3A82A

Crystal structure of trypsin complexed with pre-synthesized (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a82A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a82A02
2XCFA 3SUEA 1TGBA 3FFGA 3UUZA 4ZKOU 4Y8ZA 1VITF 2WV5A 4WF8A 3SQHE 7KMEH 1NN6A 4CBOA 1EB1H 1H9LB 4O9VA 4ZXXH 3VPKA 1ZHMA 1F0RA 1EP6A 4JYUH 5JBAS 4INLA 2GZ8A 1FI8A 1TABE 1QQUA 2CJIA 2YOLA 1CSOE 4ISIH 2UUYA 1ZZZA 4X0WU 5ESTE 2ANYA 3D65E 1CHGA 1Y59T 1C1RA 1V3XA 2AGEX 1BMAA 3A7VA 3UWIA 2QXJA 1AU8A 1C5WB 3BV9B 4Y8YA 3LH1A 1B0EA 3K6YA 1CA0B 1O3EA 4FU7A 2H5DA 1FY3A 4UFGH 2UWLA 5E2PA 3D62A 3LH3A 5GPIB 1C1QA 3TGKE 7GCHG 1LHEH 3KQBA 1S84A 2VIQA 1TAWA 4UFEH 3UNSA 1NPMA 1IQGA 4WH8A 1FY4A 3SU0A 1AB9C 2G5VA 2R3UA 3GY8A 4KTUA 4O03A 1NROH 1A46H 1FIWA 1J9CH 2AGGX 3BN9A 3LOXA 4UFDH 3MH5A 4KP0A 2ZECA 5T6GA 3A88A 1BJUA 2ZU2A 3EA8A 1UTQA 4XE4A 3ZZ9A 2Y5GA 3PO1B 5EQRA 3RMMH 3TNSA 4NA9H 3ZVAA 1CBWB 3RU4D 2OXSA 2DE8A 1TA6A 2PGBB 2QF3A 1A0HB 1QGFA 3UPEA 4FU9A 1QL8A 3PTNA 4B73A 1AKSA 1QB9A 1BHXF 3K6ZA 2BQ6B 1Z8IB 1HFDA 1K21H 3SV9A 2BB4A 4YLQH 2BTCE 2XRCA 3E3TA 3TH2H 3VB5A 3VGCC 4CRAA 2QV1A 1ZRBA 3LDXH 2J95A 2BD3A 3RXQA 3E16B 1O2RA 3MO3A 3QUMP 4ZHLU 1F5KU 1N8OC 1QRXA 1E37B 2B5TB 3QTVH 1EJAA 1IQFA 4YOIA 3STIA 4FUHA 2FOMB 3LGVA 3URDA 4BAMB 5IYTA 1ID5H 1NO9H 4I8HA 3FP6E 2SFAA 3AAUA 1C2LA 3SU3A 2STBE 1EOLA 4GCHG 1SGYE 3UNQA 1ESAA 3RC4A 4OS7A 1GI4A 1C5TA 4I8GA 3V0XA 3SU6A 3BIVH 1P3CA 3BTME 1XUKA 1VITG 2XNIA 2AERH 1GHWH 1AE8H 1EPTC 1VCQA 2ZCHP 2ZPRA 1IQHA 1BTYA 5L2YH 2BY5X 5FCKA 1BMMH 1HAVB 1Z71A 1ZGIA 1SSXA 1XM1A 5F03A 1GGDC 1BTWA 4X8SH 1CO7E 1DWBH 4FUGA 1LHGH 8KME2 3NK8A 1TA2A 1HLTH 2SGAA 2SNVA 1QRZA 1NM6A 2BD5A 3E8LA 3RUOA 1WCZA 2JH0D 2HRVA 3M5LA 1YPMH 2C8XB 1V2ST 1F7ZA 1E34B 1HJ8A 2BQ7B 2P3UB 5PTPA 4IW4E 3RXFA 2GD4B 2GTBA 2J38A 1H9HE 1BB0B 3Q3KA 1O2WA 1TBQH 2CV3A 1WYKA 1C4Y2 4FXGH 3F9GA 3Q00A 1GBIA 4O3UA 4TPIZ 1AIXH 3PV4A 1O2MA 3MH4A 1GDNA 2A4RA 1O33A 2BD9A 2HWLB 3ODDA 1ANDA 1TGTA 2UUKB 1A5HA 3M7UA 4BTIB 1HIAB 4XOJA 5C1YA 4DW2U 5B6OA 2FOEA 1G2LA 1MMJN 1LVYA 2ZKSA 2PGQB 1KIGH 1GBMA 1O3PB 2GVFA 1H1BA 1WBGB 4QT8C 9LPRA 3A7ZA 2BLOA 1ZHRA 4I8LA 3A7TA 1XKAC 2BD2A 2FS8A 4ABIA 3M37A 2NU4E 2BOHB 3F9HA 1BZXE 1MKWH 1ELTA 3BG4B 4ISNA 4OS1A 1ZJDA 4K8YA 3UWJH 1GHXH 2B8OH 2JETB 1W0YH 3PMAB 4ISLA 3PYHA 3BEFB 3GDVA 2FOAA 1NU7B 1GCTC 2ZQ1A 2WYGA 1ANCA 4UDWH 3O8CA 5J4SA 1UVTH 1PPEE 3RMLH 4B1TA 5J4QA 1EOJA 1C5UA 1TPOA 1F5LA 3ZZ8A 1D6WA 2AH4X 2BYAX 2P8OB 3A7YA 2EA3A 2WUCA 3P17H 1V2UT 3BTEE 1D3TB 1UTMA 2QGRA 1W3CA 2K1QA 3DHKH 4NFFA 1KLTA 1YPHC 2SGEE 1HXFH 4NGAH 3LC3A 4WMEA 5BRRE 2GMTB 3GCTF 2XXLA 1RRKA 4B2CA 1QB6A 1MKXH 2W7UA 4AFSA 4A92A 5FPTA 3EGKH 1SI5H 1KXAA 2P59A 3SNAA 2GGVB 1NRRH 1UVPA 3QK1A 3ZZ7A 1FQ3A 1PJPA 1GJ9B 2ZDAH 3FVFB 4WY3A 2Q6FA 1T8NA 3LJOA 1GBBA 5LPRA 1GI1A 1ZJKA 3HK6B 1P11E 3ZZDA 1C2DA 2G51A 5LPEA 1L2EA 1MBQA 3SN8A 1PQAA 3NUMA 4Y0ZE 1TGCA 2CXVA 2FX4A 4DOQA 1GBKA 1ELGA 4MPXA 4H42U 4MQAA 3RP2A 3ENSB 4A5TS 1L4DA 5T6DA 2J9NA 2ALVA 1NFWA 2J2UA 1XUIA 1XUFA 1P10A 1YP9A 2R0KA 3SBKA 4HFPB 3ZVFA 1YCPM 2H1UA 3MYWA 1P02A 2HGTH 1NY22 5E8EH 3H5CB 5DG6A 1O2VA 2ZQ2A 1DITH 1SGPE 1UVOA 2Y5FA 3RXRA 4A1VA 1NT1A 4OGXA 1H8DH 3S69A 1G30B 2VNTA 1HDTH 1O3DA 1YGCH 1BBRK 2JH5D 2A5IA 1YM0A 1GVLA 1SLXB 1ELBA 3R3GB 2Y7ZA 1BMLA 1GBCA 1EJMA 1JIMA 1O3NA 1PYTC 1AFQC 2F9NA 3RXUA 2HOBA 2VWLA 5AFYH 2QC2A 1T31A 1UHBB 4IN2A 1HIAA 2BLWA 2QN5T 1OP0A 1LMWB 5EPYA 4GSOA 4U32A 2A7CA 1TOCB 2O8UA 1UTKA 1AI8H 2R0LA 3E1XB 3M35A 1DXPA 4Y6DA 1DT2A 1P8VC 4FUCA 1KXCA 1UCYK 4NIWA 1AN1E 5LH8A 2A4OA 2Y5HA 4NZLA 4AORA 1GI6A 2C4FH 1LHFH 2FOGA 1AE5A 2G8TA 5EQQA 3O8BA 3HATH 1IQEA 1IAUA 3V13A 1A1RA 1ELEE 2XYAA 2BDHA 3M3TA 2J92A 1TE0A 2EI6A 4ZHAA 2A7HA 3STJA 1K28D 1ELFA 2B9LA 2ZEBA 1SPJA 1DICA 2D8WA 5T3HA 1N6YA 1ESBA 2FLRH 5C1XA 3RXPA 1BTZA 2RDLA 3Q3XA 1BRUP 3UFAA 5CHAB 3FZDA 1JWTA 3GCTG 1A0JA 3P8FA 1OS8A 3JZ1B 3SGQE 2FYRA 4ZHMU 4YO9A 4DVAU 3V7TA 2ZDKA 1WAYB 1LDTT 1OP2A 3BTGE 1MD8A 1SOTA 2Z9LA 1SGTA 3QX5H 5C5NA 1B5GH 1GBDA 3Q76A 3LC5A 3ZYEA 1FXYA 4YZUA 3LGWA 1C5LH 2C8WB 4GVUA 2ANKH 1E0FD 1BA8B 4CBNA 1LVOA 1AHTH 1QRWA 3PWCA 1FUJA 1ZSJA 1LVBA 2BM2A 5GWZA 3EE0B 4B71A 1AFEH 3ATMA 2ZCKP 3SJ8A 2VIPA 1MCTA 1H4WA 1Y3UA 1P2MA 2AS9A 2ZPQA 2C3SA 2AEIH 1DY9A 1DX5M 3F1SB 4NIXA 3W94A 2TGPZ 3QO6A 1A7SA 3SV8A 1O39A 1O2ZA 2FYQA 2ZU3A 3SUGA 5F8ZA 3HK3B 1J17T 1FONA 2YNAA 3E6PH 1QBVH 1LHDH 1UTJA 3LGIA 2VH0A 4JZIA 4Y71A 2BQWB 3M5MA 1H8IH 2G5NA 1WSSH 3SGBE 4Y76A 4CREA 4CRCA 4IC6A 1VITH 2ALPA 1KTTB 2ZDMA 2LNCA 2ZF0H 1AZZA 1EP5A 1C2JA 2PHBA 1YKTA 2ZGBH 4O97A 1YC0A 2TPIZ 2VVVA 2ULLA 1W12U 1TNLA 1O2TA 4FU8A 1ABIH 3ODFA 3SNDA 1WTHD 4Y7BA 1ELCA 5AHGH 3UQVA 4K8BA 4AYYB 5DJ7A 1VCPA 4MPUA 1C1OA 2FLBH 4MNXA 2XC0A 1P2IA 3U69H 3NCLA 3A7XA 3A81A 2WPIS 3U8TH 4B74A 1GMDF 1O3HA 4LK4A 3GY7A 4AZ2B 3ZVGA 3OU0A 1GJAB 2NU2E 3TIUA 1AWFH 2CN0H 1UHBA 1ETTH 2GKVE 1O32A 3GDUA 4E7NA 3PMBB 2VU8E 3I29A 1O5DH 1QBOA 1GHZA 5C67A 3PLPA 5HM2A 2V35A 1S0QA 1ZPZA 1ZTKA 2ZTXA 3BEIB 4JZEH 1MTSA 2H5CA 1LKBA 3MU0A 2QIQA 2ZG0H 3RLWH 1GCDA 5A0CA 2TGAA 4XBDA 3I78A 1RJXB 