA 3JZ1B 1UVTH 1HAZB 2P3UB 1B7XB 3ESTA 2ESTE 5FPYA 1F0RA 1C5YB 4AB9A 3SI4H 4CRCA 1YPEH 3RXIA 4ZKRU 3FAOA 3FP7E 3F0PA 4ABGA 4K60A 2ZFSA 1C5UA 3EE0B 2ZC9H 3BV9B 1BDAA 1GI4A 2DE8A 3M5MA 4IC6A 3U9AH 3U8TH 1N6YA 2NU1E 5ESTE 1G36A 1TGBA 1KSNA 1AHTH 1GCTB 3IG6B 3EYDA 5C3NA 3UFAA 1HAVB 2G81E 2W7SA 2BOHB 3QN7A 4RT0A 1AD8H 3ODDA 1MTVA 4YOGA 2ZTZA 1K22H 2JKHA 1Q3XA 2TRMA 4GUXA 3ITIA 4TSFD 4DY7B 3KQDA 3CS7A 3UTUH 3V0XA 5A8YA 3P8NA 1C1NA 4FUJA 3SNEA 3GYLB 3TGKE 3V12A 3V3MA 1IHSH 2JJ2D 4RKJB 1BB0B 1Z1JA 2ZP0H 4AFZA 1HAPH 3P6ZB 4H4FA 2ZFPH 1BRBE 1Z7KA 3A80A 3D62A 2GZ7A 2ZHWH 1LQEA 4AG2A 2XNDD 1ETRH 1TA6A 2WPHS 3RXEA 4B2CA 1LHDH 2F9BH 1VJ9U 1UTQA 4KTCA 4QT8C 1Y5BT 1AQ7A 1ACBE 1MTNC 2A5AA 3M5OA 1IQNA 2BVRH 1DSTA 3MNXA 1W14U 1CGHA 2EEKA 2G8TA 3QLPH 1W7XH 4GHQA 1EP5A 1W10U 1TPPA 1ZHMA 3PMAB 3VG8A 5KEDA 1BJUA 1CU1A 1EAWA 4JYVH 1Q31A 5AFZH 5DP5A 1THSH 1P02A 2PGQB 1K1LA 4BXWA 1S6FA 1CO7E 1O36A 1DY8A 1A5IA 4WMDA 1UTPA 1YC0A 1OWHA 3MH6A 1HUTH 5F8TA 1C1TA 3RXPA 3PMJA 4O97A 4I8KA 1GVLA 4X1QU 1EZUC 5HXFA 1UK2A 2IPHA 1SQOA 5SGAE 2KM0A 2QF5A 1PYTC 3SNCA 2VH0A 2ZTYA 5C20A 1BBRK 1SC8U 2AS9A 1O37A 3I78A 1O2HA 2O8WA 1TOCB 4I31A 1MTSA 2QXGA 3O8DA 2EA3A 4NIWA 1C1SA 1Z71A 5DP7A 4ISIH 3QK1A 7GCHG 5C5OA 1NRNH 3GISB 2J95A 1HJ8A 1E0FD 3M5NA 3BIUH 2P8OB 2XC5A 2XC4A 2F91A 1SBWA 3UWIA 1L1JA 1XVMA 4KTUA 3ZZ4A 4WMEA 1AKSB 6GCHG 3GOVB 1EATA 2G5VA 4D7GA 5C1XA 3RXVA 1B5GH 1F5RA 3P92A 3MH5A 3BTFE 4X8TH 5JBBS 2BXUH 1ZHPA 1NBME 1CBWB 2Y7ZA 2FS8A 2V6NA 3MU4A 1JBUH 1AIXH 1HB0B 1EKBB 4XE4A 1ZGVA 1QRWA 1P04A 1QIXB 2ZQ1A 2FESH 1PQ5A 1F5KU 1YCPM 3T62A 2OLGA 4NSVA 1HYLA 5FBEA 1RTLA 1QA7A 5K0HA 4DT7B 1YF4A 2F3CE 1B0FA 3U28C 1W0ZU 4IMQA 1CHOG 1O2GH 4Y76A 1W3CA 1MZAA 4HI3A 2AMPA 1FX0B 3O8CA 4MNXA 1EZSC 4FU7A 4XBBA 3S7HB 1BUIA 1AFQB 3SZNA 2O8LA 1TONA 3ZVCA 5B6LA 2VBCA 1EJMA 3BTDE 3E16B 2HVYB 3OY5U 3LGIA 1GBEA 4X2YA 5FCKA 4K1TA 1GBCA 1TBQH 4VGCC 1QRZA 3H7OA 3Q3XA 1TAWA 1TIOA 4WH8A 3UOPA 4O03A 1O2WA 3N7OA 4CRAA 3VXEH 4JCNA 1QY6A 3QZRA 3URCA 2JH6D 2HLDD 3SHAH 2KZ4A 1RTFB 1C2DA 1DLKB 1INCA 1SLXB 4ZKOU 1C5SA 1TNJA 2ZTXA 1N6XA 4O3TA 3AAUA 4I7YH 3V13A 1TX8A 2BQ6B 1F7ZA 1TPAE 4MPVA 3N7DA 1FJSA 2BDHA 5FXLA 4GAWA 1O32A 3A8BA 3ZYEA 1TGSZ 2BD2A 2ZECA 1JIRA 1BIOA 2A45B 1VITF 1SLWB 1BZXE 2GCHF 2OCVB 2RA0A 1QZ8A 3KCGH 4HFPB 6ESTA 3B23B 3F1SB 4TPIZ 4GSOA 5EXLA 3MU5A 2QAAA 5AF9H 1AVXA 5A2MH 3BG8A 3KYFA 3BTKE 3AW0A 1OP8A 1VCQA 5JBTA 4LZ4B 1DX5M 3TNSA 1CGJE 2CGAA 1OX1A 1JOUB 3MNSA 1KY9A 4B6FA 1DT2A 2ZHEH 5HM2A 2GV7A 3MWIU 4Z0KA 1P09A 3IITA 