3A85A

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 15 seconds)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a85A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a85A02
3A7TA 2ZFPH 5T6DA 2ANMH 1HIAA 1QA7A 2QGRA 4IS5A 4ZHAA 4GPGA 1Z71A 3LDXH 4YESB 4A92A 3O8CA 1QURH 5T3HA 3M37A 1C5WB 3TPIZ 2OUAA 1FQ3A 1A0JA 1QGFA 3SORA 1H4WA 2FDAA 2R3YA 2ILNA 3LGUA 5AVDA 2R9PA 1EAIA 3VGCB 1AGJA 3P17H 4B71A 2HALA 3MH5A 5DKMA 1MKWH 2CHAB 2K1QA 3MTYA 4GHTA 1UK2A 2F3CE 4DGJA 1XX9A 1W2KH 5GXPA 1AE5A 1FY4A 1GL0E 5DPAA 5FBEA 4IGDA 2J4IA 3E91A 1B0EA 4UDWH 3ZZ7A 1CVWH 1MH0A 1SR5C 3RU4T 4K60A 1TNGA 1LHDH 1BHXF 3B23B 3A8AA 1P2MA 2OD3B 3SV2H 1BT7A 1GJ9B 1VJ9U 4NA7A 2ZHQH 3BIVH 3A8BA 1BMMH 1SPJA 3SU3A 1AB9C 3H7OA 4ABBA 1OYQA 3HPTB 1A2CH 2HRVA 3I77A 1SSXA 2RDLA 3F68H 1V2PT 3F6UH 2BQ6B 3P92A 2O8LA 3R3GB 5CHAC 2F9PA 3RXIA 1TNJA 1J9CH 1GG6C 5GCHF 3M3VA 1TNIA 3GYLB 5HM2A 3TNSA 4ABJA 1O2WA 3LH3A 1NS3A 1UTOA 1QJ6B 3BSQA 3MH7A 1AKSA 2XWBI 1TMUH 3ZYEA 2ZDNA 1C2GA 1GHWH 3HK3B 2D2DA 4FUHA 4VGCC 8GCHF 1FUJA 1SB1H 1ZHMA 2XRCA 8KME2 3ZVGA 1MD7A 3VXFH 3BTKE 4AFQA 1OX1A 4CRDA 1FY5A 2HOBA 3PV4A 2ZO3H 1WOFA 3I29A 3M7UA 1ZJKA 4BOHA 2AMQA 1Y3UA 1BUIA 1SQOA 1GHVH 1NM6A 1P02A 1XM1A 1G32B 2OC0A 4HZHA 3LONA 2R0LA 2ZTYA 2EA3A 2BY9X 4AGKA 1C5UA 2BDGA 1HNEE 1C2JA 2BY6X 2WYJA 2IOTA 4X6PA 2BVRH 1K2I1 3RLYH 2GT8A 1GI8B 4BXWA 1GI0A 1LQDB 3E0NB 1YLDA 3UUZA 3T5FH 6GCHG 4I7YH 3LKWA 2ZU1A 4NIWA 1GVZA 2G4UA 4BAQB 3OTJE 2THFB 2TGAA 3BEIB 4Q7YA 2VNTA 3SV7A 3O8RA 1OWJA 3KQEA 4WMDA 4MDSA 3KN2A 3GCOA 2GZ8A 1U6QA 2B7DH 2BTCE 3BG4C 3PO1B 3RXKA 1P2KA 3LGTA 4OS4A 1CU1A 1P3EA 1AFEH 4A7IB 1NU7B 1LVYA 1O2RA 4FUDA 4ZHLU 1SGDE 2GX4A 3GCHB 3M5OA 1K1OA 2OBQA 1NPMA 2FEQH 3QO6A 4MPWA 5C1YA 1EAXA 1TAWA 3QZQA 5HYOA 2FTMA 1F5RA 1SFIA 3GY3A 5GDSH 3SBKA 2BHGA 1IQLA 3VEQB 4YT7H 4Y76A 1TB6H 1TONA 2DE8A 1A3BH 1HJ9A 1C1QA 1FIWA 2A31A 1E34B 1RRKA 3SI4H 5JYIA 3RXPA 1C2LA 4UD9H 4UFEH 3T25A 1KXFA 3O8BA 5DP9A 1O2QA 5EPNA 5A8XA 3A84A 1G3EA 1ELVA 3A87A 1GBAA 1C4V2 3A83A 1O5DH 1FY8E 3GISB 3S7HB 1IHSH 2CF8H 3ZZDA 2A1DB 2BX3A 2STAE 1Z8GA 1KY9A 3FANA 2STBE 2QXHA 2TBSA 3GYMA 4I8KA 1FAKH 1IQEA 1C5QA 1BRBE 2ALPA 1MQ6A 3QX5H 4Q2KA 2OC7A 1YGCH 3ZVBA 1QBOA 3PMBB 1KTTB 1FY1A 1XXDA 2Z9IA 1ABJH 1DUEA 2BZ6H 2XXLA 3RC4A 1O2OA 1MD8A 1F0TA 1O3NA 1SVPA 1HAOH 1DT2A 2FI3E 1NZQH 3M3TA 3TLOA 1ANDA 1FI8A 3M5MA 2BMGB 2I6SA 2VIDA 2BXUH 1K1MA 5K0HA 3RXOA 5K7RA 4UEHH 3MMGA 2AGIX 2BLOA 1P2IA 2VWOA 1SGRE 4K8BA 3UR6A 3TVJB 2PGBB 5EQSA 1W3CA 4YO9A 2SNWA 1H8IH 1M9UA 4XBCA 1GBIA 4INLA 2PLXA 2EC9H 1KIGH 3MU1A 2J9NA 4VGCB 1GHYH 1Y8TA 2NU2E 3OYPA 1NC6A 3RXRA 1EPTC 1V2VT 1O5GH 2GD4B 2VVUA 1P10A 3DT0H 4ISNA 2AIPA 4Q7XA 4TWYA 3TJUA 1LHCH 5C2ZA 4I33A 1HAXB 2AMPA 3UY9A 1SOTA 2XC5A 1T31A 2JKHA 5E2OA 1WTHD 4CRGA 5H4IB 1UCYE 2HNTE 4UFFH 4U32A 5F8TA 1GI2A 1OPHB 1LDTT 4IN2A 1ZGIA 2UUKB 5E2PA 1HAIH 3U98H 2VIQA 3PROA 1AI8H 1EJAA 1UTKA 3SO3A 2ZPSA 1KYNA 5E0JA 1DVAH 3VGCC 1ZTKA 3UR9A 1CA8B 3ZVEA 1VGCC 3SI3H 3MWIU 1O3KA 2ZPRA 3MOCA 2GV6A 5JB8S 1BBRH 2F91A 2Z9JA 3RMOH 2ESTE 1HAVA 3ZVDA 1C2EA 1V2JT 5F8XA 4YOGA 2ZPQA 4XE4A 1FJSA 3BN9A 1GWAA 1IQJA 1LHGH 2Q6FA 1INCA 1J16A 1AUJA 4B73A 