3A80A

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)-2-methylpropanoic acid (soaking 40seconds)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a80A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a80A02
2GX4A 3ZZ3A 1NT1A 1A5IA 2FX4A 1SMFE 1UCYH 1FPHH 2B8OH 1SGFG 1NFWA 1W8BH 1PJPA 4AYVB 2BY9X 3EAJA 2Y82A 8GCHG 4ZAEA 1E35B 4NWLA 1C5YB 2ZU2A 3PMHB 4ZKOU 2R9PA 2Z9KA 3BSQA 4K8YA 1TX8A 7ESTE 3CS7A 1DM4B 3KL6A 1OWHA 1RD3B 4CR5A 3RMMH 2A1DB 3P95A 2HNTF 3RP2A 3BTHE 2ZTXA 1ESTA 2Z6BD 2C8WB 1WQSA 1ELGA 4MTBA 2GT7A 1T4VH 3U9AH 4YOIA 1YPHE 2QCYA 1C2GA 2BLVA 2IN2A 1EOJA 3TK6A 3MU8A 2A5AA 4CBOA 1Q3XA 1AE5A 3MU0A 3ZZBA 2DUCA 3E90B 3PLBA 3S7HB 1C2DA 1QJ1B 2OC1A 3UNQA 1CGIE 1K21H 3P8NA 2ALVA 5EXMA 4FUEA 2XNIA 1OP8A 7GCHG 2IOTA 1HAYB 1MUEB 1SVPA 5LGOA 1P8VC 1ZMLA 1G3CA 1HIAA 4MG3A 1CBWC 1MQ6A 2AYWA 2Q6DA 1WSSH 1SHHB 1GBIA 1B0EA 1GI4A 1P04A 3RXMA 1GHXH 3URDA 3SU0A 2O9QA 1GWAA 4K60A 2M5TA 3SI3H 4ZHLU 3RXPA 1PYTD 1OYQA 1GMHG 3TH3H 1C5XB 3HGNA 1EZXC 1GJDB 4D7FA 1L1JA 2OLGA 1FMGA 1C1UH 1TGCA 4B74A 1TQ0B 4E06H 1GHYH 1VGCB 2J95A 2BDYA 2TRMA 2VWOA 1ELDE 1FJSA 4HI3A 5DP5A 1VJAU 2XC4A 2BX3A 2VGCC 3GCHC 2J38A 3H7OA 4GHQA 5ETXA 2NU2E 3LU9B 4WMEA 3UOUA 4BXWA 2BLWA 2XXLA 3S69A 4AN7A 1TLDA 1V2JT 4K5ZA 2FTMA 3M61U 1F2SE 3TJVA 3TJUA 1CGJE 1N6XA 3MH7A 4DW2U 2BQ6B 1E37B 1O2MA 1O34A 2VH0A 3IITA 2GCTC 2BD5A 2V3OH 3HK6B 2A4OA 4X8VH 2XYAA 4WY3A 1K1NA 4X1NU 1VITF 3BG4C 4YLQH 3AAVA 1TPSA 1FXYA 2WPLS 1TBZH 1DUEA 1Z6EA 3BTQE 1UVOA 3SQHE 1DY9A 2VIQA 5HM9A 3PB1E 1DDJA 3BTGE 1KY9A 4KTUA 3M37A 1T31A 2QF3A 1HAVA 1U6QA 1C5SA 1YPLH 2EI8A 2ZDNA 2V0BA 3HPTB 1IQHA 4NA7A 6CHAC 1F5RA 4JZFH 1XUFA 3NWUA 5BRRE 1ELTA 4Y79A 2STAE 3TU7H 5A0CA 3C27B 5GDSH 5T3HA 4JCNA 2A0QB 4J1YA 3S7KB 3S9BA 1GVLA 2JH5D 4X1QU 1TWXB 3S0NA 4I8JA 4ABIA 1SQAA 3PWBA 4MNYA 2BYAX 4OGXA 1GBJA 4ASHA 3CS0A 4A6LA 1ZSJA 1LHGH 2TBSA 5JBTA 2ZGHA 6CHAB 2ZQ1A 3A7WA 1NS3A 5C1XA 2W7SA 1GBCA 4CRAA 1L1NA 2QN5T 2OUAA 4ISOA 3M36A 2WV5A 1BTXA 1C2IA 2ZA5A 1GCTC 1A0JA 3TVJB 1DS2E 3SV8A 3MWIU 1LTOA 1GVZA 1AKSB 3SNEA 1FLEE 3TITA 2K1QA 3SNCA 1YLDA 1HIAB 2WPHS 1HYLA 1BZXE 3TIUA 3M5NA 1ZLRA 2VH6A 1TNHA 1MKWK 4ZXXH 2BVXH 5HGGA 1GI6A 1DXPA 1GI0A 1GHBF 3OYPA 1GBBA 4FUGA 4GHTA 1J15A 2Y5GA 2SGQE 3QX5H 4SGAE 3VB5A 1AFQC 3ITIA 1YBWA 1ELFA 1OWEA 4H6SB 1KLJH 1HAIH 3ELAH 3RDZA 4GCHF 1TYNA 5HXFA 3UR6A 3Q77A 2BD7A 2PTNA 4IW4E 1VGCC 1SL3A 1LCYA 1X7AC 1BA8B 3RUOA 3LGUA 3A85A 1TPOA 5LH8A 1XXFA 3F1SB 2GCHG 1HAZB 6GCHG 1YPEH 4NSVA 3M35A 3SGBE 3LOXA 1D3DB 1C4U2 1H1BA 1T8MA 2H9TH 4I8HA 1C1VH 4H42U 4CH8B 1Y3YA 3M3VA 3MH5A 2ZGBH 4NIWA 1DWEH 2TIOA 5FBEA 3BTWE 2BX4A 1H9IE 1BTZA 1PPCE 2RA3A 5CE1A 1O31A 4E7RG 4X6OA 4YO9A 1PQAA 3ZZAA 1THSH 3MH6A 4OGYA 3EA9A 4WH6A 1HJ8A 1YCPK 1P09A 1RJXB 2GTBA 5I25A 1F0UA 2AFQB 3DT0H 4ZKRU 1AGJA 1O5BB 1T4UH 4AOQA 3F6UH 1RS0A 2C4FH 3Q76A 5F8TA 2H9EH 1GBDA 4YOJA 3QDZB 3F9HA 2PHBA 4NFEA 1CGHA 1O2TA 1MTWA 3ATLA 3UPEA 3U98H 1BRBE 2BLQA 2CF9H 2AIQA 5A8YA 4ABAA 1GGDB 5FAHA 1SOTA 1HDTH 2P3UB 2FPZA 2PKAA 3TH2H 1O5AB 1QBVH 1GCTB 2QXJA 1THRH 4I31A 1PPHE 1O2RA 2BD8A 1EJMA 2FX6A 1OWJA 4CHAC 2BD2A 2ALPA 1CBWB 2VVUA 1QCPA 2O8WA 3MNXA 1SFQB 2FOAA 2XWAA 3FFGA 3A8AA 2YNBA 3D23A 4LK4A 2ESTE 2ZHEH 1ZPBA 2G81E 5LPRA 1NY22 4K3JA 4MNWA 2ZU5A 5ESTE 2ZDAH 1MTSA 3MI4A 1IQMA 1C1MA 1EXFA 1GBHA 2BLOA 1G2LA 1VCWA 1A61H 1GBTA 1MBMA 1O3CA 2PKSC 2OCVB 2WPKS 2XW9A 3RXDA 3T2NA 1DOJA 1JIRA 3RM0H 3SUDA 8KME2 1NFYA 2BVSH 3A7YA 2Q6FA 3FANA 3O8BA 2C8XB 2VB0A 1ZTLA 1QBNA 1GMDG 1AE8H 2ZI2H 3BG4B 2A4GA 3URCA 3RMLH 4DIIH 1AB9B 1JXPA 1AU8A 3A88A 1SQOA 3UFAA 2FODA 1AO5A 4Q2KA 1NRSH 4YT7H 1SB1H 1IQNA 1O3EA 3T25A 3RC6A 3KQDA 1ORFA 4BTIB 3HK3B 3RXTA 1BTWA 2B5TB 5EQRA 1GHZA 4ESTE 2HPQH 1SG8B 2HRVA 2F9OA 2QXIA 3A7TA 1D4PB 2F9VA 3P8GA 3SN8A 3NKKA 1JIMA 2O8UA 5A0BA 5JB9S 1O3FA 2PV9B 1YPHC 1IAUA 1LHDH 1MMJN 4O9VA 1TQ7B 1HJ9A 2JETB 4YZUA 1UTPA 2PWXA 2VWMA 2J9NA 4JZEH 4NZQA 3HATH 3RU4D 2JH6D 3BTEE 4JMYA 3RXAA 3CENA 4J2YB 1EZUC 4Y76A 2PFEA 1H8IH 3FP8E 2J92A 2B0FA 4NSYA 1GHVH 3RXRA 2FMJA 3SHAH 4INKA 1NROH 4Y8YA 1SLVB 4XBDA 2VIOA 4ZROA 4AFUA 1K1PA 1QA0A 2DE8A 5FPSA 1Z7KA 4AG2A 4X1PU 2GDEH 2VIPA 4ABDA 3ZZDA 1C5NH 1EAIA 2GCTB 1EJAA 2XCNA 3RLWH 3M3TA 1WV7H 2UUFB 4I8LA 3P92A 1KYNA 2PKAB 2EC9H 2GT8A 3SBKA 1BUIA 1C1QA 1MZAA 3RXFA 2FI5E 2HPPH 2UWLA 1SQTA 1BOQA 3SGQE 4DGJA 2FYRA 1IHSH 3D62A 1YPGH 2ZFRH 1BTYA 1O3LA 4B2AA 1BB0B 5EQQA 1AUJA 1O3KA 1OX1A 2VWNA 4IC6A 3RXUA 4D9QA 1XUJA 1JMOH 1L0ZA 3ODFA 2UUKB 2PTCE 3CP7A 4MQAA 3I78A 1QJ6B 4UD9H 4Y7BA 4NA9H 2VU8E 1OYTH 2AMQA 2ZCLP 2C90B 1HJAC 4IBLH 4ABGA 4FU9A 2FI3E 2XC5A 3I29A 1TNLA 4GLYA 4O97A 3H7TA 5LPFA 1ZPZA 4Y8ZA 4JK6A 1ZYOA 2VINA 3GDUA 4Z6AH 1F7ZA 3RXEA 1JOUB 1IQGA 3SHCH 2VVCA 1B0FA 1O2ZA 1SC8U 1NESE 1UTNA 3ODDA 1GMCF 4XBCA 3FZZA 2AGEX 4WMDA 1F5LA 4F49A 1O2QA 3PO1B 3BTFE 3ZZ9A 3K9XB 4QT8C 4NIVA 1LHFH 3I77A 3T62A 2FOEA 1UTJA 4I8KA 1MTUA 1JBUH 1RTFB 2CF8H 4ABFA 1FNIA 2RA0A 1MH0A 4D7GA 1IQIA 4K1TA 1FDPA 1IQEA 3AAUA 1DE7H 1O3PB 1T7CA 2D8WA 1S0RA 2G55A 5FCRA 4A5TS 1EUFA 1QL7A 2GVFA 1GBMA 1SGFA 4LOYH 1K1JA 