3ATLA 3TJNA 1ABJH 1QA0A 1FLEE 4Y8XA 1P05A 2ZHFH 1O3NA 1V2UT 3M7TA 1LVOA 1S81A 1SGYE 4AOQA 1DXWA 4A1TA 1UCYE 1LCYA 2IJOB 3ATMA 3ZZ3A 1D6RA 2FODA 1GL1A 3FFGA 4WMFA 3MH4A 1HAYB 3PO1B 1C1RA 4GLYA 1JMOH 1WCZA 1TB6H 3OEHD 3VEQB 4DIHH 1W0KD 1Y3YA 3I29A 3EA8A 4KELA 4BXSA 3ATWA 1IQMA 3OX7U 1P2IA 3CS0A 3BIVH 2ZO3H 3SO3A 5IK2D 1QL9A 1A1RA 1ZSLA 2FOCA 4IMZA 3SUEA 1SGPE 2V3OH 1FXYA 2KCOA 3BG4B 3MNBA 9LPRA 1RXPA 3RMLH 3KN2A 2BXTH 3BEIB 1TALA 1ELGA 1MH0A 3QO6A 2UUYA 4JYUH 1PPGE 1C1PA 3T26A 2UWOA 3HK6B 3Q3KA 4JZIA 1HXEH 3SHCH 1A0LA 1P3CA 1ESAA 5T1VA 5HIYA 2OK5A 2J98A 3QZQA 1AMHA 2J4IA 2W26A 1AVGH 3T2NA 3K65B 1T8OA 1ZSKA 1YPHC 4XDEA 2GZ9A 3RXRA 2F9PA 3SNDA 3RXFA 2TGDA 2GMTC 4NZQA 2ZFTA 3C1KA 2QA9E 3F68H 3P17H 3T29A 1MTUA 2H5DA 4X6OA 2B5TB 1O3DA 2I6SA 1NFXA 1SQAA 1UVPA 2G52A 2XCFA 3EA7A 4GHTA 4X6MA 1ANCA 1P2OA 3BTWE 4WXIA 2ZQ2A 2P3FH 2AIPA 8LPRA 3LONA 2GJGA 1GJ5H 5T6GA 1HLTH 1GGDB 4K5ZA 1P01A 4TY6A 3ZV8A 2KCPA 2QY0B 3SGAE 3SI3H 3VB4A 3F2HA 3KGPA 1GG6C 2FS9A 1OWJA 3LKWA 2HPPH 1O31A 1ZTLA 1ZGIA 4X1SU 3SV7A 1WV7H 3PMBB 5A8XA 1ID5H 1O2OA 1LKAA 2WZQA 2ZCKP 3T27A 1XMNB 1EPTC 3S0NA 2QCYA 1LO6A 3WY8A 5EQSA 1TA2A 2WUCA 3FVFB 1GHZA 1Z1IA 3NRLA 4I86A 2XWAA 2RDLA 1J15A 1J14A 4Q7ZA 4RI0A 1VCWA 1IQJA 1SSXA 2OTVA 1GI8B 1O2XA 1QBNA 4PROA 2PTNA 1OYTH 4MPWA 2H1UA 2EC9H 2HNTF 1BJVA 2YNBA 2R9PA 4FUHA 1JRTA 4Z6AH 1LHCH 5IYTA 4Y6DA 2SNWA 1O35A 1PJPA 2H9HA 2J9NA 1S6HA 1UTLM 1C2KA 2XTTB 1YPMH 1A7SA 2ODYB 5EJLA 4ABHA 5CHBA 2F9OA 5GXPA 2AYWA 4D9QA 2BDIA 2OBQA 3SUFA 1MUEB 4YTAA 2RCEA 1SGNE 2TGPZ 5CDFE 2H6MA 1SKYE 2CN0H 2KCYA 1EPTB 1Z8IB 3LOXA 1S6LA 1QQUA 1LPZB 2VIVA 5C67A 2BY5X 2ASUB 2GT7A 3OU0A 1D3TB 1TQ7B 5TCAA 1O5FH 4R8TB 1A5GH 1HAGE 4K1SA 2QF4A 5TJXA 2XCNA 4XRNA 3GICB 1GCTC 1F0TA 2OC0A 2V3HH 1EZXC 2ZF0H 1H8DH 2ALPA 1DVAH 2LP6A 4K2YA 1BTHH 1CBWC 4INLA 1QB6A 3LIWA 5JDUB 1DWCH 1FUJA 3PV2A 1OYQA 2BY8X 1O2TA 2GMTB 3FKSD 1Z8GA 4ZCNA 4Y8ZA 2V35A 4NWLA 2WYJA 1ZOMA 2BVSH 1SLVB 1TMTH 3K6YA 5C2ZA 5DP8A 1HIAB 1NFYA 5DN6D 1MQ6A 1DWDH 4B76A 4CHAC 5F8ZA 3SUGA 2M2AA 3L33A 1UVSH 1TPOA 5C94A 5GCHF 5H4IB 4WJG2 3SV8A 1NROH 1TABE 3DFJA 4FU8A 1BCUH 2HVXA 1EB1H 4ACAA 1EAIA 1YPGH 3PTBA 3SJ8A 5EW1H 3RXQA 3JZ2B 1BITA 4Q7YA 2NWNA 4AYVB 2YMSB 5DG6A 4YT7H 2BTCE 3EA9A 2ANWA 8GCHG 4WVPE 2PP6A 2PWXA 1O3GA 1SG8B 1XUFA 2FYQA 2R3UA 2BD8A 1EASA 3M5LA 4X8UH 2LPRA 2FIRH 2ZNKH 3TK6A 2FTMA 2FO9A 3LGYA 1FAKH 1VCPA 4F48B 2UWPA 1FDPA 1PYTD 2FOBA 1KDQA 2PKAA 1FPHH 3AK5A 3RXMA 4CHAB 2DUCA 5L30H 1UVOA 1QURH 3U8OH 1C5PA 2BLVA 1ORFA 2OINA 4OS4A 