3A82A

Crystal structure of trypsin complexed with pre-synthesized (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a82A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a82A02
2OUAA 1OWEA 5E0JA 3NXPA 1ZMNA 1JIMA 4GVUA 1TBZH 2A0QB 3A88A 1BMAA 2VGCB 1QR3E 2ZKSA 4WJG2 1AE5A 3ZZ9A 1GJBB 4K8YA 1TGSZ 4KKDA 5EG4A 1QB6A 1Y3VA 1ESTA 3A8DA 3URDA 1LKBA 2ANKH 2OC0A 1TABE 2F9NA 4X2VA 1CBWC 3RC5A 2FOEA 1AZ8A 1RIWB 1LVBA 1Y59T 1DSTA 4A1XA 1GMDG 4ZHAA 1NY22 4A1VA 1O2LA 1LHGH 1CT0E 1P2JA 2VVVA 1UJ1A 2G5VA 1ZOMA 1KTSB 4AORA 1G3EA 1GVLA 1FY8E 1E0FD 1Q31A 4THNH 2XTTB 2ZC9H 5DP5A 3SV7A 1XXDA 1MKXK 1H8DH 1WTGH 1EPTB 1VITG 3MO6A 3ZZ5A 1Z8GA 1W7GH 5E2PA 1ZYOA 5E8EH 1CO7E 1Y5AT 1ELEE 1DWCH 4BTIB 1OX1A 2C4FH 1DVAH 4BXWA 1C1MA 3PROA 4IC6A 1GMCF 3RM2H 2QV1A 2RCEA 1C5PA 1EX3A 1H9LB 2O8MA 3EA9A 2G5NA 4HGCA 1NM6A 1PJPA 1GBDA 3NWUA 5HYOA 1YC0A 2P8OC 5EQSA 2BX4A 2P8OB 3SQHE 1K1OA 3QN7A 4ISLA 1OWHA 5FXLA 2W7UA 5K0HA 2ZFTA 3VB5A 4TWYA 1C9PA 1O3OA 1MCVA 1FZZA 3ZZBA 3M7QA 1O3EA 1HYLA 1L4ZA 5T6FA 1FN6A 1UCYH 5L30H 3IITA 4I31A 3WY8A 2C8YB 1MUEB 1HCGA 1UTKA 3ZZ7A 1BMLA 2AYWA 3GISB 2ODPA 4B71A 5F8TA 4ASHA 1IQIA 3OSYA 2AFQB 2UWPA 2O8WA 1KSNA 1ANEA 3UWJH 2ZZUH 1TGBA 3ZVAA 1EOJA 4K1SA 5ABWA 3ZVCA 1A7SA 2FI4E 2O8TA 3M3VA 2PKAB 2WPJS 3MO9A 5GCHG 1KLJH 4XOJA 1VZQH 4AB9A 1LHDH 3S9AA 2I6QA 2QGRA 2CN0H 4TY7A 2P16A 2BDHA 1DSUA 1QJ1B 3Q3YA 2A4OA 1TMTH 1KDQA 1A3EH 1GCDA 3T27A 1O2VA 5JPMH 1W0YH 1HAVA 2R0LA 2VGCC 1BTXA 3L6PA 8KME2 1NRSH 2G4UA 1HAHH 3P8FA 2FOFA 3GYMA 3ZV9A 1G30B 1FAKH 1INCA 4DJZB 1MTNC 1UK3A 3T28A 3LGWA 2QYIA 2Y7ZA 5GJ4B 1BTZA 1NT1A 2JH5D 1QL7A 4U30A 2VIDA 3ZVDA 1UTOA 1CE5A 1VGCB 1A0LA 1H4WA 4MVNA 4CHAC 1ELBA 1XKAC 1UVUH 1GVZA 3UR6A 1YPLH 1YKTA 4ZUHA 4R8TB 3NK8A 3O8RA 2I6SA 1OWJA 1THSH 4AB8A 2W26A 4GLYA 1GWAA 1W7XH 1ESBA 2R0KA 1LMWB 2Z9KA 1TBRH 4I8JA 3I77A 1F0UA 3SV2H 1O5EH 1ZHMA 2F9BH 4X6MA 3UR9A 1SHYA 4ZAEA 1S82A 2FYQA 3RXBA 1LVMA 3RXEA 1ZZZA 4CH8B 4GCHG 4XBDA 2J95A 5EQQA 3U1IB 1YCPK 4D76A 1C1NA 2H9HA 3M7UA 2PTNA 1EB2A 3RXCA 3A85A 3KGPA 2UUJB 1GMHF 3HGPA 2D8WA 1N8OB 1MAXA 1W11U 2VH6A 4M7GA 3GY4A 1C1WH 1ANCA 3TH2H 4MNYA 1T8MA 1S0RA 2GZ8A 1WTHD 1G37A 3GDSA 4JYUH 4ABIA 3A83A 1C5NH 1VCQA 1GJ7B 2SGAA 3A8CA 4YTAA 5FCKA 4O3UA 1GJ9B 1LVYA 3AASA 5B6OA 1O2NA 2G4TA 1QFKH 4XE4A 4DG4A 3T2NA 2J4IA 2ZTXA 1O2IA 2BY5X 3GY8A 4ABBA 3BN9A 2XXLA 2A5KA 5DP4A 1ANBA 1S83A 5FPTA 3TJVA 1D6WA 2ZU4A 1TPOA 2BY6X 1GVKB 2H5CA 1BUIA 3NPSA 1VJ9U 1XUGA 4CHAB 3D23A 1AIXH 4MG3A 1Y5UT 4ABFA 1O2YA 1LO6A 4MPWA 3SBKA 4BAKB 1K1MA 1O2GH 3EA8A 1BTHH 1K22H 1JIRA 5GXPA 2BXUH 5A09A 1MTNB 4YLQH 1GBEA 1CA8B 2GCHF 1FY4A 1W13U 3MU1A 1SR5C 3UFAA 3ATMA 1PPGE 1SSXA 3SJ8A 3A7XA 1V3XA 5L2ZH 1O3GA 3BIVH 4K8BA 1EXFA 1PYTD 2A2XH 4CBOA 1MKWH 2FPZA 4FU7A 5F03A 2V3HH 3RC4A 1HGTH 1P3EA 1G3BA 1YPKH 3LGTA 3RXSA 1RJXB 3LJJA 1O31A 2HLCA 1YM0A 1TAWA 5DP9A 2Z94A 1E38B 4JYTA 3RXMA 5DP8A 2STAE 2BD9A 2SGPE 5F6MA 5GDSH 2PSYA 1BQYA 5C67A 4Y7BA 1CA0C 1O3AA 5JB9S 1LDTT 2BQWB 3RMNH 1MZDA 1F5RA 1ELFA 1G36A 2ILNA 4OS4A 4BAQB 1MTSA 4YT7H 2VU8E 1A1RA 3GY7A 2P94A 1GI0A 2Z3CA 3HATH 3DFJA 2BDYA 4AYYB 4IBLH 1J15A 1UTQA 1BHXB 2FX6A 3LGYA 4DW2U 3RMMH 1HIAA 1PPEE 1HAPH 1YPJH 1C1RA 1UMAH 2C3SA 2FWWA 4U01A 5CMXH 1O3BA 2AGEX 1C9TA 3JZ1B 1K1NA 2TGPZ 3KQCA 1C2EA 4B74A 3FANA 1MAYA 3GCNA 3SU0A 2B7DH 2BDCA 1D9IA 1VCPA 8ESTE 4YOJA 3GY6A 2VIPA 2XBWA 4FU9A 1GHBG 5IYTA 2AMQA 2BQ6B 4KTCA 5EPNA 1HAVB 1HBTH 1IQLA 2B5TB 2XWBI 5DK1A 4ABJA 2FOGA 3NUMA 4FUCA 4AFZA 1NESE 2Y6TA 3W95A 1ELGA 2FS8A 1GGDC 5JBAS 1JRTA 1L1JA 3MU5A 3V12A 4BTUB 3ATWA 1DY9A 5HXFA 2BZAA 3A7VA 3RC6A 2WPHS 1TOMH 3JZ2B 3RXPA 1A0HB 1O2TA 3PWCA 2HALA 1CGIE 3FP6E 1Y3YA 2BY8X 2FTLE 1GBHA 3SV6A 1W3CA 3U8OH 1EPTC 1AZZA 5T3HA 4MNVA 3E0PB 3UWIA 4CBNA 1O3CA 2OC1A 1O2KA 1O3JA 2NU0E 5ETXA 1PPCE 4RKJB 3LDXH 1C2JA 1DDJA 2Z9JA 4WXVA 3BF6H 4O9VA 1RIWC 2W3KA 3MNCA 3HKIB 1VCWA 3D49H 3UREA 3M36A 1CBWB 1V2OT 2THFB 1LKAA 1FQ3A 1FLEE 1ZGVA 1Y8TA 1BTUA 2D26C 2GTBA 2XC4A 2G51A 4ABGA 1QURH 1KXFA 2VIOA 3TH3H 3KNXA 2XC5A 2IPHA 1NRNH 1F7ZA 1ZHRA 4JK5A 3S7HB 2P3UB 2BM2A 1GI8B 3EYDA 5E0HA 1RTLA 5E2OA 1TX7A 1MQ5A 1P2NA 1C1SA 1TMUH 3OY5U 2BD5A 2ZFPH 1HB0B 1HXFH 2PUXB 4ZKRU 2AGGX 1T32A 2C8XB 3QZRA 1QL9A 3SHCH 1ID5H 1Z8IB 2SGEE 3K9XB 1EZSC 2BMGB 1TOCB 1AUJA 2WPIS 4WMFA 3KQBA 1JWTA 2EI6A 3SO3A 1ZJDA 3F9EA 2OBQA 5EGMA 1J9CH 5HGGA 2UUKB 1SGCA 1P05A 1BHXF 1IQHA 2VVCA 4MDSA 1A5GH 1KXDA 2HGTH 1AVWA 3VXFH 1O3FA 3HPTB 3Q77A 5G4BA 3CS7A 2H2ZA 4IN2A 2QF0A 1MBQA 4OS2A 3SV9A 3ZZ6A 1QTFA 1MTVA 2CHAB 2FEQH 4KTUA 2ZF0H 1O5DH 2Z6BD 4WY3A 1O2PA 3TJUA 1XMNB 3ZZDA 4E7NA 2GMTC 1BTPA 3R3GB 1TNHA 5BRRE 2BLOA 1NPMA 1P06A 1P3CA 1IQMA 2A7HA 3SJOA 3EGKH 2O8UA 2QXHA 1LQEA 3A82A 1CT2E 1SGEE 1LHCH 1P2OA 4X2WA 3C27B 3P8NA 1C4Y2 2VIQA 3TGJE 1G2LA 3E3TA 1UVOA 5SGAE 4INKA 3KQEA 3P8OA 1TNGA 3MH7A 5JBCS 1C2HA 1Z1IA 2VVUA 4DY7B 3A87A 1E37B 2PSXA 1KY9A 1C5UA 4JZDH 1D4PB 1BT7A 2FOMB 3UOUA 1PQ5A 2PLXA 3AW1A 4XDEA 2ZCKP 1FPCH 1IQJA 8GCHG 1JRSA 1KLIH 1ELAA 2ZHDA 1QL8A 4K1EA 4XBBA 4ESTE 3ATKA 3W94A 1Z8JB 4Y11E 1DM4B 2OCVB 1PPFE 