4H6SB 1BZXE 2FZZA 1NY22 2F9UA 4UFGH 2BVXH 8LPRA 2WV5A 1NFYA 5DGJA 2RA3A 2GGVB 3F9FA 1HAYB 1ABIH 2SNVA 1MTWA 4AZ2B 1Q2WA 1F5KU 1SMFE 2ZIQH 3SNBA 4LZ1H 4JK6A 3E6PH 4KGAA 2FOHA 4BAOB 3P8GA 5LPFA 1E38B 2ZGCA 3DD2H 3BIUH 3SNEA 4ZKSU 2O8UA 2BD5A 1TOMH 5JDUB 5DP3A 1P2QA 4X8VH 3S9BA 4Z6AH 1W8BH 1O5EH 2XCNA 3M5NA 4DW2U 1DY8A 3RDZA 2H2ZA 2FIRH 1P3CA 1K1PA 4DJZB 1LVBA 5CHAB 1LHEH 1DSUA 3U8OH 3SW2B 2ZNKH 3TU7H 1TNHA 1MZAA 1C2IA 1V2KT 3A88A 3P70B 1EZXC 1YPMH 2BDYA 1EATA 2QXJA 3Q3YA 1L1JA 4MNVA 1C9TA 2CMYA 3Q77A 2HNTF 2ZFFH 5FX5A 1XVOA 3A85A 3HATH 2ZFSA 1GDNA 1TNLA 3HKJB 1O2SA 2VWNA 2P8OB 3M61U 1P2OA 2TIOA 4U2WA 2VWMA 3SJ8A 1GCTC 5BPEA 3RXGA 3ZZ8A 5F8ZA 1GI4A 3F9EA 1O3MA 4UONA 4X6NA 5A0CA 4U01A 3SQEE 4GAWA 1P05A 3KCGH 1WQVH 1IQMA 1O5FH 1TPPA 3DFLA 3ZZBA 2OQUA 2QF0A 1OWKA 1PPFE 4YOIA 3P8NA 3TGKE 1D3QB 1PYTD 2EI6A 2WPLS 3EA8A 3VB4A 4ZROA 3NUMA 3SHCH 2B8OH 2QAAA 3M7QA 3RXCA 2J34A 5A09A 1C1OA 1OXGA 1THSH 1AE8H 2ZG0H 3SU4A 1GMCG 1TFXA 1OYTH 5EU8A 3VB5A 5EQQA 5AF9H 3FP7E 1TNKA 1UTQA 3SUFA 2FESH 4O3TA 3VB7A 3DFJA 1ESAA 1C5YB 1V2QT 3RM0H 1ZSJA 4OS1A 3KL6A 4WH8A 3BG8A 3RUOA 2BD9A 2P59A 1EZQA 1WBGB 3VFEA 1SGPE 5F6MA 1UCYH 1VITF 2ZECA 1G2MA 1NO9H 1ZJDA 4FXGH 1O5CB 1A5HA 4ABFA 1V2ST 2XCFA 1L0ZA 2H1UA 3CP7A 1RIWB 1C5VA 1Z7KA 2P93A 3C1KA 3L33A 3A81A 6CHAB 5FXLA 1P8VC 1AIXH 3SGBE 4THNH 5LH8A 3E1XB 3GOVB 2PKSC 5FBIA 1QBVH 1THPB 4YM9A 1HXEH 2FYRA 1V2WT 1YCPM 5JBCS 2ZHDA 2RCEA 3M36A 4X2VA 3S0NA 5GJ4B 1EPTA 4ZHMU 1CHOG 2BDIA 4CH8B 3URCA 2FLRH 1UVSH 2Y7ZA 1C9PA 1TBRH 2TGTA 1F5LA 1JBUH 2VIVA 4B1TA 3FZZA 3NK8A 4A1VA 1TABE 1UTMA 1O31A 1S6FA 4X1SU 5E0HA 2W7UA 3Q00A 3GDSA 1EAWA 3U8TH 1HGTH 5BRRE 4HGCA 1C5RA 2Z7FE 1HFDA 1K1IA 1MTSA 3DA9B 4I8GA 2BD8A 1C2KA 1SLUB 4O03A 3UOUA 1Y3YA 4WVPE 1FPHH 2D8WA 1L4DA 2FODA 1G2LA 2BDHA 1TE0A 2AMDA 5ESTE 1SHYA 1TALA 2FOFA 2F9OA 2PW8H 1NROH 5HMAA 1K21H 2BOHB 1EPTB 1SQAA 1GJCB 3GCTG 1BRUP 4R0IA 3OY5U 2ANWA 3ATWA 2FS9A 1GMDF 1XMNB 1UVOA 4ABHA 2TRMA 3GCHC 5EQRA 3LC5A 1AY6H 1ZSKA 2D1JA 4RSPA 2C90B 1MTNB 2Z9LA 1C1UH 3TITA 1F0SA 3D49H 3LOXA 2FI4E 1CA0C 1TOCB 1ZMNA 4A1XA 1MMJN 1QRWA 3FP8E 3SJKA 3OX7U 4BAMB 2R0KA 1J17T 2ZTXA 4OS7A 3CENA 4HTCH 1NESE 4JZFH 2SGQE 1BJUA 1UTLM 1V2RT 1NFUA 5DP8A 2CGAA 1TX6A 1N1LA 1TPOA 3ZV8A 1Y5AT 5CMXH 1EKBB 2GV7A 3B8JA 1PJPA 3SNDA 4BXSA 2NU3E 1CT2E 3LIWA 2GCTB 1PFXC 3HK6B 4NWKA 3RMNH 1AMHA 3RXLA 4MG3A 1K1NA 3SV9A 1NFWA 2WPJS 1O35A 5L30H 2G8TA 4NIXA 5L2ZH 1HAZB 1MKXH 3LC3A 3MFJA 1EQ9A 5JBAS 3GY8A 1MCVA 1BMAA 1G9IE 3TIUA 5FCRA 1A5IA 1C2MA 4OS2A 4ABAA 5EG4A 4ABEA 4X2WA 4NA8A 3EGKH 1YC0A 4DOQA 3F1SB 4B75A 7GCHF 5CE1A 4AFZA 1S0RA 1YLCA 1QRXA 4MPUA 2BY5X 1C5OH 3D65E 2OCVB 1PPCE 3FP6E 1YKTA 1G37A 3OY6U 1ELDE 3I78A 2AS9A 2HPPH 1QL9A 1ELGA 1SGNE 2Z9KA 4RKOB 3BTEE 4ABIA 3BTME 2W26A 1WYKA 4NIYA 2NU4E 3KQCA 2BYAX 1EZSC 3BEFB 3ZZAA 2Z6BD 3GCNA 2XBWA 5FPYA 1GL1A 3SU0A 1BRAA 2SGEE 4JZ1A 1UVUH 2QF3A 1F0RA 2XNIA 3SV6A 1GMCF 4OS6A 1DY9A 1OS8A 1CO7E 1NFXA 4CHAC 2A4RA 3T26A 4KTUA 1W0YH 2WPKS 1BRCE 4ZXXH 4RKJB 1WSSH 1ETRH 1KXEA 4FUIA 3A7YA 2XYAA 1WU1A 3AASA 1HYLA 4X8UH 1GCTB 5AHGH 4B76A 3RU4D 1V2TT 4JZDH 1TGTA 1HXFH 1KXCA 3QTVH 2OTVA 1EAUA 3MNCA 1LHFH 