4WH6A 3O8RA 3BIUH 2AIQA 3RXMA 1QA0A 2I6QA 1TFXA 1OWKA 1ZPBA 1Z8JB 2W3KA 1N6XA 1GBLA 3DA9B 1OPHB 2BD4A 1AY6H 2BDCA 1UTPA 5EW2H 4K1SA 2HALA 2VGCB 4GCHF 2ZU4A 2P16A 4OGYA 2RG3A 4CR5A 1Z1IA 3TNTA 1GWAA 2Z9IA 4Y8XA 1JRTA 2H2ZA 4VGCB 4YT7H 1YPJH 2VINA 5SGAE 4LOYH 3SI3H 3SV6A 1GL1A 1QY6A 1TRYA 3DFJA 1FPHH 3IG6B 1W7XH 4FUDA 2FIRH 5TCAA 4NG9H 4BANB 1O3CA 1DWEH 2GCTB 1F92A 1BOQA 3V3MA 1MTNB 1QL7A 3RM2H 4D7FA 2JKHA 2VIDA 1P2KA 3BTWE 2Z9JA 3GCOA 2SNWA 1W13U 3S9AA 3TLOA 1XUJA 3L3TA 3SU1A 2FWWA 3BSQA 1IQLA 5FX6A 3ZZCA 1V6DA 1Y5AT 4MPVA 5EXLA 4X2XA 1JOUB 4I32A 1SLWB 3A80A 2QYIA 1L1JA 3A82A 1GJ7B 1THRH 1P3EA 1WOFA 1SFIA 3B23B 1G2MA 2IOTA 3M5OA 1JMOH 6LPRA 1S82A 1W11U 2CHAB 1P03A 3QGJA 4BXWA 1AD8H 2Y82A 3AASA 2P94A 2FM2A 1ZPCA 4UE7H 3U1IB 1BMNH 2PTCE 3A84A 3URCA 2WPHS 1BCUH 3Q3YA 1V2PT 3GCHC 3PMJA 4Q7YA 4X8UH 2BLVA 2W26A 1FJSA 4I33A 2ESTE 4A6LA 5FBIA 8ESTE 3KQEA 1SGDE 1YCPK 1IHTH 4WWYA 1TNIA 5A0BA 1O2PA 4AFQA 1GMDG 3UR9A 3D49H 2ZPSA 1O3FA 1O2HA 3DD2H 4MNWA 2O8LA 4IN1A 3A83A 5A8YA 1O30A 1T7CA 2FI3E 1G37A 4CH2B 3EQ0H 4XBCA 1C5YB 1LQDB 2F9BH 1RIWB 2OC7A 2QAAA 3TK9A 2AIPA 3MHWU 2NWNA 1C2KA 2OTVA 1P57B 1LPGB 1THPB 2ZDVH 3DFLA 3MNXA 4TWWA 3SJIA 5DKMA 1BBRH 2SGFE 2PV9B 2CGAA 3MNCA 5E0JA 2QA9E 3FP8E 1OYQA 1CT0E 1O3GA 1O34A 3QWCH 3LIWA 4RKOB 4CHAB 1MTUA 3A8AA 4UONA 1TWXB 1SHYA 1EAUA 3F6UH 3P95A 1K1LA 2P93A 4I31A 4MTBA 1AWHB 4OS2A 5FCRA 4ABFA 2PKSC 1SGFA 2FOBA 3PMHB 3KL6A 2VWOA 4ABHA 1AVGH 1ETSH 3H7OA 1P0SH 1Y3XA 2GDDA 5T6FA 1SGEE 1P01A 1FAKH 3MU5A 1G9IE 2UWPA 5FHTA 1KDQB 2A4GA 1GI2A 4XFQA 1FMGA 1UCYH 1NRPH 2F9UA 3ITIA 2A45B 4ZAEA 2Y6TA 1CU1A 1X7AC 3ESTA 2G4UA 2CF9H 3MU1A 1AO5A 2A4QA 1HCGA 1YBWA 2R2MB 3BF6H 3MWIU 4GHTA 2GV7A 4KTCA 2A32A 4GHQA 1UTOA 2ZGCA 1EKBB 2A0QB 3DUXH 4GAWA 3OY5U 2XBXA 2ZHQH 4I7YH 2UUFB 3RC5A 3SUFA 1NU9A 5FBEA 1TNHA 1TX6A 1XMNB 4YM9A 4K5ZA 1NFYA 2BY6X 1P9SA 3TJUA 4UEHH 3KCGH 1TLDA 1WQSA 2FS9A 4TY6A 1MBMA 3LKWA 4NWLA 4I8JA 1T8LA 3N7OA 4KTSA 1AVXA 3MO9A 1P06A 1FLEE 3ZYDA 3V12A 5DP5A 4AN7A 1OWJA 1O5FH 1P2QA 1SQAA 1C2HA 3PB1E 2GT7A 2EI7A 1AQ7A 1HB0B 1AVWA 4DGJA 4X8VH 1GBTA 1P04A 2B0FA 1XUHA 5C5OA 2HVXA 5DP8A 4H6TA 1Z6EA 2ODPA 4YOGA 1ELVA 3LPRA 5FXLA 3GDSA 3SU2A 5A0AE 1HJAB 1GG6B 2BX4A 1OXGA 4Y79A 2SGQE 1PQ5A 1MU8B 1TPAE 2BZAA 2R9PA 3ELAH 3GY2A 2BXUH 1V2WT 3TK6A 5DK1A 1PPHE 1Z1JA 3TH4H 2BDBA 1A3BH 1O5AB 1EX3A 2ZNKH 1IQNA 1BHXB 2C8ZB 2WUBA 3F9EA 3E90B 1GMHG 2G4TA 6CHAC 3SOSA 2FOHA 1TYNA 3LGUA 4ZH8A 5JB9S 1C1PA 3U8OH 1QBNA 1DM4B 4WMFA 2FODA 4NFEA 3KHVA 1QCPA 4OS4A 1ARBA 3GY4A 4HGCA 4X2WA 5EU8A 4ZKNU 4JK6A 3MMGA 3MFJA 5F6MA 3SI4H 2XTTB 3VB3A 2Y80A 5JBTA 4JZFH 2F9VA 5DP3A 1K1IA 4JCNA 4MLFB 1O35A 4ZXYH 4E7RG 1GDUA 1HPGA 4AFZA 1J8AA 4RSPA 5H4IB 3ZZAA 1QNJA 2VWMA 3HPTB 5E2OA 4J2YB 5ETXA 4Y0YE 5EOKA 3RMNH 1UO6A 4INHA 1TALA 3RXDA 3CS7A 3TJOA 1O38A 3AW1A 1CA0C 3PLBA 5DP9A 1MUEB 1WU1A 1KDQA 4THNH 2WPJS 4ABEA 5ESBA 3T5FH 2F9PA 1PFXC 1XXFA 5TJXA 3VXEH 3MU4A 5A2MH 3VXFH 5K0HA 5C1UA 4B76A 3M7QA 2H9HA 4X1PU 2OQ5A 5DO4H 4IMZA 1W14U 1VGCB 2ZHEH 5HYOA 4GPGA 1XX9A 1ZMJA 4A1XA 2HNTE 1HAVA 2A2XH 1LO6A 1VCWA 3TK5A 3P8GA 1F0UA 1D3PB 1GBJA 1L0ZA 1D3QB 1DXWA 2XWBI 1O5CB 3PO1C 3E91A 2FO9A 2A5AA 1NFXA 4TY7A 3SORA 4E05H 4MVNA 4O3TA 1CBWC 1MZAA 4RKJB 2ZU5A 4MDSA 5JBBS 3ZZBA 3EYDA 1Q3XA 4LZ1H 4TPYA 4Q80A 2QXHA 1SGIB 1H9IE 4DY7B 3UIRA 1PPZA 5K7RA 1EAIA 1K1NA 1FPCH 2Q6DA 3UOPA 3SJOA 1LHCH 3HKJB 3RXIA 5FPYA 1ZOMA 1PQ8A 1FAXA 2ZFTA 4H6SB 1Q2WA 3LT3A 1O2KA 1RFNA 2BVSH 2ZO3H 3LU9B 3NZIA 1O5EH 1GPZA 4IS5A 1LKAA 4ABJA 1DFPA 2FI4E 4AGKA 1UMAH 3A85A 5FX5A 1ZYOA 1O36A 1MCVA 3KIDU 3GCNA 4AB9A 1A0LA 1O2IA 2RA3A 1INCA 5GJ4B 2ODQA 1AGJA 1V2TT 3GY5A 3T62A 1IQMA 1AZ8A 5CE1A 2Q6GA 4A7IB 1O3OA 1Y5BT 2GZ7A 2W7SA 3EA9A 1NS3A 3EAJA 3U9AH 1T32A 2BVXH 3FANA 4OS5A 2IN2A 3UNRA 2GP9B 2P3TB 3TGJE 4R0IA 3OX7U 1JXPA 2WYJA 4TWYA 1EJNA 1CVWH 3P8NA 1SGNE 3GOVB 1ETRH 1KXDA 1TPPA 5EXNA 5EG4A 1SB1H 1THSH 1XUGA 1KXBA 1YCPH 1O2OA 5LPFA 2PFEA 2WINI 1BIOA 1O2SA 2VJ1A 4R8TB 3W95A 1S85A 3M3SA 3ZZ4A 1AB9B 1O3LA 1TNKA 1SBWA 4Y10E 1NESE 1PPBH 3T28A 3OY6U 1GI8B 1C5RA 1A3EH 1O0DH 1P2OA 3S7KB 4KGAA 1G32B 1OYTH 1C9TA 2FESH 1C4U2 4YT6H 1GJ4H 1GI0A 1ELAA 2H6MA 1ELDE 2NU0E 3KNXA 1NC6A 1O2UA 1ZMLA 2FXRA 1QB1A 1OKXA 4UFFH 4BXSA 4TYDA 4PROA 2ZI2H 1P2NA 4X6OA 3D23A 3QLPH 1O3MA 1DLEA 2WPLS 2OC0A 3RXOA 4NSYA 5EXMA 1QL9A 1SOZA 1S6HA 4MPWA 2ZIQH 1QFKH 3TVJB 1T4UH 2Y7XA 1ZMNA 3VGCB 3ATKA 4RN6A 2XBYA 3MNSA 2NU3E 5G4BA 2ZDNA 3PROA 4WXIA 1V2VT 1EQ9A 1BRCE 1TOMH 1OWDA 4Q7XA 4X2YA 2A1DB 1FY1A 2HPPH 1N1LA 1V2JT 1SG8B 1CQQA 1N8OB 1MH0A 3KGPA 2BHGA 4X1RU 1BTXA 1PPFE 3GICB 3BG4C 2W3IA 2FEQH 2OC8A 2JETC 3E0PB 4DT7B 3BTHE 2ANMH 2BZ6H 3TU7H 2UUJB 3P6ZB 4B75A 1FY5A 3OSYA 4DCDA 4HTCH 1HUTH 1WTGH 1GJBB 1P2JA 3LGYA 5DP7A 1C1TA 1EPTB 2O8TA 1TQ0B 2A7JA 1C5SA 3R0FA 1UK2A 3BTDE 2P8OC 3OTJE 2TGDA 2PUXB 1GGDB 2OQUA 2GCHF 1C5VA 1BTPA 2V3OH 2GMTC 1CT2E 5DP4A 1G3CA 1Z8GA 3KN2A 1XVMA 3QZQA 1QJ6B 2A31A 5GCHF 2VIVA 2H9TH 5F8TA 1C2MA 1EZXC 4NZQA 2Z94A 2HLCA 2BDIA 3RXHA 2XC5A 4SGBE 3GYMA 7LPRA 1O2XA 1ARCA 4CRBA 4NCYA 2XW9A 