1BMAA 2P3TB 2VJ1A 4BAHB 2GDEH 2Z3EA 2BLWA 4FXGH 3GCOA 3QDZB 4OS2A 3M7QA 4NFEA 3MYWA 3VB5A 2ZZUH 4X1NU 4AGKA 3RXTA 1NRSH 1C2HA 1ZSJA 2BDGA 1XXFA 5JB9S 1A4WH 2K8IA 3ELAH 3LGUA 4CREA 1EOLA 1HAXB 1GPZA 1CHOF 4FVBA 4UFFH 7GCHF 3BTTE 3KQ5A 2ZGHA 3UNRA 1W0YH 3A89A 3MU8A 4NWKA 4HTCH 2F9NA 2K1QA 1C5ZB 5E2OA 3SJKA 3P8GA 2FOGA 1EJAA 2D8WA 1BBRH 3UPEA 1LQDB 4GVUA 1OOKB 1NRPH 2C93B 3BTME 1GBIA 8KME2 2BDBA 3GY8A 4ZHMU 5EW2H 3S7KB 3HKJB 3A7VA 3KQCA 2WYGA 5A0BA 2Q6GA 1O3MA 1SGIB 4ZXYH 1SFIA 1S0RA 2WUBA 1GJ7B 1YGCH 2YMSC 1GI2A 1ELDE 3UWJH 1FI8A 1DITH 1SB1H 1GDUA 4XOJA 1P12E 1RD3B 4ACBA 1ZTJA 3ZZ5A 1FIWA 1VKYA 2Z9JA 1W2KH 3LU9B 1DM4B 4NCYA 1KXBA 4TYDA 1CVWH 2VWNA 2ZGCA 4E7RG 3KEEA 1FQ3A 2VIDA 4X1PU 1CQQA 2ZU4A 4BAMB 5L2YH 4B1TA 1QBOA 1NESE 4BNRA 2ZFFH 1OKXA 1G3BA 1UJ1A 2O8UA 2QXJA 1P2JA 1TBZH 1EQ9A 2ZCHP 1ZRBA 1G2MA 2Y5GA 4ISNA 2OBOA 1H8ED 1O3EA 4UDWH 4U2WA 1BRCE 1C1VH 1OSSA 1G3EA 3A8CA 4CBNA 3TK5A 1UTMA 2OQ5A 1FIZA 1K1NA 1EPTA 1FY8E 4HGCA 4AG1A 4SGBE 1ELVA 4CBOA 1IQKA 2PSYA 4A6LA 1G3DA 1MQ5A 2W3IA 2BDCA 1F5LA 1PPFE 5JB8S 2G4TA 4X6PA 1HJ9A 2ZPSA 1DPOA 1C4U2 2D2DA 1ABIH 1TQ0B 1X7AC 2VVUA 5EJ1A 1V2QT 5F53A 2JIZD 3MO9A 2WV9A 1ANEA 2FWWA 2XC0A 1XUGA 1SGRE 2ZDVH 1L1GA 3TPIZ 4Y71A 3M7UA 1WOFA 5JBCS 1TWXB 1SHYA 1K1IA 3KYGA 1P11E 2WHXA 1O3HA 4ZKSU 4A7IB 2F9VA 1TLDA 4ZAEA 1O2KA 5EG4A 1TGTA 1K21H 2QXIA 2KR7A 2L6OA 1Q2WA 4H6TA 1G37A 5E8EH 2ZDKA 5EOKA 4WY3A 4UONA 2Z9KA 1Y5AT 3H5CB 2TBSA 1AB9C 2G5NA 3OTPA 3MHWU 1GBMA 4K1EA 1SGCA 4I33A 1UTJA 3W95A 2BD3A 5HGGA 8ESTE 1DICA 1KDQB 3RXAA 3KQEA 5FL7D 1GBTA 4ZXXH 1V6DA 2BD7A 3TH2H 1YYY1 1XX9A 2A32A 4OS7A 5DP6A 1M9UA 5GPIB 3GCNA 3M3VA 1RS0A 1HAOH 1GMHF 5FCRA 1DUEA 1GJCB 1TRYA 1ESTA 4MLFB 2H9TH 3MOCA 1AB9B 1LTOA 3WW7A 2XBVA 2FI4E 1DLEA 1J17T 3SNBA 1MTWA 1EB2A 5EPYA 3SOSA 3RXGA 4XSKU 6CHAC 4CRBA 4OGYA 2A2QH 4P02A 3S69A 1P9UA 1O5AB 1O2YA 1NT1A 2ZHQH 1EP6A 1AWHB 3RC5A 4A1XA 1FY4A 1FAXA 1LPKB 4YT6H 3SZEA 3F9HA 3GCTG 3NKKA 2Q6DA 3UY9A 2ZA5A 3GS9A 1L4ZA 1BOQA 1T4UH 4FUEA 1GI9B 4Y0ZE 1K1MA 1O3JA 5GWZA 5GCHG 2QF3A 1SL3A 1MABB 1TGCA 4WWYA 4FVDA 2A7HA 3SN8A 2JJ1D 1NO9H 4DGJA 3RC4A 4E06H 1HAVA 4YOIA 1A3BH 3O8BA 1SQRA 1AY6H 2SGPE 2Y80A 4ZKNU 3D23A 1KXAA 1PQAA 1O2ZA 1DE7H 1A61H 5PTPA 3E3TA 5DPAA 3A87A 2PTCE 2WPLS 1H1BA 2ZG0H 1GWAA 4RKOB 1FV9A 1WDIA 4ESTE 1Y3VA 5C5NA 2VVVA 6LPRA 3FO8D 4Y10E 3PLPA 1BTUA 3TK9A 2EQNA 1V2TT 3F2FA 1YP9A 2ZI2H 3K6ZA 5EPNA 1UMAH 1EAUA 3A82A 1P57B 2GT8A 3SQEE 6GCHF 3DUXH 4D9RA 1TYNA 4AZ2B 1GBBA 3FZDA 1C1OA 2VH6A 1ZHRA 4ABAA 1IQFA 3RXCA 