4D76A 3MOCA 2GP9B 1NZQH 4U30A 3MU1A 3LDXH 1KXEA 2CJIA 4O3TA 3SI4H 3RXOA 3LJOA 4AGJA 3UIRA 2H9HA 5AF9H 3NZIA 1UO6A 2V6NA 2PGBB 2FZZA 3TPIZ 1CO7E 3BIVH 1C5LH 3RC4A 2GV6A 3ZVAA 2QGRA 1V2VT 4ISIH 3ATWA 5DPAA 2GMTC 1C5ZB 4KP0A 3ZVCA 4MPVA 2FLRH 2ZU1A 3E0PB 2WUBA 3U1IB 1A5GH 4K2YA 3VFEA 4I33A 4E7NA 1QHRB 3A86A 1VCQA 2BXUH 3QUMP 2GZ9A 4TPIZ 4Z0KA 4ZUHA 2GDDA 1FN8A 2LNCA 1CT4E 2ANKH 3EA7A 1ZHRA 1MCVA 3HKJB 1KTSB 1C5UA 2OP9A 3MO9A 1HXEH 1TMTH 1GL0E 1P2KA 2F9UA 4JZIA 2P59A 1ARCA 1G9IE 3GCTG 1C5PA 2F9BH 2AGIX 1DWDH 4YESB 2ZZUH 5DGJA 1TNJA 1O2LA 3ZVGA 1DSUA 1O2JA 4ISHH 2CGAA 2FOMB 2OBOA 1SLXB 1SOZA 1UK4A 3RXBA 5GCHF 1V2MT 1O39A 1E34B 1Y59T 4ABEA 1OWKA 1C5QA 1P2IA 2THFB 4M7GA 1HGTH 5JDUB 1XUIA 1PQ5A 1OSSA 1SLWB 1AZZA 1QB9A 1DLKB 2CN0H 3RXSA 1EB2A 1OWIA 1GBKA 1HAPH 3KQCA 3LT3A 3W94A 2OD3B 2P16A 1XKBC 1TGNA 2WYGA 1TBQH 1KSNA 2HALA 1C1NA 1C5TA 2O8MA 5C67A 1CA8B 3K6ZA 1HNEE 3RXGA 2Y6TA 1UVUH 1T32A 3JZ2B 3DHKH 1ANDA 1DWBH 4DY7B 3MNCA 1OS8A 3UTUH 1BMAA 1QNJA 2RG3A 1EJNA 2VIWA 2G4TA 4B2CA 1QFKH 1W7GH 3O8DA 4BTUB 1AQ7A 1EQ9A 3N7OA 1ZRKA 1F0TA 3LKWA 1DFPA 1GL1A 2BDGA 2BOHB 1O3GA 3LC3A 4IS5A 1AMHA 1TRMA 1ELAA 2RCEA 4Y10E 3ZZ8A 2FOCA 1FIZA 1RIWB 3BF6H 4ZKSU 3E8LA 3RM2H 5TCCA 1DPOA 5T6FA 1C9TA 1GHAF 2UUJB 1HJAB 4B75A 2FOGA 3STJA 5J4QA 1HAVB 1C1RA 7KMEH 3SNBA 3LGWA 1QRWA 1ELCA 2I6SA 1O38A 3P17H 3T29A 4Q7XA 1LPKB 3EA8A 2BDBA 1KXAA 2A31A 2I6QA 4MPUA 2R0KA 4BANB 4MPWA 3Q00A 3TJNA 1VJ9U 2WPIS 1DLEA 1NU9A 1P9UA 4KGAA 1EAWA 1HLTH 2SGAA 4CREA 1AVGH 1NRPH 1H8DH 2C93B 4OS1A 3FP7E 3PLKA 1W13U 2ZPSA 3SV7A 1AIXH 1ZR0A 2ZKSA 1C4V2 4UFDH 1O2GH 2BY5X 4O3UA 1EPTA 4Y6DA 3FVFB 1LKBA 4X8SH 1WUNH 1ESBA 2O8LA 2QA9E 2PLXA 2A4RA 1O37A 1P11E 1XMNB 1O2UA 5EXNA 4TPYA 1GCDA 4FU7A 3GY7A 4IN1A 3UOPA 2BY6X 1SGCA 1CHOF 1AKSA 1KDQB 1ID5H 2FXRA 1IQLA 1BBRE 3NXPA 3GCNA 5C2ZA 5C5NA 1IQFA 1GBAA 3Q3XA 1ARBA 3PYHA 1LHCH 1Y5UT 5HMAA 2A5KA 3BTME 4UE7H 1RTKA 2KAIA 1K1LA 2Q1JA 2XBWA 1TALA 3M7UA 2ZCHP 3ZVFA 2F83A 5E2OA 1YM0A 1YYY1 4OS6A 2ZF0H 2H6MA 1BCUH 3GDVA 1UK2A 1N8OC 1O5DH 1KTTB 4ZH8A 2A2XH 1DVAH 3VGCC 1C1SA 3SUGA 1YF4A 2QAAA 1O5EH 1QTFA 2IPHA 3AVZA 1W0ZU 1Y5AT 4AX9H 1GDQA 2ZC9H 3A7ZA 8LPRA 2G5VA 3A83A 1O0DH 1NN6A 1C2LA 1ELVA 2FWWA 5EPYA 2F91A 5H4IB 3F9GA 2FOBA 3R0FA 3Q3YA 1GBEA 1OKXA 5EW1H 2ULLA 4ABJA 2PKSB 3PMAB 4A1TA 2GZ7A 1WCZA 2BZAA 1OXGA 4H4FA 4RSPA 1P2OA 5C1YA 3BEFB 5CMXH 1O2IA 3NPSA 3DD2H 3C1KA 1ZZZA 3QGJA 3UNSA 1THPB 1XKAC 1W12U 4LZ1H 1D3PB 1LPZB 1P12E 4AFSA 1NFUA 1UVSH 2G8TA 1TRNA 1O3DA 1P2JA 1G32B 3F9EA 1V2QT 1W7XH 1BDAA 1TGTA 3GDSA 4FUBA 2FLBH 4DCDA 3EYDA 1FQ3A 1OP2A 3SZNA 4CHAB 3A84A 8ESTE 1UHBA 5J4SA 1ZGVA 2ZG0H 3K2UA 1NRRH 4BNRA 5C20A 1CSOE 2Y81A 3K6YA 1TIOA 1ACBE 4Q7ZA 2HGTH 3HGPA 1KXBA 1KIGH 2ZU3A 2FI4E 4VGCB 4GVUA 5CHAB 2BD4A 1BJUA 2GGVB 1S5SA 1CE5A 1EPTB 4NCYA 1SGNE 5EQSA 1MAXA 2SFAA 1SGYE 1O5CB 5L6NH 4X1RU 4DT7B 4D9RA 3TGJE 1GDNA 4SGBE 3A7XA 1FN6A 2SGDE 4GSOA 1ZMNA 3U1JB 5FXLA 4BAHB 1W11U 1OWDA 5DP7A 2XRCA 4AYYB 1ETSH 1O2WA 4E05H 2A7HA 2B9LA 2G00A 2ZP0H 3AW0A 2EA3A 1V2TT 1SPJA 3KGPA 2SNWA 1H9HE 3OU0A 4ISLA 1W10U 3F68H 1S82A 1IQJA 2D2DA 1TX7A 4XDEA 2P8OC 1SGPE 1SHYA 1G36A 3PTBA 5ESBA 3V7TA 1TNKA 1UVTH 2XCFA 1YPKH 3LGYA 8GCHF 1RFNA 2PSYA 1K22H 1O3JA 1A5HA 1GI9B 1WQVH 1YCPM 3SORA 9LPRA 3EGKH 4AB9A 1G2MA 3E3TA 1O2NA 3TH4H 3MU4A 2TGPZ 3P8OA 2WINI 1V2OT 3MMGA 3PROA 4UEHH 1VZQH 1HAGE 1C2MA 2XC0A 1HRTH 3HKIB 1PQ8A 3D65E 3MYWA 1GJ5H 2Z9LA 1AY6H 1ZSKA 1ANBA 3A80A 1C5WB 1L2EA 1UCYK 1TA6A 4AFQA 3SOSA 2V35A 4GAWA 1V2RT 1H4WA 2QV1A 1YPMH 4PROA 3SUFA 1DX5M 2ZGCA 2OC8A 2ZHWH 3A82A 4JZ1A 4AGKA 3KNXA 2R3UA 1TAWA 1K2I1 1BHXB 1XXDA 5E8EH 2ZFPH 4AB8A 3GYLB 1O2XA 3SJIA 1BMLA 1BRCE 1K1IA 1LHEH 4X6MA 5FPYA 3ZV9A 7GCHF 2Y7ZA 4XOJA 5JBAS 4FUIA 5F6MA 3RC5A 4YTAA 5I46H 1GG6C 1G37A 1EZSC 2UUYA 4WVPE 3RXLA 3SV9A 4NIXA 4TY7A 2OC7A 2OTVA 2Y5FA 2D26C 4HZHA 4VGCC 3SW2B 5GJ4B 2HNTE 1GMHF 4WWYA 3KF2A 3BIUH 1WTHD 3QWCH 5GWZA 1YC0A 2SGPE 1GBLA 2BD9A 5JBBS 1INCA 4R8TB 2CHAB 3MTYA 1O2HA 1W3CA 1TGBA 2BVRH 2W7UA 4YLUA 2ZQ2A 3LPRA 2GKVE 3A89A 4DG4A 5C1UA 5E0JA 1AZ8A 4DVAU 2WYJA 4IN2A 3UWIA 3TGIE 4DIHH 4BAKB 2Z94A 3KIDU 3KQBA 2ZPRA 1BRAA 2LPRA 2RDLA 4BXSA 3QZQA 1O5GH 1P9SA 1QR3E 3P6ZB 4I8GA 4NZLA 2ZFFH 1RRKA 4NWKA 1E38B 1C1OA 1L4ZA 1GJ4H 5IYTA 3ZVDA 3TNSA 1F0SA 1VITG 1T8LA 2HLCA 3B8JA 5C3NA 1LVYA 1MKXH 1E0FD 4K8BA 1TBRH 2QY0B 3MU5A 5A8ZA 4BTTB 1YPJH 1QQ4A 3A81A 5L2YH 2W3IA 1KLIH 1HAOH 4UFFH 3A8BA 4R0IA 1YP9A 1VITH 3U8RH 2A5IA 3V12A 2BY8X 1WYKA 1YCPH 2VIDA 1B7XB 1V2ST 2R0LA 3DUXH 4X2XA 2J2UA 4B73A 5DP9A 2VJ1A 5E0GA 1FY4A 4CRGA 1G3EA 1DANH 4UFEH 5DJ7A 2F3CE 1TE0A 4MNXA 1P2QA 4UDWH 1WU1A 3V3MA 1FAKH 2J94A 2OQ5A 1Z1JA 1VCPA 3VXFH 4A92A 3VPKA 1D6RA 4LXBH 2ZGJA 1WBGB 2VNTA 3GCHB 1TABE 4ZHAA 4K1EA 2WPMS 3AW1A 1Q2WA 1O2PA 4B1TA 1GHWH 3ESTA 1EAXA 3SJ9A 1XUGA 2Z9IA 2JH0D 1D3QB 3QGNB 2NU1E 4FUFA 1HXFH 3SU6A 4WF8A 2AS9A 3E6PH 1HAXB 4DJZB 2ZU4A 1IOEA 5PTPA 3QTOH 4XSKU 2EI7A 2JETC 1GJCB 1P03A 1BT7A 3M5LA 3NCLA 1J8AA 3TJOA 3DFJA 1DT2A 4AZ2B 1ZRBA 1GHBG 1LKAA 2ZHFH 5EW2H 1C2FA 1SSXA 2O8TA 1FUJA 