1TNGA 4CR9A 1O3KA 1OWIA 1LVMA 2GZ9A 1HBTH 3SHCH 4XSKU 5EW1H 1O2NA 2P95A 1W8BH 3ZV8A 1EXFA 2A2QH 2ZFSA 2HPQH 2ZTYA 4WMDA 2O8MA 1GJ5H 1S0RA 1MTWA 3MU8A 3MNBA 3BEUA 3F9FA 4IMQA 1HAGE 5F8XA 1GHAF 3AVZA 1LQEA 1SL3A 1OSSA 3T25A 5LGOA 2AYWA 1EZSC 1YPLH 4A1TA 1GMCG 5DPAA 3G01A 3JZ2B 2ZHWH 1O5BB 1C1VH 1C2FA 3A8DA 2ZZUH 3T26A 2GDEH 3KQDA 1LTOA 1O3BA 1DPOA 2EC9H 1C2GA 1MD7A 3RC6A 1TMTH 1O2JA 2TRMA 2Z3CA 4FUIA 1BBRE 3FP7E 3BTTE 1FY8E 2BVRH 1C1MA 2PTNA 2ZU1A 1G3EA 3SHAH 5JB8S 1L1NA 4D9QA 1GCTB 1OWHA 1HAXB 3RXTA 5FAHA 2OLGA 2G55A 1JIRA 5IDKA 1QA7A 4JYVH 4ZKRU 1NFUA 2P3FH 4KKDA 3C1KA 1NRNH 4ABGA 5A09A 1S83A 1ZLRA 1O2YA 3RXVA 3ZVBA 3K9XB 1GHBF 1GI3A 1V2KT 1ZR0A 2G81E 4X1NU 1D6RA 4BOHA 2TBSA 1F0SA 1HNEE 1MZDA 2ANWA 2BDGA 4DJZB 3RXEA 2PSXA 5I25A 3C27B 1EZQA 2KAIB 3KQCA 1K22H 2PKAB 2Z9GA 3L33A 1NTPA 2VWNA 1EAWA 4F4OC 3LJJA 1UCYE 5FPSA 2V0BA 1A5GH 2R2WU 1FV9A 1TBZH 8LPRA 2ASUB 2DUCA 1RS0A 2Z9KA 3VEQB 2FMJA 3NKKA 1TONA 3RXBA 3ZV9A 2ZGJA 4CH8B 2F83A 1CGJE 3T2NA 2GCHG 1C5QA 2ILNA 3NWUA 5AVDA 1DY8A 2AMQA 5CHAC 3ZZ6A 2STAE 1XXDA 4JK5A 1SQTA 2C93B 2YNBA 2J4IA 2VVCA 4ZROA 1EPTA 1GHVH 1ABJH 1ESTA 5HXFA 1UJ1A 5GCHG 4ESTE 3AW0A 4X6NA 1O31A 3A86A 3M5NA 2BX3A 4GUXA 1Y3VA 3RDZA 1HRTH 1XKBC 4DG4A 3NPSA 2ZFQH 1GMHF 1CGIE 4ZUHA 1D9IA 1VJ9U 4Y11E 1O37A 3ZZ5A 2ZP0H 3A8BA 1UTNA 1P12E 1GI9B 3EA7A 5AF9H 3TGIE 2AFQB 1TPSA 1YPKH 2C90B 2OD3B 1HAOH 1BRAA 4BAHB 1VJAU 1KLJH 1MAYA 1RD3B 3UREA 3SJ9A 1QHRB 1SC8U 1V2RT 1GBAA 2B7DH 2BY9X 3Q77A 3PM3A 2PLXA 1ANEA 3P92A 3UR6A 2AGIX 1GHAG 1ZTJA 1ZHPA 1NZQH 2ZGXH 3UY9A 2FP7B 2QY0B 1AFQB 1O3AA 3H7TA 3TH3H 3VB7A 3U8RH 1CE5A 2VB0A 3E0NB 4NWKA 3RM0H 4ABDA 1YPEH 3MH6A 1UVUH 3BTQE 3M3VA 4ABBA 3RXGA 2OCVB 1EASA 2OBQA 4B2BA 1GBEA 1C5XB 1C5ZB 2Z6BD 1K1JA 2RA0A 1AMHA 1BRBE 1DANH 1HAIH 4AFUA 4YESB 4DIIH 1TBRH 3SNBA 3L6PA 1HAPH 2V3HH 3MH7A 1DWCH 1YPGH 1DSTA 1V2QT 2ZTZA 4OS6A 1B0FA 3RU4E 1GHBG 4HI3A 1MQ6A 1Y3YA 4MG3A 2BLQA 3MTYA 1ZSKA 1B7XB 3HKIB 1YYY1 4BAQB 3SUDA 1IQJA 2BXTH 2CMYA 1BUIA 1RGQA 1ZRKA 4B2AA 2BOKA 3MOCA 5AFZH 2BY7X 2F91A 5C20A 2LPRA 3S9BA 4MNYA 2ZCLP 3UTUH 1GJCB 4AX9H 2Y81A 2ZFFH 1J14A 4FUFA 2QCYA 2UWOA 3LONA 1V2OT 3SV2H 4K1EA 5I46H 4YOJA 1FNIA 3A8CA 1FIZA 2FZZA 2VIOA 2KAIA 4K3JA 4J1YA 1D3DB 1T8MA 2PKAA 4DURA 2VVUA 4AYVB 3A87A 3U1JB 4U2WA 1DOJA 1SLVB 3I77A 3VFEA 3MI4A 4FUBA 1GI5A 1UTLM 1O2GH 1BDAA 3F68H 4Q7ZA 1U6QA 1HAZB 3WY8A 1CGHA 2BD7A 1C9PA 3K65B 3BTKE 1HJ9A 4CRFA 1SR5C 3P70B 1PQ7A 2VGCC 1RTFB 5GIBA 2ZFRH 2G00A 1TQ7B 6GCHF 1C5MD 1QR3E 3SZNA 1Z8RA 8GCHF 2PUQH 4INKA 4SGAE 1EATA 4VGCC 3S9CA 1SGRE 4NA7A 2O9QA 3M7TA 1DUAA 4LXBH 2WPMS 2J94A 1ANBA 2GT8A 3IWMA 1UK3A 4X1SU 1XVOA 4Q2KA 1PPGE 2GCTC 1BTUA 1V2LT 2PSYA 2C8YB 3FAOA 1MTNC 1W2KH 3GY3A 2XCNA 1IOEA 1ZSLA 2AMPA 2BDAA 1SLUB 2XBVA 3OYPA 2ZA5A 4NIYA 1TIOA 4H4FA 2FPZA 3AAVA 3HGNA 4D76A 2FOFA 1HXEH 4U01A 1QTFA 4FUEA 3ZVCA 1SGQE 1W0ZU 4Y7AA 2I6SA 7ESTE 3PWBA 1DDJA 1TGNA 4GLYA 1NRSH 3SO3A 2BY8X 4FVBA 1L4ZA 2XBWA 1BJVA 1QIXB 1DS2E 2CHAC 3CP7A 3M36A 2SGDE 3TJVA 1GL0E 1YPHE 2OINA 1QJ7B 2EI8A 5EGMA 5L6NH 1ZTLA 2D2DA 4ZMAH 1PYTD 1F0TA 2HNTC 2V6NA 4IC5A 1K1PA 1JBUH 5GDSH 1VZQH 3RLYH 3RXSA 4HZHA 1SVPA 1Y8TA 6ESTA 5DP6A 1TNJA 2F9OA 3NXPA 1S81A 3T29A 1NRQH 2VH6A 1UVSH 2IJOB 5C3NA 1IHSH 3ATIA 1O3JA 5JYIA 1WV7H 1RIWC 1HYLA 3B8JA 2PW8H 3SU4A 1KXEA 1GVKB 4F49A 1HGTH 3QN7A 5A8XA 1LPZB 1J16A 2BD8A 2ZHDA 4AG1A 4LZ4B 2RCEA 4D8NA 1KSNA 4Z0KA 1SGCA 2VIWA 3ZVEA 3A7WA 2AMDA 1TB6H 4CHAC 2D26C 3RXKA 3TJNA 4AB8A 3SNCA 1C5NH 1GBFA 2FOCA 2D1JA 4JYTA 2XWAA 2A5KA 1T4VH 4CRDA 2EEKA 1IQIA 3SW2B 1S6FA 1SMFE 5EPNA 3CENA 4M7GA 4ASHA 1DVAH 6GCHG 1OP8A 2WV4A 2BDYA 1GHYH 1FDPA 2ZWLH 8GCHG 2ODYB 3BG8A 4MNVA 1MAXA 4XDEA 5TCCA 1Q31A 1KYNA 2FTLE 1UK4A 3RXLA 4AG2A 1G36A 3BTFE 4AOQA 2J34A 1E35B 4K60A 1KLIH 4IGDA 4X8TH 2XC4A 3RXAA 1EZUC 2O8WA 2PR3A 3B9FH 4K2YA 1A5IA 3CS0A 1TX8A 5JDUB 1C1UH 3DT0H 2CF8H 5EQSA 3VB4A 1GDQA 4ABAA 2ZDLA 1G3BA 3GCHB 1M9UA 2GX4A 1Z6JH 2QXGA 3U98H 4KELA 5JBCS 2F3CE 4JZDH 1O2LA 4X6PA 1OWEA 1A4WH 2BMGB 1Z7KA 1WUNH 1CT4E 2Q1JA 3GISB 1FN8A 3FZZA 1MTVA 2Z3DA 2OBOA 1DLKB 2R3YA 1EB2A 1V2NT 2PWXA 1BTHH 3RXJA 3T27A 1GMCF 1Y3WA 3QGNB 1C2EA 2FTMA 1IQKA 2QF0A 1TX7A 1PPCE 2Z7FE 2OP9A 1CHOF 1P09A 2ZHFH 1OOKB 4WVPE 2M5TA 2DE9A 3TPIZ 3SV7A 2WPKS 1Y5UT 3SGAE 1MQ5A 1HJAC 3ATWA 4E06H 1GG6C 5ABWA 2FDAA 1C1SA 4NIVA 3RXCA 1KXFA 2ZFPH 3PLKA 2PKSB 4D9RA 1TMBH 1C2IA 2G52A 1TRNA 1J15A 1C5OH 5HMAA 5L30H 1RTKA 3P8OA 3PTBA 1C1WH 1KY9A 2SGPE 2OUAA 1A2CH 2GV6A 1K2I1 1K9OE 3QTOH 1ZGVA 1DSUA 1QURH 5E0GA 1TMUH 2QXIA 3SJKA 4D7GA 3K2UA 9ESTA 3RMOH 1MKWK 1RXPA 3VB6A 4BTUB 2OC1A 1O2QA 2TGTA 1OX1A 1C1NA 1DWDH 1K1OA 3SQEE 4JMYA 3EDXB 3IITA 4ZKSU 1MU6B 3GY6A 4FUJA 7GCHF 1HV7A 5HM9A 4UD9H 1TRMA 1K1MA 2FX6A 1YF4A 2HNTF 1RTLA 1HAHH 4NSVA 1GI7B 3RU4T 4WJG2 3SNEA 3ZZ3A 1P9UA 1EUFA 3KF2A 3KEEA 5L2ZH 5GXPA 1DUEA 1D4PB 1ORFA 2FI5E 1V2MT 1FZZA 2JH6D 3ATLA 1GJ6A 1SFQB 4FVDA 4K69A 1AKSB 1GVZA 3TITA 5BPEA 1VR1H 3GYLB 1S5SA 4JZ1A 4BAKB 1F2SE 5A8ZA 5JPMH 2NU1E 1JRSA 1T8OA 4BNRA 1MKXK 2H9EH 5HGGA 4YLUA 5CMXH 1E36B 1O3IA 3LGTA 1EAXA 1VGCC 1SGFG 4BAOB 4I8KA 1QJ1B 2W5EA 4ISHH 3O8DA 3SU5A 1GJ8B 3ZVDA 1BITA 5E0HA 1SHHB 1E38B 1G3DA 4ISOA 2TIOA 1ACBE 1SQOA 1GBHA 3A89A 3QZRA 3S7HB 1CA8B 2ZGHA 2Z3EA 4CRGA 3MO6A 1GJDB 1YLDA 3UOUA 1QQ4A 1W7GH 4NA8A 4BTTB 3S0NA 1BQYA 1A61H 4XBBA 3UQOA 3HGPA 2IPHA 1BT7A 1W10U 4K1TA 4WXVA 4X6MA 1L1GA 3M61U 1LCYA 1O5GH 4U30A 5DGJA 4Z6AH 4YTAA 1F5RA 4AGJA 4DIHH 4X1QU 1KTSB 5EODA 1AUTC 1CHOG 5C2ZA 3QDZB 2ZC9H 1FN6A 4IBLH 1C4V2 1HAYB 1LPKB 4X2VA 1AUJA 1WQVH 6CHAB 2THFB 1TGSZ 1C5PA 1DE7H 1P05A 1YLCA