1P2JA 4AGJA 1VGCB 1XKBC 1TGCA 1FY3A 5C20A 3KIDU 1JWTA 2ZI2H 1WV7H 2VH6A 1D3TB 5GIBA 2WPIS 2CF9H 1T4UH 1AQ7A 1EOLA 1T8LA 3G01A 1CE5A 5TJXA 1T32A 3GDVA 1YM0A 4FVDA 1TQ0B 3S7KB 1TMBH 4K1EA 3R0FA 1GPZA 1CHGA 3FVFB 1GMHG 2ALVA 4K5ZA 2H9TH 3ZV9A 1OP2A 4DIIH 2RA0A 3AW0A 1KLIH 4X1PU 3U69H 5DP4A 1ZTLA 4U30A 1ELBA 1A7SA 2PGQB 4FVBA 1QTFA 1TQ7B 4MNXA 3TH2H 2SGDE 1QNJA 1O3HA 2JETC 2ZDKA 2GDDA 4A1TA 1CHOF 3A80A 3MNSA 1ACBE 1O3EA 4X2XA 5DO4H 3GY5A 1DWCH 1A5GH 1HDTH 2G4TA 3ZZ5A 4WF8A 3MNXA 1GGDC 1PPBH 5C5NA 2G55A 2BLVA 5JBBS 3QN7A 3TJNA 2B0FA 1V2LT 2FPZA 3HGPA 1ARBA 1YCPH 3M5LA 2ZU2A 1T8NA 2UUFB 3P6ZB 4IC5A 5HGGA 3ZZ3A 4MPVA 1C5SA 3UQOA 2ZKSA 2XC0A 1GJ4H 2G51A 3VPKA 2FWWA 1C1RA 2NU1E 2B5TB 2ZC9H 4D7FA 4I8JA 2P8OC 4D9RA 3LPRA 3PWBA 2ZDMA 2QXIA 2QYIA 4DG4A 1LCYA 3UNQA 3SU1A 3EQ0H 4E06H 4LXBH 4O9VA 3RU4E 3ATLA 3KF2A 1L1NA 5AFYH 1SGQE 2HGTH 1VJAU 3VXEH 4AOQA 4X6OA 2FX4A 2G52A 4FU9A 1A46H 1S84A 1Y3VA 1PQ8A 1ZHRA 1TMTH 4Y79A 1KSNA 9ESTA 1GMDG 1YPLH 1GVKB 1YYY1 3IG6B 3QGJA 2UUYA 2BVSH 1EXFA 1SI5H 1IQGA 1UO6A 2WYGA 1UMAH 3MO9A 4WY3A 3URDA 1O2MA 5EXLA 1S82A 4B2CA 2A32A 4NZLA 1WCZA 1N8OB 1T7CA 2C3SA 1Y3XA 1GVLA 2J95A 2UWOA 3TH3H 1IQIA 3PTNA 4TY7A 1QCPA 3QGNB 1P11E 1O3AA 1TGSZ 2BD4A 3U1JB 2HLCA 5C5OA 3K2UA 5FHTA 4X1NU 4JZEH 3E16B 1ZHPA 2PFEA 1AVXA 1SGTA 1GI5A 1J8AA 1TX7A 4XBDA 4AORA 3GY4A 4A5TS 1WAYB 2WPMS 7LPRA 1ZPZA 3LJOA 4DT7B 2ZU4A 2TGPZ 3MU4A 3SUDA 3EA7A 3NZIA 3PMJA 4WMFA 1FLEE 7KMEH 2FOCA 1GJAB 2Y5FA 2PUQH 1RIWC 3RXDA 2CHAC 1OOKB 1LQEA 2FO9A 3QTOH 2XTTB 1K22H 2VIPA 4AFSA 4GLYA 3RXJA 1G30B 4XSKU 1O2PA 1QB9A 2YOLA 1S85A 3RXTA 1P09A 1WTGH 3KQDA 1O3FA 1EB1H 2ZFRH 1P12E 1YF4A 1QA0A 5TCCA 3UWIA 8GCHG 4NG9H 4PROA 1FNIA 1XUHA 3RXVA 1EZUC 1UTNA 3AVZA 3D62A 3D23A 3E8LA 2V35A 1A1RA 1D3PB 2R3UA 1HAVB 3BTDE 2GCTC 1K1JA 5HM9A 2HVXA 1W0ZU 4FUBA 4Y0YE 1B0FA 4ZKOU 2BOKA 1SL3A 2Y80A 1ANEA 2CJIA 2J38A 1KDQA 3ENSB 2AEIH 3RM2H 1CGHA 2YNAA 2FX6A 1GHAG 3E90B 1AB9B 1LTOA 3O8DA 1V2NT 4FUCA 1TA6A 3RXAA 1H9HE 4YZUA 1JIRA 2ULLA 5EXMA 4LZ4B 1MKWK 4JYUH 3SU5A 4Y11E 2KAIA 1EB2A 3P8OA 2AFQB 1RFNA 3A7ZA 4I31A 3UWJH 2M5TA 3UOPA 3BTTE 3ZZ4A 2Z9GA 1S83A 4YT6H 1D4PB 5SGAE 2LNCA 1GJBB 3ZZ9A 2ZF0H 3LGYA 2QXGA 1HAGE 5ETXA 5G4BA 3ZVFA 2SGFE 2QIQA 1F0UA 1L2EA 4WMEA 2ZU5A 4KELA 1CQQA 1N6YA 2ANYA 4HI3A 1OWIA 1NTPA 1W10U 2G00A 3AAVA 3SHAH 4FU8A 2A4GA 4OGYA 1ORFA 1MZDA 1KDQB 5IYTA 2C8XB 4XOJA 1HJAB 1UTPA 4TPYA 1O0DH 3MNBA 2A7JA 4Y0ZE 4CRFA 6GCHF 1C4Y2 1V2OT 1OP8A 3UREA 1BIOA 1FAXA 1TIOA 1V3XA 3BTGE 1CA0B 4WXVA 3DUXH 2FOEA 4SGBE 2Y5HA 3RXMA 1D9IA 3BV9B 4NSVA 3K9XB 1AFQC 2XBYA 2J94A 3RXHA 2A4OA 2YNBA 4JMYA 2DE9A 4E05H 1O37A 4ASHA 3PYHA 2G5NA 4BANB 4D9QA 1G3BA 2BY8X 2VGCB 2QA9E 1Z6JH 4JK5A 1N8OC 1O3CA 2CN0H 4B2AA 4TPIZ 1DM4B 2GT7A 3VB3A 4DURA 1ZLRA 2G5VA 4XBBA 3PO1C 1O3PB 1PYTC 4YLUA 1MTUA 3BTWE 1GBTA 1SGEE 1BTYA 1C5NH 1D6WA 1P9UA 2O8MA 3K6YA 3PM3A 1DS2E 1GI1A 3F9GA 1W13U 1BA8B 7GCHG 1DLEA 4K3JA 1NRSH 4TWWA 1VCWA 1O3DA 2OBOA 2I6QA 1GHAF 4Y8ZA 1ZMLA 1SLVB 3A8CA 2VIWA 2GP9B 1IQKA 1ETSH 2GKVE 2PUXB 1DPOA 1IHTH 4AX9H 1IQNA 4AG2A 3TK5A 1RD3B 1TPAE 4AG1A 4IBLH 1ELEE 1X7AC 5L2YH 1GBDA 1GG6B 4WXIA 1P03A 2H9HA 1V2MT 4ZH8A 