2FS9A 3RXCA 2FS8A 5FBIA 1PPEE 2BDHA 5EPNA 1Z8IB 1GJ6A 2Y7XA 5HYOA 4GCHG 1JRSA 1P2NA 3WY8A 1EP6A 1Z8RA 4X1SU 5C5OA 2Z3DA 2BZ6H 1G3DA 1HBTH 3G01A 2GZ8A 3LGVA 1AN1E 5GXPA 2BD3A 2GCHF 3ZZ6A 4TY6A 2CXVA 1P06A 3GICB 6GCHF 1O30A 1Y3UA 1S81A 3SU5A 2BM2A 2XBXA 3D49H 3UWJH 2P94A 4JZDH 2Q6GA 5CHAC 4IGDA 2BMGB 4JK5A 3SV6A 1K9OE 2ANYA 1C2HA 2FIRH 1AI8H 1KLTA 3GY3A 1T8NA 2SGEE 5F8ZA 4WXVA 4ZHMU 3E91A 4X0WU 3UQOA 1A2CH 1DWCH 2FO9A 4UFGH 1GI2A 1TMUH 1RIWC 4BOHA 1LQEA 1QL8A 3PTNA 1TFXA 1P01A 3KCGH 2IJOB 2HVXA 3MNBA 3SU2A 3ZZ4A 2ZDLA 6LPRA 1D6WA 1Z8JB 2B7DH 3PLPA 2ZDVH 3S9CA 3ZVEA 2SGFE 1A0LA 1SBWA 2WUCA 3T28A 1FY3A 1G30B 2JKHA 1Y8TA 1MTVA 1SGIB 1WTGH 4AORA 2AIPA 3GISB 3KN2A 3O8CA 2C8ZB 3A87A 1MU6B 1TB6H 2ODQA 4Q80A 3QTVH 1O3OA 3TGKE 5GIBA 5LPEA 3BEIB 1QJ7B 1HFDA 1A4WH 2PSXA 4OS7A 1BITA 1BIOA 3P70B 1L1GA 2ZFQH 2FOFA 4Y71A 3P8FA 4IMZA 3TNTA 3E1XB 1GI7B 2ANWA 1GG6B 2PW8H 3F9FA 5EXLA 1S0QA 2G52A 1PQ7A 1NTPA 1TPPA 3RXKA 5B6OA 4XE4A 1GI3A 2NU0E 2A32A 1GJ7B 2ZECA 2AMDA 3UUZA 1BTUA 2A4QA 5TCAA 1CT2E 3LIWA 2G4UA 1DITH 1C1WH 1AVWA 2TGAA 1QRXA 2C3SA 5JYIA 1UTOA 2ASUB 3SU3A 1SGEE 4B76A 1BJVA 1KXFA 4MVNA 1FAXA 1N6YA 1Y5BT 2PUQH 2YOLA 2FOHA 3QZRA 2AH4X 4FXGH 3SU1A 1V2PT 3ZVBA 1Z1IA 2ZTYA 4GPGA 1DXWA 2A7JA 1MAYA 1A1RA 2ZHQH 3PO1C 1GMDF 3LH1A 1QQUA 1S6HA 5AFYH 4ZXYH 4CRBA 1LDTT 1ABJH 2ZNKH 3GY8A 1N1LA 1FONA 1QURH 3B23B 5EU8A 2BXTH 6ESTA 1MD7A 1ZHMA 3Q3KA 3TLOA 1BTPA 1M9UA 3OY5U 3RU4T 2SNVA 2PR3A 1CQQA 1S85A 1UJ1A 1C2JA 5DP8A 3RMOH 3SQEE 2BHGA 3LC5A 2AGGX 3MHWU 4B2BA 2H5CA 1KDQA 3BTDE 3MO6A 1LVMA 1ELBA 2HWLB 2Z9GA 3M3SA 3PMBB 1ZSLA 4A1VA 5DKMA 1FZZA 1FIWA 3UY9A 3JZ1B 5F8XA 4U01A 3VXEH 1OP0A 1SGQE 1J9CH 5JPMH 4BAOB 2ZDKA 1Y3VA 4WMFA 2KAIB 3RXVA 3M5OA 1C9PA 1O2OA 4NGAH 1GJAB 2R3YA 4B71A 1SGDE 2P3FH 4IC5A 5AVDA 4CRCA 5E0HA 4OS4A 1A3BH 1GI8B 5F03A 2PGQB 2R2MB 1O32A 3BV9B 5FX5A 4NFFA 1K1MA 2VGCB 3ATIA 4GUXA 4X8UH 5DP6A 1TX6A 1S6FA 4DOQA 4HFPB 5G4BA 4ZKNU 1BTHH 1Z6JH 5EG4A 3SJKA 1DSTA 1H9LB 1ZJKA 1GJ8B 1HV7A 1JWTA 1ZJDA 4A7IB 2OXSA 4ABBA 5E2PA 5IDKA 1MCTA 2FTLE 2NWNA 3ZZ7A 4CRFA 3FP6E 4WJG2 3A7VA 1V2WT 5DP4A 1C4Y2 1SGTA 3GY4A 2BY7X 3QO6A 3A8DA 2OINA 1PFXC 1ZGIA 1GPZA 4Y8XA 1FPCH 1O2VA 2OQUA 3OY6U 1PPGE 1V2NT 4MDSA 1PYTC 3VGCB 3UNRA 2FESH 1GVKB 4JYTA 4U2WA 1EP5A 3ZZ5A 1EASA 2TGDA 3UQVA 9ESTA 1QL9A 3STIA 1P57B 1BQYA 1ETTH 4HGCA 1GMCG 2H5DA 2ZIQH 1WOFA 1UTQA 1UHBB 1MBQA 1Y3WA 3BEUA 1UMAH 4DURA 1L4DA 1CA0C 3SNDA 1P0SH 1V3XA 1FY1A 3IWMA 4UONA 4LZ4B 1WAYB 1V2LT 4F4OC 1GI5A 1EX3A 3T27A 1C2EA 5JBCS 1O3IA 3FZDA 2AERH 2UWPA 4FU8A 4BAMB 1NM6A 1HAHH 2QYIA 1SGRE 3ENSB 1XVOA 1QY6A 3V0XA 4JYVH 1NC6A 1C2KA 1V2KT 3QN7A 3GCOA 4I32A 1Z71A 1YKTA 2OC0A 3LGIA 1EKBB 3SU4A 1P3EA 1RTLA 2Z3CA 2AEIH 3BG8A 1YGCH 5EGMA 2P95A 3ZYDA 4RKOB 1C1TA 2VVVA 2Z3EA 1TNIA 2Y80A 1B5GH 2QXHA 5GPIB 5K0HA 1TOCB 4FUDA 2BB4A 1A3EH 2P8OB 1CU1A 1AFQB 2Z9JA 1Z8GA 3PV4A 1O3MA 4KTSA 4XBBA 5FX6A 2P3TB 4I7YH 1D3TB 3K65B 3OTJE 5DK1A 4IMQA 3ZZCA 1P10A 5DP3A 1AUTC 1P02A 3FAOA 2FM2A 1E36B 2FDAA 3BN9A 3GY2A 1TOMH 3SUEA 1V2UT 4FUJA 1G3BA 1C1PA 1J14A 2D1JA 2ZTZA 5TJXA 3RMNH 1EPTC 2BOKA 2BTCE 5L30H 1DY8A 3GCTF 1ETRH 4CH2B 3M7TA 3KHVA 1ZTJA 4NIYA 5A8XA 1MQ5A 1HPGA 3UR9A 4X6PA 1TONA 3QLPH 1KXDA 3RXIA 1FY5A 5GCHG 3TK5A 2FP7B 3SO3A 1SFIA 1QGFA 1ZOMA 1TRYA 1GJ9B 2A2QH 1ABIH 3L6PA 2BQ7B 2NU4E 3A8CA 3SNAA 1AD8H 1O3AA 3BTKE 1HUTH 2CMYA 4JYUH 4D8NA 1UTKA 1N8OB 3LJJA 1O3NA 2EI6A 3PMJA 1TGSZ 3NUMA 2ANMH 2BQWB 3U8OH 2G5NA 1SI5H 5EODA 1A7SA 1IQKA 4ZMAH 1MZDA 2V3HH 5K7RA 3V13A 5FHTA 4YM9A 3O8RA 1TA2A 3KQEA 4KTCA 5AFZH 1BBRH 4X2WA 1AHTH 5AHGH 1ZHPA 3GY5A 2P93A 2XTTB 2FYQA 4FVDA 1CA0B 2ODYB 3NK8A 4TWWA 4INHA 2BDCA 3ZV8A 1C5RA 5L2ZH 1V6DA 2BDIA 1RGQA 1S83A 1XVMA 1LMWB 1LO6A 2FEQH 2W5EA 3AASA 1VR1H 2F9PA 3H5CB 1XUHA 5DO4H 3VEQB 1W0YH 3DFLA 2C8YB 2J4IA 4FUCA 3U69H 1Y3XA 1BBRK 1O35A 1O2YA 1QBOA 3MH4A 3ZYEA 4INLA 1O36A 3E0NB 1IHTH 4X6NA 4Y7AA 2XBYA 1MTNB 2QXGA 5FPTA 1F92A 1GHAG 1QB1A 1AB9C 2ZO3H 3E16B 4MPXA 4K1SA 1EB1H 4BAQB 3BTTE 1PPBH 3R3GB 1LQDB 2ILNA 5FCKA 3L33A 1EOLA 4MNVA 3MFJA 2TPIZ 4CBNA 5A2MH 3VB3A 2PUXB 1LPGB 1KXCA 1O5FH 3VB4A 2GMTB 4Q7YA 1EAUA 1RXPA 1HCGA 1MKXK 3M7QA 3TK9A 1QIXB 3SV2H 3EE0B 3LONA 2VWLA 2NU3E 1UCYE 2EEKA 2ODPA 1PPZA 1NRNH 5SGAE 4X2YA 4NA8A 1F0RA 4O03A 1XX9A 1FV9A 4RKJB 1K1OA 2HOBA 1W2KH 1S84A 1BMMH 3LH3A 4YOGA 1ANEA 5DG6A 1UTMA 5BPEA 1A0HB 3T5FH 2OBQA 1P3CA 1UK3A 1CHOG 1JRTA 2CHAC 3PWCA 2W26A 1XM1A 2ZEBA 1QA7A 2ZDMA 4TYDA 2Z7FE 1AWFH 3W95A 3RXQA 3IG6B 1GGDC 1BMNH 1UVPA 1DICA 1CHGA 2YNAA 1AFEH 4OS5A 4MLFB 1FY8E 1YLCA 2DE9A 1O3BA 1CT0E 2STBE 4U32A 1C5VA 2AMPA 5JB8S 2ZHDA 1F5KU 2ZWLH 3PM3A 3VB6A 1ELEE 1C5MD 1OOKB 1GDUA 2J34A 3RXHA 2UWOA 2W3KA 2VIVA 1A46H 4WXIA 3GYMA 1MU8B 1QB6A 1GBFA 2G51A 3LGTA 3MO3A 3OSYA 4HTCH 3VB7A 3S9AA 1ANCA 1ZTKA 4CR9A 4CRDA 1D9IA 2CV3A 2GD4B 1NO9H 1MKWH 1O3HA 1SR5C 2A7CA 1NU7B 1OPHB 5HM2A 4AG1A 2XBVA 1HB0B 1AVXA 1ZPCA 3OX7U 1SLUB 4Y11E 1P2MA 3DA9B 1ESAA 3SJOA 3RU4E 2ZGXH 5ABWA 1GJBB 5T6DA 2Y5HA 1FI8A 2R2WU 3ATKA 1GI1A 7LPRA 1Q31A 2H1UA 3EDXB 4TWYA 3M5MA 1MTNC 1LVBA 4A1XA 2HNTC 1T8OA 2GV7A 4KKDA 1O2SA 2QC2A 4X2VA 4NG9H 3U8TH 2ZCKP 3B9FH 4OS2A 3UREA 4WH8A 1TMBH 5T6GA 1J16A 1TNGA 4XFQA 2WPJS 4X8TH 1J17T 2H2ZA 3RLYH 1TPAE 2A45B 1MD8A 4KELA 1LVOA 1UTLM 2ZFSA 1BHXF 1EATA 2QIQA 3KEEA 5A0AE 3L3TA 1QRZA 2XWBI 1O33A 5EOKA 1NPMA 3SJ8A 4FVBA 2F9NA 3GY6A 4THNH 4YT6H 2TGTA 1CVWH 4FUHA 1BRUP 1DUAA 4ISNA 4K69A 3T26A 4AFZA 2BDAA 3RXJA 4Y0YE 4H6TA 1EZQA 1NRQH 2QF0A 1P05A 2WV4A 5A09A 1C5OH 4RN6A 1NFXA 1AWHB 1K28D 1XUKA 3QK1A 1PPFE 2ZFTA 4ABHA 1W14U 3GOVB 3SGAE 3EQ0H 3ATMA 3MNSA 1O2KA 1ZMJA 2ZPQA 4Y0ZE