chains in the Genus database with same CATH superfamily
2XCFA 3SUEA 1TGBA 3FFGA 3UUZA 4ZKOU 4Y8ZA 1VITF 2WV5A 4WF8A 3SQHE 7KMEH 1NN6A 4CBOA 1EB1H 1H9LB 4O9VA 4ZXXH 3VPKA 1ZHMA 1F0RA 1EP6A 4JYUH 5JBAS 4INLA 2GZ8A 1FI8A 4FOUC 1TABE 1QQUA 2CJIA 2YOLA 1CSOE 4ISIH 2UUYA 1ZZZA 4X0WU 5ESTE 2ANYA 3D65E 3F2HA 1CHGA 1Y59T 1C1RA 1V3XA 2AGEX 1BMAA 3A7VA 3UWIA 2QXJA 1AU8A 1C5WB 3BV9B 4Y8YA 3LH1A 1B0EA 3K6YA 1CA0B 1O3EA 4FU7A 2H5DA 1FY3A 4UFGH 2UWLA 5E2PA 3D62A 3LH3A 5GPIB 1C1QA 3TGKE 7GCHG 1LHEH 3KQBA 3OEHD 1S84A 2VIQA 1TAWA 4UFEH 3UNSA 1NPMA 1IQGA 4WH8A 1QZ8A 1FY4A 3SU0A 2JDID 1AB9C 2G5VA 4AC9A 2R3UA 3GY8A 4KTUA 4O03A 1NROH 1A46H 1FIWA 1J9CH 2AGGX 3BN9A 3LOXA 4UFDH 3MH5A 4KP0A 2ZECA 5T6GA 3A88A 1BJUA 2ZU2A 3EA8A 1UTQA 4XE4A 3ZZ9A 2Y5GA 3PO1B 5EQRA 3RMMH 3TNSA 4NA9H 3ZVAA 1CBWB 3RU4D 2OXSA 2DE8A 1TA6A 2PGBB 2QF3A 2RDEA 1A0HB 2HVYB 1QGFA 3UPEA 4FU9A 1QL8A 3PTNA 4B73A 1AKSA 1QB9A 1BHXF 3K6ZA 2BQ6B 1Z8IB 1HFDA 1K21H 3SV9A 2BB4A 4YLQH 2BTCE 2XRCA 3E3TA 3TH2H 3VB5A 3VGCC 4CRAA 2QV1A 1VKYA 1ZRBA 3OE7D 3LDXH 2J95A 2BD3A 3RXQA 3E16B 1O2RA 3MO3A 3QUMP 4ZHLU 1F5KU 1N8OC 1QRXA 1E37B 2B5TB 3QTVH 1EJAA 1IQFA 4YOIA 3STIA 4FUHA 2FOMB 3LGVA 3URDA 4BAMB 5IYTA 1ID5H 1NO9H 4I8HA 3FP6E 2SFAA 3AAUA 1C2LA 3SU3A 2STBE 1EOLA 3FN8A 4GCHG 1SGYE 1YWUA 3UNQA 1E1RD 1ESAA 3RC4A 4OS7A 1GI4A 1C5TA 4I8GA 3V0XA 3SU6A 3BIVH 1P3CA 1H8HD 3BTME 1XUKA 1VITG 2XNIA 5CDFE 2AERH 1GHWH 1AE8H 1EPTC 1VCQA 2ZCHP 2ZPRA 1IQHA 1BTYA 3DSPA 5L2YH 2BY5X 5FCKA 1BMMH 3UB0A 1HAVB 1Z71A 1ZGIA 1SSXA 1XM1A 5F03A 1GGDC 1BTWA 4X8SH 1CO7E 1DWBH 4FUGA 1LHGH 8KME2 3NK8A 1TA2A 1HLTH 2SGAA 2SNVA 1QRZA 1NM6A 2BD5A 3E8LA 3RUOA 1WCZA 2GJGA 2HRVA 2JH0D 3M5LA 4XD7D 1YPMH 2C8XB 1V2ST 1F7ZA 1E34B 1HJ8A 2BQ7B 2P3UB 5PTPA 4IW4E 3RXFA 2GD4B 2GTBA 2J38A 1H9HE 1BB0B 3Q3KA 1O2WA 1TBQH 2CV3A 1WYKA 1C4Y2 4FXGH 3F9GA 3Q00A 1GBIA 3EE7A 5EJZA 4O3UA 4TPIZ 1AIXH 3PV4A 5DSFA 1O2MA 3MH4A 3DCLA 1GDNA 2A4RA 1O33A 2BD9A 2HWLB 1E79D 3ODDA 1ANDA 1TGTA 2QF4A 2UUKB 1A5HA 3M7UA 4BTIB 1HIAB 4XOJA 5C1YA 4DW2U 5B6OA 2FOEA 2LP6A 2V7QD 1G2LA 1MMJN 1LVYA 2ZKSA 2PGQB 1KIGH 1GBMA 2KCOA 5HIYA 1O3PB 2GVFA 1H1BA 1WBGB 4QT8C 2WZQA 9LPRA 3A7ZA 2BLOA 1ZHRA 4I8LA 3A7TA 1XKAC 2BD2A 2FS8A 4ABIA 3M37A 2NU4E 2BOHB 3F9HA 1BZXE 1MKWH 1ELTA 3BG4B 4ISNA 5EJ1A 4OS1A 4RT0A 1ZJDA 4K8YA 3UWJH 1GHXH 2B8OH 2JETB 1W0YH 3PMAB 3KYGA 4ISLA 3PYHA 3BEFB 3GDVA 2FOAA 1NU7B 1GCTC 2ZQ1A 2WYGA 1ANCA 4UDWH 3O8CA 2KCYA 5J4SA 1UVTH 2KX4A 1PPEE 3RMLH 4B1TA 5J4QA 1EOJA 1C5UA 1TPOA 1F5LA 3ZZ8A 1D6WA 2AH4X 2BYAX 2P8OB 3A7YA 2EA3A 2WUCA 3P17H 1V2UT 3BTEE 1D3TB 1UTMA 2QGRA 1W3CA 2K1QA 3DHKH 4NFFA 1KLTA 1YPHC 2SGEE 1HXFH 4NGAH 3LC3A 4WMEA 5BRRE 2IJD1 2GMTB 3GCTF 2XXLA 3F0PA 1RRKA 4B2CA 1QB6A 1MKXH 2W7UA 4AFSA 4A92A 5FPTA 3EGKH 1SI5H 1KXAA 2JIZD 2KR7A 2P59A 3SNAA 2GGVB 1NRRH 1UVPA 3QK1A 4TSFD 3ZZ7A 1FQ3A 1PJPA 1GJ9B 2ZDAH 3FVFB 4WY3A 2Q6FA 1T8NA 3LJOA 1GBBA 5LPRA 1GI1A 1ZJKA 3HK6B 1P11E 3ZZDA 1C2DA 2G51A 5LPEA 1L2EA 1MBQA 3SN8A 1PQAA 3NUMA 4Y0ZE 1TGCA 2CXVA 2FX4A 4DOQA 1GBKA 1ELGA 4MPXA 4H42U 4MQAA 3RP2A 3ENSB 4A5TS 1L4DA 5T6DA 2J9NA 2ALVA 1NFWA 2J2UA 1XUIA 2J5UA 1XUFA 1P10A 1YP9A 2R0KA 3SBKA 4HFPB 3ZVFA 1YCPM 2H1UA 3MYWA 1P02A 2HGTH 1NY22 5E8EH 3OTPA 3H5CB 5DG6A 1O2VA 2ZQ2A 1DITH 1SGPE 1UVOA 2Y5FA 3RXRA 4A1VA 1NT1A 4OGXA 1H8DH 3S69A 3PRDA 1G30B 2VNTA 1HDTH 1O3DA 1YGCH 1BBRK 2JH5D 3VG8A 2A5IA 1YM0A 1GVLA 1SLXB 1ELBA 3R3GB 2Y7ZA 1BMLA 1GBCA 1EJMA 1JIMA 1O3NA 1PYTC 1AFQC 2F9NA 3DSGA 3RXUA 2V3MA 2HOBA 2VWLA 5AFYH 2QC2A 1T31A 1UHBB 4IN2A 1HIAA 2BLWA 2QN5T 1OP0A 1LMWB 5EPYA 4GSOA 4U32A 2A7CA 1TOCB 2O8UA 1UTKA 1AI8H 2R0LA 3E1XB 3M35A 1DXPA 4Y6DA 1DT2A 1P8VC 4FUCA 1KXCA 1UCYK 4NIWA 1AN1E 5LH8A 2A4OA 2Y5HA 4NZLA 4AORA 1GI6A 2C4FH 1LHFH 2FOGA 1AE5A 2G8TA 5EQQA 3O8BA 3HATH 1IQEA 1IAUA 4RI0A 3V13A 1A1RA 4Q4LA 1ELEE 2XYAA 2BDHA 2M2AA 2J92A 1TE0A 2EI6A 3M3TA 4ZHAA 2A7HA 3STJA 1K28D 1ELFA 2B9LA 2ZEBA 2L6OA 1SPJA 1DICA 2D8WA 5T3HA 1N6YA 1ESBA 2FLRH 5C1XA 3RXPA 1BTZA 2RDLA 3Q3XA 1BRUP 3UFAA 5CHAB 3FZDA 1JWTA 3GCTG 1A0JA 3P8FA 1OS8A 3JZ1B 3SGQE 2FYRA 4ZHMU 4YO9A 4DVAU 3V7TA 2ZDKA 1WAYB 1LDTT 1SKYE 1UW7A 1OP2A 3BTGE 5F53A 1MD8A 1SOTA 2Z9LA 1SGTA 3QX5H 5C5NA 1B5GH 1GBDA 3Q76A 3LC5A 3ZYEA 1FXYA 4YZUA 3LGWA 1C5LH 2C8WB 4GVUA 2ANKH 1E0FD 1BA8B 2F4LA 4CBNA 1LVOA 1AHTH 1QRWA 3PWCA 1FUJA 1ZSJA 1LVBA 2BM2A 5GWZA 2WV9A 3UAIC 3EE0B 4B71A 1AFEH 3ATMA 2ZCKP 3SJ8A 2VIPA 1MCTA 1H4WA 1Y3UA 1P2MA 2AS9A 2ZPQA 2C3SA 2AEIH 1DY9A 1DX5M 3F1SB 4NIXA 3W94A 2TGPZ 3QO6A 1A7SA 3SV8A 1O39A 1O2ZA 2FYQA 