2WUBA 2C4FH 1PPZA 4SGAE 1HJ8A 4MLFB 1GDQA 5EXNA 3T27A 3RLWH 1IAUA 1EUFA 1F7ZA 1TWXB 2BLWA 1O3GA 5ESBA 3A8DA 1G3DA 4NFEA 1CT0E 3LT3A 2P94A 2ZDVH 1TRNA 1XUKA 3ZZCA 4AN7A 3OU0A 3PB1E 2ODQA 3ZVAA 4AB8A 5J4QA 4K8YA 2H9EH 1ZGVA 3A89A 4ZMAH 3U1IB 4FUJA 1QIXB 3RXQA 4ZUHA 1GBKA 3LGWA 4JCNA 3M3SA 3GCTF 3ODFA 1P04A 2ZCLP 5I25A 5EODA 3QUMP 3NWUA 8ESTE 5LPRA 1BDAA 2ZHEH 1SC8U 1O2XA 1THRH 2GCHF 4NSYA 1SGYE 3PWCA 1E37B 2ANKH 4RN6A 4O3UA 1HCGA 3MU8A 4X6MA 1QJ7B 1O34A 3SJOA 1DOJA 1QL7A 1C1MA 3E0PB 2Z3CA 3QZRA 2OP9A 5HXFA 1DE7H 2ZCHP 2ZQ2A 1Y5BT 4CRBA 5A8ZA 2ZTZA 1VR1H 1ELFA 3TGJE 1C2FA 4H42U 3VB6A 1MQ5A 1GDUA 1BMNH 1Y3WA 1XUJA 1XVMA 1KLTA 4NCYA 1CBWB 2A0QB 1BOQA 4DY7B 4J2YB 1A0LA 5JPMH 1LMWB 3SGQE 4KP0A 1AZZA 1J15A 2BDCA 4ISHH 3FFGA 5FX6A 4X1RU 3KGPA 3U8RH 3RMMH 2BDBA 3MH6A 3KNXA 1IQFA 1QL8A 2ZZUH 2O8TA 2BY7X 3UPEA 2BLQA 5IDKA 1O5AB 5GCHG 2HPQH 2WV4A 4MTBA 2Y6TA 1YPHC 1F92A 1QQ4A 3SQHE 3RC6A 1YBWA 4QT8C 1SBWA 3ATIA 1OSSA 1PQ5A 3FAOA 1OWDA 3EAJA 1QB6A 1SLXB 5GPIB 1MBMA 1BJVA 1O2KA 1D6RA 3GY2A 1O2YA 1A3EH 3SU6A 1TBZH 3SUGA 1HIAB 1GHXH 6ESTA 1CSOE 1B5GH 2PV9B 2ZFQH 4TY6A 1O3LA 5I46H 1VITG 2A2QH 1QRZA 2QN5T 1JRTA 3OSYA 4BAHB 4X1QU 2LPRA 3ITIA 1MTVA 1NRQH 1VCQA 1ZPCA 1GI7B 1EASA 1O2ZA 1C1VH 2CV3A 1O32A 1FIZA 1JXPA 4NWLA 4O97A 4ZKNU 1JOUB 3FZDA 2PTNA 2JH5D 1QHRB 2WPHS 1FN6A 2ZFTA 2W7SA 2ZGJA 1RJXB 3LH1A 2NWNA 4TYDA 3P95A 1VZQH 1AVWA 3RC5A 1ELAA 2FLBH 5FCKA 1C5LH 2J2UA 4A6LA 1ESTA 4XDEA 3QWCH 1FDPA 5A2MH 2C8WB 1RTLA 4M7GA 3S9AA 1HJAC 3TK6A 4CBNA 4X2YA 2XBVA 2KAIB 2W3KA 1HB0B 1GI3A 2XWAA 1ETTH 1YPKH 4WWYA 1GBFA 1Z1IA 2QC2A 1GHBG 1MU6B 1SGFA 4I8LA 3Q76A 2BD7A 1GBLA 1QR3E 1GHBF 1GHZA 1BTHH 1OWEA 3MO3A 2O9QA 2UUJB 4INHA 1T4VH 1GJ6A 1AWHB 1MAYA 3NKKA 1XUFA 5GWZA 4MVNA 1PPHE 2VGCC 3EYDA 2ZWLH 2ZDLA 3V13A 2FP7B 4KTSA 4ISIH 3ZVCA 5A8YA 2VU8E 3BEUA 5E0GA 1JMOH 1SQTA 2PSXA 1AU8A 1GJ5H 1O39A 1P01A 1N6XA 1DUAA 5L6NH 1XUGA 4NIVA 4OGXA 3MYWA 2ZU3A 4ISOA 4NZQA 2FYQA 1DXWA 1F2SE 1AVGH 1QBNA 1BMLA 1FPCH 2GDEH 2GTBA 2PSYA 1ELCA 3EDXB 3RXFA 1SFQB 1J14A 4DIHH 4IN1A 1UK3A 1C5XB 5DP7A 6CHAC 2V6NA 1UVTH 2BQ7B 1O3JA 1C1WH 4BAKB 2IJOB 2FXRA 2PKSB 2AYWA 1VCPA 5EGMA 3UNSA 1RTFB 1UHBB 2Z3EA 1AKSB 2A45B 1EOJA 4Q7ZA 4MPXA 5C1XA 3B9FH 4KTCA 2ZDAH 1C5MD 3Q3KA 3QK1A 4H6TA 1KXAA 2A5IA 5EOKA 1A4WH 1YCPK 2D26C 4FU7A 3V7TA 1GI9B 3ELAH 2WUCA 1KTSB 1LPGB 5EW2H 5PTPA 1P06A 2A5KA 3MHWU 3PMHB 7ESTE 1QJ1B 1TX8A 2P95A 2CXVA 2Q1JA 3DHKH 3SJ9A 1IQHA 1AFQB 3W95A 1TGBA 2PR3A 2F9BH 1O36A 2F9VA 2TGDA 4IMZA 2V3HH 1SGIB 3A86A 2O8WA 2AGGX 1TRYA 1HRTH 1YPHE 1C5TA 3RXUA 1W7GH 1FMGA 5FAHA 1BTWA 1EP5A 1EP6A 1UVPA 6LPRA 1XXFA 3KEEA 1WQSA 2ZGBH 1SGFG 3A7VA 3LGVA 4NFFA 1KXDA 4B2BA 3K6ZA 1NN6A 1DANH 2VB0A 3V3MA 1GBMA 1P9SA 2EI8A 2GCHG 1BTZA 1C1NA 1UJ1A 2UWLA 1O2HA 3A82A 1O5BB 2H5DA 3EE0B 4AYYB 2VVVA 4K69A 4YTAA 1ZZZA 3GY7A 2OLGA 1AHTH 1BITA 1GBBA 1P2NA 4Y7AA 1GBCA 5LPEA 3MO6A 2Y81A 3A7XA 1DSTA 1LKAA 1MTNC 5AFZH 5JB9S 1O2JA 4E7RG 2ASUB 2BM2A 2FM2A 1ZR0A 1RS0A 1V2UT 3JZ2B 4YLQH 4ABDA 4B74A 2Z94A 9LPRA 1AO5A 1AUTC 2HWLB 4MQAA 1GBJA 4Y10E 2JH6D 1DFPA 2BB4A 1YPEH 1CBWC 3JZ1B 2ZGXH 1DICA 4JYVH 2AIQA 3SNAA 3T29A 1SLWB 1A61H 3GICB 4I8HA 1TRMA 