chains in the Genus database with same CATH superfamily
2GX4A 3ZZ3A 1NT1A 1E1QD 1A5IA 2FX4A 1SMFE 1UCYH 1FPHH 2B8OH 1SGFG 1NFWA 1SQRA 1PJPA 1W8BH 4AYVB 2BY9X 3EAJA 2Y82A 8GCHG 4ZAEA 4RT0A 1E35B 4NWLA 1C5YB 2ZU2A 3PMHB 4ZKOU 2R9PA 2Z9KA 3BSQA 4K8YA 1TX8A 4ASUD 7ESTE 3CS7A 1DM4B 3KL6A 1OWHA 1RD3B 4CR5A 3RMMH 2A1DB 3P95A 2HNTF 3RP2A 3BTHE 2ZTXA 1ESTA 2Z6BD 2C8WB 3OEHD 1WQSA 1ELGA 4MTBA 2RDEA 2GT7A 2W6ID 1T4VH 3U9AH 4YOIA 1YPHE 2QCYA 1C2GA 2BLVA 2IN2A 1EOJA 3TK6A 3MU8A 2A5AA 4CBOA 1Q3XA 1AE5A 3MU0A 3ZZBA 2DUCA 3E90B 3PLBA 3S7HB 1C2DA 1QJ1B 2OC1A 3UNQA 1CGIE 1K21H 3P8NA 4DT4A 2ALVA 5EXMA 2KCPA 4FUEA 2XNIA 1OP8A 7GCHG 2IOTA 1HAYB 1MUEB 1SVPA 5LGOA 1P8VC 1ZMLA 1G3CA 1HIAA 4MG3A 1CBWC 1MQ6A 2AYWA 2Q6DA 1WSSH 1SHHB 1GBIA 1B0EA 1GI4A 1P04A 3RXMA 1GHXH 3URDA 1S6LA 3SU0A 2O9QA 1GWAA 4K60A 2M5TA 3SI3H 4ZHLU 3RXPA 1PYTD 1OYQA 1GMHG 3TH3H 1C5XB 3HGNA 1EZXC 1GJDB 4D7FA 1L1JA 3OE7D 2OLGA 1FMGA 1C1UH 1TGCA 4B74A 1TQ0B 4E06H 5IK2D 1GHYH 1VGCB 2J95A 3FKSD 2BDYA 2TRMA 2VWOA 1ELDE 1FJSA 4HI3A 5DP5A 1VJAU 5C0UA 2XC4A 2BX3A 2VGCC 3GCHC 2J38A 3H7OA 4GHQA 5ETXA 2NU2E 3LU9B 4WMEA 3UOUA 4BXWA 2BLWA 2XXLA 3S69A 4AN7A 3ZIAD 1TLDA 1V2JT 4K5ZA 2FTMA 3M61U 1F2SE 3TJVA 3TJUA 1CGJE 4Z1MD 3MQKC 1N6XA 3MH7A 4DW2U 2BQ6B 1E37B 1O2MA 1O34A 2VH0A 3IITA 2CK3D 2GCTC 2BD5A 2V3OH 3HK6B 2A4OA 4X8VH 2XYAA 4WY3A 1K1NA 4X1NU 1VITF 3BG4C 4YLQH 3AAVA 1TPSA 1FXYA 2WPLS 1TBZH 1DUEA 1Z6EA 3BTQE 1UVOA 3SQHE 1DY9A 2VIQA 5HM9A 3PB1E 1DDJA 3BTGE 1KY9A 4KTUA 3M37A 1T31A 5F53A 2QF3A 1HAVA 1U6QA 1C5SA 1YPLH 2EI8A 2ZDNA 2V0BA 3HPTB 1IQHA 4NA7A 6CHAC 1F5RA 4JZFH 1XUFA 3NWUA 5BRRE 1ELTA 4Y79A 2STAE 3TU7H 5A0CA 3C27B 5GDSH 5T3HA 4JCNA 2A0QB 4J1YA 4OM9A 3S7KB 1GVLA 2JH5D 4X1QU 3S9BA 1TWXB 3F2GA 3S0NA 4I8JA 4ABIA 1SQAA 3PWBA 4MNYA 2BYAX 4OGXA 1GBJA 4ASHA 3CS0A 4A6LA 1ZSJA 1LHGH 2TBSA 5JBTA 2ZGHA 6CHAB 2ZQ1A 3A7WA 1NS3A 5C1XA 2W7SA 1GBCA 4CRAA 1L1NA 2QN5T 2OUAA 4ISOA 3M36A 2WV5A 1BTXA 1OHHD 1C2IA 2ZA5A 1GCTC 1A0JA 3TVJB 2PP6A 1DS2E 3SV8A 3MWIU 1LTOA 1GVZA 1AKSB 3SNEA 1FLEE 1YWUA 3TITA 2K1QA 3SNCA 1YLDA 1HIAB 2WPHS 1HYLA 1BZXE 3TIUA 3M5NA 1ZLRA 2VH6A 1TNHA 1MKWK 4ZXXH 2BVXH 5HGGA 1GI6A 2XNDD 1DXPA 1GI0A 1GHBF 3OYPA 1GBBA 4FUGA 4GHTA 3U28C 1J15A 2Y5GA 2SGQE 3QX5H 4SGAE 3VB5A 1AFQC 3ITIA 1YBWA 1ELFA 1OWEA 4H6SB 1KLJH 1HAIH 3ELAH 3RDZA 4GCHF 1TYNA 5HXFA 3UR6A 3Q77A 1MABB 2BD7A 2PTNA 4IW4E 1VGCC 1SL3A 1LCYA 1X7AC 1BA8B 4F48B 3RUOA 3LGUA 2KZ4A 3A85A 1TPOA 5LH8A 1XXFA 3F1SB 2GCHG 1HAZB 3KYFA 6GCHG 1YPEH 4NSVA 3M35A 3SGBE 3LOXA 1D3DB 1C4U2 1H1BA 1T8MA 2H9TH 4I8HA 5HKKD 1C1VH 4H42U 4CH8B 1Y3YA 3M3VA 3MH5A 2ZGBH 4NIWA 1DWEH 2TIOA 5FBEA 3BTWE 2BX4A 1H9IE 1BTZA 1PPCE 2RA3A 5CE1A 1O31A 4E7RG 4X6OA 4YO9A 3PV5A 3N7DA 1PQAA 3ZZAA 1THSH 3MH6A 4OGYA 3EA9A 4WH6A 1HJ8A 1YCPK 1P09A 1RJXB 2GTBA 5I25A 1F0UA 2AFQB 3DT0H 4ZKRU 1AGJA 1O5BB 1T4UH 4AOQA 3F6UH 1RS0A 2C4FH 3Q76A 5F8TA 2H9EH 1GBDA 4YOJA 3QDZB 3F9HA 2PHBA 4NFEA 1CGHA 1O2TA 1MTWA 3ATLA 3UPEA 3U98H 1BRBE 2BLQA 2CF9H 2AIQA 5A8YA 4ABAA 1GGDB 5FAHA 1SOTA 1HDTH 2P3UB 2FPZA 2PKAA 3TH2H 1O5AB 3KQ5A 1QBVH 1GCTB 2QXJA 1THRH 4I31A 1PPHE 4P00A 1O2RA 2BD8A 5HIZA 1EJMA 2FX6A 1OWJA 4CHAC 2BD2A 2ALPA 1CBWB 2VVUA 1QCPA 2O8WA 3MNXA 1SFQB 2FOAA 2XWAA 3FFGA 5EJ1A 3A8AA 2YNBA 3OEED 3D23A 4LK4A 1VKYA 2ESTE 2ZHEH 5C94A 2EY4C 1ZPBA 2G81E 5LPRA 1NY22 4K3JA 4MNWA 2ZU5A 5ESTE 2ZDAH 1MTSA 3MI4A 1IQMA 1C1MA 1EXFA 1GBHA 2BLOA 2VBCA 1G2LA 1VCWA 1A61H 1GBTA 1MBMA 1O3CA 2PKSC 2OCVB 2WPKS 2XW9A 3RXDA 3T2NA 1DOJA 1JIRA 3RM0H 3SUDA 8KME2 1NFYA 2BVSH 3A7YA 2Q6FA 3FANA 4YXWD 2JIZD 1UW7A 3O8BA 2C8XB 2VB0A 1ZTLA 1QBNA 1GMDG 1AE8H 2ZI2H 3BG4B 2A4GA 3URCA 3RMLH 4DIIH 1AB9B 1JXPA 1AU8A 3A88A 1SQOA 3KYGA 5CHBA 2FODA 3UFAA 1AO5A 4Q2KA 1NRSH 4YT7H 1SB1H 1IQNA 1O3EA 3T25A 3RC6A 3KQDA 1ORFA 4BTIB 3HK3B 3RXTA 1BTWA 2B5TB 5EQRA 2KCAA 1GHZA 4ESTE 2HPQH 1SG8B 2HRVA 2F9OA 2QXIA 3A7TA 1D4PB 2F9VA 3P8GA 2KR7A 3NKKA 1JIMA 3SN8A 2O8UA 5A0BA 5JB9S 1O3FA 2PV9B 1YPHC 2IJD1 1IAUA 1LHDH 1MMJN 4O9VA 1TQ7B 1HJ9A 2JETB 4YZUA 1UTPA 2PWXA 2VWMA 2J9NA 4JZEH 4NZQA 3HATH 3RU4D 2JH6D 3BTEE 4JMYA 3RXAA 3CENA 4J2YB 1EZUC 4Y76A 2PFEA 1H8IH 3FP8E 2J92A 2B0FA 4NSYA 1GHVH 3RXRA 2FMJA 3SHAH 4INKA 2KCOA 1NROH 4Y8YA 1SLVB 4XBDA 2VIOA 4ZROA 4AFUA 1K1PA 1QA0A 2DE8A 5FPSA 1Z7KA 4AG2A 4X1PU 2GDEH 2VIPA 4ABDA 3ZZDA 1C5NH 1EAIA 2GCTB 1EJAA 2XCNA 3RLWH 3M3TA 1WV7H 2UUFB 4I8LA 3P92A 2YMSC 1KYNA 2PKAB 2EC9H 2GT8A 3SBKA 1BUIA 1C1QA 1MZAA 3RXFA 2FI5E 2HPPH 2UWLA 1SQTA 1BOQA 3SGQE 4DGJA 2FYRA 1IHSH 3D62A 