1V2OT 2UUJB 1O30A 1DSUA 2SGQE 3HATH 3S9AA 1B0EA 1ZMJA 1WUNH 1ZPZA 1AE5A 2W6JD 5FHTA 1C5LH 5DP3A 3ZVEA 2Y5FA 1UTOA 1ZLRA 1CE5A 2FI3E 3S9CA 3RMMH 1JRSA 2PFEA 1DFPA 2PKSB 4JK5A 1YLNA 1AN1E 2OD3B 4F49A 3T5FH 1YWUA 2FXRA 2F83A 2PKAB 3MNCA 1BQYA 1GVZA 3P70B 1AKSA 2BX4A 3RXDA 5I25A 5K7RA 1DOJA 4ZROA 2FOMB 4JYTA 4H42U 1PPHE 2VU8E 2ZWLH 4M9FA 4Z1MD 3SJIA 1C1QA 3PMHB 3F9EA 2AEIH 2QGRA 2AERH 2CMYA 1BMMH 1YPLH 3BEUA 1W0JD 1FZZA 3GDUA 2KAIA 1W7GH 3SORA 4NA7A 1GVKB 1DDJA 1C2EA 2FX6A 2NU4E 1O3AA 1V2JT 8GCHF 2ZDLA 3F3BA 2ULLA 1SHHB 1A0JA 3HGPA 3LDXH 2EI6A 4B74A 1DY9A 2F4LA 5ESBA 1ELBA 2Z6BD 2TGAA 2J92A 5AHGH 4AC9A 3MO3A 2NU3E 3VPKA 1Z8RA 4KGAA 3OAAD 1GHWH 2STBE 5A09A 3EAJA 1FY1A 3KIDU 1EXFA 2J5UA 4ISOA 2WPJS 2GVFA 2AGEX 1GMDG 1THRH 3F6UH 1UHBA 2J38A 1GJAB 1SMFE 3E8LA 1A0HB 2B7DH 1FONA 2D26C 3U8RH 2ILNA 2Q6FA 3ZVBA 4X0WU 3SGQE 3ZVFA 4AX9H 1YLDA 1EFRD 1NFUA 2GZ8A 1O2JA 1D6WA 5EGMA 5LH8A 1O3BA 1HFDA 5C0TA 3RXOA 1W8BH 2WPMS 3FN8A 2AMDA 4I8HA 2OXSA 1D3DB 3BTEE 1WXRA 1QQ4A 2HRVA 2ZGXH 2CF9H 4BANB 7ESTE 1HRTH 1A3EH 1NBMD 1NM6A 1O5EH 1KLTA 3OYPA 3PV5A 1H4WA 1PPEE 1DUAA 2G4UA 2A4GA 3SU0A 1OPHB 2OC1A 3RDZA 1L0ZA 1O5GH 4AN7A 1AZZA 3AW1A 2P93A 4WH6A 2A4RA 1WSSH 1GI0A 3H7TA 2AHME 1NU9A 1FN6A 1O2MA 2G55A 1ELFA 1RJXB 3A7ZA 4E05H 2Y7XA 2KCAA 3NK8A 3SU5A 1HNEE 2XXLA 2C8YB 1RGQA 1O2SA 4FETA 4NG9H 1WQVH 1C9PA 2TIOA 2ODQA 2RDEA 3A7TA 3GY4A 3L3TA 4XFQA 1GHBF 4ABEA 1ZJDA 2AGIX 3STIA 4UEHH 1GI3A 1C5RA 3RXKA 2ZGBH 2FOAA 1MU6B 1LVBA 1C5MD 5EQQA 1P3EA 2A2XH 1MCTA 2BVXH 3M36A 4YLUA 1HV7A 3NZIA 1S84A 1TX7A 1V2MT 2ZCLP 3GY2A 1PQ8A 2BM2A 4GCHF 2A7CA 1H8IH 3K2UA 2GDDA 3OE7D 1V3XA 1GG6B 3E6PH 1HBTH 1WAYB 1D4PB 1ARBA 4DVAU 2AIQA 2GKVE 3DT0H 1UTNA 4A92A 4INHA 4BTTB 1YPKH 2AFQB 1T7CA 1P2QA 5FBIA 3DD2H 2FZZA 2ZU1A 3RXLA 1MD8A 1K28D 1MTNB 2CHAC 1PPZA 3TH3H 1GDNA 3UQVA 4BOHA 3ZZ7A 1MAXA 3AAVA 5DJ7A 1G3CA 1WQSA 1SVPA 1KIGH 2BX3A 2GTBA 1C2MA 1DS2E 1QBVH 3HKIB 3O8RA 1KLJH 2F9UA 1C2JA 1F2SE 3SUDA 1GI1A 2GCHG 2EY4C 3SYJA 4BAKB 1V2WT 3F9GA 2BB4A 2ZFRH 5I46H 2BD4A 1EAXA 1W13U 4Q80A 4YLQH 3PYHA 1P06A 3VB6A 1FMGA 1XUHA 4YOJA 5C1YA 5F8XA 3TVJB 2BZAA 1A5HA 1EX3A 1ZPBA 2ANYA 1NN6A 3RU4D 5B6OA 2C90B 2PKSC 1ZMLA 3KHVA 4FUGA 4K8BA 2B8OH 5T3HA 2IOTA 3U69H 4I32A 3GDSA 3M3SA 1S82A 1YCPK 1RRKA 2HPQH 2ZU2A 2LELA 5DGJA 1BMLA 3LPRA 1VGCC 1H9IE 2FTLE 1XVOA 2BQWB 3A7YA 2WPIS 4K3JA 4BAOB 3STJA 4B2AA 1HAIH 4CR9A 4NA8A 3RMOH 1O3LA 2KFWA 3ZVDA 1YPHE 3GY6A 5HKKD 2UUKB 2TGTA 3SQHE 4DT4A 1C1UH 2QYIA 1N8OB 3B8JA 2Y5HA 1E38B 4X2XA 1K1PA 3ZVAA 