2XW9A 1HAPH 4K1SA 5C3NA 4GCHG 2ODPA 3SV8A 1BCUH 1QQUA 2P3UB 5EPYA 3MH4A 1OWHA 3NPSA 1D3DB 1SG8B 1EJNA 1XUIA 5FPSA 1L4ZA 1BQYA 2VJ1A 1RXPA 4D7GA 1HV7A 2GMTB 3WY8A 3RXBA 1S81A 1GI6A 2FOBA 4K1TA 1GBHA 4CRCA 3SJIA 2QCYA 3K65B 3L3TA 3TK9A 4CR9A 1QY6A 4GUXA 3IITA 5C1UA 4Y71A 1BB0B 1O2IA 1OP0A 1DITH 1QFKH 2V3OH 1O38A 2R2MB 2FOAA 3BF6H 1E0FD 3MU5A 1O3IA 2VWLA 2H5CA 2ZEBA 1K1LA 1C4U2 3QDZB 1YP9A 4Y6DA 1SOZA 1O33A 1NU9A 1O3BA 4X0WU 2H6MA 1IOEA 2BX4A 3UFAA 3CS0A 2OXSA 1O2GH 3S69A 1ZSLA 1DX5M 4BTTB 3S9CA 1LVOA 2OC8A 1BTUA 5B6OA 2BQWB 1PQ7A 1W11U 2JH0D 3SZNA 1EX3A 3AAUA 1TLDA 1LPKB 4CBOA 1K9OE 2BD2A 1H9LB 2IPHA 2J92A 4F49A 2ZA5A 3CS7A 1XKAC 5F03A 2AGEX 1ELTA 1H8DH 3HKIB 3TNTA 3RXEA 4LOYH 3H7TA 4CHAB 3ESTA 2SGPE 3TGIE 3GDUA 4GSOA 1W14U 2GVFA 1EJMA 2FTLE 3T28A 3BTFE 1ZTJA 4ESTE 4Q80A 4IW4E 1GBEA 1W7XH 5LGOA 3TH4H 3M35A 2ODYB 5DP5A 1CGJE 1BHXB 2EEKA 1Y59T 1E35B 5DP6A 1O2UA 3TJOA 2F9NA 1L1GA 3BTQE 1DLKB 3UIRA 1DWDH 4JZIA 1ANBA 2OQ5A 1G36A 4HFPB 1ESBA 5EW1H 1O3OA 4MNWA 2PKAA 5DK1A 4MNYA 1DDJA 4CRAA 1MU8B 3H5CB 1MUEB 2EI7A 2BXTH 1RTKA 2F83A 3T2NA 3UNRA 4INKA 1BBRE 2VIOA 2VH0A 3TJVA 4OS5A 2C8YB 1UTJA 2BDAA 5C67A 3V0XA 1HUTH 1Z8IB 1NRNH 1Q3XA 3LGIA 4Z0KA 2ZQ1A 5J4SA 1O2VA 1FN8A 1LO6A 1C2DA 2WINI 4IC6A 1Z8JB 1SGCA 4FUFA 1TYNA 3QLPH 2G81E 1OKXA 1GCDA 2W3IA 4YOJA 3EA9A 1GJDB 3SUEA 3SOSA 3KQBA 3BG4B 2C93B 1UCYK 3BTHE 2GZ7A 2Y82A 2Z3DA 4ZAEA 4BNRA 4F4OC 2GZ9A 1GJ8B 1VITH 3STIA 1AWFH 5FPTA 1H1BA 4GVUA 1G3CA 1ID5H 4H4FA 2PHBA 4CH2B 4Y7BA 1YPGH 4CREA 1C1PA 3IWMA 1GGDB 1ZRKA 1T8MA 1ARCA 4IMQA 4JYTA 2Y5GA 1SHHB 2A5AA 4AYVB 1RGQA 4Y8XA 4X8SH 2VINA 1MCTA 4GCHF 3ATKA 2ZHWH 4K2YA 3UQVA 2P3FH 2ZP0H 2GMTC 3GY6A 1UHBA 4I32A 3PLKA 4X8TH 5E8EH 1TPSA 3LU9B 1O2TA 3SU2A 3T62A 1DWBH 4FUEA 1H9IE 4BTUB 1CT4E 1WUNH 1Z1JA 2V0BA 4WJG2 1ZRBA 4XFQA 1MBQA 1Z8RA 1BTXA 3HGNA 4NGAH 4UE7H 1AZ8A 3ODDA 4KKDA 1P57B 4DCDA 4GHQA 2A7HA 3PLBA 2FOMB 3SGAE 3MI4A 5DG6A 1S0QA 3RXSA 3F9HA 4J1YA 1C2HA 2OINA 2SGAA 5ABWA 1CGIE 5TCAA 4AFUA 1S5SA 2NU0E 3ZYDA 2DUCA 1NRPH 1YPJH 2QY0B 2A4QA 3C27B 4CR5A 1W12U 1ZOMA 3PTBA 2ZHFH 1C1TA 4NA9H 2A7CA 1TA2A 1T8OA 4ZKRU 1HBTH 1B7XB 3ZZ6A 1MAXA 1AD8H 4BTIB 1PPEE 1BTPA 3P8FA 2BZAA 2ZGHA 1FZZA 3PMAB 3RMLH 1FONA 1P0SH 1A0HB 1PPGE 1E36B 2Q6DA 3KHVA 1O30A 1ANCA 3MU0A 1HLTH 1C1SA 4LK4A 4WH6A 2OC1A 1C5PA 5A0AE 1DWEH 4R8TB 1ZPBA 3U9AH 4E7NA 2P3TB 1QB1A 5DJ7A 1Q31A 2W5EA 1ZMJA 2C8ZB 2JETB 1LKBA 1DXPA 1NRRH 3L6PA 1AN1E 4FUGA 2Q6GA 4ABGA 2QV1A 4D76A 1V6DA 3UTUH 2FS8A 1KLJH 3NXPA 3N7OA 2FOGA 3W94A 2FMJA 3ATMA 2PTCE 1NT1A 1HPGA 4ISLA 3STJA 2UWPA 1FXYA 2PWXA 3NCLA 2P16A 1K28D 2FI5E 3V12A 1JRSA 3SNCA 1ZYOA 2HNTC 5T6FA 1FV9A 4Y8YA 2A2XH 2SFAA 2IN2A 3PLPA 2R2WU 2VVCA 1BBRK 1LVMA 1UK4A 2ZCKP 3M7TA 1TGNA 5T6GA 1MKXK 5JBTA 3A7WA 3AW1A 1S6HA 2B9LA 2PKAB 1JIMA 1Y5UT 3LJJA 1GJ7B 2BD3A 1Z6EA 1O2NA 2AH4X 1LPZB 2RG3A 1C5ZB 3SN8A 3RP2A 1KXBA 1HAHH 4DVAU 1GMHF 1TBQH 2AERH 2XBXA 1O2LA 2Y7XA 5A0BA 3Q3XA 1PQAA 3E3TA 4ZXYH 4UFDH 2TPIZ 2XC4A 4AB9A 4D8NA
chains in the Genus database with same CATH superfamily