2IPQX 1YPGH 5DSFA 2ZFRH 1BTYA 1O3LA 1YLNA 4B2AA 1BB0B 5EQQA 1AUJA 1O3KA 1OX1A 2VWNA 4IC6A 3RXUA 4D9QA 1XUJA 1JMOH 1L0ZA 3ODFA 2UUKB 2PTCE 3CP7A 4MQAA 3I78A 1QJ6B 4UD9H 4Y7BA 4NA9H 2VU8E 1OYTH 2AMQA 2ZCLP 2C90B 1HJAC 4IBLH 4ABGA 4FU9A 2FI3E 2XC5A 3I29A 1TNLA 3UAIC 4GLYA 4O97A 3H7TA 5LPFA 1ZPZA 4Y8ZA 4JK6A 1ZYOA 2VINA 3GDUA 4Z6AH 1F7ZA 3RXEA 1JOUB 1IQGA 3SHCH 1B0FA 1O2ZA 2VVCA 1SC8U 1NESE 1UTNA 3ODDA 1GMCF 4XBCA 3FZZA 2AGEX 4WMDA 1F5LA 4F49A 1O2QA 3PO1B 3BTFE 3ZZ9A 3K9XB 4QT8C 4NIVA 1LHFH 3I77A 3GS9A 3T62A 2FOEA 1UTJA 4I8KA 1MTUA 1JBUH 1RTFB 2CF8H 4ABFA 1FNIA 2RA0A 1MH0A 4D7GA 1IQIA 4K1TA 1FDPA 1IQEA 3AAUA 1DE7H 1O3PB 1T7CA 5C0TA 2D8WA 1S0RA 2G55A 5FCRA 4A5TS 1EUFA 1QL7A 2GVFA 1GBMA 1SGFA 2J5UA 1K1JA 4LOYH 4D76A 3MOCA 2GP9B 1NZQH 4U30A 3MU1A 3LDXH 1KXEA 2CJIA 4O3TA 3SI4H 3RXOA 3LJOA 4AGJA 3UIRA 2H9HA 5AF9H 3F2HA 3NZIA 1UO6A 2V6NA 2PGBB 2FZZA 3W1EA 3TPIZ 1CO7E 3BIVH 1C5LH 3RC4A 2GV6A 2JJ2D 2QGRA 3ZVAA 1V2VT 4ISIH 3ATWA 4RT1A 2GMTC 1C5ZB 4KP0A 5DPAA 3ZVCA 4MPVA 2FLRH 2WHXA 2ZU1A 3E0PB 2WUBA 3U1IB 1A5GH 4K2YA 3VFEA 4I33A 4E7NA 1QHRB 3A86A 1VCQA 2BXUH 3QUMP 2GZ9A 4TPIZ 4Z0KA 4ZUHA 2GDDA 1FN8A 2LNCA 1CT4E 2ANKH 3EA7A 1ZHRA 1MCVA 3HKJB 2OP9A 1KTSB 1C5UA 3MO9A 1HXEH 1TMTH 1GL0E 1P2KA 2F9UA 4JZIA 4FETA 2P59A 1ARCA 1G9IE 3GCTG 1C5PA 2F9BH 2AGIX 5EJLA 1DWDH 4YESB 2ZZUH 5DGJA 1TNJA 1O2LA 3ZVGA 1DSUA 1O2JA 4ISHH 2CGAA 2FOMB 2OBOA 1SLXB 1SOZA 1UK4A 3RXBA 5GCHF 1V2MT 2K8IA 1O39A 1E34B 1Y59T 4ABEA 1OWKA 1C5QA 1P2IA 2THFB 4M7GA 1HGTH 5JDUB 1XUIA 1PQ5A 1OSSA 1SLWB 1AZZA 1QB9A 1DLKB 2CN0H 3RXSA 1EB2A 1OWIA 1GBKA 1HAPH 3KQCA 2QE7D 3LT3A 3W94A 2OD3B 2P16A 1XKBC 3PRDA 1YY3A 1TGNA 2WYGA 1TBQH 1KSNA 2HALA 1C1NA 1C5TA 2O8MA 5C67A 1CA8B 3K6ZA 1HNEE 3RXGA 2Y6TA 1UVUH 1T32A 3JZ2B 3DHKH 1ANDA 1DWBH 3F2FA 4DY7B 3MNCA 1OS8A 3UTUH 1BMAA 1QNJA 2RG3A 1EJNA 2VIWA 2G4TA 4B2CA 1QFKH 1W7GH 3O8DA 4BTUB 1AQ7A 1EQ9A 3N7OA 1ZRKA 1F0TA 3LKWA 1DFPA 2QF5A 1GL1A 2BDGA 2BOHB 1O3GA 5EIYA 3LC3A 4IS5A 1AMHA 1TRMA 1ELAA 1NBMD 2LP6A 2RCEA 4Y10E 3ZZ8A 2FOCA 1FIZA 1RIWB 3BF6H 4ZKSU 3E8LA 3RM2H 5TCCA 1DPOA 5T6FA 1C9TA 1GHAF 2UUJB 1HJAB 4B75A 2FOGA 3UB0A 3STJA 5J4QA 1HAVB 1C1RA 7KMEH 3SNBA 3LGWA 1QRWA 1ELCA 2I6SA 1O38A 3P17H 3T29A 4Q7XA 1LPKB 3EA8A 2BDBA 1KXAA 2A31A 2I6QA 4MPUA 2R0KA 4BANB 4MPWA 3Q00A 5EJZA 3TJNA 1VJ9U 2WPIS 1DLEA 1NU9A 1P9UA 4KGAA 1EAWA 1HLTH 2SGAA 4CREA 3DSPA 1AVGH 1NRPH 1H8DH 2C93B 4OS1A 3FP7E 3PLKA 2HVYB 1W13U 2ZPSA 3SV7A 1AIXH 1ZR0A 2ZKSA 1C4V2 4UFDH 1O2GH 2BY5X 4O3UA 1EPTA 4Y6DA 3FVFB 1LKBA 4X8SH 1WUNH 1ESBA 2O8LA 2QA9E 1NBME 2PLXA 2A4RA 1O37A 1P11E 1XMNB 1O2UA 5EXNA 4TPYA 1GCDA 4FU7A 3GY7A 4IN1A 3UOPA 2KM0A 2BY6X 1SGCA 1CHOF 5KGOA 1AKSA 1KDQB 1ID5H 2FXRA 1IQLA 1BBRE 2M2AA 3NXPA 3GCNA 5C2ZA 5C5NA 1IQFA 1GBAA 3Q3XA 1ARBA 3F0PA 3PYHA 1LHCH 1Y5UT 5HMAA 2A5KA 3BTME 4UE7H 1RTKA 2KAIA 1K1LA 2Q1JA 2XBWA 1TALA 3M7UA 2ZCHP 3ZVFA 2F83A 5E2OA 1YM0A 1YYY1 4OS6A 1FX0B 2ZF0H 2H6MA 1BCUH 3GDVA 1UK2A 1N8OC 1O5DH 1KTTB 4ZH8A 2A2XH 1DVAH 3VGCC 1C1SA 3SUGA 1YF4A 2QAAA 1O5EH 1QTFA 2IPHA 3AVZA 1W0ZU 1Y5AT 4AX9H 1GDQA 2ZC9H 3A7ZA 8LPRA 2G5VA 3A83A 1O0DH 1NN6A 1C2LA 2FWWA 1ELVA 1KMHB 5EPYA 2F91A 5H4IB 3F9GA 2FOBA 3R0FA 3Q3YA 1GBEA 1OKXA 5EW1H 2ULLA 4ABJA 2PKSB 3PMAB 4A1TA 2GZ7A 1WCZA 2BZAA 1OXGA 4H4FA 4RSPA 1P2OA 5C1YA 3BEFB 5CMXH 1O2IA 3NPSA 3DD2H 3C1KA 1ZZZA 3QGJA 3UNSA 1THPB 1XKAC 1W12U 4LZ1H 1D3PB 1LPZB 1P12E 4AFSA 1NFUA 1UVSH 2G8TA 2KX4A 1TRNA 1O3DA 1P2JA 1G32B 3F9EA 1V2QT 1W7XH 1BDAA 1TGTA 3GDSA 4FUBA 2FLBH 4DCDA 3EYDA 1FQ3A 1OP2A 3SZNA 4CHAB 3A84A 8ESTE 1UHBA 5J4SA 1ZGVA 2ZG0H 3K2UA 1NRRH 4BNRA 5C20A 1CSOE 2Y81A 3K6YA 1TIOA 1ACBE 4Q7ZA 2HGTH 3HGPA 1KXBA 1KIGH 2ZU3A 2FI4E 4VGCB 4GVUA 5CHAB 2BD4A 1BJUA 2GGVB 1S5SA 1CE5A 1EPTB 4NCYA 1SGNE 5EQSA 1MAXA 2SFAA 1SGYE 1O5CB 5L6NH 4X1RU 4DT7B 4D9RA 3TGJE 1GDNA 4SGBE 3A7XA 1FN6A 2SGDE 4GSOA 1ZMNA 3U1JB 5FXLA 4BAHB 1W11U 1OWDA 5DP7A 2XRCA 4AYYB 1ETSH 1O2WA 4E05H 2A7HA 2B9LA 2G00A 2ZP0H 3AW0A 2EA3A 1V2TT 1SPJA 3KGPA 2SNWA 1H9HE 3OU0A 4ISLA 1W10U 3F68H 1S82A 1IQJA 2D2DA 2V3MA 1TX7A 4XDEA 2P8OC 1SGPE 1SHYA 1G36A 3PTBA 5ESBA 3V7TA 1TNKA 1UVTH 2XCFA 1YPKH 3LGYA 8GCHF 1RFNA 2PSYA 1K22H 1O3JA 1A5HA 1GI9B 1WQVH 1YCPM 3SORA 9LPRA 3EGKH 4AB9A 1G2MA 2L74A 2WZQA 1O2NA 3E3TA 3TH4H 3MU4A 2TGPZ 3P8OA 2WINI 1V2OT 3MMGA 3PROA 4UEHH 1VZQH 1HAGE 1C2MA 2XC0A 1HRTH 3HKIB 1PQ8A 3D65E 3MYWA 1GJ5H 2Z9LA 1AY6H 1ZSKA 1ANBA 3A80A 1C5WB 1L2EA 1UCYK 1TA6A 4AFQA 3SOSA 2V35A 4GAWA 1V2RT 1H4WA 2QV1A 1YPMH 4PROA 3SUFA 1DX5M 2ZGCA 2OC8A 2ZHWH 3A82A 4JZ1A 4AGKA 3KNXA 2R3UA 4ACAA 1TAWA 1K2I1 1BHXB 1XXDA 5E8EH 2ZFPH 4AB8A 3GYLB 1O2XA 3SJIA 1BMLA 1BRCE 1K1IA 1LHEH 4X6MA 5FPYA 3ZV9A 7GCHF 2Y7ZA 4XOJA 5JBAS 4FUIA 5F6MA 2QF4A 3RC5A 4YTAA 5I46H 1GG6C 1G37A 1BMFD 1EZSC 2UUYA 4WVPE 3RXLA 3SV9A 4NIXA 4TY7A 2OC7A 2OTVA 2Y5FA 2D26C 4HZHA 4VGCC 3SW2B 5GJ4B 2HNTE 1GMHF 4WWYA 3KF2A 2WPDD 3BIUH 1WTHD 3QWCH 5GWZA 1YC0A 2SGPE 1GBLA 2BD9A 5JBBS 1INCA 4R8TB 2CHAB 3MTYA 1O2HA 1W3CA 1TGBA 2BVRH 3OTPA 2W7UA 4YLUA 2ZQ2A 3LPRA 2GKVE 3A89A 3FO8D 4DG4A 5C1UA 5E0JA 1QZ8A 