2ZU3A 3SUGA 5F8ZA 3HK3B 1J17T 4F55A 1FONA 2YNAA 3E6PH 1QBVH 1LHDH 1UTJA 3LGIA 2VH0A 4JZIA 4Y71A 2BQWB 3M5MA 1H8IH 2G5NA 1WSSH 3SGBE 4Y76A 4CREA 4CRCA 1W0KD 4IC6A 1VITH 2ALPA 1KTTB 2ZDMA 2LNCA 2ZF0H 1AZZA 1EP5A 1C2JA 2PHBA 1YKTA 2ZGBH 4O97A 1YC0A 2RFKC 2TPIZ 2KCPA 2VVVA 2ULLA 1W12U 1TNLA 1O2TA 4FU8A 1ABIH 3ODFA 3SNDA 1WTHD 4Y7BA 1ELCA 5AHGH 3UQVA 4K8BA 4AYYB 5DJ7A 1NBME 1VCPA 4MPUA 1C1OA 2FLBH 4MNXA 2XC0A 1P2IA 3U69H 3NCLA 3A7XA 3A81A 2WPIS 3U8TH 4B74A 1GMDF 1O3HA 4LK4A 3GY7A 4AZ2B 3ZVGA 3OU0A 1GJAB 2NU2E 3TIUA 1AWFH 2CN0H 1UHBA 1ETTH 2GKVE 1O32A 3GDUA 4E7NA 3PMBB 2VU8E 3I29A 1O5DH 1QBOA 1GHZA 5C67A 3PLPA 5HM2A 2V35A 1S0QA 1ZPZA 1ZTKA 2ZTXA 3BEIB 4JZEH 1MTSA 2H5CA 1LKBA 3MU0A 3H09A 3N7DA 2QIQA 2ZG0H 2EQNA 3RLWH 1GCDA 5A0CA 2TGAA 4XBDA 3I78A 1RJXB 4WH6A 3O8RA 3BIUH 2AIQA 3RXMA 1QA0A 3N7EA 2I6QA 1TFXA 1OWKA 1ZPBA 1Z8JB 2W3KA 1N6XA 1GBLA 3DA9B 1OPHB 2BD4A 1AY6H 2BDCA 1UTPA 5EW2H 4K1SA 2HALA 2VGCB 4GCHF 2ZU4A 2P16A 4OGYA 2RG3A 4CR5A 1Z1IA 3TNTA 1GWAA 2Z9IA 4Y8XA 1JRTA 2H2ZA 4VGCB 4YT7H 1YPJH 4ZCNA 2VINA 5SGAE 4LOYH 3SI3H 3SV6A 1GL1A 1QY6A 1TRYA 3DFJA 1FPHH 3IG6B 1W7XH 4FUDA 2FIRH 5TCAA 4NG9H 4BANB 3F2GA 1O3CA 2L74A 1DWEH 2GCTB 3F3BA 1F92A 1BOQA 3V3MA 1MTNB 1QL7A 3RM2H 4D7FA 5C0TA 2JKHA 2VIDA 1P2KA 3BTWE 2Z9JA 3GCOA 2SNWA 1W13U 3S9AA 3TLOA 1XUJA 3L3TA 3SU1A 2FWWA 3BSQA 1IQLA 5FX6A 3ZZCA 1V6DA 1Y5AT 4MPVA 5EXLA 4X2XA 1JOUB 4I32A 1SLWB 3A80A 2QYIA 1L1JA 3A82A 1GJ7B 1THRH 1P3EA 1WOFA 1SFIA 3B23B 3F0OA 1G2MA 2IOTA 3M5OA 1JMOH 6LPRA 1S82A 1W11U 2CHAB 1P03A 3QGJA 4BXWA 1AD8H 1MABB 2Y82A 3AASA 2P94A 2FM2A 1K0HA 1ZPCA 4UE7H 3U1IB 1BMNH 2PTCE 3A84A 3URCA 2WPHS 1BCUH 3Q3YA 1V2PT 3GCHC 3PMJA 4Q7YA 2IPQX 4X8UH 2BLVA 2W26A 1FJSA 4I33A 2ESTE 4A6LA 5FBIA 8ESTE 3KQEA 1SGDE 1YCPK 1IHTH 2KZ4A 4WWYA 1TNIA 5A0BA 1O2PA 4AFQA 1GMDG 3UR9A 2PP6A 3D49H 2ZPSA 1O3FA 1O2HA 3DD2H 4MNWA 2O8LA 4IN1A 3A83A 5A8YA 1O30A 1T7CA 2FI3E 1G37A 4CH2B 3EQ0H 4XBCA 3W1EA 1C5YB 1LQDB 2F9BH 1RIWB 2OC7A 2QAAA 3TK9A 5C0UA 2AIPA 3KQ5A 3MHWU 2NWNA 1C2KA 2OTVA 1P57B 1LPGB 1THPB 2ZDVH 3DFLA 3MNXA 4TWWA 3SJIA 5DKMA 1BBRH 2SGFE 2PV9B 2CGAA 3MNCA 5E0JA 2QA9E 3FP8E 1OYQA 1CT0E 1O3GA 1O34A 3FO8D 4F48B 3QWCH 3LIWA 4RKOB 4CHAB 1MTUA 3A8AA 4UONA 1TWXB 1SHYA 1EAUA 3F6UH 3P95A 1K1LA 2P93A 4I31A 4MTBA 1AWHB 4OS2A 5FCRA 4ABFA 2PKSC 1SGFA 2FOBA 3PMHB 3KL6A 2VWOA 4ABHA 1AVGH 1ETSH 3H7OA 1P0SH 1Y3XA 2GDDA 5T6FA 1SGEE 1P01A 1FAKH 3MU5A 1G9IE 2UWPA 5FHTA 1KDQB 2A4GA 1GI2A 4XFQA 1FMGA 1UCYH 1NRPH 2F9UA 3ITIA 2A45B 3OEED 4ZAEA 2Y6TA 1CU1A 1X7AC 3ESTA 2G4UA 2CF9H 3MU1A 1AO5A 2A4QA 1HCGA 1YBWA 2K0QA 2R2MB 3BF6H 3MWIU 4GHTA 2GV7A 4KTCA 2A32A 4GHQA 1UTOA 2ZGCA 1EKBB 2A0QB 3DUXH 4GAWA 3OY5U 2XBXA 2ZHQH 4I7YH 2UUFB 3RC5A 3SUFA 1NU9A 5FBEA 1TNHA 1TX6A 1XMNB 2YMSB 3MQKC 4YM9A 4K5ZA 1NFYA 2BY6X 1P9SA 3TJUA 4UEHH 3KCGH 1TLDA 1WQSA 2FS9A 4TY6A 1MBMA 3LKWA 4NWLA 4I8JA 1T8LA 3N7OA 4KTSA 1AVXA 3MO9A 1P06A 1FLEE 3ZYDA 3V12A 5DP5A 4AN7A 1OWJA 1O5FH 1P2QA 1SQAA 1C2HA 3PB1E 2GT7A 2EI7A 1AQ7A 1HB0B 1AVWA 4DGJA 4X8VH 1GBTA 1P04A 2B0FA 1SQRA 1XUHA 5C5OA 2HVXA 5DP8A 4H6TA 5GNDA 1Z6EA 2ODPA 4YOGA 1ELVA 3LPRA 5FXLA 3GDSA 3SU2A 5A0AE 1HJAB 1GG6B 4ACBA 2BX4A 1OXGA 4Y79A 2SGQE 1PQ5A 1MU8B 1TPAE 2BZAA 4M9FA 2R9PA 3ELAH 3GY2A 2BXUH 5FL7D 1V2WT 3TK6A 5DK1A 1PPHE 1Z1JA 3TH4H 1COWD 2BDBA 5B6LA 1A3BH 1O5AB 1EX3A 2ZNKH 1IQNA 1BHXB 2C8ZB 2WUBA 3F9EA 3E90B 1GMHG 2G4TA 6CHAC 3SOSA 2FOHA 1TYNA 2KCAA 3LGUA 4ZH8A 1YLNA 3KYFA 5JB9S 1C1PA 3U8OH 1QBNA 1DM4B 2AHME 2FODA 2QF5A 4WMFA 4NFEA 3KHVA 1QCPA 4OS4A 1ARBA 3GY4A 4HGCA 4X2WA 5EU8A 4ZKNU 4JK6A 3MMGA 2KFWA 3MFJA 5F6MA 3SI4H 2XTTB 3VB3A 2Y80A 5JBTA 4JZFH 2F9VA 5DP3A 1K1IA 4JCNA 4MLFB 1O35A 4ZXYH 4E7RG 1H8ED 1GDUA 1HPGA 4AFZA 1J8AA 1KMHB 4RSPA 4XRNA 5H4IB 3ZZAA 1QNJA 2VWMA 3HPTB 5E2OA 4J2YB 5ETXA 4Y0YE 5EOKA 3RMNH 1UO6A 2HLDD 4INHA 1TALA 3RXDA 3CS7A 3TJOA 1O38A 3AW1A 1CA0C 3PLBA 5DP9A 1MUEB 1WU1A 1KDQA 4THNH 4ACAA 2WPJS 4ABEA 5ESBA 3T5FH 2F9PA 1PFXC 1XXFA 5TJXA 3VXEH 3MU4A 5A2MH 3VXFH 5K0HA 5C1UA 4B76A 3M7QA 2H9HA 4X1PU 2OQ5A 3ZIAD 5DO4H 4IMZA 1W14U 1VGCB 2ZHEH 5HYOA 4GPGA 1XX9A 1ZMJA 4A1XA 2HNTE 1HAVA 2A2XH 1LO6A 1VCWA 3TK5A 3P8GA 1F0UA 1D3PB 1GBJA 1L0ZA 1D3QB 1DXWA 2XWBI 1O5CB 3PO1C 3E91A 2FO9A 2F43B 2A5AA 1NFXA 4TY7A 3SORA 4E05H 2WHXA 4MVNA 4O3TA 4P02A 1CBWC 1EFRD 1MZAA 4RKJB 2ZU5A 3OFND 4MDSA 5JBBS 3ZZBA 3EYDA 1Q3XA 4LZ1H 4TPYA 4Q80A 2QXHA 1SGIB 1H9IE 4DY7B 2OK5A 1PPZA 3UIRA 5K7RA 1EAIA 1K1NA 1FPCH 2Q6DA 3UOPA 3SJOA 1LHCH 3HKJB 3RXIA 5FPYA 1ZOMA 1PQ8A 1FAXA 2ZFTA 4H6SB 1Q2WA 3LT3A 1O2KA 1RFNA 2BVSH 2ZO3H 3LU9B 3NZIA 1O5EH 1GPZA 4IS5A 1LKAA 4ABJA 1DFPA 2FI4E 4AGKA 1E1QD 1UMAH 3A85A 5FX5A 1ZYOA 1O36A 1MCVA 3KIDU 3GCNA 4AB9A 1A0LA 1O2IA 2RA3A 1INCA 5GJ4B 2ODQA 1AGJA 1V2TT 3GY5A 3T62A 1IQMA 1AZ8A 5CE1A 2Q6GA 4A7IB 1O3OA 3SZEA 1Y5BT 2GZ7A 2XOKD 2W7SA 3EA9A 1NS3A 3EAJA 3U9AH 1T32A 2BVXH 3FANA 4OS5A 2IN2A 3UNRA 2GP9B 2P3TB 3TGJE 4R0IA 1W0JD 3OX7U 1JXPA 2WYJA 4TWYA 1EJNA 1CVWH 3P8NA 4HG6A 1SGNE 3GOVB 1ETRH 1KXDA 1TPPA 5EXNA 5EG4A 1SB1H 1THSH 1XUGA 1KXBA 1YCPH 1O2OA 