1KXAA 1QBVH 1YCPM 1J8AA 1O2HA 1SGYE 1RTKA 2ZIQH 1K21H 3TJOA 1NU7B 3F1SB 4UE7H 2ULLA 2R2WU 1XUFA 1EJMA 4Y7AA 3GCHC 1AWFH 1PPHE 3T29A 1C5WB 1ETRH 1F0RA 4FUIA 4B73A 5DG6A 1YPEH 5K7RA 4OS6A 1V2ST 4IS5A 2WPMS 1A61H 3M5LA 4X6PA 1Q2WA 1QBNA 1MKXH 5C1XA 3B8JA 3TK9A 1D6RA 4Y0ZE 1E35B 1WCZA 1RRKA 1D3QB 1TE0A 1RXPA 1P10A 1Z71A 1V2UT 3ZV8A 1GBKA 3DUXH 3D62A 5LPRA 2A31A 1FIZA 1YPMH 4DVAU 1FN8A 4BANB 4GUXA 1NROH 2GGVB 3VB6A 3A80A 2GV6A 3S9CA 4X1PU 4INHA 2J9NA 4BXSA 3UY9A 3P95A 3PMBB 1GI9B 2BLVA 2A1DB 1PQAA 3ZVBA 2ZFRH 4WH8A 1OP8A 3P6ZB 4Q7XA 1DUEA 3A7TA 2FO9A 3TK6A 4FUEA 4ZKNU 3NZIA 4B75A 1V6DA 5GIBA 3SJIA 2TBSA 1TWXB 2FS9A 1V2MT 2ANWA 3GOVB 1AB9C 1LCYA 1UVPA 2TGDA 2W7SA 4Y79A 4BAOB 1EPTA 3U8TH 2WUCA 1PFXC 3M61U 1FJSA 2AEIH 4ZH8A 3EDXB 2F9VA 4D9QA 1ZTJA 4Y76A 1K1JA 1WUNH 1UTPA 3MO3A 2YNAA 3LONA 4ZXXH 1AVGH 1LPZB 1AI8H 3LGUA 1MTUA 2EA3A 4JMYA 2XYAA 3QGJA 3RU4D 1SGFG 5AHGH 2BDAA 5T6GA 7KMEH 2ZQ2A 3GYLB 8GCHF 1SB1H 7GCHG 1S0QA 3SI4H 5DJ7A 2OD3B 2ASUB 1L1NA 4NZQA 2FDAA 2QCYA 3UQVA 3T26A 1C5OH 3IG6B 5DKMA 4Y8ZA 3SV8A 5ESBA 5BPEA 3RLWH 4KTSA 1J17T 3KN2A 3VGCB 2CMYA 1GPZA 1TQ7B 4NIVA 4AGJA 4CR5A 1YLDA 1TGTA 1MZAA 3MOCA 3SN8A 3BEUA 1DXWA 1NRPH 2UUYA 2ZFQH 3LOXA 3A8AA 1H1BA 3Q3KA 2J2UA 4AG1A 3ODDA 4FUHA 1AHTH 3SNBA 1B7XB 6ESTA 1YPGH 2XRCA 1FY5A 2LPRA 3MU8A 6CHAB 1IQFA 4IMQA 2ZG0H 1ZSJA 2PKSC 1BA8B 1MD7A 4WXIA 2PW8H 1BBRK 1K28D 2H9EH 1CGJE 1NO9H 1QRZA 1XKBC 5EU8A 2QXJA 4ZROA 1ZR0A 4FVDA 2FOAA 2HVXA 2AMDA 4UEHH 4H6TA 3P17H 4FXGH 2F9UA 2BDIA 2W5EA 3BTFE 1QA0A 1EP5A 1RTFB 4PROA 2VWOA 1FMGA 2OINA 3OU0A 2ZGCA 1JOUB 1DICA 4K2YA 1U6QA 5I46H 2JH6D 2PTCE 1TYNA 2P3FH 1Y3UA 5FX6A 1EAWA 5A0CA 2ZNKH 3M5NA 1WOFA 3V13A 2WUBA 2TIOA 1YLCA 5LPEA 3BTHE 1UTLM 1TIOA 1QCPA 3I29A 3RXQA 1GI7B 1IOEA 2SGDE 3TLOA 2TPIZ 1F0TA 2AIQA 1GHBF 1FPHH 3G01A 5H4IB 4B2AA 1GDUA 2HOBA 3VPKA 4D9RA 1EUFA 5HMAA 1NC6A 1O3MA 3SNAA 3SNCA 3T5FH 3BG4B 1C5RA 3BTTE 3QTOH 4ZXYH 2PGQB 1KIGH 3A7ZA 2WPKS 1LPGB 2M5TA 3RUOA 1P04A 1XXFA 2Z7FE 5C2ZA 1PYTC 1F2SE 2OLGA 4JZFH 3PO1C 1DUAA 1J16A 1SGTA 3ZVFA 4Z6AH 2VIWA 1YCPH 9LPRA 4LZ4B 2FX4A 2GT7A 2ZGXH 4VGCC 9ESTA 3SUGA 4ABAA 1DFPA 2BY9X 1TONA 3VEQB 3MHWU 1O5FH 4WF8A 3PMHB 3FFGA 4IC5A 3F6UH 2Y7XA 3E0NB 4AFQA 5EQRA 2FODA 1ABJH 4IW4E 5C5OA 1SHHB 1OSSA 1TBQH 2HWLB 5PTPA 4X6NA 1C2FA 3GCOA 4ZHLU 3E90B 2O9QA 1V2VT 3KQDA 4ABEA 4I7YH 2ZCLP 1GJ8B 2V3OH 4MNXA 1DX5M 1S6HA 1A46H 1SBWA 4X2XA 1ZRKA 1QJ6B 2QXIA 1SGQE 2ZHQH 1O0DH 3VB7A 4XSKU 3IWMA 5FPYA 2EEKA 1EZUC 3A89A 2ZU1A 4BOHA 4UFFH 1O3NA 5A8XA 1L4DA 3Q3XA 2V0BA 2Y5GA 1GCTC 4NWKA 2RG3A 2FLRH 1SI5H 2VB0A 4GHQA 1BOQA 4INLA 3GY3A 1ELCA 1QY6A 3AAVA 3KIDU 4A7IB 2BD7A 2ZO3H 1L0ZA 2ESTE 1AY6H 1Y3XA 3SNDA 1TPPA 3A81A 2ZHEH 1SGRE 1O3PB 4IGDA 3SU6A 3L3TA 3S69A 1SLVB 3SGAE 4K1TA 4BTTB 1MCTA 1WQVH 1DITH 1C5XB 1HRTH 1O32A 2B8OH 1A5IA 1GBFA 1GHVH 2FI3E 3TJNA 1ZRBA 1C2MA 2STBE 2BZ6H 1WSSH 2SNWA 3QZQA 2OTVA 2FIRH 1O3KA 1SLWB 2NU4E 1DANH 1LPKB 2C90B 2C8ZB 2Y82A 1GL1A 1C2KA 1O2JA 2CV3A 2H1UA 1DY8A 3LH1A 3SGBE 1DXPA 1BJVA 1TX6A 1GHAF 4GHTA 3BTDE 5EXLA 2A32A 1ZPCA 4JZ1A 1HJAB 4KELA 3UNSA 2C8WB 1W8BH 3BTEE 2IN2A 3LC3A 1OP2A 1GG6C 1GJCB 3HKJB 2QXGA 2VWLA 4K5ZA 2GCTC 5EW2H 2ZWLH 4NWLA 1ZPBA 3LIWA 4AFUA 3CENA 3GDVA 4YESB 4NSVA 1GMCG 3VB3A 1AKSA 2ZPRA 1T8OA 2W3IA 2XNIA 2ZDAH 2ZDMA 1NS3A 3HK3B 3HGNA 3MYWA 2FXRA 2XBYA 1V2QT 2GDEH 2P93A 2WV5A 5TCAA 2OQ5A 2FOBA 4MTBA 1UCYE 3E16B 3ZZAA 1GHWH 1O5GH 1OWDA 2VNTA 2FOHA 5EODA 2VINA 2Y5FA 1FXYA 1FY3A 2ZPQA 1TQ0B 1O2MA 1QHRB 1YPHC 3SHAH 3RXVA 2G55A 1C5YB 4CR9A 4DOQA 1DOJA 2BY7X 2BD2A 4YO9A 1KTTB 2H5DA 3DFLA 1IAUA 2A5AA 2Z9LA 2F83A 3KF2A 1NRQH 2FZZA 2Y80A 2P95A 1F92A 1DS2E 2VIVA 1QRWA 1NZQH 1TB6H 3TPIZ 1O2SA 1V2RT 4WMEA 1EKBB 1ESAA 2O8LA 2J38A 4H4FA 4D7GA 1XUKA 3BTGE 3URCA 3LC5A 2OC7A 1GHAG 4UD9H 2BTCE 1AFQB 1BRAA 1SG8B 1SFIA 4MLFB 2HRVA 4O97A 4I32A 1MQ6A 3LGVA 3E8LA 3T25A 2CXVA 2UUFB 5EXMA 1RGQA 1QIXB 1L2EA 3V7TA 1UVTH 1A5HA 2PV9B 1HJ9A 1N6XA 1A2CH 1ORFA 1PPZA 1W12U 4X8UH 3E91A 2EC9H 1W2KH 4B2CA 1O38A 3KHVA 4NIYA 1T31A 3KL6A 5FCRA 2WYGA 1BB0B 3U9AH 1CHOG 1O39A 1V2WT 1TMBH 4FUJA 1TNKA 2ZCHP 1XUJA 3SU3A 1C2LA 1GG6B 3NCLA 4JZEH 3RMLH 1AFEH 4CRGA 1SMFE 4ZKOU 3SQEE 3MH6A 1EZQA 1TGNA 1K9OE 3CS0A 2PGBB 4KP0A 1GJAB 4MNWA 1WV7H 1ZMLA 2NU2E 4RKOB 2VWMA 3SI3H 3SUEA 2QC2A 1K2I1 4Q2KA 2JETB 1DPOA 3LT3A 1O2OA 2TGAA 1AD8H 4X1NU 1ETSH 4J2YB 3QTVH 4A6LA 1JBUH 1A3BH 1QJ7B 1LTOA 1P57B 5EXNA 5I25A 3LU9B 4K60A 1SQOA 1THRH 4X6OA 5L6NH 1H8IH 1ZTLA 1GJ5H 2ZTYA 1VJAU 1JXPA 2PWXA 3GY5A 1ZJKA 4UFDH 1AE8H 1CVWH 3S9BA 1GBAA 2VWNA 4NIXA 4OS5A 1P9UA 3U1JB 1P11E 5JB8S 4Y10E 5E0GA 3C1KA 3M35A 7GCHF 2B9LA 1NFYA 3ATLA 1C5MD 1SC8U 1T4VH 4WVPE 2GKVE 2FP7B 3Q00A 1SGIB 5CHAB 3DHKH 3M5MA 1SLXB 1Z1JA 1IHSH 2XCNA 2XW9A 3AAUA 3MFJA 1C1OA 1EATA 1Y3WA 3MNSA 2XWAA 4FUBA 1C1VH 1GCTB 3UNQA 3BG8A 2G52A 3RXUA 1D3PB 1J14A 3RU4T 1FI8A 4UONA 3O8BA 3M3TA 5HM9A 1XVOA 3ZZ4A 2J94A 3UQOA 1LHEH 1BCUH 8LPRA 1QNJA 4OS7A 3SZNA 4CRBA 2ZP0H 1TRMA 2FOCA 3A86A 1O5AB 1LVOA 3E6PH 2ANMH 3ESTA 2WV4A 1CQQA 1IQNA 5CHAC 1UO6A 1O2QA 2BDGA 1NRRH 