1AZ8A 4DVAU 2WYJA 4IN2A 3UWIA 2WV9A 3TGIE 4DIHH 4BAKB 2Z94A 3KIDU 3KQBA 2ZPRA 1BRAA 4ZCNA 2J98A 2LPRA 2RDLA 1SKYE 2YMSD 3QZQA 4BXSA 1O5GH 1P9SA 1QR3E 3P6ZB 4I8GA 4NZLA 2ZFFH 1RRKA 4NWKA 1E38B 1C1OA 1L4ZA 1GJ4H 5IYTA 3ZVDA 3TNSA 4XRNA 1F0SA 1VITG 2OK5A 1T8LA 2HLCA 3B8JA 5C3NA 1LVYA 1MKXH 1E0FD 4K8BA 1TBRH 2QY0B 3MU5A 5A8ZA 4BTTB 1YPJH 1QQ4A 3A81A 5L2YH 2W3IA 1KLIH 1HAOH 4UFFH 4P02A 3A8BA 4R0IA 1YP9A 1VITH 3U8RH 1W0KD 2A5IA 3V12A 2BY8X 1WYKA 1YCPH 2VIDA 1B7XB 1V2ST 2R0LA 3DUXH 4X2XA 2J2UA 4B73A 5DP9A 2VJ1A 5E0GA 1FY4A 4CRGA 1G3EA 1DANH 4UFEH 5DJ7A 2F3CE 1E79D 1TE0A 4MNXA 1P2QA 4UDWH 1WU1A 3V3MA 4I86A 1FAKH 2J94A 2OQ5A 1Z1JA 1VCPA 3VXFH 4A92A 3VPKA 1D6RA 4LXBH 2ZGJA 1WBGB 2VNTA 3GCHB 1TABE 4ZHAA 4K1EA 2J97A 2WPMS 3AW1A 1Q2WA 1O2PA 4ACBA 4B1TA 1GHWH 3ESTA 1EAXA 3SJ9A 1XUGA 3WWFA 2Z9IA 2JH0D 1D3QB 3AK5A 3QGNB 2NU1E 4FUFA 1HXFH 3SU6A 4WF8A 2AS9A 3E6PH 1HAXB 4DJZB 2ZU4A 1IOEA 5PTPA 3QTOH 4XSKU 2EI7A 2JETC 3N99A 1GJCB 1P03A 1BT7A 3M5LA 3NCLA 1J8AA 3TJOA 3DFJA 1DT2A 4AZ2B 1ZRBA 1W0JD 1GHBG 2F43B 1LKAA 2ZHFH 5EW2H 1C2FA 1SSXA 2O8TA 1FUJA 2FS9A 3RXCA 4AC9A 2FS8A 5FBIA 1PPEE 2BDHA 5EPNA 1Z8IB 1GJ6A 2Y7XA 4M9FA 4GCHG 5HYOA 1JRSA 3SZEA 1P2NA 3WY8A 1EP6A 1Z8RA 4X1SU 5C5OA 2Z3DA 2BZ6H 1G3DA 1HBTH 3G01A 2GZ8A 3LGVA 1AN1E 5GXPA 2BD3A 2GCHF 3ZZ6A 4TY6A 2CXVA 1P06A 3GICB 6GCHF 1O30A 1Y3UA 1S81A 3SU5A 2BM2A 2XBXA 3D49H 3UWJH 2P94A 4JZDH 2Q6GA 5CHAC 4IGDA 2BMGB 4JK5A 3SV6A 1K9OE 2ANYA 1C2HA 2FIRH 1AI8H 1KLTA 3GY3A 1T8NA 2SGEE 5F8ZA 4WXVA 4ZHMU 3E91A 4X0WU 3UQOA 1A2CH 1DWCH 2FO9A 4UFGH 1GI2A 1TMUH 1RIWC 4BOHA 1LQEA 1QL8A 3PTNA 1TFXA 1P01A 3KCGH 2IJOB 2HVXA 3MNBA 1WXRA 3SU2A 3ZZ4A 2ZDLA 6LPRA 1D6WA 1Z8JB 2B7DH 3PLPA 2ZDVH 3S9CA 3ZVEA 2SGFE 1A0LA 1SBWA 2WUCA 3T28A 1FY3A 1G30B 2JKHA 4RI0A 1Y8TA 1MTVA 1SGIB 1WTGH 4HG6A 2AIPA 4AORA 3GISB 3KN2A 3O8CA 2C8ZB 3A87A 1MU6B 1TB6H 2ODQA 4Q80A 3QTVH 1O3OA 3TGKE 5GIBA 5LPEA 3BEIB 1QJ7B 1HFDA 1A4WH 2PSXA 4OS7A 1BITA 3WWBA 1BIOA 3P70B 3FOAA 1L1GA 2ZFQH 2FOFA 4Y71A 3P8FA 4IMZA 3TNTA 3E1XB 1GI7B 2ANWA 1GG6B 2PW8H 1K0HA 3F9FA 5EXLA 1S0QA 2G52A 5C17A 1PQ7A 1NTPA 1TPPA 3RXKA 5B6OA 4XE4A 1GI3A 2NU0E 2A32A 1GJ7B 2ZECA 2AMDA 3UUZA 1BTUA 2A4QA 1WDIA 5TCAA 1CT2E 3LIWA 5KECA 2G4UA 1DITH 1C1WH 2AHME 1AVWA 2TGAA 1E1RD 1QRXA 2C3SA 5JYIA 1UTOA 2ASUB 3SU3A 1SGEE 4B76A 1BJVA 1KXFA 4MVNA 2XOKD 1FAXA 1N6YA 1Y5BT 2PUQH 2YOLA 2FOHA 3QZRA 2AH4X 4FXGH 3SU1A 1V2PT 3ZVBA 1Z1IA 2ZTYA 4GPGA 1DXWA 2A7JA 1MAYA 1A1RA 2ZHQH 3PO1C 1GMDF 3LH1A 1QQUA 1S6HA 5AFYH 4ZXYH 4CRBA 1LDTT 1ABJH 2ZNKH 3GY8A 1N1LA 1FONA 1QURH 3B23B 2W6JD 5EU8A 2BXTH 6ESTA 1MD7A 1ZHMA 3Q3KA 3TLOA 1BTPA 1M9UA 3OY5U 3RU4T 2SNVA 2PR3A 1CQQA 1S85A 1UJ1A 1C2JA 5DP8A 3RMOH 3SQEE 2BHGA 3LC5A 2AGGX 3MHWU 3N7EA 4B2BA 2H5CA 1KDQA 3BTDE 3DSOA 3MO6A 1LVMA 1ELBA 2HWLB 2Z9GA 3M3SA 3PMBB 1ZSLA 4A1VA 5DKMA 1FZZA 5GNDA 1FIWA 3UY9A 3JZ1B 5F8XA 4U01A 3VXEH 1OP0A 1SGQE 1J9CH 5JPMH 4BAOB 2ZDKA 1Y3VA 4WMFA 2KAIB 3VG8A 3RXVA 3M5OA 1C9PA 1O2OA 4NGAH 2YMSB 1GJAB 2R3YA 4B71A 1SGDE 2P3FH 4IC5A 5AVDA 4CRCA 5E0HA 4OS4A 1A3BH 1GI8B 5F03A 2PGQB 2R2MB 1O32A 3BV9B 3PV2A 5FX5A 4NFFA 1K1MA 2VGCB 3ATIA 4GUXA 4X8UH 5DP6A 4F55A 1TX6A 1S6FA 4DOQA 4HFPB 5G4BA 2V7QD 4ZKNU 1BTHH 1Z6JH 5EG4A 3SJKA 1DSTA 1H9LB 1ZJKA 1GJ8B 1HV7A 1JWTA 1ZJDA 4A7IB 2OXSA 4ABBA 5E2PA 5IDKA 1MCTA 2FTLE 2NWNA 3ZZ7A 4CRFA 3FP6E 4WJG2 3A7VA 1V2WT 5DP4A 1C4Y2 1SGTA 3GY4A 2BY7X 3QO6A 3A8DA 2OINA 1PFXC 1ZGIA 1GPZA 4Y8XA 1FPCH 1O2VA 2OQUA 4TT3D 3OY6U 1PPGE 1V2NT 4MDSA 1PYTC 3VGCB 5FL7D 3UNRA 2FESH 1GVKB 4JYTA 4U2WA 1EP5A 3EE7A 3ZZ5A 1EASA 2TGDA 3UQVA 9ESTA 1QL9A 3STIA 1P57B 1BQYA 1ETTH 4HGCA 1GMCG 2H5DA 2ZIQH 1WOFA 1UTQA 1UHBB 1MBQA 1Y3WA 3BEUA 1UMAH 4DURA 1L4DA 1CA0C 3SNDA 1P0SH 1V3XA 1FY1A 3IWMA 4UONA 4LZ4B 1WAYB 4B6EA 2KCYA 1V2LT 4F4OC 1GI5A 3PRBA 1EX3A 3T27A 1C2EA 5JBCS 1O3IA 3FZDA 2AERH 2UWPA 4FU8A 4BAMB 1NM6A 1HAHH 2QYIA 1SGRE 3ENSB 1XVOA 1QY6A 3V0XA 4JYVH 1NC6A 1C2KA 1V2KT 3QN7A 3GCOA 4I32A 1Z71A 3F3BA 1YKTA 2OC0A 3LGIA 1EKBB 3SU4A 1P3EA 1RTLA 2Z3CA 2AEIH 3BG8A 1YGCH 5EGMA 2P95A 3ZYDA 4RKOB 1C1TA 2VVVA 2Z3EA 4XD7D 1TNIA 2Y80A 1B5GH 2QXHA 5GPIB 5DN6D 5K0HA 1TOCB 4FUDA 2BB4A 1A3EH 4Q63A 2P8OB 1CU1A 1AFQB 2Z9JA 1Z8GA 5T1VA 3PV4A 1O3MA 4KTSA 4XBBA 5FX6A 2P3TB 3NRLA 4I7YH 1D3TB 3K65B 3OTJE 5DK1A 4IMQA 3ZZCA 1P10A 5DP3A 1AUTC 1P02A 3FAOA 2FM2A 1E36B 2FDAA 3BN9A 3GY2A 1TOMH 3SUEA 1V2UT 4FUJA 1G3BA 1C1PA 1J14A 2KFWA 2D1JA 2ZTZA 5TJXA 3RMNH 1EPTC 4FOUC 2BOKA 2BTCE 5HIYA 1DY8A 5L30H 3GCTF 1ETRH 4CH2B 3M7TA 3KHVA 1ZTJA 4NIYA 5A8XA 1MQ5A 1HPGA 3UR9A 4X6PA 1TONA 3QLPH 1KXDA 3RXIA 1FY5A 5GCHG 3TK5A 2FP7B 3SO3A 1SFIA 1QGFA 1ZOMA 1TRYA 1GJ9B 2A2QH 1ABIH 3L6PA 2BQ7B 2NU4E 5B6LA 3A8CA 3SNAA 1AD8H 1O3AA 3BTKE 1HUTH 2CMYA 4JYUH 4D8NA 3OAAD 1UTKA 1N8OB 3LJJA 1O3NA 2EI6A 3PMJA 1TGSZ 3NUMA 2ANMH 5CDFE 2JJ1D 2BQWB 3U8OH 2G5NA 1SI5H 5EODA 1A7SA 1IQKA 4ZMAH 1MZDA 2V3HH 5K7RA 3V13A 5FHTA 4YM9A 3O8RA 1TA2A 3KQEA 4KTCA 5AFZH 3SYJA 1BBRH 3F0OA 4X2WA 1AHTH 2HLDD 5AHGH 2EQNA 1ZHPA 3GY5A 2P93A 2XTTB 3OFND 2FYQA 4FVDA 1CA0B 2ODYB 3NK8A 4TWWA 