3A7TA 2ZFPH 5T6DA 2ANMH 1HIAA 1QA7A 2QGRA 4IS5A 4ZHAA 4GPGA 1Z71A 3LDXH 4YESB 4A92A 3O8CA 1QURH 5T3HA 3M37A 1C5WB 2AHME 3TPIZ 2OUAA 1FQ3A 1A0JA 1QGFA 3SORA 1H4WA 2FDAA 2R3YA 2ILNA 3LGUA 5AVDA 2R9PA 1EAIA 3VGCB 1AGJA 3P17H 4B71A 2HALA 3MH5A 5DKMA 1MKWH 2CHAB 2K1QA 3MTYA 4GHTA 1UK2A 2F3CE 4DGJA 1XX9A 1W2KH 5GXPA 1AE5A 1FY4A 1GL0E 5DPAA 5FBEA 1YY3A 4IGDA 2J4IA 3E91A 1B0EA 4UDWH 3ZZ7A 1CVWH 1MH0A 5EJLA 1SR5C 3RU4T 4K60A 1TNGA 1LHDH 3F2GA 1BHXF 3B23B 3A8AA 1P2MA 3DCLA 2OD3B 3SV2H 1BT7A 1GJ9B 1VJ9U 4NA7A 2ZHQH 3BIVH 3A8BA 1BMMH 1SPJA 3SU3A 1AB9C 3H7OA 4ABBA 1OYQA 3HPTB 3EE7A 1A2CH 2HRVA 3I77A 1SSXA 2RDLA 3F68H 1V2PT 5KGOA 3F6UH 2BQ6B 3P92A 5CHBA 2O8LA 3R3GB 5CHAC 2F9PA 3RXIA 1TNJA 1J9CH 1GG6C 5GCHF 3M3VA 1TNIA 3GYLB 5HM2A 3TNSA 4ABJA 1O2WA 3LH3A 1NS3A 1UTOA 1QJ6B 3BSQA 3MH7A 1AKSA 2XWBI 1TMUH 3ZYEA 2ZDNA 1C2GA 1GHWH 3HK3B 2D2DA 4FUHA 4VGCC 8GCHF 1FUJA 1SB1H 2PP6A 1ZHMA 2XRCA 8KME2 3ZVGA 1MD7A 3VXFH 3BTKE 4AFQA 1OX1A 4CRDA 1FY5A 2HOBA 3PV4A 2ZO3H 1WOFA 3I29A 3M7UA 1ZJKA 4BOHA 4FETA 2K0QA 2AMQA 1Y3UA 1BUIA 1SQOA 1GHVH 1NM6A 1P02A 1XM1A 1G32B 2OC0A 4HZHA 3LONA 2R0LA 2ZTYA 2EA3A 2BY9X 4AGKA 1C5UA 2BDGA 1HNEE 1C2JA 2BY6X 2WYJA 2IOTA 4X6PA 2BVRH 1K2I1 3RLYH 2GT8A 1GI8B 4BXWA 1GI0A 1LQDB 3E0NB 1YLDA 3UUZA 3T5FH 6GCHG 4I7YH 3LKWA 2ZU1A 4NIWA 1GVZA 2G4UA 4BAQB 3OTJE 2THFB 2TGAA 3BEIB 4Q7YA 2VNTA 3SV7A 3O8RA 1OWJA 3KQEA 4WMDA 4MDSA 3KN2A 3GCOA 2GZ8A 1U6QA 2B7DH 2BTCE 3BG4C 3PO1B 4Q63A 3RXKA 1P2KA 3LGTA 4OS4A 1CU1A 1P3EA 1AFEH 4A7IB 1NU7B 1LVYA 1O2RA 4FUDA 5B6LA 4ZHLU 1SGDE 2GX4A 3GCHB 3M5OA 4M9FA 1K1OA 2OBQA 1NPMA 2FEQH 3QO6A 4MPWA 5C1YA 1EAXA 1TAWA 3QZQA 5HYOA 2FTMA 1F5RA 1SFIA 3GY3A 5GDSH 3SBKA 2BHGA 1IQLA 3VEQB 4TT3D 4Y76A 4YT7H 1TB6H 1TONA 2DE8A 1A3BH 1HJ9A 1C1QA 1FIWA 2A31A 1E34B 1RRKA 3SI4H 5JYIA 3RXPA 1C2LA 4UD9H 4UFEH 3T25A 1KXFA 3O8BA 5DP9A 1O2QA 2V3MA 5EPNA 5A8XA 3A84A 1G3EA 1ELVA 3A87A 1GBAA 1C4V2 3A83A 1O5DH 1FY8E 3GISB 3S7HB 1IHSH 4YXWD 2CF8H 3ZZDA 2A1DB 2BX3A 2STAE 1Z8GA 1KY9A 3FANA 2STBE 2QXHA 2TBSA 3GYMA 4I8KA 1FAKH 1IQEA 1C5QA 1BRBE 2ALPA 1MQ6A 3QX5H 1VKYA 4Q2KA 2OC7A 1YGCH 2LP6A 2WPDD 3ZVBA 1QBOA 3PMBB 1KTTB 1FY1A 1XXDA 2Z9IA 1MABB 1ABJH 1DUEA 2BZ6H 2XXLA 3RC4A 1O2OA 1MD8A 1F0TA 1O3NA 1SVPA 1HAOH 1DT2A 2FI3E 1NZQH 3N99A 3M3TA 3TLOA 1ANDA 1FI8A 3M5MA 2BMGB 2I6SA 2VIDA 2BXUH 1K1MA 5K0HA 3RXOA 5K7RA 1WXRA 4UEHH 3MMGA 2AGIX 2BLOA 1P2IA 2VWOA 1SGRE 4K8BA 3UR6A 3TVJB 2PGBB 5EQSA 1W3CA 4YO9A 2SNWA 3OE7D 1H8IH 1M9UA 4XBCA 1GBIA 4INLA 2PLXA 2EC9H 1KIGH 3MU1A 2J9NA 4VGCB 1GHYH 1Y8TA 2NU2E 3OYPA 1NC6A 3RXRA 1EPTC 1V2VT 1O5GH 2GD4B 2VVUA 1P10A 3DT0H 4ISNA 2AIPA 4Q7XA 4TWYA 3TJUA 1LHCH 4AC9A 5C2ZA 4I33A 1HAXB 2AMPA 3UY9A 1SOTA 2XC5A 1T31A 2JKHA 3FN8A 1WTHD 5E2OA 4CRGA 5H4IB 1UCYE 2HNTE 4UFFH 4U32A 5F8TA 1GI2A 1OPHB 1LDTT 4IN2A 1ZGIA 2UUKB 5E2PA 1HAIH 3U98H 2VIQA 3PROA 1AI8H 1EJAA 1UTKA 3SO3A 2ZPSA 1KYNA 5E0JA 1DVAH 3VGCC 1ZTKA 3UR9A 1CA8B 3ZVEA 1VGCC 3SI3H 3MWIU 1O3KA 2ZPRA 3MOCA 2GV6A 5JB8S 1BBRH 3OEHD 2F91A 2Z9JA 3RMOH 2ESTE 1HAVA 3ZVDA 1C2EA 1V2JT 2KCAA 5F8XA 4YOGA 2ZPQA 4XE4A 1FJSA 2HLDD 1GWAA 3BN9A 1IQJA 3N7DA 3PRDA 1LHGH 2Q6FA 1INCA 1J16A 2HVYB 1AUJA 4B73A 4H6SB 1BZXE 2FZZA 1NY22 2F9UA 4UFGH 2BVXH 8LPRA 2WV5A 1NFYA 5DGJA 2RA3A 2GGVB 3F9FA 1HAYB 1ABIH 2SNVA 