1GI5A 1H9IE 1ZSLA 4XBCA 1HAIH 3ZZCA 1X7AC 4ABHA 4DCDA 3UTUH 4TWWA 2RDLA 1IHTH 3SJKA 2HPQH 2ZTZA 1N6YA 5GCHF 4VGCB 2CF9H 1CU1A 1HIAB 2Y81A 1BBRE 1GBLA 2PHBA 3N7OA 2H9TH 2JKHA 1ARBA 4DT7B 2BXTH 3SU4A 1ELDE 1FV9A 1C1TA 1NFXA 3PO1B 1N1LA 1O5CB 1AUTC 1EZXC 4ABDA 3MMGA 1ARCA 5JYIA 2NU1E 3BTWE 3D65E 3MH5A 3ZYEA 4AG2A 3TU7H 4OGYA 1BIOA 1C1PA 1EQ9A 3BG4C 2JETC 1SVPA 3PV4A 1QQ4A 1P2MA 3RDZA 1BTYA 2H6MA 1SQTA 3QLPH 1G32B 1OYTH 1S6FA 3R0FA 1WAYB 1NU9A 1P09A 3K2UA 1IQGA 3U69H 5AFYH 2Z3DA 2GV7A 4Z0KA 1O3LA 4BNRA 1C4V2 1GI3A 3FZZA 3HK6B 3LKWA 3P92A 4K3JA 3BEIB 2BVXH 1YP9A 1G3DA 3LJOA 4NA9H 4HZHA 3TK5A 1C5LH 1EB1H 4F4OC 3RXGA 3TGKE 1TNIA 2Q6DA 2B0FA 4B76A 3M37A 2NU3E 1GBBA 4CRDA 3UPEA 1ZGIA 2GX4A 1W14U 1ANDA 1ZLRA 4MPVA 5FPSA 3RMOH 1GL0E 3GCTF 3B23B 1W0ZU 1XX9A 3A84A 4ZKSU 3SU1A 3KEEA 4RSPA 4WWYA 3ENSB 1RS0A 2JH0D 3ELAH 1RFNA 1FDPA 3DA9B 2QAAA 1AFQC 1P2QA 3A8BA 1MBMA 1GDNA 1GI2A 4ZMAH 4NA7A 1A4WH 3DD2H 4UFEH 3GDUA 3UNRA 1GMDF 2QF3A 2ZGHA 3BIUH 5EPYA 3SNEA 4AGKA 1E34B 2FM2A 1KDQB 4JYVH 1AU8A 6CHAC 2BD8A 2GZ7A 3RLYH 1A0JA 1VR1H 1O2UA 2ODYB 3RP2A 1P12E 2UWOA 1P03A 1O2WA 4X1QU 3ZZ8A 2HNTE 1LHFH 2A5IA 1GI6A 1F5LA 3RXLA 3S7KB 1XUIA 4NZLA 1PPBH 3VGCC 3BTQE 1YBWA 3H7TA 2CGAA 1K1PA 3RXIA 4A92A 4YM9A 3MI4A 2ZEBA 4DIHH 5C20A 1DWBH 4LOYH 4GSOA 1FIWA 4I8GA 3SU2A 4ISOA 2OP9A 5DGJA 1YGCH 1EJAA 1QB9A 2C93B 3P8GA 5A8ZA 3TNSA 1V2NT 1HFDA 1BBRH 4AX9H 1TPAE 4HI3A 4TYDA 1O5BB 4H6SB 2BB4A 5A0BA 4NGAH 3Q76A 2GCTB 3SGQE 3OX7U 5A2MH 2BLWA 2F91A 5A0AE 1BMNH 4Y0YE 2LNCA 2BOHB 3PLBA 1C5VA 2OC8A 2AH4X 4TPIZ 5F8ZA 3FP7E 1B5GH 3QDZB 4YLUA 1F0SA 2GD4B 1GDQA 4DGJA 5A8YA 1HJAC 2A7CA 1GBIA 2IOTA 3H7OA 1QQUA 3EE0B 3MU4A 4IMZA 5CE1A 2A4QA 3QO6A 1MU8B 1QB1A 1YPHE 3GY2A 1ZTKA 1GJDB 2RA0A 3FVFB 2TRMA 5FBEA 2R2MB 2GCHG 1AKSB 3UIRA 1ZSKA 5L2YH 3PTNA 5T6DA 1NFWA 1GJ4H 1LQDB 1CHOF 2J92A 2GZ9A 5DP7A 2QA9E 2AIPA 1B0FA 1HAZB 1O2RA 4MPUA 3BTKE 2PR3A 1GHXH 2D2DA 4TPYA 2ZDNA 4JCNA 1C5ZB 1T4UH 1EAXA 2ZGJA 3MWIU 3M7TA 5JDUB 3STJA 4YZUA 3SJ9A 4LK4A 1O3IA 1UCYK 1GBCA 3MNXA 5AF9H 1B0EA 4ISNA 4NA8A 2PFEA 2ZGBH 7ESTE 3SUFA 1AVXA 2D1JA 1C2GA 1OS8A 2XBVA 4D8NA 1EOLA 4Y6DA 1P2IA 5EOKA 4ZHMU 3M3SA 4FU8A 1HV7A 2ODQA 1UVSH 1ABIH 4WMDA 3PWBA 2F3CE 4NIWA 4NSYA 1TALA 2CJIA 3ODFA 4MPXA 5JBBS 2ZDLA 3V3MA 3F9HA 5GWZA 1GI1A 2BYAX 5DPAA 1S84A 1G2MA 3QK1A 1BRCE 1SL3A 4YOIA 4CREA 2AS9A 2Z3EA 3SW2B 2F9OA 2R3YA 2BHGA 2ZU5A 2BD3A 1KXCA 6LPRA 3K65B 2GDDA 4DIIH 1SOZA 2F9PA 5C5NA 1SGNE 3P70B 2VH0A 3F9GA 1TA6A 1OPHB 2FESH 2ZDVH 1ELVA 5GPIB 4UDWH 1FUJA 3UOPA 2WYJA 1OWIA 1L1GA 1EAUA 3RXJA 1V2PT 1Z8RA 1GI4A 2EI7A 3MH4A 2DE8A 4OS1A 1ZPZA 3KCGH 1BMMH 1HAGE 2FMJA 2EI8A 1GBJA 1UK2A 5C1UA 4I33A 1UTNA 1O30A 4X1SU 4X2YA 3QGNB 1SOTA 3BTME 3T62A 1KLTA 1O33A 3RXKA 1SQAA 4TY6A 1QBOA 2GMTB 3ZVGA 2TGTA 4AN7A 1HAOH 2A45B 2QIQA 2ALVA 4LZ1H 4B1TA 1C5TA 2G8TA 2CHAC 3CP7A 4Y71A 4O03A 3PM3A 3PMJA 2G81E 1O3DA 1D3DB 1O2ZA 1O3HA 1CT4E 2UWLA 2DUCA 1AMHA 3GCTG 1TGCA 5TJXA 1O35A 2KAIB 1TLDA 1YF4A 2YNBA 3UUZA 2ZA5A 2G00A 1TRYA 3BEFB 1HXEH 3DT0H 3PB1E 3TIUA 1ZHPA 2A7JA 1VITF 2ZFSA 2V35A 3ZVEA 1OKXA 3VB4A 2BDBA 1GHZA 2QN5T 5C3NA 6GCHF 3F68H 4YOGA 4JK6A 4GAWA 1WBGB 1SGFA 1ZMJA 1E36B 1K1LA 1KXEA 3QUMP 2P3TB 1GMHG 1P01A 3QX5H 1Q3XA 1V2TT 2A4RA 1EP6A 1T8LA 3OY6U 2ZU3A 4AOQA 2PKSB 2ZQ1A 4X0WU 1QRXA 4JZIA 2V6NA 4CH2B 3S0NA 3LGIA 1IQKA 4FVBA 2A4GA 1XM1A 5DP3A 2PKAA 5FX5A 1C5QA 1RD3B 3TH4H 1EJNA 5HM2A 4IN1A 3NKKA 4X8VH 3MTYA 1ETTH 2HNTF 1HAXB 4SGBE 2R9PA 5FAHA 4B2BA 1P0SH 3ZZ3A 2VJ1A 4A1TA 2FI5E 2ZI2H 3SOSA 4OGXA 1C2IA 4LXBH 3B9FH 3BSQA 3FZDA 1HUTH 4I8KA 2GT8A 1C1UH 2R3UA 2SFAA 2GP9B 1MKWK 5FBIA 3EQ0H 1S85A 1TPSA 1TX8A 3U8RH 4FUDA 3RXFA 1V2KT 1OWKA 2ZHFH 1G3CA 2WINI 3SORA 1GHYH 2YOLA 5LGOA 3RXAA 1KYNA 2ALPA 1IQEA 3M5OA 1UHBA 1BRBE 5AFZH 1JMOH 4YT6H 1MU6B 4H42U 1BITA 1BZXE 1SGPE 2GVFA 5EW1H 1UHBB 1QGFA 4Y8YA 2ZFFH 2KAIA 3I78A 3O8CA 1GGDB 1HJ8A 1SLUB 3TVJB 4SGAE 5J4SA 2ZDKA 3RXHA 4E06H 1AN1E 3V0XA 1G9IE 1S5SA 3MU0A 2Q1JA 1AB9B 3MNBA 3PTBA 1C5SA 1PQ7A 2ANYA 4CRAA 1OOKB 1M9UA 1WU1A 3H5CB 2P59A 2BD4A 2Q6FA 1PQ8A 4F49A 2AGIX 4HTCH 1P2KA 4GCHF 3RXOA 1HNEE 3E1XB 1TFXA 2ZU2A 2Z9IA 2SGFE 1C1QA 1GBTA 1H9HE 1S81A 4X8TH 2OXSA 2Y5HA 1AQ7A 2HPPH 1TRNA 3AW0A 4A5TS 3PLPA 1TA2A 1YYY1 1MH0A 1ELTA 1DWDH 1CA0B 2FTMA 1O37A 2SNVA 4GPGA 2HNTC 3RXTA 4AZ2B 1HLTH 1ACBE 2BQ7B 3ITIA 4E05H 5J4QA 1V2LT 1XUHA 1EASA 3OYPA 1CSOE 1GJ6A 2AMPA 3TNTA 1BRUP 1HAYB 2K1QA 4X8SH 1O36A 2XBXA 1VITH 1BJUA 1BDAA 4E7RG 3FAOA 3GICB 4NFEA 5ESTE 4DURA 4NG9H 1HPGA 5TCCA 3GCHB 4Q7YA 3TITA 1WYKA 3ATIA 1NFUA 4U2WA 3RU4E 2OQUA 3F9FA 1W10U 2OBOA 4Q7ZA 1P02A 2FYRA 2CF8H 1D3TB 4FUFA 3U98H 1C4U2 7LPRA 2NWNA 1TNLA 1V2JT 3SUDA 5LPFA 1Z6EA 1OP0A 1MD8A 2BOKA 1CGHA 1FAXA 1F5KU 2WPLS 4R0IA 5JBTA 5DO4H 1DLKB 1WQSA 3FP8E 3ZYDA 3VXEH 1AWHB 5LH8A 4I8LA 4I8HA 4RN6A 2RA3A 1SFQB 1BTWA 2BX3A 4ISIH 3RXRA 2PUQH 2DE9A 1C2DA 2ZECA 1UTJA 1AO5A 4WH6A 5IDKA 1K1IA 3LH3A 1T7CA 3PMAB 3VFEA 2Z9GA 2A2QH 1T8NA 2AERH 3EA7A 1XVMA 4HFPB 1MTWA 3STIA 4NCYA 3AVZA 5C1YA 1UK4A 3QWCH 4MQAA 1OXGA 1MMJN 1P8VC 4U32A 3TGIE 4CRFA 1CHGA 1NN6A 3EAJA 1FY1A 2XC0A 4NFFA 4D7FA 1FONA 1N8OC 3L33A 2BVSH 1SPJA 4J1YA 2ZPSA 4Q80A 1EAIA 4BAHB 4CRCA 3A7WA 3K6YA 3LPRA 1NTPA 1O34A 3A7YA 4XFQA 4UFGH 1DT2A 1THPB 3OTJE 2FLBH 1DLEA 4ISHH 1KXBA 4FUGA 1Z6JH 5F8XA 2BVRH 3RXDA 1SGDE 4AYVB 5DP6A 1HDTH 1DWEH 1TNJA 4KGAA 6GCHG 1QA7A 3PLKA 3O8DA 1UTMA 3K6ZA 1AGJA 2ZHWH 1GBMA 3RM0H 4O3TA 1FNIA 4X1RU 1DE7H 4BAMB 1P9SA 2SGQE 2IJOB 1VGCC 2QY0B 1OYQA 1O2XA 4Y8XA 2BLQA 2Q6GA 1Z7KA 2XCFA 5FHTA 4QT8C 4K69A 1Y5BT 2J34A 4AFSA 3PYHA 3BV9B 3SU5A 5AVDA