5LPFA 2PFEA 2WINI 1BIOA 1O2SA 5EJLA 2VJ1A 4R8TB 3W95A 3SYJA 1S85A 2QE7D 3M3SA 3ZZ4A 1AB9B 1O3LA 1TNKA 1SBWA 4Y10E 1NESE 1PPBH 3T28A 3OY6U 1GI8B 4RT1A 1C5RA 1A3EH 1O0DH 1P2OA 3S7KB 1FX0B 1NBMD 4KGAA 1G32B 1OYTH 1C9TA 2FESH 2JJ2D 1C4U2 4YT6H 1GJ4H 1GI0A 1ELAA 2H6MA 1ELDE 2NU0E 3KNXA 1NC6A 1O2UA 1ZMLA 2FXRA 1QB1A 1OKXA 4UFFH 1S6LA 4BXSA 4TYDA 4PROA 2ZI2H 3WWBA 1P2NA 4X6OA 2JJ1D 3D23A 3QLPH 1O3MA 1DLEA 2WPLS 2OC0A 3RXOA 4NSYA 5EXMA 1QL9A 1SOZA 1S6HA 4MPWA 2ZIQH 1QFKH 3TVJB 1T4UH 2Y7XA 1ZMNA 3VGCB 3ATKA 4RN6A 2XBYA 3MNSA 2NU3E 5G4BA 2ZDNA 3PROA 4WXIA 1V2VT 1EQ9A 1BRCE 1TOMH 1OWDA 4Q7XA 4X2YA 2A1DB 1FY1A 2HPPH 1N1LA 1V2JT 1SG8B 1CQQA 1N8OB 1MH0A 3KGPA 2BHGA 4X1RU 1BTXA 1PPFE 3GICB 3BG4C 2W3IA 2FEQH 4B6EA 2OC8A 2JETC 3E0PB 4DT7B 3BTHE 2ANMH 2BZ6H 3TU7H 2UUJB 3P6ZB 4B75A 1FY5A 3OSYA 4DCDA 4HTCH 1HUTH 1WTGH 1GJBB 1P2JA 3LGYA 5DP7A 1C1TA 1EPTB 3NRLA 2O8TA 1TQ0B 2A7JA 1C5SA 3R0FA 1UK2A 3BTDE 2P8OC 2EY4C 3OTJE 2TGDA 2PUXB 1GGDB 2OQUA 2GCHF 1C5VA 1BTPA 2V3OH 2XNDD 2GMTC 1CT2E 5DP4A 1G3CA 1Z8GA 3KN2A 1XVMA 3QZQA 1QJ6B 2A31A 5GCHF 2VIVA 2H9TH 5F8TA 1C2MA 1EZXC 4NZQA 2Z94A 2HLCA 3F2FA 2BDIA 3RXHA 2XC5A 4SGBE 3GYMA 7LPRA 1O2XA 1ARCA 4CRBA 4NCYA 2XW9A 1TNGA 4CR9A 1O3KA 1OWIA 1LVMA 2GZ9A 1HBTH 3SHCH 4XSKU 5EW1H 1O2NA 2P95A 1W8BH 3ZV8A 1EXFA 2A2QH 2ZFSA 2HPQH 2ZTYA 4WMDA 2O8MA 1GJ5H 1S0RA 1MTWA 3MU8A 3MNBA 3BEUA 3F9FA 4IMQA 1HAGE 5F8XA 1GHAF 3AVZA 1LQEA 1SL3A 1OSSA 3T25A 5LGOA 2AYWA 1EZSC 1YPLH 4A1TA 1GMCG 5DPAA 3G01A 3JZ2B 2ZHWH 1O5BB 1C1VH 1C2FA 3A8DA 2ZZUH 3T26A 2GDEH 3KQDA 1LTOA 1O3BA 1DPOA 2EC9H 1C2GA 1MD7A 3RC6A 1TMTH 1O2JA 2TRMA 2Z3CA 4FUIA 1BBRE 3FP7E 3BTTE 1FY8E 2BVRH 1C1MA 2PTNA 2ZU1A 1G3EA 3SHAH 5JB8S 1L1NA 4D9QA 1GCTB 1OWHA 1HAXB 3RXTA 5FAHA 2OLGA 2G55A 1JIRA 5IDKA 1QA7A 4JYVH 4ZKRU 1NFUA 2P3FH 4KKDA 3C1KA 1NRNH 4ABGA 5A09A 1S83A 1ZLRA 1O2YA 3RXVA 3ZVBA 3K9XB 1GHBF 4YXWD 1GI3A 1V2KT 1ZR0A 2G81E 4X1NU 1D6RA 4BOHA 2TBSA 1F0SA 1HNEE 1MZDA 2ANWA 2BDGA 4DJZB 3RXEA 2PSXA 5I25A 3C27B 1EZQA 2KAIB 3KQCA 1K22H 2PKAB 2Z9GA 3L33A 1NTPA 2VWNA 1EAWA 4F4OC 3LJJA 1UCYE 5FPSA 2V0BA 1A5GH 2R2WU 1FV9A 4FETA 1TBZH 8LPRA 2ASUB 2DUCA 1RS0A 2Z9KA 3VEQB 2FMJA 3NKKA 1TONA 1WXRA 3RXBA 3ZV9A 2ZGJA 4CH8B 5KEDA 2F83A 1CGJE 3T2NA 2GCHG 1C5QA 2ILNA 3NWUA 5AVDA 1DY8A 2AMQA 5CHAC 3ZZ6A 2STAE 1XXDA 4JK5A 1SQTA 2C93B 2YNBA 2J4IA 2VVCA 4ZROA 1EPTA 1GHVH 1ABJH 1ESTA 5HXFA 1UJ1A 5GCHG 4ESTE 3AW0A 4X6NA 1O31A 2WPDD 3A86A 3M5NA 2BX3A 4GUXA 1Y3VA 3RDZA 1HRTH 1XKBC 4DG4A 3NPSA 2ZFQH 1GMHF 1CGIE 4ZUHA 1D9IA 1VJ9U 4Y11E 1O37A 3ZZ5A 2ZP0H 3A8BA 1UTNA 1P12E 1GI9B 3EA7A 5AF9H 3TGIE 2AFQB 1OHHD 1TPSA 1YPKH 2C90B 2OD3B 1HAOH 1BRAA 4BAHB 1VJAU 1KLJH 1MAYA 4TT3D 1RD3B 3UREA 3SJ9A 1QHRB 1SC8U 1V2RT 1GBAA 2B7DH 2BY9X 3Q77A 3PM3A 2PLXA 1ANEA 3P92A 3UR6A 2AGIX 1GHAG 1ZTJA 1ZHPA 1NZQH 2ZGXH 3UY9A 2CK3D 2FP7B 2QY0B 1AFQB 1O3AA 3H7TA 3TH3H 3VB7A 3U8RH 1CE5A 2VB0A 3E0NB 4NWKA 3RM0H 4ABDA 1YPEH 3MH6A 1UVUH 3BTQE 3M3VA 4ABBA 3RXGA 2OCVB 1EASA 2OBQA 4B2BA 1GBEA 1C5XB 1C5ZB 2Z6BD 1K1JA 2RA0A 1AMHA 1BRBE 1DANH 1HAIH 4AFUA 4YESB 4DIIH 1TBRH 3SNBA 3L6PA 1HAPH 2V3HH 3MH7A 1DWCH 1YPGH 1DSTA 1V2QT 2ZTZA 4OS6A 1B0FA 3RU4E 1GHBG 4HI3A 1MQ6A 1Y3YA 4MG3A 2BLQA 3MTYA 1ZSKA 1B7XB 3HKIB 1YYY1 4BAQB 3SUDA 1IQJA 2BXTH 2CMYA 1BUIA 1RGQA 1WDIA 1ZRKA 4B2AA 2BOKA 3MOCA 5AFZH 2BY7X 2F91A 5C20A 2J97A 2LPRA 3S9BA 4MNYA 2ZCLP 3UTUH 1GJCB 4AX9H 2Y81A 2ZFFH 1J14A 4FUFA 2QCYA 2UWOA 3LONA 1V2OT 3SV2H 4K1EA 5I46H 4YOJA 1FNIA 3A8CA 1FIZA 2FZZA 2VIOA 2KAIA 4K3JA 4J1YA 1D3DB 1T8MA 2PKAA 4DURA 2VVUA 4AYVB 3A87A 2W6JD 3U1JB 4U2WA 1DOJA 1SLVB 3I77A 3VFEA 5IK2D 3MI4A 4FUBA 1GI5A 1UTLM 1O2GH 2VBCA 5CHBA 1BDAA 3F68H 4Q7ZA 1U6QA 1HAZB 3WY8A 1CGHA 2BD7A 1C9PA 3K65B 3BTKE 1HJ9A 4CRFA 1SR5C 3P70B 1PQ7A 2VGCC 1RTFB 5GIBA 2ZFRH 2G00A 1TQ7B 6GCHF 1C5MD 1QR3E 3SZNA 1Z8RA 8GCHF 2PUQH 4INKA 4SGAE 1EATA 1BMFD 4VGCC 3S9CA 1SGRE 4NA7A 3PV5A 2J98B 2O9QA 3WWFA 3M7TA 1DUAA 4LXBH 2WPMS 2J94A 1ANBA 2GT8A 3IWMA 1UK3A 4X1SU 1XVOA 4Q2KA 1PPGE 2GCTC 1BTUA 1V2LT 5KECA 2PSYA 2C8YB 3FAOA 1MTNC 1W2KH 3GY3A 2XCNA 1IOEA 1ZSLA 2AMPA 2BDAA 1SLUB 2XBVA 3OYPA 2ZA5A 4NIYA 1TIOA 4H4FA 2FPZA 3AAVA 3HGNA 4D76A 2FOFA 1HXEH 4U01A 1QTFA 4FUEA 3ZVCA 1SGQE 1W0ZU 4Y7AA 2I6SA 7ESTE 3PWBA 1DDJA 3U28C 1TGNA 4GLYA 1NRSH 3SO3A 2BY8X 4FVBA 1L4ZA 2XBWA 1BJVA 1QIXB 1DS2E 2CHAC 3CP7A 3M36A 2SGDE 3TJVA 4B6FA 1GL0E 1YPHE 2OINA 1QJ7B 2EI8A 5EGMA 5L6NH 5C94A 1ZTLA 2D2DA 4ZMAH 2KM0A 1PYTD 1F0TA 2HNTC 2V6NA 4IC5A 1K1PA 1JBUH 5GDSH 1VZQH 3RLYH 3RXSA 4HZHA 1SVPA 1Y8TA 6ESTA 5DP6A 1TNJA 2F9OA 3NXPA 1S81A 3T29A 1NRQH 2VH6A 1UVSH 2IJOB 5C3NA 1IHSH 3ATIA 1O3JA 5JYIA 1WV7H 5KGOA 1RIWC 1HYLA 3B8JA 2PW8H 2YMSD 3SU4A 1KXEA 1GVKB 4F49A 1HGTH 3QN7A 5A8XA 1LPZB 1J16A 2BD8A 2ZHDA 4AG1A 4LZ4B 2RCEA 4D8NA 1KSNA 4Z0KA 1SGCA 2VIWA 3ZVEA 3A7WA 2AMDA 1TB6H 2LELA 4CHAC 2D26C 3RXKA 3TJNA 4AB8A 3SNCA 3GS9A 1C5NH 1GBFA 3OAAD 2FOCA 2D1JA 4JYTA 2XWAA 2A5KA 1T4VH 4CRDA 2EEKA 1IQIA 2W6ID 3SW2B 3WW7A 5EIYA 1S6FA 3FOAA 1SMFE 5EPNA 3CENA 4M7GA 4ASHA 1DVAH 6GCHG 1OP8A 2WV4A 2BDYA 1GHYH 