1KMHB 1MTWA 4AZ2B 1Q2WA 1F5KU 1SMFE 2ZIQH 3SNBA 4LZ1H 4JK6A 3E6PH 4KGAA 2FOHA 4BAOB 3P8GA 5LPFA 1E38B 2ZGCA 3DD2H 3BIUH 3SNEA 4ZKSU 2O8UA 2BD5A 1TOMH 5JDUB 5DP3A 1P2QA 4X8VH 3S9BA 4Z6AH 1W8BH 1O5EH 2XCNA 3M5NA 4DW2U 1DY8A 3RDZA 2H2ZA 2FIRH 1P3CA 1K1PA 4DJZB 1LVBA 5CHAB 1LHEH 1DSUA 3U8OH 3SW2B 2ZNKH 3TU7H 1TNHA 1MZAA 1C2IA 4RT1A 1V2KT 4XD7D 5T1VA 3A88A 3P70B 1EZXC 1YPMH 2BDYA 1EATA 2QXJA 3Q3YA 1L1JA 4MNVA 1C9TA 2CMYA 3Q77A 2HNTF 2ZFFH 5FX5A 1XVOA 3A85A 3HATH 2ZFSA 1GDNA 1TNLA 3HKJB 1O2SA 2VWNA 2P8OB 3M61U 1P2OA 2TIOA 4U2WA 2VWMA 3SJ8A 1GCTC 5BPEA 3RXGA 3ZZ8A 5F8ZA 1GI4A 3F9EA 1O3MA 4UONA 4X6NA 5A0CA 4U01A 3SQEE 4GAWA 1P05A 3KCGH 1WQVH 5HIYA 1IQMA 1O5FH 1TPPA 2L74A 3DFLA 3ZZBA 2OQUA 2QF0A 1OWKA 1PPFE 4YOIA 3P8NA 3TGKE 1D3QB 1PYTD 2EI6A 2WPLS 3EA8A 3VB4A 4ZROA 3NUMA 3SHCH 4Q4LA 2B8OH 2W6JD 2QAAA 3M7QA 3RXCA 2J34A 5A09A 1C1OA 1OXGA 1THSH 1AE8H 2ZG0H 3SU4A 1GMCG 4RT0A 1TFXA 1OYTH 5EU8A 3VB5A 5EQQA 5AF9H 3FP7E 1TNKA 1UTQA 3SUFA 2FESH 4O3TA 3VB7A 3DFJA 1ESAA 1C5YB 1V2QT 3RM0H 1ZSJA 4OS1A 3KL6A 4WH8A 3BG8A 3RUOA 2BD9A 2P59A 4TSFD 1EZQA 1WBGB 3VFEA 1SGPE 5F6MA 1UCYH 1VITF 2ZECA 1G2MA 1NO9H 1ZJDA 4FXGH 1O5CB 1A5HA 4ABFA 1V2ST 2XCFA 1L0ZA 2H1UA 3CP7A 1FX0B 1RIWB 1C5VA 1Z7KA 2P93A 3C1KA 3L33A 3A81A 6CHAB 5FXLA 1P8VC 1AIXH 3SGBE 4THNH 5LH8A 2M2AA 3E1XB 3GOVB 2PKSC 5FBIA 1QBVH 1THPB 4YM9A 1HXEH 2FYRA 1V2WT 1YCPM 5JBCS 4FOUC 2ZHDA 2RCEA 3M36A 4X2VA 3S0NA 5GJ4B 1EPTA 4ZHMU 1CHOG 2BDIA 4CH8B 3URCA 2FLRH 1UVSH 2Y7ZA 1C9PA 1TBRH 2TGTA 1F5LA 1JBUH 2VIVA 4B1TA 3FZZA 3NK8A 4A1VA 1TABE 5HKKD 1UTMA 1O31A 1S6FA 4X1SU 5E0HA 2W7UA 3Q00A 3GDSA 3WWBA 1EAWA 3U8TH 1HGTH 5BRRE 4HGCA 1E79D 1C5RA 2Z7FE 1HFDA 1K1IA 1MTSA 3DA9B 4I8GA 2BD8A 1C2KA 1SLUB 4O03A 3UOUA 1Y3YA 4WVPE 1FPHH 2D8WA 1L4DA 2FODA 1G2LA 2BDHA 1NBMD 1TE0A 2AMDA 5ESTE 1SHYA 1TALA 2FOFA 2F9OA 2PW8H 1NROH 5HMAA 1K21H 2BOHB 1EPTB 1SQAA 1GJCB 3GCTG 1BRUP 4R0IA 3OY5U 2ANWA 3ATWA 2FS9A 1GMDF 1XMNB 1UVOA 4ABHA 2TRMA 3GCHC 5EQRA 3LC5A 1AY6H 4P00A 1ZSKA 2D1JA 4RSPA 2C90B 1MTNB 2Z9LA 1C1UH 3TITA 1F0SA 3D49H 3LOXA 2FI4E 1CA0C 1TOCB 1ZMNA 4A1XA 1MMJN 1QRWA 3FP8E 3SJKA 2QF5A 2KR7A 3OX7U 2R0KA 4BAMB 1J17T 2ZTXA 4OS7A 3CENA 4HTCH 1NESE 4JZFH 2SGQE 1BJUA 1UTLM 1V2RT 1NFUA 5DP8A 2CGAA 1TX6A 1N1LA 1TPOA 3ZV8A 1Y5AT 5CMXH 1EKBB 2GV7A 3B8JA 1PJPA 3SNDA 4BXSA 2NU3E 1CT2E 3LIWA 2GCTB 1PFXC 3HK6B 4NWKA 3RMNH 1AMHA 3RXLA 4MG3A 3FKSD 1K1NA 3SV9A 1NFWA 2WPJS 1O35A 5L30H 2G8TA 4NIXA 5L2ZH 1HAZB 1MKXH 3LC3A 3MFJA 1EQ9A 3WW7A 5JBAS 3GY8A 1MCVA 1BMAA 1G9IE 3TIUA 5FCRA 1A5IA 1C2MA 4OS2A 4ABAA 5EG4A 4ABEA 4X2WA 4NA8A 3EGKH 1YC0A 4DOQA 3F1SB 4B75A 7GCHF 5CE1A 4AFZA 1S0RA 1YLCA 1QRXA 4MPUA 2BY5X 4F48B 1C5OH 3D65E 2OCVB 1PPCE 3FP6E 1YKTA 1G37A 3OY6U 1ELDE 3I78A 2AS9A 2HPPH 1QL9A 1ELGA 1SGNE 2Z9KA 4RKOB 3BTEE 4ABIA 3BTME 2W26A 1WYKA 4NIYA 2NU4E 3KQCA 2BYAX 1EZSC 3BEFB 3ZZAA 2Z6BD 3GCNA 2XBWA 5FPYA 1GL1A 3SU0A 1BRAA 2SGEE 4JZ1A 1UVUH 2QF3A 1F0RA 2XNIA 3SV6A 1GMCF 4OS6A 1DY9A 1OS8A 3KYGA 1CO7E 1NFXA 1H8HD 4CHAC 2A4RA 2JDID 3T26A 4KTUA 1W0YH 2WPKS 1BRCE 4ZXXH 4RKJB 1WSSH 1ETRH 1BMFD 1KXEA 4FUIA 3A7YA 2XYAA 1WU1A 3AASA 1HYLA 4X8UH 1GCTB 5AHGH 4B76A 3RU4D 