chains in the Genus database with same CATH superfamily
2OUAA 1OWEA 5E0JA 3NXPA 1ZMNA 1JIMA 4GVUA 3OEED 1TBZH 2A0QB 3A88A 1BMAA 2VGCB 1QR3E 2ZKSA 4WJG2 1AE5A 3ZZ9A 1GJBB 4K8YA 1TGSZ 3F2GA 4KKDA 5EG4A 1QB6A 1Y3VA 1ESTA 3A8DA 4Q4LA 2WPDD 3URDA 1LKBA 2ANKH 2OC0A 1TABE 2F9NA 4X2VA 1CBWC 5CHBA 3RC5A 2FOEA 1AZ8A 3WWBA 1RIWB 1LVBA 1Y59T 1DSTA 4A1XA 1GMDG 4ZHAA 1NY22 4A1VA 4FOUC 1O2LA 1LHGH 1CT0E 1P2JA 2VVVA 1UJ1A 2G5VA 1ZOMA 1KTSB 4AORA 1G3EA 1GVLA 1FY8E 1E0FD 1Q31A 4THNH 2XTTB 2ZC9H 4I86A 5DP5A 3SV7A 1XXDA 1MKXK 1H8DH 1WTGH 1EPTB 1VITG 3MO6A 3ZZ5A 1Z8GA 1W7GH 5E2PA 1ZYOA 5E8EH 1CO7E 1Y5AT 1ELEE 1DWCH 4BTIB 1OX1A 2C4FH 1DVAH 4BXWA 1C1MA 4Z1MD 3PROA 4IC6A 1GMCF 3RM2H 2QV1A 2RCEA 1C5PA 1EX3A 1H9LB 2O8MA 3EA9A 2G5NA 4HGCA 1NM6A 1PJPA 1GBDA 3NWUA 5HYOA 1YC0A 2P8OC 5EQSA 2BX4A 2P8OB 3SQHE 1K1OA 3QN7A 4ISLA 1OWHA 5FXLA 2W7UA 5K0HA 2ZFTA 3VB5A 1K0HA 4TWYA 1C9PA 1O3OA 1MCVA 1FZZA 3ZZBA 3M7QA 1O3EA 1HYLA 1L4ZA 5T6FA 1FN6A 1UCYH 5L30H 3IITA 4I31A 3WY8A 2C8YB 5DN6D 1MUEB 1HCGA 2QE7D 1UTKA 3ZZ7A 5B6LA 1BMLA 2AYWA 3GISB 2ODPA 4B71A 5F8TA 4ASHA 1IQIA 3OSYA 2AFQB 2UWPA 2O8WA 1KSNA 1ANEA 3UWJH 2GJGA 2ZZUH 1TGBA 3ZVAA 1EOJA 4K1SA 1E1QD 5ABWA 3ZVCA 1A7SA 5EJZA 2FI4E 2O8TA 3M3VA 2PKAB 2WPJS 3MO9A 5GCHG 1KLJH 4XOJA 1H8ED 1VZQH 4AB9A 1LHDH 3S9AA 2I6QA 2QGRA 2CN0H 4TY7A 2P16A 2BDHA 1DSUA 1QJ1B 3Q3YA 2A4OA 1TMTH 1KDQA 1A3EH 1GCDA 3T27A 1O2VA 5JPMH 1W0YH 1HAVA 1YLNA 2R0LA 2VGCC 1BTXA 3L6PA 8KME2 1NRSH 2G4UA 1HAHH 3P8FA 2FOFA 3GYMA 3ZV9A 1G30B 1FAKH 1INCA 4DJZB 1MTNC 1UK3A 3T28A 3LGWA 2QYIA 2Y7ZA 5GJ4B 1BTZA 1NT1A 3MQKC 2JH5D 1QL7A 3F0PA 4U30A 2VIDA 1H8HD 3ZVDA 1UTOA 1CE5A 1VGCB 1A0LA 1H4WA 4MVNA 4CHAC 1ELBA 1XKAC 1UVUH 1GVZA 3UR6A 1YPLH 1YKTA 4ZUHA 4R8TB 3NK8A 3O8RA 2I6SA 1OWJA 1THSH 4AB8A 2W26A 4GLYA 1GWAA 1W7XH 1ESBA 2K0QA 2R0KA 1LMWB 2Z9KA 1TBRH 4I8JA 3I77A 1F0UA 3SV2H 1O5EH 1ZHMA 2F9BH 4X6MA 3UR9A 1SHYA 4ZAEA 1S82A 2FYQA 3RXBA 1LVMA 3RXEA 1ZZZA 4CH8B 4GCHG 4XBDA 2J95A 5EQQA 3U1IB 1YCPK 4D76A 1C1NA 2H9HA 3M7UA 2PTNA 1EB2A 3RXCA 3A85A 1BMFD 3KGPA 2UUJB 1GMHF 3HGPA 2D8WA 1N8OB 1MAXA 1W11U 2VH6A 5DSFA 4P02A 4M7GA 3GY4A 1C1WH 1ANCA 3TH2H 4MNYA 1T8MA 1S0RA 3AK5A 2GZ8A 1WTHD 2IPQX 1G37A 3GDSA 4JYUH 4ABIA 3A83A 1C5NH 1VCQA 1GJ7B 2SGAA 3A8CA 4YTAA 5FCKA 4O3UA 1GJ9B 1LVYA 3AASA 5B6OA 1O2NA 2EY4C 2G4TA 1QFKH 4XE4A 4DG4A 3T2NA 2J4IA 2ZTXA 1O2IA 2BY5X 3GY8A 4ABBA 3BN9A 2XXLA 2A5KA 5DP4A 1ANBA 1S83A 5FPTA 3TJVA 1D6WA 2ZU4A 1TPOA 2BY6X 1GVKB 2H5CA 1BUIA 3NPSA 1VJ9U 1UW7A 2JJ2D 1XUGA 4CHAB 3D23A 1AIXH 4MG3A 1Y5UT 4ABFA 1O2YA 1LO6A 4MPWA 3SBKA 4BAKB 4ASUD 1K1MA 1O2GH 3EA8A 1BTHH 1K22H 1JIRA 5GXPA 2BXUH 5A09A 2JIZD 1MTNB 4YLQH 1GBEA 1CA8B 2GCHF 1FY4A 1W13U 3MU1A 1SR5C 3UFAA 3ATMA 1PPGE 1SSXA 3SJ8A 3A7XA 1V3XA 5L2ZH 4TT3D 1O3GA 3BIVH 4K8BA 1EXFA 1PYTD 2A2XH 4CBOA 1MKWH 3KYGA 2FPZA 4FU7A 5F03A 2V3HH 3RC4A 1HGTH 1P3EA 1G3BA 1YPKH 3LGTA 3RXSA 1RJXB 3LJJA 1O31A 2HLCA 1YM0A 1TAWA 5DP9A 2Z94A 1E38B 4JYTA 3RXMA 5DP8A 2STAE 2BD9A 2SGPE 5F6MA 5GDSH 2PSYA 1WDIA 1BQYA 5C67A 4Y7BA 1CA0C 1O3AA 5JB9S 1LDTT 2BQWB 3RMNH 1MZDA 3N99A 1F5RA 1ELFA 1G36A 2ILNA 4OS4A 4BAQB 1MTSA 4YT7H 2VU8E 1A1RA 3GY7A 2P94A 1GI0A 2Z3CA 3HATH 3DFJA 2BDYA 4AYYB 4IBLH 1J15A 1UTQA 1BHXB 2FX6A 3LGYA 4DW2U 3RMMH 1HIAA 1PPEE 1HAPH 1YPJH 1C1RA 1UMAH 2C3SA 2FWWA 4U01A 5CMXH 1O3BA 2AGEX 1C9TA 3JZ1B 1K1NA 2TGPZ 3KQCA 1C2EA 4B74A 3FANA 1MAYA 3GCNA 3SU0A 2B7DH 2BDCA 1D9IA 1VCPA 2HLDD 8ESTE 4YOJA 3GY6A 2VIPA 2XBWA 4FU9A 1GHBG 5IYTA 2AMQA 2BQ6B 4KTCA 5EPNA 1HAVB 1HBTH 1IQLA 2B5TB 2XWBI 5DK1A 4ABJA 2FOGA 3NUMA 4FUCA 4AFZA 1NESE 2Y6TA 3W95A 1ELGA 2FS8A 1GGDC 3F2FA 5JBAS 1JRTA 1L1JA 3MU5A 3V12A 4BTUB 3ATWA 1DY9A 5KECA 5HXFA 2BZAA 3A7VA 3RC6A 2WPHS 1TOMH 2KCPA 3JZ2B 3RXPA 1A0HB 1O2TA 3PWCA 2HALA 1CGIE 3FP6E 1Y3YA 2BY8X 2FTLE 1GBHA 3SV6A 1W3CA 3U8OH 1EPTC 1AZZA 5T3HA 4MNVA 3E0PB 3UWIA 4CBNA 1O3CA 2OC1A 1O2KA 1O3JA 2NU0E 5ETXA 1PPCE 4RKJB 3LDXH 1C2JA 1DDJA 2Z9JA 4WXVA 3BF6H 4O9VA 1RIWC 2W3KA 3MNCA 3HKIB 1VCWA 3D49H 3UREA 3M36A 1CBWB 1V2OT 2THFB 1LKAA 1FQ3A 1FLEE 1ZGVA 1Y8TA 1BTUA 2D26C 1NBMD 2GTBA 2XC4A 2G51A 4ABGA 1QURH 1KXFA 2VIOA 3DCLA 3TH3H 3KNXA 2XC5A 2IPHA 1NRNH 1F7ZA 1ZHRA 4JK5A 3S7HB 2P3UB 2BM2A 1GI8B 3EYDA 5E0HA 1RTLA 3N7DA 5E2OA 1TX7A 1MQ5A 1P2NA 1C1SA 1TMUH 4B6EA 1OHHD 3OY5U 2BD5A 2ZFPH 1HB0B 1HXFH 2PUXB 4ZKRU 2AGGX 1T32A 2XNDD 2C8XB 3QZRA 1QL9A 3SHCH 1ID5H 1Z8IB 2SGEE 3K9XB 2RDEA 1EZSC 2BMGB 1TOCB 1AUJA 2WPIS 4WMFA 3KQBA 1JWTA 2EI6A 3SO3A 1ZJDA 3F9EA 2OBQA 5EGMA 1J9CH 5HGGA 2UUKB 1SGCA 1P05A 