4UFDH 1BT7A 4I8GA 5IDKA 4CR5A 3UREA 3TIUA 1GGDC 4AYYB 1DWBH 2R0LA 3W1EA 1O2QA 5A0CA 2ZGJA 3U1JB 1WBGB 2M5TA 1UK3A 2UWLA 3EQ0H 5DK1A 3NPSA 4UD9H 1TNLA 4ZMAH 1Y59T 3GY5A 3HK3B 1HPGA 1C9TA 2P8OC 2BY9X 2ALVA 3TGJE 4FU9A 4JZFH 1EZQA 1GJDB 1TNKA 2OUAA 2QV1A 1C4V2 1TNIA 3UB0A 1DWEH 3Q3YA 1HCGA 4UFEH 3UIRA 2FDAA 3UR9A 1C1WH 1W11U 3ENSB 1V2RT 1CT2E 3URDA 3DA9B 1BRUP 2VIQA 1XUKA 1GMCF 4KP0A 4SGAE 1C5NH 1LVYA 5BPEA 1FPCH 2JETB 2ANMH 2C8WB 1FNIA 2XNIA 1MZDA 3OSYA 3IWMA 1L4DA 1AFQC 3RP2A 3SJOA 2B9LA 4LZ1H 3A8AA 2P94A 1CGIE 3EDXB 2ZDAH 5JPMH 1MMJN 1SFQB 2XRCA 3G01A 3SJ9A 3ODFA 4DCDA 5JYIA 5KECA 1GI6A 1K0HA 1UHBB 3RC6A 3ATIA 2FLRH 3LJJA 1QL7A 6CHAB 4JMYA 2J2UA 1C5QA 5GJ4B 1DANH 4DURA 3MU1A 1EUFA 3TGIE 4Y7BA 1O5CB 4XD7D 1IQEA 1HJAB 2CV3A 5A8ZA 3GDVA 3ZVGA 3RXBA 2PHBA 3TH4H 3E90B 1LHFH 2BDAA 2HALA 4U01A 4AFSA 2WPKS 5FX6A 5CHAC 1TX6A 2Z3DA 1TNHA 1W12U 3OTJE 5GDSH 4AFUA 1AUTC 4XBDA 1TFXA 1Y8TA 4INKA 1ZPCA 3VB7A 9ESTA 2RA3A 3T28A 1J8AA 1SGQE 1CHGA 2W6ID 4U30A 1GHAF 3ZZ8A 4FUDA 3DFLA 1UCYK 4CRFA 1AO5A 5DO4H 1GBKA 4AB8A 1T31A 1WTHD 2V7QD 3RMNH 1BBRE 2W7UA 3ZZ6A 4ABBA 3NCLA 4O9VA 1GMHG 1YLCA 1O5BB 3LGTA 1BA8B 1WU1A 4YO9A 2SGDE 1V2NT 1GHBG 1NS3A 1SOTA 3A7XA 5EODA 4Y11E 3PLKA 2OQUA 4A1VA 2RFKC 3DSPA 1ELTA 1HXFH 1SGFA 3QUMP 5EXNA 4ZH8A 5L6NH 2GD4B 5J4SA 1RIWC 3GCTF 1LMWB 4UE7H 2QF0A 2HNTC 3BN9A 5GNDA 3RU4E 4B71A 1CA8B 3H09A 1Z8JB 1SI5H 1GI5A 1JIMA 1ZYOA 2JH5D 1NY22 3BTHE 4P00A 4UFGH 5EJZA 5HYOA 4O3UA 2GGVB 1K9OE 2WPDD 2PV9B 1CSOE 4Y7AA 3M3TA 1THPB 3OFND 3PROA 4LXBH 3A81A 4TWYA 2PSXA 1AU8A 2F43B 3VB3A 2FM2A 5LGOA 3MQKC 3GY7A 1PQ7A 4ZUHA 3NUMA 1Y3UA 1IQGA 5EQRA 1P2MA 2GP9B 4BTUB 3I77A 1HIAA 2RG3A 3CENA 2VGCC 3RXSA 2VVCA 4MNYA 1ZR0A 3QWCH 1GJ6A 3N99A 2UUFB 3GCHB 5HMAA 2LNCA 1V2PT 1MD7A 5ETXA 1MBMA 1XKAC 1UO6A 3MO6A 1ELAA 1E35B 2JETC 2FYRA 2VIOA 4NIVA 2A0QB 2SNVA 2EI8A 2H9EH 2J94A 3SU2A 3Q77A 1C2LA 1CT4E 4CRGA 1KXEA 2VWLA 1F92A 2BHGA 3T25A 3K9XB 3TITA 1SOZA 3D49H 1S85A 2O8TA 1OWKA 1UK4A 1C1MA 1ZTKA 3BTQE 4JZ1A 3BEFB 3UOUA 4F55A 5KGOA 2W5EA 2XBWA 3PRDA 4DOQA 4X2VA 4MPUA 3QX5H 2H2ZA 3FANA 5ABWA 1S5SA 1PFXC 4DG4A 3SU4A 4R0IA
chains in the Genus database with same CATH topology