4INHA 2BDCA 3ZV8A 1C5RA 5L2ZH 1V6DA 2BDIA 1RGQA 1S83A 1XVMA 1LMWB 5KEDA 1LO6A 2FEQH 2W5EA 3AASA 1VR1H 2F9PA 3H5CB 1XUHA 5DO4H 3VEQB 2J98B 1W0YH 3DCLA 3DFLA 2K0QA 2C8YB 2J4IA 4FUCA 3U69H 1Y3XA 1BBRK 1O35A 3FN8A 1O2YA 1QBOA 3MH4A 3ZYEA 4INLA 1O36A 3E0NB 1IHTH 4X6NA 4Y7AA 2XBYA 1MTNB 2QXGA 5FPTA 1F92A 1GHAG 1QB1A 1AB9C 2ZO3H 3E16B 4MPXA 4K1SA 1EB1H 4BAQB 3BTTE 1PPBH 3R3GB 1LQDB 2ILNA 5FCKA 3L33A 1EOLA 4MNVA 3MFJA 2TPIZ 4CBNA 5A2MH 3VB3A 2PUXB 1LPGB 1KXCA 1O5FH 3VB4A 2GMTB 4Q7YA 1H8HD 1H8ED 1EAUA 1RXPA 1HCGA 1MKXK 3M7QA 3TK9A 1QIXB 3SV2H 3EE0B 3LONA 2VWLA 2NU3E 1UCYE 2EEKA 2ODPA 1PPZA 1NRNH 5SGAE 4X2YA 4NA8A 1F0RA 4O03A 1XX9A 1FV9A 4B6FA 4RKJB 1K1OA 2HOBA 1W2KH 1S84A 1BMMH 3LH3A 4YOGA 1ANEA 5DG6A 1UTMA 5BPEA 1A0HB 3T5FH 2OBQA 1P3CA 1UK3A 1CHOG 1JRTA 2CHAC 3PWCA 2W26A 1XM1A 2ZEBA 1QA7A 2ZDMA 4TYDA 2Z7FE 1AWFH 3H09A 3W95A 3RXQA 3IG6B 3CNRA 1GGDC 1BMNH 1UVPA 1DICA 3DSGA 1CHGA 2YNAA 1AFEH 4OS5A 4MLFB 1FY8E 1YLCA 2DE9A 1O3BA 1CT0E 2STBE 4U32A 1C5VA 2AMPA 5JB8S 2ZHDA 1F5KU 2ZWLH 3PM3A 3VB6A 1ELEE 1C5MD 1OOKB 1GDUA 2J34A 3RXHA 2UWOA 2W3KA 2VIVA 2F4LA 2LELA 1A46H 4WXIA 3GYMA 1MU8B 1QB6A 2L6OA 1GBFA 2G51A 3LGTA 3MO3A 3OSYA 4HTCH 3VB7A 3S9AA 1ANCA 1ZTKA 4CR9A 4CRDA 1D9IA 2CV3A 2GD4B 1NO9H 1MKWH 2JDID 1O3HA 1EFRD 1SR5C 2A7CA 1NU7B 1OPHB 5HM2A 4AG1A 2XBVA 1HB0B 1AVXA 1ZPCA 3OX7U 1SLUB 4Y11E 1P2MA 3DA9B 1ESAA 3SJOA 3RU4E 2ZGXH 5ABWA 1GJBB 5T6DA 2Y5HA 1FI8A 2R2WU 3ATKA 1GI1A 7LPRA 1Q31A 2H1UA 3EDXB 4TWYA 3M5MA 1MTNC 1LVBA 4A1XA 2HNTC 1T8OA 2GV7A 4KKDA 1O2SA 2QC2A 4X2VA 4NG9H 3U8TH 2ZCKP 3B9FH 4OS2A 3UREA 4WH8A 1TMBH 5T6GA 1J16A 1TNGA 4XFQA 2WPJS 4X8TH 1J17T 2H2ZA 3RLYH 1TPAE 2A45B 1MD8A 4KELA 1LVOA 1UTLM 2GJGA 2ZFSA 1BHXF 1EATA 2QIQA 2RFKC 1COWD 3KEEA 5A0AE 3L3TA 1QRZA 2XWBI 1O33A 5EOKA 1NPMA 3SJ8A 4FVBA 2F9NA 3GY6A 4TSFD 4THNH 4Q4LA 4YT6H 2TGTA 1CVWH 4FUHA 1BRUP 1DUAA 4ISNA 4K69A 3T26A 4AFZA 2BDAA 3RXJA 4Y0YE 4H6TA 1EZQA 1NRQH 2QF0A 1P05A 2WV4A 5A09A 1C5OH 4RN6A 1NFXA 1AWHB 1K28D 1XUKA 3QK1A 1PPFE 2ZFTA 4ABHA 3WW7A 1W14U 3GOVB 3SGAE 3EQ0H 3ATMA 2WSSD 3MNSA 1O2KA 1ZMJA 2ZPQA 4Y0ZE
chains in the Genus database with same CATH topology
2GX4A 3ZZ3A 1NT1A 1A5IA 2FX4A 1SMFE 1UCYH 1FPHH 2B8OH 1SGFG 1NFWA 1W8BH 1PJPA 4AYVB 2BY9X 3EAJA 2Y82A 8GCHG 4ZAEA 1E35B 4NWLA 1C5YB 2ZU2A 3PMHB 4ZKOU 2R9PA 2Z9KA 3BSQA 4K8YA 1TX8A 7ESTE 3CS7A 1DM4B 3KL6A 1OWHA 1RD3B 4CR5A 3RMMH 2A1DB 3P95A 2HNTF 3RP2A 3BTHE 2ZTXA 1ESTA 2Z6BD 2C8WB 1WQSA 1ELGA 4MTBA 2GT7A 1T4VH 3U9AH 4YOIA 1YPHE 2QCYA 1C2GA 2BLVA 2IN2A 1EOJA 3TK6A 3MU8A 2A5AA 4CBOA 1Q3XA 1AE5A 3MU0A 3ZZBA 2DUCA 3E90B 3PLBA 3S7HB 1C2DA 1QJ1B 2OC1A 3UNQA 1CGIE 1K21H 3P8NA 2ALVA 5EXMA 4FUEA 2XNIA 1OP8A 7GCHG 2IOTA 1HAYB 1MUEB 1SVPA 5LGOA 1P8VC 1ZMLA 1G3CA 1HIAA 4MG3A 1CBWC 1MQ6A 2AYWA 2Q6DA 1WSSH 1SHHB 1GBIA 1B0EA 1GI4A 1P04A 3RXMA 1GHXH 3URDA 3SU0A 2O9QA 1GWAA 4K60A 2M5TA 3SI3H 4ZHLU 3RXPA 1PYTD 1OYQA 1GMHG 3TH3H 1C5XB 3HGNA 1EZXC 1GJDB 4D7FA 1L1JA 2OLGA 1FMGA 1C1UH 1TGCA 4B74A 1TQ0B 4E06H 1GHYH 1VGCB 2J95A 2BDYA 2TRMA 2VWOA 1ELDE 1FJSA 4HI3A 5DP5A 1VJAU 2XC4A 2BX3A 2VGCC 3GCHC 2J38A 3H7OA 4GHQA 5ETXA 2NU2E 3LU9B 4WMEA 3UOUA 4BXWA 2BLWA 2XXLA 3S69A 4AN7A 1TLDA 1V2JT 4K5ZA 2FTMA 3M61U 1F2SE 3TJVA 3TJUA 1CGJE 1N6XA 3MH7A 4DW2U 2BQ6B 1E37B 1O2MA 1O34A 2VH0A 3IITA 2GCTC 2BD5A 2V3OH 3HK6B 2A4OA 4X8VH 2XYAA 4WY3A 1K1NA 4X1NU 1VITF 3BG4C 4YLQH 3AAVA 1TPSA 1FXYA 2WPLS 1TBZH 1DUEA 1Z6EA 3BTQE 1UVOA 3SQHE 1DY9A 2VIQA 5HM9A 3PB1E 1DDJA 3BTGE 1KY9A 4KTUA 3M37A 1T31A 2QF3A 1HAVA 1U6QA 1C5SA 1YPLH 2EI8A 2ZDNA 2V0BA 3HPTB 1IQHA 4NA7A 6CHAC 1F5RA 4JZFH 1XUFA 3NWUA 5BRRE 1ELTA 4Y79A 2STAE 3TU7H 5A0CA 3C27B 5GDSH 5T3HA 4JCNA 2A0QB 4J1YA 3S7KB 3S9BA 1GVLA 2JH5D 4X1QU 1TWXB 3S0NA 4I8JA 4ABIA 1SQAA 3PWBA 4MNYA 2BYAX 4OGXA 1GBJA 4ASHA 3CS0A 4A6LA 1ZSJA 1LHGH 2TBSA 5JBTA 2ZGHA 6CHAB 2ZQ1A 3A7WA 1NS3A 5C1XA 2W7SA 1GBCA 4CRAA 1L1NA 2QN5T 2OUAA 4ISOA 3M36A 2WV5A 1BTXA 1C2IA 2ZA5A 1GCTC 1A0JA 3TVJB 1DS2E 3SV8A 3MWIU 1LTOA 1GVZA 1AKSB 3SNEA 1FLEE 3TITA 2K1QA 3SNCA 1YLDA 1HIAB 2WPHS 1HYLA 1BZXE 3TIUA 3M5NA 1ZLRA 2VH6A 1TNHA 1MKWK 4ZXXH 2BVXH 5HGGA 1GI6A 1DXPA 1GI0A 1GHBF 3OYPA 1GBBA 4FUGA 4GHTA 1J15A 2Y5GA 2SGQE 3QX5H 4SGAE 3VB5A 1AFQC 3ITIA 1YBWA 1ELFA 1OWEA 4H6SB 1KLJH 1HAIH 3ELAH 3RDZA 4GCHF 1TYNA 5HXFA 3UR6A 3Q77A 2BD7A 2PTNA 4IW4E 1VGCC 1SL3A 1LCYA 1X7AC 1BA8B 3RUOA 3LGUA 3A85A 1TPOA 5LH8A 1XXFA 3F1SB 2GCHG 1HAZB 6GCHG 1YPEH 4NSVA 3M35A 3SGBE 3LOXA 1D3DB 1C4U2 1H1BA 1T8MA 2H9TH 4I8HA 1C1VH 4H42U 4CH8B 1Y3YA 3M3VA 3MH5A 2ZGBH 4NIWA 1DWEH 2TIOA 5FBEA 3BTWE 2BX4A 1H9IE 1BTZA 1PPCE 2RA3A 5CE1A 1O31A 4E7RG 4X6OA 4YO9A 1PQAA 3ZZAA 1THSH 3MH6A 4OGYA 3EA9A 4WH6A 1HJ8A 1YCPK 1P09A 1RJXB 2GTBA 5I25A 1F0UA 2AFQB 3DT0H 4ZKRU 1AGJA 1O5BB 1T4UH 4AOQA 3F6UH 1RS0A 2C4FH 3Q76A 5F8TA 2H9EH 1GBDA 4YOJA 3QDZB 3F9HA 2PHBA 4NFEA 1CGHA 1O2TA 1MTWA 3ATLA 3UPEA 3U98H 1BRBE 2BLQA 2CF9H 2AIQA 5A8YA 4ABAA 1GGDB 5FAHA 1SOTA 1HDTH 2P3UB 2FPZA 2PKAA 3TH2H 1O5AB 1QBVH 1GCTB 2QXJA 1THRH 4I31A 1PPHE 1O2RA 2BD8A 1EJMA 2FX6A 1OWJA 4CHAC 2BD2A 2ALPA 