1BHXF 1IQHA 2VVCA 4MDSA 1A5GH 1KXDA 3W1EA 2HGTH 1AVWA 3VXFH 1O3FA 3HPTB 3Q77A 5G4BA 3CS7A 2H2ZA 4IN2A 2QF0A 1MBQA 2JDID 4OS2A 3SV9A 3ZZ6A 1QTFA 1MTVA 2CHAB 2FEQH 4KTUA 2ZF0H 1O5DH 2Z6BD 4WY3A 1O2PA 3TJUA 1XMNB 3ZZDA 4E7NA 2GMTC 1BTPA 3R3GB 1TNHA 5BRRE 2BLOA 1NPMA 1P06A 1P3CA 1IQMA 2A7HA 3SJOA 3KYFA 3EGKH 2O8UA 2QXHA 1LQEA 2KR7A 3A82A 1CT2E 1SGEE 2J98B 1LHCH 2YMSC 1P2OA 4X2WA 3C27B 3P8NA 1C4Y2 2VIQA 3TGJE 1G2LA 2XOKD 3E3TA 1UVOA 5SGAE 4INKA 3KQEA 3P8OA 1TNGA 3MH7A 2KCOA 5JBCS 1C2HA 1Z1IA 2VVUA 4DY7B 3A87A 1E37B 2PSXA 1KY9A 1C5UA 4JZDH 1D4PB 1BT7A 2FOMB 3UOUA 1PQ5A 2PLXA 3AW1A 4XDEA 2ZCKP 1FPCH 1IQJA 8GCHG 1JRSA 1KLIH 1ELAA 2ZHDA 1QL8A 4K1EA 4XBBA 5IK2D 4ESTE 3ATKA 3W94A 1Z8JB 4Y11E 5HIZA 1DM4B 2OCVB 1PPFE 1KXAA 1QBVH 1YCPM 1J8AA 4RT1A 1O2HA 2RFKC 1SGYE 1RTKA 2ZIQH 1K21H 3TJOA 1NU7B 3F1SB 4UE7H 2ULLA 2R2WU 4HG6A 1XUFA 1EJMA 4Y7AA 3GCHC 1AWFH 1PPHE 3T29A 1C5WB 1ETRH 1F0RA 4FUIA 4B73A 1QZ8A 2W6ID 1YPEH 5DG6A 5K7RA 5T1VA 4OS6A 1V2ST 4IS5A 2WPMS 1A61H 3M5LA 4X6PA 1Q2WA 1QBNA 1MKXH 5C1XA 3B8JA 3TK9A 1D6RA 4Y0ZE 1E35B 1WCZA 1RRKA 1D3QB 1TE0A 1RXPA 1P10A 1Z71A 1V2UT 3ZV8A 1GBKA 3DUXH 3D62A 5LPRA 2A31A 3SZEA 1FIZA 1YPMH 4DVAU 1FN8A 4FETA 4BANB 4GUXA 1NROH 2GGVB 3VB6A 3A80A 2GV6A 3S9CA 4X1PU 1EFRD 4INHA 2J9NA 4BXSA 3UY9A 3P95A 3PMBB 1GI9B 2BLVA 2A1DB 1PQAA 3ZVBA 2ZFRH 4WH8A 1OP8A 3P6ZB 4Q7XA 1DUEA 3A7TA 2FO9A 3TK6A 4FUEA 4ZKNU 3NZIA 4B75A 1V6DA 5GIBA 3SJIA 2TBSA 1TWXB 5F53A 2FS9A 1V2MT 2ANWA 3GOVB 1AB9C 1LCYA 1UVPA 2TGDA 2HVYB 2W7SA 4Y79A 4BAOB 1EPTA 3U8TH 2WUCA 1PFXC 3M61U 1FJSA 2AEIH 4ZH8A 3EDXB 2F9VA 4D9QA 1ZTJA 4Y76A 1K1JA 1WUNH 1UTPA 3MO3A 2YNAA 3LONA 4ZXXH 1AVGH 1LPZB 1AI8H 3LGUA 1MTUA 2EA3A 4JMYA 2XYAA 3QGJA 3RU4D 4AC9A 1SGFG 5AHGH 2BDAA 5T6GA 3GS9A 7KMEH 2ZQ2A 3GYLB 8GCHF 5C0UA 1SB1H 7GCHG 1S0QA 3SI4H 5DJ7A 2OD3B 2ASUB 1L1NA 4NZQA 2FDAA 2QCYA 3UQVA 3T26A 1C5OH 3IG6B 5DKMA 4Y8ZA 3SV8A 5ESBA 5BPEA 3RLWH 4KTSA 1J17T 3KN2A 4OM9A 3VGCB 2CMYA 1GPZA 1TQ7B 4NIVA 4AGJA 4CR5A 1YLDA 1TGTA 1MZAA 3MOCA 3SN8A 3BEUA 1DXWA 1NRPH 2UUYA 2ZFQH 3LOXA 3A8AA 1H1BA 3Q3KA 2J2UA 4AG1A 3ODDA 4FUHA 1AHTH 3SNBA 1B7XB 6ESTA 1YPGH 2XRCA 1FY5A 2LPRA 3MU8A 6CHAB 1IQFA 4IMQA 2ZG0H 1ZSJA 2PKSC 3H09A 2EQNA 1BA8B 1MD7A 4WXIA 2PW8H 1BBRK 1K28D 2H9EH 1CGJE 1NO9H 1QRZA 1XKBC 5EU8A 2QXJA 4ZROA 1ZR0A 4FVDA 2FOAA 2HVXA 2AMDA 4UEHH 4H6TA 3P17H 4FXGH 2F9UA 2BDIA 2W5EA 3BTFE 1QA0A 1EP5A 1RTFB 4PROA 2VWOA 1FMGA 2OINA 3OU0A 2ZGCA 1JOUB 1DICA 4K2YA 1U6QA 5I46H 2JH6D 2PTCE 1TYNA 2P3FH 1Y3UA 5FX6A 1EAWA 5A0CA 1VKYA 2ZNKH 3M5NA 1WOFA 3V13A 2WUBA 2TIOA 1YLCA 5LPEA 3BTHE 1UTLM 1TIOA 1QCPA 3I29A 3RXQA 1IOEA 1GI7B 2SGDE 3TLOA 2TPIZ 1F0TA 2AIQA 3NRLA 1GHBF 1FPHH 2CK3D 3G01A 5H4IB 4B2AA 1GDUA 2HOBA 3VPKA 4D9RA 1EUFA 5HMAA 1NC6A 3WWFA 4M9FA 1O3MA 3SNAA 3SNCA 3T5FH 3BG4B 1C5RA 3BTTE 1YY3A 3QTOH 4ZXYH 2PGQB 1KIGH 3U28C 3A7ZA 2WPKS 1LPGB 2M5TA 3RUOA 1P04A 1XXFA 2Z7FE 5C2ZA 1PYTC 1F2SE 2OLGA 4JZFH 3PO1C 1DUAA 1J16A 1SGTA 3ZVFA 4Z6AH 2VIWA 1YCPH 9LPRA 4LZ4B 2FX4A 2GT7A 2ZGXH 4VGCC 9ESTA 3SUGA 4ABAA 1DFPA 2BY9X 1TONA 3VEQB 3MHWU 1O5FH 4WF8A 2JJ1D 3PMHB 3FFGA 4IC5A 3F6UH 2Y7XA 3E0NB 4AFQA 5EQRA 2FODA 1ABJH 4IW4E 5C5OA 1SHHB 1OSSA 1TBQH 2HWLB 5PTPA 4X6NA 1C2FA 3GCOA 4ZHLU 3E90B 2O9QA 1V2VT 3KQDA 4ABEA 4I7YH 2ZCLP 1GJ8B 2V3OH 4MNXA 1DX5M 1S6HA 1A46H 1SBWA 4X2XA 1ZRKA 1QJ6B 2QXIA 1SGQE 2ZHQH 1O0DH 3VB7A 4XSKU 3IWMA 5FPYA 2EEKA 1EZUC 2J5UA 3A89A 2ZU1A 3DSGA 4BOHA 4UFFH 1O3NA 5A8XA 1L4DA 3Q3XA 2V0BA 2Y5GA 1GCTC 4NWKA 2RG3A 2FLRH 1SI5H 2VB0A 4GHQA 1BOQA 5C94A 4INLA 3GY3A 1ELCA 1QY6A 3AAVA 3KIDU 4A7IB 2BD7A 2ZO3H 1L0ZA 2KM0A 2ESTE 1AY6H 4ZCNA 1Y3XA 3SNDA 1TPPA 3A81A 2ZHEH 1SGRE 1O3PB 4IGDA 3SU6A 3L3TA 3S69A 1SLVB 3SGAE 4K1TA 4BTTB 1MCTA 1WQVH 1DITH 1C5XB 1HRTH 1O32A 2B8OH 1A5IA 1GBFA 1GHVH 2FI3E 3TJNA 1ZRBA 2J98A 1C2MA 2STBE 2L74A 2BZ6H 1WSSH 2SNWA 3QZQA 2OTVA 2FIRH 1O3KA 1SLWB 2NU4E 1DANH 1LPKB 2C90B 2C8ZB 2Y82A 1GL1A 1C2KA 1O2JA 2CV3A 2H1UA 1DY8A 3LH1A 2K8IA 3SGBE 3FN8A 1DXPA 1BJVA 1TX6A 1GHAF 4GHTA 3BTDE 5EXLA 2A32A 1ZPCA 4JZ1A 1HJAB 4KELA 3UNSA 2C8WB 1W8BH 2IJD1 3BTEE 2IN2A 3LC3A 1OP2A 1GG6C 1GJCB 3HKJB 2QXGA 2VWLA 4K5ZA 2GCTC 5EW2H 2ZWLH 4NWLA 1ZPBA 3LIWA 4AFUA 3CENA 3GDVA 4YESB 4NSVA 1GMCG 3VB3A 1AKSA 2ZPRA 1T8OA 1NBME 2W3IA 2XNIA 2ZDAH 2ZDMA 1NS3A 3HK3B 3HGNA 3MYWA 2FXRA 2XBYA 1V2QT 2GDEH 2P93A 2WV5A 1YWUA 5TCAA 2OQ5A 2FOBA 4MTBA 1UCYE 3E16B 3ZZAA 1GHWH 1O5GH 1OWDA 2VNTA 2FOHA 5EODA 2VINA 2Y5FA 3VG8A 1FXYA 1FY3A 2ZPQA 1FX0B 1TQ0B 1O2MA 1QHRB 1YPHC 3SHAH 3RXVA 2G55A 1C5YB 4CR9A 4DOQA 1DOJA 2BY7X 2BD2A 4YO9A 1KTTB 2H5DA 1KMHB 1IAUA 2A5AA 3DFLA 2Z9LA 2F83A 3KF2A 5EJ1A 1NRQH 2FZZA 2Y80A 2P95A 1F92A 1DS2E 2VIVA 1QRWA 1NZQH 1TB6H 3TPIZ 1O2SA 1V2RT 4WMEA 3OTPA 1EKBB 1ESAA 2O8LA 2J38A 4H4FA 4D7GA 1XUKA 3BTGE 3URCA 3LC5A 2OC7A 1GHAG 4UD9H 2BTCE 1AFQB 1BRAA 1SG8B 1SFIA 4MLFB 2HRVA 2WV9A 2VBCA 4I32A 4O97A 1MQ6A 3LGVA 3E8LA 3T25A 2QF5A 2CXVA 2UUFB 5EXMA 1RGQA 2LP6A 1QIXB 1L2EA 3V7TA 2M2AA 1UVTH 2OK5A 1A5HA 2PV9B 1HJ9A 1N6XA 1A2CH 1ORFA 1PPZA 1W12U 4X8UH 3E91A 2EC9H 1W2KH 