1FDPA 2ZWLH 8GCHG 2ODYB 3BG8A 4MNVA 1MAXA 4XDEA 5TCCA 2K8IA 1Q31A 1KYNA 2FTLE 1UK4A 3RXLA 4AG2A 1G36A 3BTFE 4AOQA 2J34A 1E35B 4K60A 1KLIH 4IGDA 4X8TH 2XC4A 3RXAA 1EZUC 4ASUD 2O8WA 2PR3A 3B9FH 4K2YA 1A5IA 3CS0A 1TX8A 2J98A 5JDUB 1C1UH 3DT0H 2CF8H 5EQSA 2YMSC 3VB4A 1GDQA 4ABAA 2ZDLA 1G3BA 3GCHB 1M9UA 2GX4A 1Z6JH 2QXGA 3U98H 4KELA 5JBCS 2F3CE 4JZDH 1O2LA 4X6PA 1OWEA 1A4WH 2BMGB 1Z7KA 1WUNH 1CT4E 2Q1JA 3GISB 1FN8A 3FZZA 1MTVA 2Z3DA 2OBOA 1DLKB 2R3YA 1EB2A 1V2NT 2PWXA 1BTHH 3RXJA 3T27A 2WSSD 1GMCF 1Y3WA 3QGNB 1C2EA 2FTMA 1IQKA 2QF0A 1TX7A 1PPCE 2Z7FE 4Q63A 2OP9A 1CHOF 1P09A 2ZHFH 1OOKB 4WVPE 5T1VA 4DT4A 3DSOA 2M5TA 2DE9A 3TPIZ 3SV7A 2WPKS 1Y5UT 3SGAE 1MQ5A 1HJAC 3ATWA 4E06H 1GG6C 5ABWA 2FDAA 1C1SA 4NIVA 3RXCA 1KXFA 2ZFPH 4I86A 3PLKA 2PKSB 4D9RA 1TMBH 1C2IA 2G52A 1TRNA 5C17A 1J15A 1C5OH 5HMAA 5L30H 1RTKA 3P8OA 3PTBA 1C1WH 1KY9A 2SGPE 2OUAA 1A2CH 2GV6A 1K2I1 1K9OE 3QTOH 1ZGVA 1DSUA 1QURH 5E0GA 1TMUH 2QXIA 3SJKA 4D7GA 3K2UA 9ESTA 3RMOH 1MKWK 1RXPA 3VB6A 4BTUB 2OC1A 1O2QA 2TGTA 1OX1A 1C1NA 1DWDH 1K1OA 3SQEE 4JMYA 3EDXB 3IITA 4ZKSU 1MU6B 3GY6A 4FUJA 7GCHF 1HV7A 5HM9A 5HIZA 4UD9H 1TRMA 1K1MA 2FX6A 1YF4A 2HNTF 1RTLA 1HAHH 4NSVA 1GI7B 3RU4T 4WJG2 3SNEA 3ZZ3A 1P9UA 1EUFA 3KF2A 3KEEA 4OM9A 5L2ZH 5GXPA 1DUEA 1D4PB 1ORFA 2FI5E 5HKKD 1V2MT 1FZZA 2JH6D 3ATLA 1GJ6A 1SFQB 4FVDA 4K69A 1AKSB 1GVZA 3TITA 5BPEA 1VR1H 3GYLB 1S5SA 4JZ1A 4BAKB 1F2SE 5A8ZA 5JPMH 2NU1E 1JRSA 1T8OA 4BNRA 3PRBA 1MKXK 2H9EH 5HGGA 4YLUA 5CMXH 1E36B 1O3IA 3LGTA 1EAXA 1VGCC 1SGFG 4BAOB 4I8KA 1QJ1B 2W5EA 4ISHH 3O8DA 3FKSD 3SU5A 1GJ8B 3N99A 3ZVDA 1BITA 5E0HA 1SHHB 1E38B 1G3DA 4ISOA 2TIOA 1ACBE 1SQOA 1GBHA 3A89A 3AK5A 3QZRA 3S7HB 1CA8B 2ZGHA 2Z3EA 4CRGA 3MO6A 1GJDB 1YLDA 3UOUA 1QQ4A 3PV2A 1W7GH 4NA8A 4BTTB 3S0NA 1BQYA 1A61H 4XBBA 3UQOA 3HGPA 2IPHA 1BT7A 1W10U 4K1TA 4WXVA 4X6MA 1L1GA 3M61U 1LCYA 1O5GH 4U30A 5DGJA 4Z6AH 4YTAA 1F5RA 4AGJA 4DIHH 4X1QU 1KTSB 5EODA 1AUTC 1CHOG 5C2ZA 3QDZB 2ZC9H 1FN6A 4IBLH 1C4V2 1HAYB 1LPKB 4P00A 4X2VA 1AUJA 1WQVH 6CHAB 2THFB 1TGSZ 1C5PA 1DE7H 1YY3A 1P05A 3CNRA 4Z1MD 1YLCA 5DN6D
chains in the Genus database with same CATH topology
2XCFA 3SUEA 1TGBA 3FFGA 3UUZA 4ZKOU 4Y8ZA 1VITF 2WV5A 4WF8A 3SQHE 7KMEH 1NN6A 4CBOA 1EB1H 1H9LB 4O9VA 4ZXXH 3VPKA 1ZHMA 1F0RA 1EP6A 4JYUH 5JBAS 4INLA 2GZ8A 1FI8A 1TABE 1QQUA 2CJIA 2YOLA 1CSOE 4ISIH 2UUYA 1ZZZA 4X0WU 5ESTE 2ANYA 3D65E 1CHGA 1Y59T 1C1RA 1V3XA 2AGEX 1BMAA 3A7VA 3UWIA 2QXJA 1AU8A 1C5WB 3BV9B 4Y8YA 3LH1A 1B0EA 3K6YA 1CA0B 1O3EA 4FU7A 2H5DA 1FY3A 4UFGH 2UWLA 5E2PA 3D62A 3LH3A 5GPIB 1C1QA 3TGKE 7GCHG 1LHEH 3KQBA 1S84A 2VIQA 1TAWA 4UFEH 3UNSA 1NPMA 1IQGA 4WH8A 1FY4A 3SU0A 1AB9C 2G5VA 2R3UA 3GY8A 4KTUA 4O03A 1NROH 1A46H 1FIWA 1J9CH 2AGGX 3BN9A 3LOXA 4UFDH 3MH5A 4KP0A 2ZECA 5T6GA 3A88A 1BJUA 2ZU2A 3EA8A 1UTQA 4XE4A 3ZZ9A 2Y5GA 3PO1B 5EQRA 3RMMH 3TNSA 4NA9H 3ZVAA 1CBWB 3RU4D 2OXSA 2DE8A 1TA6A 2PGBB 2QF3A 1A0HB 1QGFA 3UPEA 4FU9A 1QL8A 3PTNA 4B73A 1AKSA 1QB9A 1BHXF 3K6ZA 2BQ6B 1Z8IB 1HFDA 1K21H 3SV9A 2BB4A 4YLQH 2BTCE 2XRCA 3E3TA 3TH2H 3VB5A 3VGCC 4CRAA 2QV1A 1ZRBA 3LDXH 2J95A 2BD3A 3RXQA 3E16B 1O2RA 3MO3A 3QUMP 4ZHLU 1F5KU 1N8OC 1QRXA 1E37B 2B5TB 3QTVH 1EJAA 1IQFA 4YOIA 3STIA 4FUHA 2FOMB 3LGVA 3URDA 4BAMB 5IYTA 1ID5H 1NO9H 4I8HA 3FP6E 2SFAA 3AAUA 1C2LA 3SU3A 2STBE 1EOLA 4GCHG 1SGYE 3UNQA 1ESAA 3RC4A 4OS7A 1GI4A 1C5TA 4I8GA 3V0XA 3SU6A 3BIVH 1P3CA 3BTME 1XUKA 1VITG 2XNIA 2AERH 1GHWH 1AE8H 1EPTC 1VCQA 2ZCHP 2ZPRA 1IQHA 1BTYA 5L2YH 2BY5X 5FCKA 1BMMH 1HAVB 1Z71A 1ZGIA 1SSXA 1XM1A 5F03A 1GGDC 1BTWA 4X8SH 1CO7E 1DWBH 4FUGA 1LHGH 8KME2 3NK8A 1TA2A 1HLTH 2SGAA 2SNVA 1QRZA 1NM6A 2BD5A 3E8LA 3RUOA 1WCZA 2JH0D 2HRVA 3M5LA 1YPMH 2C8XB 1V2ST 1F7ZA 1E34B 1HJ8A 2BQ7B 2P3UB 5PTPA 4IW4E 3RXFA 2GD4B 2GTBA 2J38A 1H9HE 1BB0B 3Q3KA 1O2WA 1TBQH 2CV3A 1WYKA 1C4Y2 4FXGH 3F9GA 3Q00A 1GBIA 4O3UA 4TPIZ 1AIXH 3PV4A 1O2MA 3MH4A 1GDNA 2A4RA 1O33A 2BD9A 2HWLB 3ODDA 1ANDA 1TGTA 2UUKB 1A5HA 3M7UA 4BTIB 1HIAB 4XOJA 5C1YA 4DW2U 5B6OA 2FOEA 1G2LA 1MMJN 1LVYA 2ZKSA 2PGQB 1KIGH 1GBMA 1O3PB 2GVFA 1H1BA 1WBGB 4QT8C 9LPRA 3A7ZA 2BLOA 1ZHRA 4I8LA 3A7TA 1XKAC 2BD2A 2FS8A 4ABIA 3M37A 2NU4E 2BOHB 3F9HA 1BZXE 1MKWH 1ELTA 3BG4B 4ISNA 4OS1A 1ZJDA 4K8YA 3UWJH 1GHXH 2B8OH 2JETB 1W0YH 3PMAB 4ISLA 3PYHA 3BEFB 3GDVA 2FOAA 1NU7B 1GCTC 2ZQ1A 2WYGA 1ANCA 4UDWH 3O8CA 5J4SA 1UVTH 1PPEE 3RMLH 4B1TA 5J4QA 1EOJA 1C5UA 1TPOA 1F5LA 3ZZ8A 1D6WA 2AH4X 2BYAX 2P8OB 3A7YA 2EA3A 2WUCA 3P17H 1V2UT 3BTEE 1D3TB 1UTMA 2QGRA 1W3CA 2K1QA 3DHKH 4NFFA 1KLTA 1YPHC 2SGEE 1HXFH 4NGAH 3LC3A 4WMEA 5BRRE 2GMTB 3GCTF 2XXLA 1RRKA 4B2CA 1QB6A 1MKXH 2W7UA 4AFSA 4A92A 5FPTA 3EGKH 1SI5H 1KXAA 2P59A 3SNAA 2GGVB 1NRRH 1UVPA 3QK1A 3ZZ7A 1FQ3A 1PJPA 1GJ9B 2ZDAH 3FVFB 4WY3A 2Q6FA 1T8NA 3LJOA 1GBBA 5LPRA 1GI1A 1ZJKA 3HK6B 1P11E 3ZZDA 1C2DA 2G51A 5LPEA 1L2EA 1MBQA 3SN8A 1PQAA 3NUMA 4Y0ZE 1TGCA 2CXVA 2FX4A 4DOQA 1GBKA 1ELGA 4MPXA 4H42U 4MQAA 3RP2A 3ENSB 4A5TS 1L4DA 5T6DA 2J9NA 2ALVA 1NFWA 2J2UA 1XUIA 1XUFA 1P10A 1YP9A 2R0KA 3SBKA 4HFPB 3ZVFA 1YCPM 2H1UA 3MYWA 1P02A 2HGTH 1NY22 5E8EH 