2P95A 2BMGB 3UNQA 2PUXB 5FX5A 4BAQB 3A88A 1C4Y2 1T32A 1S0QA 4B75A 3TJOA 3Q76A 3FP6E 1YM0A 3BF6H 2IN2A 3MMGA 1GL0E 1IQLA 3QGJA 2SGEE 4AGJA 1ZMNA 3ZZDA 3GY3A 1UCYH 1O38A 1AZ8A 3A8DA 1MKWK 1UVUH 1GBAA 1SGFG 1FN8A 3RXUA 1Y3XA 2A5IA 2P59A 3R0FA 2BD9A 1OXGA 4E7NA 1VGCB 3NXPA 1IQHA 3TU7H 1C5XB 1G2LA 1TNGA 3PV4A 3V7TA 2ZIQH 1G9IE 2YOLA 1NFWA 2XBXA 3DHKH 3SGBE 2BY7X 1AFEH 2SGFE 1O2RA 3FP8E 1OS8A 1ETSH 4RSPA 1WTGH 2FOHA 4TWWA 4X1RU 3PB1E 2Q1JA 1E37B 1C2IA 1V2ST 1GI7B 2JH0D 1C5VA 5DKMA 1ELEE 2DE9A 4KKDA 1H9HE 3E1XB 2Z7FE 2ZEBA 1D3PB 5CE1A 2C8ZB 2Z94A 3BTGE 4FUBA 1LHGH 1AGJA 3A7WA 1IQIA 2OP9A 2ANKH 1VITH 3M61U 2G51A 1P9SA 1TE0A 3ZV9A 4NIYA 4MG3A 4YESB 4I8JA 1GCDA 1OWDA 4J2YB 1O5DH 4J1YA 3GYMA 3KF2A 1O2NA 2ODPA 4D76A 1E36B 4TY7A 2ZHDA 1QFKH 3A85A 1V2LT 3EGKH 1LPGB 2BY6X 3B9FH 3PLBA 1C5OH 1ZRKA 4ZHAA 1QRXA 2QXHA 1C5WB 4AORA 2FOEA 1P10A 3KQBA 1BHXB 4B73A 2Z9GA 2STAE 1O34A 3TJVA 2P16A 3SNAA 2BDYA 2YNAA 3E91A 5DP4A 1K1JA 1Z6JH 3Q00A 1MU8B 4NA9H 3RM2H 2FOFA 4Y0YE 3PWBA 1DXPA 5AFYH 2J34A 3QTOH 3LH1A 1WYKA 2GCTC 1ESBA 3HGNA 2VIWA 2Y81A 3RXJA 2VB0A 3U1IB 1TOMH 1GJ8B 3TJUA 2THFB 4RN6A 3UNSA 1P0SH 2FPZA 1O2IA 2SGAA 4X6NA 4OGXA 1HGTH 5E2PA 1U6QA 3MH7A 4XBCA 1CA0C 1BTXA 2A7JA 2BYAX 4X8VH 2A31A 2BZ6H 3RXHA 4K69A 1IAUA 4ABJA 5E0HA 1F0UA 3MU0A 1K2I1 4MDSA 2BOKA 2Y82A 2H5CA 5FAHA 1H9LB 4Q7XA 1MKWH 3ZZBA 2Y6TA 1NRRH 3ZYDA 1O2UA 1QGFA 5CMXH 1GBLA 2AGGX 4OS1A 4FUIA 4LK4A 2BD5A 2A5KA 2ZPQA 1C2FA 1BTYA 1GHXH 1TMBH 2VWOA 1MCVA 5F03A 1ZJKA 3M37A 1MKXK 1GMDF 5CHAB 2HOBA 3TLOA 4NIXA 1G32B 2Z9LA 5GIBA 3RM0H 1ANBA 4IS5A 1TRNA 1HJAC 2BQ7B 1QTFA 2FI5E 3RUOA 1O3KA 1PPCE 3PWCA 1GJ9B 3PO1C 2C4FH 4WXVA 2NU2E 1Y3WA 3MFJA 2CXVA 5J4QA 1O2PA 1Y5UT 3HPTB 1D9IA 5LPEA 2TPIZ 3SV2H 3ZZAA 2PW8H 1OWIA 1SGTA 3CP7A 5DP9A 1QB1A 2ZU3A 1QJ6B 3P95A 4KTSA 3LT3A 1P2NA 2FLBH 3VGCB 1GHAG 1RIWB 4ABDA 1OP2A 1YPJH 3C27B 5HM9A 1L2EA 1IHTH 2R3YA 1QHRB 2R2WU 2ZDNA 3SV9A 2B0FA 1XM1A 1YKTA 1RFNA 5BRRE 1KTSB 1VJAU 2FEQH 4IN2A 3L6PA 5T6DA 1AE8H 2HWLB 4NZLA 1D3QB 4D7FA 1SGEE 2BLQA 2SFAA 3E0NB 3VFEA 1T4VH 4HZHA 4YZUA 1TMUH 1OWEA 1CA0B 3RLYH 4ABIA 4U32A 1N1LA 5LPRA 1FY3A 1BTZA 1GBJA 1TBRH 1O3FA 1GDQA 2PR3A 4OS6A 4DJZB 3QGNB 4IN1A 1ETTH 2ZPRA 2R0KA 1RTKA 1NZQH 4GCHG 1XUJA 1G30B 3F9FA 2Z9IA 4MVNA 2PLXA 1NU7B 4IC5A 3AASA 3W94A 3U98H 5AVDA 1ZZZA 2FP7B 1QJ7B 3FZZA 2A4QA 1XKBC 2KAIB 1SGDE 2XBYA 4OS5A 2AH4X 1QNJA 1NC6A 1O0DH 1KLIH 1AUJA 4MPXA 4THNH 1EJNA 1KXCA 1YBWA 1E34B 4D8NA 1BTPA 1P03A 5FPSA 1GMCG 1O3IA 4MNVA 5TCCA 4GPGA 3UR6A 2VINA 1K1OA 3NWUA 1UTKA 1V2VT 1EOJA 1GHVH 2ZFQH 2ZU5A 2ZDMA 3VXFH 4H6SB 1FY5A 3KNXA 4ASHA 5F6MA 1KXDA 1P2KA 2WV4A 2EI7A 3LJOA 5L2ZH 1AVWA 1HAHH 2XW9A 1MKXH 4FUFA 1HDTH 2O9QA 2V0BA 4VGCB 4AFQA 3MI4A 4I8LA 4IW4E 5G4BA 4WF8A 2NU0E 3SW2B 1LHEH 3PM3A 4MQAA 1YCPH 1XUIA 3BG4C 1O3OA 1ELCA 2FX4A 1AI8H 2XYAA 4K8YA 2WINI 3LH3A 2Z3CA 1O3PB 2QIQA 