4B2CA 1O38A 3KHVA 4NIYA 1T31A 2KFWA 3KL6A 5FCRA 2WYGA 1BB0B 3U9AH 1CHOG 1O39A 1V2WT 1TMBH 4FUJA 1TNKA 2ZCHP 1XUJA 3SU3A 1C2LA 1GG6B 3NCLA 4JZEH 3RMLH 1AFEH 4CRGA 1SMFE 4ZKOU 3SQEE 3MH6A 1EZQA 1TGNA 1K9OE 3CS0A 2PGBB 4KP0A 1GJAB 4MNWA 1WV7H 1ZMLA 2QF4A 2NU2E 4RKOB 2VWMA 3SI3H 3SUEA 2QC2A 1K2I1 4Q2KA 2JETB 1DPOA 2V3MA 1O2OA 3LT3A 2TGAA 1AD8H 4X1NU 1ETSH 4J2YB 3QTVH 4A6LA 1JBUH 1A3BH 1QJ7B 1LTOA 1P57B 5EXNA 5I25A 3LU9B 4K60A 1SQOA 1THRH 4X6OA 5L6NH 1H8IH 1ZTLA 1GJ5H 2ZTYA 1VJAU 1JXPA 2PWXA 3GY5A 1ZJKA 4UFDH 1AE8H 1CVWH 3S9BA 1GBAA 2VWNA 4NIXA 4OS5A 1P9UA 3U1JB 1P11E 5JB8S 4Y10E 5E0GA 3C1KA 3M35A 7GCHF 2B9LA 1NFYA 3ATLA 1C5MD 1SC8U 4B6FA 1T4VH 4WVPE 2GKVE 2FP7B 3Q00A 1SGIB 5CHAB 3DHKH 1E1RD 3M5MA 1SLXB 1Z1JA 1IHSH 2XCNA 2XW9A 3AAUA 3MFJA 1C1OA 1EATA 1Y3WA 3MNSA 2XWAA 4FUBA 4P00A 1C1VH 1GCTB 3UNQA 3BG8A 2G52A 3RXUA 1D3PB 1J14A 3RU4T 1FI8A 4F55A 4UONA 3O8BA 3M3TA 5HM9A 1XVOA 3ZZ4A 4RT0A 2J94A 3UQOA 1LHEH 1BCUH 8LPRA 1QNJA 4OS7A 3EE7A 3SZNA 4CRBA 2ZP0H 1TRMA 2FOCA 3A86A 1O5AB 1LVOA 3E6PH 2ANMH 3ESTA 2WV4A 1CQQA 1IQNA 3F0OA 5CHAC 1UO6A 1O2QA 2BDGA 1NRRH 1GI5A 1H9IE 1ZSLA 4XBCA 1HAIH 3ZZCA 1X7AC 4ABHA 4DCDA 3UTUH 4TWWA 2RDLA 1IHTH 2V7QD 3SJKA 2HPQH 2ZTZA 1N6YA 5GCHF 4VGCB 2CF9H 1CU1A 1HIAB 2Y81A 1BBRE 1GBLA 2PHBA 3N7OA 2H9TH 2JKHA 1ARBA 4DT7B 2BXTH 3SU4A 1ELDE 1FV9A 1C1TA 1NFXA 3PO1B 1N1LA 1O5CB 1AUTC 1EZXC 4ABDA 3MMGA 1ARCA 5JYIA 2NU1E 3BTWE 3D65E 3MH5A 3ZYEA 4AG2A 3TU7H 4OGYA 1BIOA 1C1PA 1EQ9A 3BG4C 2JETC 1SVPA 3PV4A 1QQ4A 4ACAA 1P2MA 3RDZA 1BTYA 2H6MA 1SQTA 3QLPH 1G32B 1OYTH 1S6FA 3R0FA 1WAYB 1NU9A 2WHXA 4DT4A 1P09A 3K2UA 1IQGA 3U69H 5AFYH 2Z3DA 2GV7A 4Z0KA 1O3LA 4BNRA 1C4V2 1GI3A 3FZZA 3HK6B 3LKWA 3P92A 4K3JA 3BEIB 2BVXH 1YP9A 1G3DA 3LJOA 4NA9H 4HZHA 1WXRA 3TK5A 1C5LH 3DSPA 1EB1H 4F4OC 3RXGA 3TGKE 1TNIA 2Q6DA 2B0FA 4B76A 3M37A 2NU3E 1GBBA 4CRDA 3UPEA 1ZGIA 2GX4A 1W14U 1ANDA 1ZLRA 4MPVA 5FPSA 3RMOH 1GL0E 3GCTF 3B23B 1W0ZU 1XX9A 3A84A 4ZKSU 3SU1A 3KEEA 4RSPA 4WWYA 3ENSB 5GNDA 1RS0A 2JH0D 3ELAH 1RFNA 1FDPA 3DA9B 2QAAA 1AFQC 1P2QA 3A8BA 1MBMA 1GDNA 1GI2A 4ZMAH 4NA7A 1A4WH 3DD2H 4UFEH 3GDUA 3UNRA 1GMDF 2QF3A 2ZGHA 3BIUH 5EPYA 3SNEA 2LELA 4AGKA 1E34B 2FM2A 1KDQB 4JYVH 1AU8A 6CHAC 2BD8A 2GZ7A 3RLYH 1A0JA 1VR1H 1O2UA 2ODYB 3RP2A 1P12E 2UWOA 1P03A 1O2WA 2L6OA 4X1QU 3ZZ8A 2HNTE 1LHFH 2A5IA 1GI6A 1F5LA 3RXLA 3S7KB 1XUIA 4NZLA 1PPBH 3VGCC 5CDFE 3PV5A 3BTQE 1YBWA 3H7TA 2CGAA 1K1PA 3RXIA 4A92A 4YM9A 3MI4A 2ZEBA 4DIHH 5C20A 1DWBH 4LOYH 4GSOA 1FIWA 4I8GA 3SU2A 4ISOA 2OP9A 5DGJA 1YGCH 1EJAA 1QB9A 2C93B 3P8GA 5A8ZA 3TNSA 1V2NT 1HFDA 1BBRH 4AX9H 1TPAE 4HI3A 4TYDA 1O5BB 4H6SB 2BB4A 5A0BA 4NGAH 3Q76A 2GCTB 3SGQE 3OX7U 3F2HA 2BLWA 5A2MH 2F91A 5A0AE 1BMNH 4Y0YE 2LNCA 2BOHB 3PLBA 1C5VA 2OC8A 2AH4X 4TPIZ 5F8ZA 3FP7E 5C17A 1B5GH 3QDZB 4YLUA 1F0SA 2GD4B 1GDQA 4DGJA 5A8YA 1HJAC 1W0JD 1GBIA 2IOTA 2A7CA 3H7OA 1QQUA 3EE0B 3MU4A 4IMZA 5CE1A 2A4QA 3QO6A 1MU8B 1QB1A 1YPHE 3GY2A 1ZTKA 1GJDB 2RA0A 3FVFB 2TRMA 5FBEA 2R2MB 2GCHG 1AKSB 3UIRA 1ZSKA 4TSFD 5L2YH 3PTNA 5T6DA 1NFWA 1GJ4H 1LQDB 1CHOF 2WZQA 2J92A 2GZ9A 5DP7A 2QA9E 2AIPA 1B0FA 1HAZB 1O2RA 4MPUA 3BTKE 2PR3A 1GHXH 2D2DA 4TPYA 2ZDNA 4JCNA 1C5ZB 1T4UH 1EAXA 2ZGJA 3MWIU 3M7TA 5JDUB 3STJA 4YZUA 2KX4A 3SJ9A 4LK4A 1O3IA 1UCYK 1GBCA 3MNXA 3N7EA 5AF9H 1B0EA 4ISNA 4NA8A 2PFEA 2ZGBH 2PP6A 7ESTE 3SUFA 1AVXA 2D1JA 1C2GA 1OS8A 2XBVA 4D8NA 1EOLA 4Y6DA 1P2IA 5EOKA 4ZHMU 3M3SA 4FU8A 1HV7A 2ODQA 1UVSH 3UAIC 1ABIH 4WMDA 3PWBA 2F3CE 4NIWA 4NSYA 1TALA 2CJIA 3ODFA 2AHME 4MPXA 2ZDLA 5JBBS 3F9HA 3V3MA 5GWZA 1GI1A 2BYAX 5DPAA 1S84A 1G2MA 5EIYA 3QK1A 1BRCE 1SL3A 4YOIA 1W0KD 4CREA 2F43B 2AS9A 2Z3EA 1MABB 3SW2B 2F9OA 2KZ4A 2R3YA 2BHGA 2ZU5A 2BD3A 1KXCA 6LPRA 3K65B 2GDDA 4DIIH 1SOZA 2F9PA 5C5NA 1SGNE 3P70B 2VH0A 3F9GA 1TA6A 1OPHB 4RI0A 2FESH 2ZDVH 1ELVA 5GPIB 4UDWH 1FUJA 3UOPA 2WYJA 4Q63A 1OWIA 1L1GA 1EAUA 3PV2A 3RXJA 1V2PT 1Z8RA 1GI4A 2EI7A 3MH4A 2DE8A 4OS1A 1ZPZA 2J97A 3KCGH 1BMMH 1HAGE 2FMJA 2YMSB 2EI8A 1GBJA 1UK2A 5C1UA 4I33A 1UTNA 1O30A 4X1SU 4X2YA 3QGNB 1SOTA 3BTME 3T62A 1KLTA 1O33A 3RXKA 1SQAA 4TY6A 1QBOA 2GMTB 3ZVGA 2TGTA 3OAAD 4AN7A 2A45B 2QIQA 1HAOH 2ALVA 4LZ1H 4B1TA 1C5TA 2G8TA 2CHAC 3CP7A 4Y71A 4O03A 3PM3A 3PMJA 2G81E 1O3DA 1D3DB 1O2ZA 1O3HA 1CT4E 2UWLA 2DUCA 1AMHA 3GCTG 3OEHD 1TGCA 5TJXA 1O35A 4YXWD 2KAIB 1TLDA 1YF4A 2YNBA 3UUZA 2ZA5A 2G00A 1COWD 1TRYA 3BEFB 1HXEH 3DT0H 3PB1E 3TIUA 1ZHPA 2A7JA 5KEDA 1VITF 2ZFSA 2V35A 3ZVEA 3FOAA 1OKXA 3F3BA 2BDBA 3VB4A 1GHZA 2QN5T 5C3NA 6GCHF 3FO8D 3F68H 4YOGA 4JK6A 4GAWA 1WBGB 1SGFA 1ZMJA 1E36B 1K1LA 1KXEA 3KQ5A 3QUMP 2P3TB 1GMHG 1P01A 3QX5H 2WSSD 1Q3XA 1V2TT 2KCAA 2A4RA 1EP6A 1T8LA 3OY6U 2ZU3A 4AOQA 2PKSB 2ZQ1A 4X0WU 1QRXA 4JZIA 2V6NA 4CH2B 3S0NA 3LGIA 1IQKA 4FVBA 2A4GA 1XM1A 5DP3A 2PKAA 5FX5A 1C5QA 1RD3B 3TH4H 1EJNA 5HM2A 4IN1A 3NKKA 4X8VH 3MTYA 1ETTH 2HNTF 1HAXB 4SGBE 2R9PA 5FAHA 4B2BA 1P0SH 3ZZ3A 2VJ1A 4A1TA 2FI5E 2ZI2H 3SOSA 4OGXA 1C2IA 4LXBH 3B9FH 3BSQA 3FZDA 1HUTH 4I8KA 2GT8A 1C1UH 2R3UA 2SFAA 2GP9B 1MKWK 5FBIA 3EQ0H 1S85A 1TPSA 1TX8A 3U8RH 4FUDA 3RXFA 