1CBWB 2VVUA 1QCPA 2O8WA 3MNXA 1SFQB 2FOAA 2XWAA 3FFGA 3A8AA 2YNBA 3D23A 4LK4A 2ESTE 2ZHEH 1ZPBA 2G81E 5LPRA 1NY22 4K3JA 4MNWA 2ZU5A 5ESTE 2ZDAH 1MTSA 3MI4A 1IQMA 1C1MA 1EXFA 1GBHA 2BLOA 1G2LA 1VCWA 1A61H 1GBTA 1MBMA 1O3CA 2PKSC 2OCVB 2WPKS 2XW9A 3RXDA 3T2NA 1DOJA 1JIRA 3RM0H 3SUDA 8KME2 1NFYA 2BVSH 3A7YA 2Q6FA 3FANA 3O8BA 2C8XB 2VB0A 1ZTLA 1QBNA 1GMDG 1AE8H 2ZI2H 3BG4B 2A4GA 3URCA 3RMLH 4DIIH 1AB9B 1JXPA 1AU8A 3A88A 1SQOA 3UFAA 2FODA 1AO5A 4Q2KA 1NRSH 4YT7H 1SB1H 1IQNA 1O3EA 3T25A 3RC6A 3KQDA 1ORFA 4BTIB 3HK3B 3RXTA 1BTWA 2B5TB 5EQRA 1GHZA 4ESTE 2HPQH 1SG8B 2HRVA 2F9OA 2QXIA 3A7TA 1D4PB 2F9VA 3P8GA 3SN8A 3NKKA 1JIMA 2O8UA 5A0BA 5JB9S 1O3FA 2PV9B 1YPHC 1IAUA 1LHDH 1MMJN 4O9VA 1TQ7B 1HJ9A 2JETB 4YZUA 1UTPA 2PWXA 2VWMA 2J9NA 4JZEH 4NZQA 3HATH 3RU4D 2JH6D 3BTEE 4JMYA 3RXAA 3CENA 4J2YB 1EZUC 4Y76A 2PFEA 1H8IH 3FP8E 2J92A 2B0FA 4NSYA 1GHVH 3RXRA 2FMJA 3SHAH 4INKA 1NROH 4Y8YA 1SLVB 4XBDA 2VIOA 4ZROA 4AFUA 1K1PA 1QA0A 2DE8A 5FPSA 1Z7KA 4AG2A 4X1PU 2GDEH 2VIPA 4ABDA 3ZZDA 1C5NH 1EAIA 2GCTB 1EJAA 2XCNA 3RLWH 3M3TA 1WV7H 2UUFB 4I8LA 3P92A 1KYNA 2PKAB 2EC9H 2GT8A 3SBKA 1BUIA 1C1QA 1MZAA 3RXFA 2FI5E 2HPPH 2UWLA 1SQTA 1BOQA 3SGQE 4DGJA 2FYRA 1IHSH 3D62A 1YPGH 2ZFRH 1BTYA 1O3LA 4B2AA 1BB0B 5EQQA 1AUJA 1O3KA 1OX1A 2VWNA 4IC6A 3RXUA 4D9QA 1XUJA 1JMOH 1L0ZA 3ODFA 2UUKB 2PTCE 3CP7A 4MQAA 3I78A 1QJ6B 4UD9H 4Y7BA 4NA9H 2VU8E 1OYTH 2AMQA 2ZCLP 2C90B 1HJAC 4IBLH 4ABGA 4FU9A 2FI3E 2XC5A 3I29A 1TNLA 4GLYA 4O97A 3H7TA 5LPFA 1ZPZA 4Y8ZA 4JK6A 1ZYOA 2VINA 3GDUA 4Z6AH 1F7ZA 3RXEA 1JOUB 1IQGA 3SHCH 2VVCA 1B0FA 1O2ZA 1SC8U 1NESE 1UTNA 3ODDA 1GMCF 4XBCA 3FZZA 2AGEX 4WMDA 1F5LA 4F49A 1O2QA 3PO1B 3BTFE 3ZZ9A 3K9XB 4QT8C 4NIVA 1LHFH 3I77A 3T62A 2FOEA 1UTJA 4I8KA 1MTUA 1JBUH 1RTFB 2CF8H 4ABFA 1FNIA 2RA0A 1MH0A 4D7GA 1IQIA 4K1TA 1FDPA 1IQEA 3AAUA 1DE7H 1O3PB 1T7CA 2D8WA 1S0RA 2G55A 5FCRA 4A5TS 1EUFA 1QL7A 2GVFA 1GBMA 1SGFA 4LOYH 1K1JA 4D76A 3MOCA 2GP9B 1NZQH 4U30A 3MU1A 3LDXH 1KXEA 2CJIA 4O3TA 3SI4H 3RXOA 3LJOA 4AGJA 3UIRA 2H9HA 5AF9H 3NZIA 1UO6A 2V6NA 2PGBB 2FZZA 3TPIZ 1CO7E 3BIVH 1C5LH 3RC4A 2GV6A 3ZVAA 2QGRA 1V2VT 4ISIH 3ATWA 5DPAA 2GMTC 1C5ZB 4KP0A 3ZVCA 4MPVA 2FLRH 2ZU1A 3E0PB 2WUBA 3U1IB 1A5GH 4K2YA 3VFEA 4I33A 4E7NA 1QHRB 3A86A 1VCQA 2BXUH 3QUMP 2GZ9A 4TPIZ 4Z0KA 4ZUHA 2GDDA 1FN8A 2LNCA 1CT4E 2ANKH 3EA7A 1ZHRA 1MCVA 3HKJB 1KTSB 1C5UA 2OP9A 3MO9A 1HXEH 1TMTH 1GL0E 1P2KA 2F9UA 4JZIA 2P59A 1ARCA 1G9IE 3GCTG 1C5PA 2F9BH 2AGIX 1DWDH 4YESB 2ZZUH 5DGJA 1TNJA 1O2LA 3ZVGA 1DSUA 1O2JA 4ISHH 2CGAA 2FOMB 2OBOA 1SLXB 1SOZA 1UK4A 3RXBA 5GCHF 1V2MT 1O39A 1E34B 1Y59T 4ABEA 1OWKA 1C5QA 1P2IA 2THFB 4M7GA 1HGTH 5JDUB 1XUIA 1PQ5A 1OSSA 1SLWB 1AZZA 1QB9A 1DLKB 2CN0H 3RXSA 1EB2A 1OWIA 1GBKA 1HAPH 3KQCA 3LT3A 3W94A 2OD3B 2P16A 1XKBC 1TGNA 2WYGA 1TBQH 1KSNA 2HALA 1C1NA 1C5TA 2O8MA 5C67A 1CA8B 3K6ZA 1HNEE 3RXGA 2Y6TA 1UVUH 1T32A 3JZ2B 3DHKH 1ANDA 1DWBH 4DY7B 3MNCA 1OS8A 3UTUH 1BMAA 1QNJA 2RG3A 1EJNA 2VIWA 2G4TA 4B2CA 1QFKH 1W7GH 3O8DA 4BTUB 1AQ7A 1EQ9A 3N7OA 1ZRKA 1F0TA 3LKWA 1DFPA 1GL1A 2BDGA 2BOHB 1O3GA 3LC3A 4IS5A 1AMHA 1TRMA 1ELAA 2RCEA 4Y10E 3ZZ8A 2FOCA 1FIZA 1RIWB 3BF6H 4ZKSU 3E8LA 3RM2H 5TCCA 1DPOA 5T6FA 1C9TA 1GHAF 2UUJB 1HJAB 4B75A 2FOGA 3STJA 5J4QA 1HAVB 1C1RA 7KMEH 3SNBA 3LGWA 1QRWA 1ELCA 2I6SA 1O38A 3P17H 3T29A 4Q7XA 1LPKB 3EA8A 2BDBA 1KXAA 2A31A 2I6QA 4MPUA 2R0KA 4BANB 4MPWA 3Q00A 3TJNA 1VJ9U 2WPIS 1DLEA 1NU9A 1P9UA 4KGAA 1EAWA 1HLTH 2SGAA 4CREA 1AVGH 1NRPH 1H8DH 2C93B 4OS1A 3FP7E 3PLKA 1W13U 2ZPSA 3SV7A 1AIXH 1ZR0A 2ZKSA 1C4V2 4UFDH 1O2GH 2BY5X 4O3UA 1EPTA 4Y6DA 3FVFB 1LKBA 4X8SH 1WUNH 1ESBA 2O8LA 2QA9E 2PLXA 2A4RA 1O37A 1P11E 1XMNB 1O2UA 5EXNA 4TPYA 1GCDA 4FU7A 3GY7A 4IN1A 3UOPA 2BY6X 1SGCA 1CHOF 1AKSA 1KDQB 1ID5H 2FXRA 1IQLA 1BBRE 3NXPA 3GCNA 5C2ZA 5C5NA 1IQFA 1GBAA 3Q3XA 1ARBA 3PYHA 1LHCH 1Y5UT 5HMAA 2A5KA 3BTME 4UE7H 1RTKA 2KAIA 1K1LA 2Q1JA 2XBWA 1TALA 3M7UA 2ZCHP 3ZVFA 2F83A 5E2OA 1YM0A 1YYY1 4OS6A 2ZF0H 2H6MA 1BCUH 3GDVA 1UK2A 1N8OC 1O5DH 1KTTB 4ZH8A 2A2XH 1DVAH 3VGCC 1C1SA 3SUGA 1YF4A 2QAAA 1O5EH 1QTFA 2IPHA 3AVZA 1W0ZU 1Y5AT 4AX9H 1GDQA 2ZC9H 3A7ZA 8LPRA 2G5VA 3A83A 1O0DH 1NN6A 1C2LA 1ELVA 2FWWA 5EPYA 2F91A 5H4IB 3F9GA 2FOBA 3R0FA 3Q3YA 1GBEA 1OKXA 5EW1H 2ULLA 4ABJA 2PKSB 3PMAB 4A1TA 2GZ7A 1WCZA 2BZAA 1OXGA 4H4FA 4RSPA 1P2OA 5C1YA 3BEFB 5CMXH 1O2IA 3NPSA 3DD2H 3C1KA 1ZZZA 3QGJA 3UNSA 1THPB 1XKAC 1W12U 4LZ1H 1D3PB 1LPZB 1P12E 4AFSA 1NFUA 1UVSH 2G8TA 1TRNA 1O3DA 1P2JA 1G32B 3F9EA 1V2QT 1W7XH 1BDAA 1TGTA 3GDSA 4FUBA 2FLBH 4DCDA 3EYDA 1FQ3A 1OP2A 3SZNA 4CHAB 3A84A 8ESTE 1UHBA 5J4SA 1ZGVA 2ZG0H 3K2UA 1NRRH 4BNRA 5C20A 1CSOE 2Y81A 3K6YA 1TIOA 1ACBE 4Q7ZA 2HGTH 3HGPA 1KXBA 1KIGH 2ZU3A 2FI4E 4VGCB 4GVUA 5CHAB 2BD4A 1BJUA 2GGVB 1S5SA 1CE5A 1EPTB 4NCYA 1SGNE 5EQSA 1MAXA 2SFAA 1SGYE 1O5CB 5L6NH 4X1RU 4DT7B 4D9RA 3TGJE 1GDNA 4SGBE 3A7XA 1FN6A 2SGDE 4GSOA 1ZMNA 3U1JB 5FXLA 4BAHB 1W11U 1OWDA 5DP7A 2XRCA 4AYYB 1ETSH 1O2WA 4E05H 2A7HA 2B9LA 2G00A 2ZP0H 3AW0A 2EA3A 1V2TT 1SPJA 3KGPA 2SNWA 1H9HE 3OU0A 4ISLA 1W10U 3F68H 1S82A 1IQJA 2D2DA 1TX7A 4XDEA