2XWBI 2C3SA 3E0PB 3D65E 1LKBA 2GCTB 4F4OC 2A1DB 4CRDA 1SLUB 2BLOA 4TPYA 4B2BA 1GBHA 2OC8A 2PGBB 3TNTA 1QB9A 3PTNA 1JWTA 3BSQA 2G00A 1QJ1B 5LPFA 1TPSA 4Q2KA 2QN5T 5E0GA 1KTTB 3SV6A 2WV5A 4MNWA 4ISLA 1GBFA 1C5TA 3KL6A 3LGVA 1TGNA 3A83A 3AVZA 1LDTT 2GX4A 3UUZA 1GHYH 1NTPA 5A0AE 3S9BA 5T6FA 1O33A 2VNTA 4NFFA 1NRQH 2CF8H 4JZDH 2HNTE 4A5TS 4IBLH 1C2GA 1T8NA 2R2MB 4ABFA 3RU4T 1IOEA 3MTYA 2ZKSA 1BRAA 5FPTA 4BTIB 5JBAS 1N8OC 1OP0A 3P8FA 4LOYH 3LC3A 5E0JA 2AMQA 2GV6A 1KYNA 1GJ4H 3R3GB 1KXFA 4MTBA 1O39A 2OC7A 3ATKA 3SU1A 1SPJA 1SR5C 1J16A 1ARCA 4IGDA 1P8VC 3UQOA 1T8MA 1QR3E 5EXMA 1VR1H 2W3KA 4ISHH 4DIIH 1GBDA 1NPMA 1O3CA 3OY6U 1BHXF 2A4OA 1QL8A 2FMJA 4NGAH 4NSYA 1F0SA 1JXPA 7LPRA 3SBKA 1L1NA 4CH8B 1A46H 1BMNH 1O2VA 1T8LA 4ZHLU 1QCPA 4Y79A 1SQTA 3M35A 4X8SH 5EU8A 3SU6A 1AWFH 3LC5A 1LVMA 1BTWA 1PPBH 4YM9A 2I6QA 1V2KT 1S83A 2HGTH 2HLCA 4DW2U 1CT0E 2D1JA 3VGCC 7KMEH 1XXDA 1MAYA 2PUQH 3QTVH 3RLWH 1O2LA 1VITG 2QC2A 4M7GA 3GCHC 2CJIA 1Z6EA 2O8MA 1VZQH 1GJBB 2C8XB 3A84A 3P8OA 3ZZ9A 2VGCB 5C1UA 4JK6A 4Y8YA 4X2WA 3SU3A 1MBQA 1J9CH 2VIPA 2CHAB 4JZEH 4CH2B 3LGWA 3ZZCA 2VWMA 1TRMA 1ANDA 3A86A 1A2CH 4FUCA 3JZ1B 1UVTH 1HAZB 2P3UB 1B7XB 3ESTA 2ESTE 5FPYA 1F0RA 1C5YB 4AB9A 3SI4H 4CRCA 1YPEH 3RXIA 4ZKRU 3FAOA 3FP7E 4ABGA 4K60A 2ZFSA 1C5UA 3EE0B 2ZC9H 3BV9B 1BDAA 1GI4A 2DE8A 3M5MA 4IC6A 3U9AH 3U8TH 1N6YA 2NU1E 5ESTE 1G36A 1TGBA 1KSNA 1AHTH 1GCTB 3IG6B 3EYDA 5C3NA 3UFAA 1HAVB 2G81E 2W7SA 2BOHB 3QN7A 1AD8H 3ODDA 1MTVA 4YOGA 2ZTZA 1K22H 2JKHA 1Q3XA 2TRMA 4GUXA 3ITIA 4DY7B 3KQDA 3CS7A 3UTUH 3V0XA 5A8YA 3P8NA 1C1NA 4FUJA 3SNEA 3GYLB 3TGKE 3V12A 3V3MA 1IHSH 4RKJB 1BB0B 1Z1JA 2ZP0H 4AFZA 1HAPH 3P6ZB 4H4FA 2ZFPH 1BRBE 1Z7KA 3A80A 3D62A 2GZ7A 2ZHWH 1LQEA 4AG2A 1ETRH 1TA6A 2WPHS 3RXEA 4B2CA 1LHDH 2F9BH 1VJ9U 1UTQA 4KTCA 4QT8C 1Y5BT 1AQ7A 1ACBE 1MTNC 2A5AA 3M5OA 1IQNA 2BVRH 1DSTA 3MNXA 1W14U 1CGHA 2EEKA 2G8TA 3QLPH 1W7XH 4GHQA 1EP5A 1W10U 1TPPA 1ZHMA 3PMAB 1BJUA 1CU1A 1EAWA 4JYVH 1Q31A 5AFZH 5DP5A 1THSH 1P02A 2PGQB 1K1LA 4BXWA 1S6FA 1CO7E 1O36A 1DY8A 1A5IA 4WMDA 1UTPA 1YC0A 1OWHA 3MH6A 1HUTH 5F8TA 1C1TA 3RXPA 3PMJA 4O97A 4I8KA 1GVLA 4X1QU 1EZUC 5HXFA 1UK2A 2IPHA 1SQOA 5SGAE 1PYTC 3SNCA 2VH0A 2ZTYA 5C20A 1BBRK 1SC8U 2AS9A 1O37A 3I78A 1O2HA 2O8WA 1TOCB 4I31A 1MTSA 2QXGA 3O8DA 2EA3A 4NIWA 1C1SA 1Z71A 5DP7A 4ISIH 3QK1A 7GCHG 5C5OA 1NRNH 3GISB 2J95A 1HJ8A 1E0FD 3M5NA 3BIUH 2P8OB 2XC5A 2XC4A 2F91A 1SBWA 3UWIA 1L1JA 1XVMA 4KTUA 3ZZ4A 4WMEA 1AKSB 6GCHG 3GOVB 1EATA 2G5VA 4D7GA 5C1XA 3RXVA 1B5GH 1F5RA 3P92A 