1V2KT 1OWKA 2ZHFH 1G3CA 2WINI 3SORA 5FL7D 1GHYH 2YOLA 5LGOA 3RXAA 1KYNA 2ALPA 1IQEA 3M5OA 1UHBA 1BRBE 5AFZH 1JMOH 4YT6H 1MU6B 3UB0A 4H42U 1BITA 1BZXE 1SGPE 2F4LA 1E79D 2GVFA 1UHBB 5EW1H 1QGFA 4Y8YA 2ZFFH 2KAIA 3I78A 3O8CA 1GGDB 1HJ8A 1SLUB 3TVJB 4SGAE 5J4SA 2ZDKA 3RXHA 4E06H 1AN1E 3V0XA 1G9IE 1S5SA 3MU0A 2Q1JA 1AB9B 3MNBA 3PTBA 1C5SA 1PQ7A 2KCYA 3FKSD 2ANYA 3PRBA 1OOKB 4CRAA 1M9UA 1WU1A 3H5CB 2P59A 2BD4A 2Q6FA 1PQ8A 4F49A 2AGIX 4HTCH 1P2KA 4GCHF 3RXOA 1SQRA 1HNEE 3E1XB 1TFXA 2ZU2A 2Z9IA 4F48B 2SGFE 1C1QA 1GBTA 1H9HE 1S81A 4X8TH 2OXSA 2Y5HA 1AQ7A 2HPPH 1TRNA 3AW0A 4A5TS 3PLPA 5HKKD 1TA2A 1YYY1 1MH0A 1ELTA 1DWDH 1CA0B 2FTMA 1O37A 2SNVA 4GPGA 2HNTC 3RXTA 4AZ2B 1HLTH 1ACBE 2BQ7B 3ITIA 4E05H 5J4QA 1V2LT 1XUHA 1EASA 3OYPA 1CSOE 1GJ6A 2AMPA 3WW7A 3TNTA 1BRUP 3ZIAD 1HAYB 2K1QA 4X8SH 1O36A 2XBXA 1VITH 1BJUA 1BDAA 4E7RG 3FAOA 3GICB 4NFEA 5C0TA 5ESTE 4DURA 4NG9H 1HPGA 5TCCA 3GCHB 4Q7YA 3TITA 1WYKA 3ATIA 1NFUA 4U2WA 3RU4E 2OQUA 3F9FA 1W10U 2OBOA 4Q7ZA 5HIYA 1P02A 2FYRA 4XD7D 2CF8H 1D3TB 4FUFA 3U98H 1C4U2 1S6LA 7LPRA 2NWNA 1TNLA 1V2JT 3SUDA 5LPFA 1Z6EA 1OP0A 1MD8A 2BOKA 1CGHA 1FAXA 2YMSD 1F5KU 2WPLS 4R0IA 5JBTA 5DO4H 1DLKB 1WQSA 3FP8E 3ZYDA 3VXEH 1AWHB 5LH8A 4I8LA 4I8HA 4RN6A 2RA3A 1SFQB 1BTWA 2BX3A 4ISIH 3RXRA 2PUQH 3OE7D 2DE9A 1C2DA 2ZECA 1UTJA 1AO5A 2W6JD 4WH6A 5IDKA 1K1IA 3LH3A 1T7CA 3PMAB 3VFEA 2Z9GA 2A2QH 1T8NA 2AERH 3EA7A 1XVMA 4HFPB 1MTWA 3STIA 4NCYA 3AVZA 5C1YA 1UK4A 3DSOA 3QWCH 4MQAA 1OXGA 1MMJN 1P8VC 4U32A 3TGIE 4CRFA 1CHGA 1NN6A 3EAJA 1FY1A 1SKYE 2XC0A 4ACBA 4NFFA 4D7FA 1FONA 1N8OC 3L33A 2BVSH 5KGOA 1SPJA 4J1YA 2ZPSA 4Q80A 1EAIA 4BAHB 4CRCA 3A7WA 3K6YA 3PRDA 3LPRA 1NTPA 1O34A 3SYJA 3A7YA 4XFQA 4UFGH 1DT2A 1THPB 3OTJE 2FLBH 1DLEA 4ISHH 1KXBA 4FUGA 1Z6JH 5F8XA 2BVRH 3RXDA 1SGDE 4AYVB 5DP6A 1HDTH 1DWEH 1TNJA 4KGAA 3CNRA 1QA7A 6GCHG 3PLKA 3O8DA 1UTMA 3K6ZA 1AGJA 2ZHWH 1GBMA 3RM0H 4O3TA 1FNIA 4X1RU 1DE7H 4BAMB 1P9SA 3OFND 2SGQE 2IJOB 1VGCC 2QY0B 4XRNA 1OYQA 1O2XA 4Y8XA 2BLQA 2Q6GA 1Z7KA 2XCFA 5FHTA 4QT8C 5EJLA 4K69A 1Y5BT 2J34A 4AFSA 3PYHA 3BV9B 3SU5A 5AVDA
chains in the Genus database with same CATH topology
2OUAA 1OWEA 5E0JA 3NXPA 1ZMNA 1JIMA 4GVUA 1TBZH 2A0QB 3A88A 1BMAA 2VGCB 1QR3E 2ZKSA 4WJG2 1AE5A 3ZZ9A 1GJBB 4K8YA 1TGSZ 4KKDA 5EG4A 1QB6A 1Y3VA 1ESTA 3A8DA 3URDA 1LKBA 2ANKH 2OC0A 1TABE 2F9NA 4X2VA 1CBWC 3RC5A 2FOEA 1AZ8A 1RIWB 1LVBA 1Y59T 1DSTA 4A1XA 1GMDG 4ZHAA 1NY22 4A1VA 1O2LA 1LHGH 1CT0E 1P2JA 2VVVA 1UJ1A 2G5VA 1ZOMA 1KTSB 4AORA 1G3EA 1GVLA 1FY8E 1E0FD 1Q31A 4THNH 2XTTB 2ZC9H 5DP5A 3SV7A 1XXDA 1MKXK 1H8DH 1WTGH 1EPTB 1VITG 3MO6A 3ZZ5A 1Z8GA 1W7GH 5E2PA 1ZYOA 5E8EH 1CO7E 1Y5AT 1ELEE 1DWCH 4BTIB 1OX1A 2C4FH 1DVAH 4BXWA 1C1MA 3PROA 4IC6A 1GMCF 3RM2H 2QV1A 2RCEA 1C5PA 1EX3A 1H9LB 2O8MA 3EA9A 2G5NA 4HGCA 1NM6A 1PJPA 1GBDA 3NWUA 5HYOA 1YC0A 2P8OC 5EQSA 2BX4A 2P8OB 3SQHE 1K1OA 3QN7A 4ISLA 1OWHA 5FXLA 2W7UA 5K0HA 2ZFTA 3VB5A 4TWYA 1C9PA 1O3OA 1MCVA 1FZZA 3ZZBA 3M7QA 1O3EA 1HYLA 1L4ZA 5T6FA 1FN6A 1UCYH 5L30H 3IITA 4I31A 3WY8A 2C8YB 1MUEB 1HCGA 1UTKA 3ZZ7A 1BMLA 2AYWA 3GISB 2ODPA 4B71A 5F8TA 4ASHA 1IQIA 3OSYA 2AFQB 2UWPA 2O8WA 1KSNA 1ANEA 3UWJH 2ZZUH 1TGBA 3ZVAA 1EOJA 4K1SA 5ABWA 3ZVCA 1A7SA 2FI4E 2O8TA 3M3VA 2PKAB 2WPJS 3MO9A 5GCHG 1KLJH 4XOJA 1VZQH 4AB9A 1LHDH 3S9AA 2I6QA 2QGRA 2CN0H 4TY7A 2P16A 2BDHA 1DSUA 1QJ1B 3Q3YA 2A4OA 1TMTH 1KDQA 1A3EH 1GCDA 3T27A 1O2VA 5JPMH 1W0YH 1HAVA 2R0LA 2VGCC 1BTXA 3L6PA 8KME2 1NRSH 2G4UA 1HAHH 3P8FA 2FOFA 3GYMA 3ZV9A 1G30B 1FAKH 1INCA 4DJZB 1MTNC 1UK3A 3T28A 3LGWA 2QYIA 2Y7ZA 5GJ4B 1BTZA 1NT1A 2JH5D 1QL7A 4U30A 2VIDA 3ZVDA 1UTOA 1CE5A 1VGCB 1A0LA 1H4WA 4MVNA 4CHAC 1ELBA 1XKAC 1UVUH 1GVZA 3UR6A 1YPLH 1YKTA 4ZUHA 4R8TB 3NK8A 3O8RA 2I6SA 1OWJA 1THSH 4AB8A 2W26A 4GLYA 1GWAA 1W7XH 1ESBA 2R0KA 1LMWB 2Z9KA 1TBRH 4I8JA 3I77A 1F0UA 3SV2H 1O5EH 1ZHMA 2F9BH 4X6MA 3UR9A 1SHYA 4ZAEA 1S82A 2FYQA 3RXBA 1LVMA 3RXEA 1ZZZA 4CH8B 4GCHG 4XBDA 2J95A 5EQQA 3U1IB 1YCPK 4D76A 1C1NA 2H9HA 3M7UA 2PTNA 1EB2A 3RXCA 3A85A 3KGPA 2UUJB 1GMHF 3HGPA 2D8WA 1N8OB 1MAXA 1W11U 2VH6A 4M7GA 3GY4A 1C1WH 1ANCA 3TH2H 4MNYA 1T8MA 1S0RA 2GZ8A 1WTHD 1G37A 3GDSA 4JYUH 4ABIA 3A83A 1C5NH 1VCQA 1GJ7B 2SGAA 3A8CA 4YTAA 5FCKA 4O3UA 1GJ9B 1LVYA 3AASA 5B6OA 1O2NA 2G4TA 1QFKH 4XE4A 4DG4A 3T2NA 2J4IA 2ZTXA 1O2IA 2BY5X 3GY8A 4ABBA 3BN9A 2XXLA 2A5KA 5DP4A 1ANBA 1S83A 5FPTA 3TJVA 1D6WA 2ZU4A 1TPOA 2BY6X 1GVKB 2H5CA 1BUIA 3NPSA 1VJ9U 1XUGA 4CHAB 3D23A 1AIXH 4MG3A 1Y5UT 4ABFA 1O2YA 1LO6A 4MPWA 3SBKA 4BAKB 1K1MA 1O2GH 3EA8A 1BTHH 1K22H 1JIRA 5GXPA 2BXUH 5A09A 1MTNB 4YLQH 1GBEA 1CA8B 2GCHF 1FY4A 1W13U 3MU1A 1SR5C 3UFAA 3ATMA 1PPGE 1SSXA 3SJ8A 3A7XA 1V3XA 5L2ZH 1O3GA 3BIVH 4K8BA 1EXFA 1PYTD 2A2XH 4CBOA 1MKWH 2FPZA 4FU7A 5F03A 2V3HH 3RC4A 1HGTH 1P3EA 1G3BA 1YPKH 3LGTA 3RXSA 1RJXB 3LJJA 1O31A 2HLCA 1YM0A 1TAWA 5DP9A 2Z94A 1E38B 4JYTA 3RXMA 5DP8A 2STAE 2BD9A 2SGPE 5F6MA 5GDSH 2PSYA 1BQYA 5C67A 4Y7BA 1CA0C 1O3AA 5JB9S 1LDTT 2BQWB 3RMNH 1MZDA 1F5RA 1ELFA 1G36A 2ILNA 4OS4A 4BAQB 1MTSA 4YT7H 2VU8E 1A1RA 3GY7A 2P94A 1GI0A 2Z3CA 3HATH 