3H5CB 5DG6A 1O2VA 2ZQ2A 1DITH 1SGPE 1UVOA 2Y5FA 3RXRA 4A1VA 1NT1A 4OGXA 1H8DH 3S69A 1G30B 2VNTA 1HDTH 1O3DA 1YGCH 1BBRK 2JH5D 2A5IA 1YM0A 1GVLA 1SLXB 1ELBA 3R3GB 2Y7ZA 1BMLA 1GBCA 1EJMA 1JIMA 1O3NA 1PYTC 1AFQC 2F9NA 3RXUA 2HOBA 2VWLA 5AFYH 2QC2A 1T31A 1UHBB 4IN2A 1HIAA 2BLWA 2QN5T 1OP0A 1LMWB 5EPYA 4GSOA 4U32A 2A7CA 1TOCB 2O8UA 1UTKA 1AI8H 2R0LA 3E1XB 3M35A 1DXPA 4Y6DA 1DT2A 1P8VC 4FUCA 1KXCA 1UCYK 4NIWA 1AN1E 5LH8A 2A4OA 2Y5HA 4NZLA 4AORA 1GI6A 2C4FH 1LHFH 2FOGA 1AE5A 2G8TA 5EQQA 3O8BA 3HATH 1IQEA 1IAUA 3V13A 1A1RA 1ELEE 2XYAA 2BDHA 3M3TA 2J92A 1TE0A 2EI6A 4ZHAA 2A7HA 3STJA 1K28D 1ELFA 2B9LA 2ZEBA 1SPJA 1DICA 2D8WA 5T3HA 1N6YA 1ESBA 2FLRH 5C1XA 3RXPA 1BTZA 2RDLA 3Q3XA 1BRUP 3UFAA 5CHAB 3FZDA 1JWTA 3GCTG 1A0JA 3P8FA 1OS8A 3JZ1B 3SGQE 2FYRA 4ZHMU 4YO9A 4DVAU 3V7TA 2ZDKA 1WAYB 1LDTT 1OP2A 3BTGE 1MD8A 1SOTA 2Z9LA 1SGTA 3QX5H 5C5NA 1B5GH 1GBDA 3Q76A 3LC5A 3ZYEA 1FXYA 4YZUA 3LGWA 1C5LH 2C8WB 4GVUA 2ANKH 1E0FD 1BA8B 4CBNA 1LVOA 1AHTH 1QRWA 3PWCA 1FUJA 1ZSJA 1LVBA 2BM2A 5GWZA 3EE0B 4B71A 1AFEH 3ATMA 2ZCKP 3SJ8A 2VIPA 1MCTA 1H4WA 1Y3UA 1P2MA 2AS9A 2ZPQA 2C3SA 2AEIH 1DY9A 1DX5M 3F1SB 4NIXA 3W94A 2TGPZ 3QO6A 1A7SA 3SV8A 1O39A 1O2ZA 2FYQA 2ZU3A 3SUGA 5F8ZA 3HK3B 1J17T 1FONA 2YNAA 3E6PH 1QBVH 1LHDH 1UTJA 3LGIA 2VH0A 4JZIA 4Y71A 2BQWB 3M5MA 1H8IH 2G5NA 1WSSH 3SGBE 4Y76A 4CREA 4CRCA 4IC6A 1VITH 2ALPA 1KTTB 2ZDMA 2LNCA 2ZF0H 1AZZA 1EP5A 1C2JA 2PHBA 1YKTA 2ZGBH 4O97A 1YC0A 2TPIZ 2VVVA 2ULLA 1W12U 1TNLA 1O2TA 4FU8A 1ABIH 3ODFA 3SNDA 1WTHD 4Y7BA 1ELCA 5AHGH 3UQVA 4K8BA 4AYYB 5DJ7A 1VCPA 4MPUA 1C1OA 2FLBH 4MNXA 2XC0A 1P2IA 3U69H 3NCLA 3A7XA 3A81A 2WPIS 3U8TH 4B74A 1GMDF 1O3HA 4LK4A 3GY7A 4AZ2B 3ZVGA 3OU0A 1GJAB 2NU2E 3TIUA 1AWFH 2CN0H 1UHBA 1ETTH 2GKVE 1O32A 3GDUA 4E7NA 3PMBB 2VU8E 3I29A 1O5DH 1QBOA 1GHZA 5C67A 3PLPA 5HM2A 2V35A 1S0QA 1ZPZA 1ZTKA 2ZTXA 3BEIB 4JZEH 1MTSA 2H5CA 1LKBA 3MU0A 2QIQA 2ZG0H 3RLWH 1GCDA 5A0CA 2TGAA 4XBDA 3I78A 1RJXB 4WH6A 3O8RA 3BIUH 2AIQA 3RXMA 1QA0A 2I6QA 1TFXA 1OWKA 1ZPBA 1Z8JB 2W3KA 1N6XA 1GBLA 3DA9B 1OPHB 2BD4A 1AY6H 2BDCA 1UTPA 5EW2H 4K1SA 2HALA 2VGCB 4GCHF 2ZU4A 2P16A 4OGYA 2RG3A 4CR5A 1Z1IA 3TNTA 1GWAA 2Z9IA 4Y8XA 1JRTA 2H2ZA 4VGCB 4YT7H 1YPJH 2VINA 5SGAE 4LOYH 3SI3H 3SV6A 1GL1A 1QY6A 1TRYA 3DFJA 1FPHH 3IG6B 1W7XH 4FUDA 2FIRH 5TCAA 4NG9H 4BANB 1O3CA 1DWEH 2GCTB 1F92A 1BOQA 3V3MA 1MTNB 1QL7A 3RM2H 4D7FA 2JKHA 2VIDA 1P2KA 3BTWE 2Z9JA 3GCOA 2SNWA 1W13U 3S9AA 3TLOA 1XUJA 3L3TA 3SU1A 2FWWA 3BSQA 1IQLA 5FX6A 3ZZCA 1V6DA 1Y5AT 4MPVA 5EXLA 4X2XA 1JOUB 4I32A 1SLWB 3A80A 2QYIA 1L1JA 3A82A 1GJ7B 1THRH 1P3EA 1WOFA 1SFIA 3B23B 1G2MA 2IOTA 3M5OA 1JMOH 6LPRA 1S82A 1W11U 2CHAB 1P03A 3QGJA 4BXWA 1AD8H 2Y82A 3AASA 2P94A 2FM2A 1ZPCA 4UE7H 3U1IB 1BMNH 2PTCE 3A84A 3URCA 2WPHS 1BCUH 3Q3YA 1V2PT 3GCHC 3PMJA 4Q7YA 4X8UH 2BLVA 2W26A 1FJSA 4I33A 2ESTE 4A6LA 5FBIA 8ESTE 3KQEA 1SGDE 1YCPK 1IHTH 4WWYA 1TNIA 5A0BA 1O2PA 4AFQA 1GMDG 3UR9A 3D49H 2ZPSA 1O3FA 1O2HA 3DD2H 4MNWA 2O8LA 4IN1A 3A83A 5A8YA 1O30A 1T7CA 2FI3E 1G37A 4CH2B 3EQ0H 4XBCA 1C5YB 1LQDB 2F9BH 1RIWB 2OC7A 2QAAA 3TK9A 2AIPA 3MHWU 2NWNA 1C2KA 2OTVA 1P57B 1LPGB 1THPB 2ZDVH 3DFLA 3MNXA 4TWWA 3SJIA 5DKMA 1BBRH 2SGFE 2PV9B 2CGAA 3MNCA 5E0JA 2QA9E 3FP8E 1OYQA 1CT0E 1O3GA 1O34A 3QWCH 3LIWA 4RKOB 4CHAB 1MTUA 3A8AA 4UONA 1TWXB 1SHYA 1EAUA 3F6UH 3P95A 1K1LA 2P93A 4I31A 4MTBA 1AWHB 4OS2A 5FCRA 4ABFA 2PKSC 1SGFA 2FOBA 3PMHB 3KL6A 2VWOA 4ABHA 1AVGH 1ETSH 3H7OA 1P0SH 1Y3XA 2GDDA 5T6FA 1SGEE 1P01A 1FAKH 3MU5A 1G9IE 2UWPA 5FHTA 1KDQB 2A4GA 1GI2A 4XFQA 1FMGA 1UCYH 1NRPH 2F9UA 3ITIA 2A45B 4ZAEA 2Y6TA 1CU1A 1X7AC 3ESTA 2G4UA 2CF9H 3MU1A 1AO5A 2A4QA 1HCGA 1YBWA 2R2MB 3BF6H 3MWIU 4GHTA 2GV7A 4KTCA 2A32A 4GHQA 1UTOA 2ZGCA 1EKBB 2A0QB 3DUXH 4GAWA 3OY5U 2XBXA 2ZHQH 4I7YH 2UUFB 3RC5A 3SUFA 1NU9A 5FBEA 1TNHA 1TX6A 1XMNB 4YM9A 4K5ZA 1NFYA 2BY6X 1P9SA 3TJUA 4UEHH 3KCGH 1TLDA 1WQSA 2FS9A 4TY6A 1MBMA 3LKWA 4NWLA 4I8JA 1T8LA 3N7OA 4KTSA 1AVXA 3MO9A 1P06A 1FLEE 3ZYDA 3V12A 5DP5A 4AN7A 1OWJA 1O5FH 1P2QA 1SQAA 1C2HA 3PB1E 2GT7A 2EI7A 1AQ7A 1HB0B 1AVWA 4DGJA 4X8VH 1GBTA 1P04A 2B0FA 1XUHA 5C5OA 2HVXA 5DP8A 4H6TA 1Z6EA 2ODPA 4YOGA 1ELVA 3LPRA 5FXLA 3GDSA 3SU2A 5A0AE 1HJAB 1GG6B 2BX4A 1OXGA 4Y79A 2SGQE 1PQ5A 1MU8B 1TPAE 2BZAA 2R9PA 3ELAH 3GY2A 2BXUH 1V2WT 3TK6A 5DK1A 1PPHE 1Z1JA 3TH4H 2BDBA 1A3BH 1O5AB 1EX3A 2ZNKH 1IQNA 1BHXB 2C8ZB 2WUBA 3F9EA 3E90B 1GMHG 2G4TA 6CHAC 3SOSA 2FOHA 1TYNA 3LGUA 4ZH8A 5JB9S 1C1PA 3U8OH 1QBNA 1DM4B 4WMFA 2FODA 4NFEA 3KHVA 1QCPA 4OS4A 1ARBA 3GY4A 4HGCA 4X2WA 5EU8A 4ZKNU 4JK6A 3MMGA 3MFJA 5F6MA 3SI4H 2XTTB 3VB3A 2Y80A 5JBTA 4JZFH 2F9VA 5DP3A 1K1IA 4JCNA 4MLFB 1O35A 4ZXYH 4E7RG 1GDUA 1HPGA 4AFZA 1J8AA 4RSPA 5H4IB 3ZZAA 1QNJA 2VWMA 3HPTB 5E2OA 4J2YB 5ETXA 4Y0YE 5EOKA 3RMNH 1UO6A 4INHA 1TALA 3RXDA 3CS7A 3TJOA 1O38A 3AW1A 1CA0C 3PLBA 5DP9A 1MUEB 1WU1A 1KDQA 4THNH 2WPJS 4ABEA 5ESBA 3T5FH 2F9PA 1PFXC 1XXFA 5TJXA 3VXEH 3MU4A 5A2MH 3VXFH 5K0HA 5C1UA 4B76A 3M7QA 2H9HA 4X1PU 2OQ5A 5DO4H 4IMZA 1W14U 1VGCB 2ZHEH 5HYOA 4GPGA 1XX9A 1ZMJA 4A1XA 2HNTE 1HAVA 2A2XH 1LO6A 1VCWA