3MH5A 3BTFE 4X8TH 5JBBS 2BXUH 1ZHPA 2Y7ZA 1CBWB 2FS8A 2V6NA 3MU4A 1JBUH 1AIXH 1HB0B 1EKBB 4XE4A 1ZGVA 1QRWA 1P04A 1QIXB 2ZQ1A 2FESH 1PQ5A 1F5KU 1YCPM 3T62A 2OLGA 4NSVA 1HYLA 5FBEA 1RTLA 1QA7A 5K0HA 4DT7B 1YF4A 2F3CE 1B0FA 1W0ZU 4IMQA 1CHOG 1O2GH 4Y76A 1W3CA 1MZAA 4HI3A 2AMPA 3O8CA 4MNXA 1EZSC 4FU7A 4XBBA 3S7HB 1BUIA 1AFQB 3SZNA 2O8LA 1TONA 3ZVCA 3BTDE 1EJMA 3E16B 3OY5U 3LGIA 1GBEA 4X2YA 5FCKA 4K1TA 1GBCA 1TBQH 4VGCC 1QRZA 3H7OA 3Q3XA 1TAWA 1TIOA 4WH8A 3UOPA 4O03A 1O2WA 3N7OA 4CRAA 3VXEH 4JCNA 1QY6A 3QZRA 3URCA 2JH6D 3SHAH 1RTFB 1C2DA 1DLKB 1INCA 1SLXB 4ZKOU 1C5SA 1TNJA 2ZTXA 1N6XA 4O3TA 3AAUA 4I7YH 3V13A 1TX8A 2BQ6B 1F7ZA 1TPAE 4MPVA 1FJSA 2BDHA 5FXLA 4GAWA 1O32A 3A8BA 3ZYEA 1TGSZ 2BD2A 2ZECA 1JIRA 1BIOA 2A45B 1VITF 1SLWB 1BZXE 2GCHF 2OCVB 2RA0A 3KCGH 4HFPB 6ESTA 3B23B 3F1SB 4TPIZ 4GSOA 5EXLA 3MU5A 2QAAA 5AF9H 1AVXA 5A2MH 3BG8A 3BTKE 3AW0A 1OP8A 1VCQA 5JBTA 4LZ4B 1DX5M 3TNSA 1CGJE 2CGAA 1OX1A 1JOUB 3MNSA 1KY9A 1DT2A 2ZHEH 5HM2A 2GV7A 3MWIU 4Z0KA 1P09A 3IITA 3ATLA 3TJNA 1ABJH 1QA0A 1FLEE 4Y8XA 1P05A 2ZHFH 1O3NA 1V2UT 3M7TA 1LVOA 1S81A 1SGYE 4AOQA 1DXWA 4A1TA 1UCYE 1LCYA 2IJOB 3ATMA 3ZZ3A 1D6RA 2FODA 1GL1A 3FFGA 4WMFA 3MH4A 1HAYB 3PO1B 1C1RA 4GLYA 1JMOH 1WCZA 1TB6H 3VEQB 4DIHH 1Y3YA 3I29A 3EA8A 4KELA 4BXSA 3ATWA 1IQMA 3OX7U 1P2IA 3CS0A 3BIVH 2ZO3H 3SO3A 1QL9A 1A1RA 1ZSLA 2FOCA 4IMZA 3SUEA 1SGPE 2V3OH 1FXYA 3BG4B 3MNBA 9LPRA 1RXPA 3RMLH 3KN2A 2BXTH 3BEIB 1TALA 1ELGA 1MH0A 3QO6A 2UUYA 4JYUH 1PPGE 1C1PA 3T26A 2UWOA 3HK6B 3Q3KA 4JZIA 1HXEH 3SHCH 1A0LA 1P3CA 1ESAA 3QZQA 1AMHA 2J4IA 2W26A 1AVGH 3T2NA 3K65B 1T8OA 1ZSKA 1YPHC 4XDEA 2GZ9A 3RXRA 2F9PA 3SNDA 3RXFA 2TGDA 2GMTC 4NZQA 2ZFTA 3C1KA 2QA9E 3F68H 3P17H 3T29A 1MTUA 2H5DA 4X6OA 2B5TB 1O3DA 2I6SA 1NFXA 1SQAA 1UVPA 2G52A 2XCFA 3EA7A 4GHTA 4X6MA 1ANCA 1P2OA 3BTWE 4WXIA 2ZQ2A 2P3FH 2AIPA 8LPRA 3LONA 1GJ5H 5T6GA 1HLTH 1GGDB 4K5ZA 1P01A 4TY6A 3ZV8A 3SGAE 2QY0B 3SI3H 3VB4A 3KGPA 1GG6C 2FS9A 1OWJA 3LKWA 2HPPH 1O31A 1ZTLA 1ZGIA 4X1SU 3SV7A 1WV7H 3PMBB 5A8XA 1ID5H 1O2OA 1LKAA 2ZCKP 3T27A 1XMNB 1EPTC 3S0NA 2QCYA 1LO6A 3WY8A 5EQSA 1TA2A 2WUCA 3FVFB 1GHZA 1Z1IA 2XWAA 2RDLA 1J15A 1J14A 4Q7ZA 1VCWA 1IQJA 1SSXA 2OTVA 1GI8B 1O2XA 1QBNA 4PROA 2PTNA 1OYTH 4MPWA 2H1UA 2EC9H 2HNTF 1BJVA 2YNBA 2R9PA 4FUHA 1JRTA 4Z6AH 1LHCH 5IYTA 4Y6DA 2SNWA 1O35A 1PJPA 2H9HA 2J9NA 1S6HA 1UTLM 1C2KA 2XTTB 1YPMH 1A7SA 2ODYB 4ABHA 5GXPA 2F9OA 2AYWA 4D9QA 2BDIA 2OBQA 3SUFA 1MUEB 4YTAA 2RCEA 1SGNE 2TGPZ 2H6MA 2CN0H 1EPTB 1Z8IB 3LOXA 5C67A 1QQUA 1LPZB 2VIVA