3DFJA 2BDYA 4AYYB 4IBLH 1J15A 1UTQA 1BHXB 2FX6A 3LGYA 4DW2U 3RMMH 1HIAA 1PPEE 1HAPH 1YPJH 1C1RA 1UMAH 2C3SA 2FWWA 4U01A 5CMXH 1O3BA 2AGEX 1C9TA 3JZ1B 1K1NA 2TGPZ 3KQCA 1C2EA 4B74A 3FANA 1MAYA 3GCNA 3SU0A 2B7DH 2BDCA 1D9IA 1VCPA 8ESTE 4YOJA 3GY6A 2VIPA 2XBWA 4FU9A 1GHBG 5IYTA 2AMQA 2BQ6B 4KTCA 5EPNA 1HAVB 1HBTH 1IQLA 2B5TB 2XWBI 5DK1A 4ABJA 2FOGA 3NUMA 4FUCA 4AFZA 1NESE 2Y6TA 3W95A 1ELGA 2FS8A 1GGDC 5JBAS 1JRTA 1L1JA 3MU5A 3V12A 4BTUB 3ATWA 1DY9A 5HXFA 2BZAA 3A7VA 3RC6A 2WPHS 1TOMH 3JZ2B 3RXPA 1A0HB 1O2TA 3PWCA 2HALA 1CGIE 3FP6E 1Y3YA 2BY8X 2FTLE 1GBHA 3SV6A 1W3CA 3U8OH 1EPTC 1AZZA 5T3HA 4MNVA 3E0PB 3UWIA 4CBNA 1O3CA 2OC1A 1O2KA 1O3JA 2NU0E 5ETXA 1PPCE 4RKJB 3LDXH 1C2JA 1DDJA 2Z9JA 4WXVA 3BF6H 4O9VA 1RIWC 2W3KA 3MNCA 3HKIB 1VCWA 3D49H 3UREA 3M36A 1CBWB 1V2OT 2THFB 1LKAA 1FQ3A 1FLEE 1ZGVA 1Y8TA 1BTUA 2D26C 2GTBA 2XC4A 2G51A 4ABGA 1QURH 1KXFA 2VIOA 3TH3H 3KNXA 2XC5A 2IPHA 1NRNH 1F7ZA 1ZHRA 4JK5A 3S7HB 2P3UB 2BM2A 1GI8B 3EYDA 5E0HA 1RTLA 5E2OA 1TX7A 1MQ5A 1P2NA 1C1SA 1TMUH 3OY5U 2BD5A 2ZFPH 1HB0B 1HXFH 2PUXB 4ZKRU 2AGGX 1T32A 2C8XB 3QZRA 1QL9A 3SHCH 1ID5H 1Z8IB 2SGEE 3K9XB 1EZSC 2BMGB 1TOCB 1AUJA 2WPIS 4WMFA 3KQBA 1JWTA 2EI6A 3SO3A 1ZJDA 3F9EA 2OBQA 5EGMA 1J9CH 5HGGA 2UUKB 1SGCA 1P05A 1BHXF 1IQHA 2VVCA 4MDSA 1A5GH 1KXDA 2HGTH 1AVWA 3VXFH 1O3FA 3HPTB 3Q77A 5G4BA 3CS7A 2H2ZA 4IN2A 2QF0A 1MBQA 4OS2A 3SV9A 3ZZ6A 1QTFA 1MTVA 2CHAB 2FEQH 4KTUA 2ZF0H 1O5DH 2Z6BD 4WY3A 1O2PA 3TJUA 1XMNB 3ZZDA 4E7NA 2GMTC 1BTPA 3R3GB 1TNHA 5BRRE 2BLOA 1NPMA 1P06A 1P3CA 1IQMA 2A7HA 3SJOA 3EGKH 2O8UA 2QXHA 1LQEA 3A82A 1CT2E 1SGEE 1LHCH 1P2OA 4X2WA 3C27B 3P8NA 1C4Y2 2VIQA 3TGJE 1G2LA 3E3TA 1UVOA 5SGAE 4INKA 3KQEA 3P8OA 1TNGA 3MH7A 5JBCS 1C2HA 1Z1IA 2VVUA 4DY7B 3A87A 1E37B 2PSXA 1KY9A 1C5UA 4JZDH 1D4PB 1BT7A 2FOMB 3UOUA 1PQ5A 2PLXA 3AW1A 4XDEA 2ZCKP 1FPCH 1IQJA 8GCHG 1JRSA 1KLIH 1ELAA 2ZHDA 1QL8A 4K1EA 4XBBA 4ESTE 3ATKA 3W94A 1Z8JB 4Y11E 1DM4B 2OCVB 1PPFE 1KXAA 1QBVH 1YCPM 1J8AA 1O2HA 1SGYE 1RTKA 2ZIQH 1K21H 3TJOA 1NU7B 3F1SB 4UE7H 2ULLA 2R2WU 1XUFA 1EJMA 4Y7AA 3GCHC 1AWFH 1PPHE 3T29A 1C5WB 1ETRH 1F0RA 4FUIA 4B73A 5DG6A 1YPEH 5K7RA 4OS6A 1V2ST 4IS5A 2WPMS 1A61H 3M5LA 4X6PA 1Q2WA 1QBNA 1MKXH 5C1XA 3B8JA 3TK9A 1D6RA 4Y0ZE 1E35B 1WCZA 1RRKA 1D3QB 1TE0A 1RXPA 1P10A 1Z71A 1V2UT 3ZV8A 1GBKA 3DUXH 3D62A 5LPRA 2A31A 1FIZA 1YPMH 4DVAU 1FN8A 4BANB 4GUXA 1NROH 2GGVB 3VB6A 3A80A 2GV6A 3S9CA 4X1PU 4INHA 2J9NA 4BXSA 3UY9A 3P95A 3PMBB 1GI9B 2BLVA 2A1DB 1PQAA 3ZVBA 2ZFRH 4WH8A 1OP8A 3P6ZB 4Q7XA 1DUEA 3A7TA 2FO9A 3TK6A 4FUEA 4ZKNU 3NZIA 4B75A 1V6DA 5GIBA 3SJIA 2TBSA 1TWXB 2FS9A 1V2MT 2ANWA 3GOVB 1AB9C 1LCYA 1UVPA 2TGDA 2W7SA 4Y79A 4BAOB 1EPTA 3U8TH 2WUCA 1PFXC 3M61U 1FJSA 2AEIH 4ZH8A 3EDXB 2F9VA 4D9QA 1ZTJA 4Y76A 1K1JA 1WUNH 1UTPA 3MO3A 2YNAA 3LONA 4ZXXH 1AVGH 1LPZB 1AI8H 3LGUA 1MTUA 2EA3A 4JMYA 2XYAA 3QGJA 3RU4D 1SGFG 5AHGH 2BDAA 5T6GA 7KMEH 2ZQ2A 3GYLB 8GCHF 1SB1H 7GCHG 1S0QA 3SI4H 5DJ7A 2OD3B 2ASUB 1L1NA 4NZQA 2FDAA 2QCYA 3UQVA 3T26A 1C5OH 3IG6B 5DKMA 4Y8ZA 3SV8A 5ESBA 5BPEA 3RLWH 4KTSA 1J17T 3KN2A 3VGCB 2CMYA 1GPZA 1TQ7B 4NIVA 4AGJA 4CR5A 1YLDA 1TGTA 1MZAA 3MOCA 3SN8A 3BEUA 1DXWA 1NRPH 2UUYA 2ZFQH 3LOXA 3A8AA 1H1BA 3Q3KA 2J2UA 4AG1A 3ODDA 4FUHA 1AHTH 3SNBA 1B7XB 6ESTA 1YPGH 2XRCA 1FY5A 2LPRA 3MU8A 6CHAB 1IQFA 4IMQA 2ZG0H 1ZSJA 2PKSC 1BA8B 1MD7A 4WXIA 2PW8H 1BBRK 1K28D 2H9EH 1CGJE 1NO9H 1QRZA 1XKBC 5EU8A 2QXJA 4ZROA 1ZR0A 4FVDA 2FOAA 2HVXA 2AMDA 4UEHH 4H6TA 3P17H 4FXGH 2F9UA 2BDIA 2W5EA 3BTFE 1QA0A 1EP5A 1RTFB 4PROA 2VWOA 1FMGA 2OINA 3OU0A 2ZGCA 1JOUB 1DICA 4K2YA 1U6QA 5I46H 2JH6D 2PTCE 1TYNA 2P3FH 1Y3UA 5FX6A 1EAWA 5A0CA 2ZNKH 3M5NA 1WOFA 3V13A 2WUBA 2TIOA 1YLCA 5LPEA 3BTHE 1UTLM 1TIOA 1QCPA 3I29A 3RXQA 1GI7B 1IOEA 2SGDE 3TLOA 2TPIZ 1F0TA 2AIQA 1GHBF 1FPHH 3G01A 5H4IB 4B2AA 1GDUA 2HOBA 3VPKA 4D9RA 1EUFA 5HMAA 1NC6A 1O3MA 3SNAA 3SNCA 3T5FH 3BG4B 1C5RA 3BTTE 3QTOH 4ZXYH 2PGQB 1KIGH 3A7ZA 2WPKS 1LPGB 2M5TA 3RUOA 1P04A 1XXFA 2Z7FE 5C2ZA 1PYTC 1F2SE 2OLGA 4JZFH 3PO1C 1DUAA 1J16A 1SGTA 3ZVFA 4Z6AH 2VIWA 1YCPH 9LPRA 4LZ4B 2FX4A 2GT7A 2ZGXH 4VGCC 9ESTA 3SUGA 4ABAA 1DFPA 2BY9X 1TONA 3VEQB 3MHWU 1O5FH 4WF8A 3PMHB 3FFGA 4IC5A 3F6UH 2Y7XA 3E0NB 4AFQA 5EQRA 2FODA 1ABJH 4IW4E 5C5OA 1SHHB 1OSSA 1TBQH 2HWLB 5PTPA 4X6NA 1C2FA 3GCOA 4ZHLU 3E90B 2O9QA 1V2VT 3KQDA 4ABEA 4I7YH 2ZCLP 1GJ8B 2V3OH 4MNXA 1DX5M 1S6HA 1A46H 1SBWA 4X2XA 1ZRKA 1QJ6B 2QXIA 1SGQE 2ZHQH 1O0DH 3VB7A 4XSKU 3IWMA 5FPYA 2EEKA 1EZUC 3A89A 2ZU1A 4BOHA 4UFFH 1O3NA 5A8XA 1L4DA 3Q3XA 2V0BA 2Y5GA 1GCTC 4NWKA 2RG3A 2FLRH 1SI5H 2VB0A 4GHQA 1BOQA 4INLA 3GY3A 1ELCA 1QY6A 3AAVA 3KIDU 4A7IB 2BD7A 2ZO3H 1L0ZA 2ESTE 1AY6H 1Y3XA 3SNDA 1TPPA 3A81A 2ZHEH 1SGRE 1O3PB 4IGDA 3SU6A 3L3TA 3S69A 1SLVB 3SGAE 4K1TA 4BTTB 1MCTA 1WQVH 1DITH 1C5XB 1HRTH 1O32A 2B8OH 1A5IA 1GBFA 1GHVH 2FI3E 3TJNA 1ZRBA 1C2MA 2STBE 2BZ6H 1WSSH 2SNWA 3QZQA 2OTVA 2FIRH 1O3KA 1SLWB 2NU4E 1DANH 1LPKB 2C90B 2C8ZB 2Y82A 1GL1A 1C2KA 1O2JA 2CV3A 2H1UA 1DY8A 3LH1A 3SGBE 1DXPA 1BJVA 1TX6A 1GHAF 4GHTA 3BTDE 5EXLA 2A32A 1ZPCA 4JZ1A 1HJAB 4KELA 3UNSA