1V2TT 4JZDH 1TGTA 2V7QD 1HXFH 1KXCA 3QTVH 2OTVA 1EAUA 3MNCA 1LHFH 1P2JA 4AGJA 1VGCB 1XKBC 2J5UA 1TGCA 1FY3A 2OK5A 5C20A 3KIDU 1JWTA 2XNDD 1WV7H 2VH6A 1D3TB 2ZI2H 5GIBA 2WPIS 2CF9H 1T4UH 1AQ7A 1EOLA 1T8LA 3G01A 1CE5A 2VBCA 5TJXA 1T32A 3GDVA 1YM0A 4FVDA 1TQ0B 3S7KB 1TMBH 4K1EA 3R0FA 1GPZA 1CHGA 3FVFB 1GMHG 2ALVA 4K5ZA 2H9TH 3ZV9A 1OP2A 4DIIH 2RA0A 3AW0A 1KLIH 4X1PU 3U69H 5DP4A 1ZTLA 4U30A 2QF4A 1ELBA 1A7SA 3DSPA 2PGQB 4FVBA 1QTFA 1TQ7B 4MNXA 3TH2H 2SGDE 1QNJA 1O3HA 2JETC 2ZDKA 2GDDA 4RI0A 4A1TA 1CHOF 2KCYA 3A80A 3MNSA 1ACBE 1O3EA 4X2XA 5DO4H 3GY5A 1DWCH 1A5GH 1HDTH 2G4TA 3ZZ5A 4WF8A 3MNXA 1GGDC 1PPBH 5C5NA 2G55A 2BLVA 5JBBS 3QN7A 3TJNA 2B0FA 1V2LT 2FPZA 3HGPA 1ARBA 1YCPH 2JJ2D 3M5LA 2ZU2A 1T8NA 2UUFB 3P6ZB 4IC5A 5HGGA 3ZZ3A 3PV5A 4MPVA 1C5SA 3SZEA 3UQOA 2ZKSA 2XC0A 1GJ4H 2G51A 2XOKD 3VPKA 2FWWA 1C1RA 2L6OA 2NU1E 2B5TB 2ZC9H 4D7FA 4I8JA 2P8OC 4D9RA 3LPRA 3PWBA 2ZDMA 2QXIA 2QYIA 4DG4A 1LCYA 3UNQA 3SU1A 3EQ0H 4E06H 4LXBH 4O9VA 3RU4E 1E1RD 3ATLA 3KF2A 1L1NA 2YMSB 5AFYH 1SGQE 2HGTH 1VJAU 3VXEH 4AOQA 4X6OA 2FX4A 2G52A 4FU9A 1A46H 1S84A 1Y3VA 1PQ8A 1ZHRA 1TMTH 4Y79A 3WWFA 1KSNA 9ESTA 1GMDG 1YPLH 1GVKB 1YYY1 3IG6B 3QGJA 2UUYA 2BVSH 1EXFA 1SI5H 1IQGA 1UO6A 2WYGA 1UMAH 3MO9A 4WY3A 3URDA 1O2MA 5EXLA 1S82A 4B2CA 2A32A 4NZLA 1WCZA 1N8OB 1T7CA 2C3SA 2IJD1 1Y3XA 1GVLA 2J95A 2UWOA 3TH3H 1IQIA 3PTNA 4TY7A 1QCPA 3QGNB 1P11E 1O3AA 1TGSZ 2BD4A 3U1JB 2HLCA 5C5OA 3K2UA 5FHTA 4X1NU 4JZEH 3E16B 1ZHPA 2PFEA 1AVXA 1SGTA 1GI5A 1J8AA 1TX7A 4XBDA 4AORA 3GY4A 4A5TS 1WAYB 2WPMS 7LPRA 1ZPZA 3LJOA 4DT7B 2ZU4A 2TGPZ 3MU4A 3SUDA 5DN6D 3EA7A 3NZIA 3PMJA 4WMFA 1FLEE 7KMEH 2FOCA 1GJAB 2Y5FA 2PUQH 1RIWC 3RXDA 2CHAC 1OOKB 1LQEA 2FO9A 3QTOH 1E1QD 1K22H 2VIPA 2XTTB 4AFSA 4GLYA 3RXJA 1G30B 4XSKU 1O2PA 1QB9A 2YOLA 1S85A 3RXTA 1P09A 1WTGH 3KQDA 1O3FA 1EB1H 2ZFRH 1P12E 1YF4A 1QA0A 5TCCA 3UWIA 8GCHG 4NG9H 4PROA 1FNIA 1XUHA 3RXVA 1EZUC 1UTNA 3AVZA 3D62A 3D23A 3E8LA 5KECA 2KM0A 1A1RA 1D3PB 2R3UA 1HAVB 2V35A 3BTDE 5EJZA 2GCTC 1K1JA 5HM9A 2HVXA 1W0ZU 4FUBA 4Y0YE 1B0FA 4ZKOU 2BOKA 1SL3A 2Y80A 1ANEA 2CJIA 2J38A 1KDQA 3ENSB 2AEIH 3OAAD 3RM2H 1CGHA 2YNAA 2FX6A 1GHAG 3E90B 1AB9B 1LTOA 3O8DA 1V2NT 4FUCA 1TA6A 3RXAA 1H9HE 4YZUA 1JIRA 2ULLA 5EXMA 4LZ4B 1MKWK 4JYUH 3SU5A 4Y11E 2KAIA 1EB2A 3P8OA 2AFQB 1RFNA 3A7ZA 4I31A 3UWJH 2M5TA 3UOPA 3BTTE 3ZZ4A 2Z9GA 1S83A 4YT6H 1D4PB 5IK2D 5SGAE 2LNCA 2EQNA 3MQKC 1GJBB 3ZZ9A 2ZF0H 3LGYA 2QXGA 2WSSD 1HAGE 5ETXA 5G4BA 3ZVFA 2SGFE 2QIQA 1F0UA 1L2EA 4WMEA 2ZU5A 4KELA 1CQQA 2EY4C 1N6YA 2ANYA 4HI3A 1OWIA 4I86A 1NTPA 1W10U 2G00A 3AAVA 3SHAH 4FU8A 2A4GA 4OGYA 1ORFA 1MZDA 1KDQB 5IYTA 2C8XB 4XOJA 1HJAB 1UTPA 4TPYA 1O0DH 2F43B 3MNBA 2A7JA 4Y0ZE 4CRFA 6GCHF 1C4Y2 1V2OT 1OP8A 3UREA 1BIOA 1FAXA 1TIOA 1V3XA 3BTGE 1CA0B 4WXVA 3DUXH 2FOEA 4SGBE 2Y5HA 3RXMA 1D9IA 3BV9B 4NSVA 3K9XB 1AFQC 2XBYA 2J94A 3RXHA 2A4OA 2YNBA 4JMYA 2DE9A 4E05H 1O37A 4ASHA 3PYHA 2G5NA 4BANB 4D9QA 1G3BA 2BY8X 2VGCB 2QA9E 1Z6JH 3GS9A 4JK5A 1N8OC 1O3CA 2CN0H 4B2AA 4TPIZ 2GT7A 1DM4B 3VB3A 4DURA 1ZLRA 2G5VA 4XBBA 3PO1C 3KYFA 3F3BA 1O3PB 1PYTC 4YLUA 1MTUA 3BTWE 1GBTA 1SGEE 1BTYA 1C5NH 1D6WA 1P9UA 2WZQA 2O8MA 3K6YA 3PM3A 1DS2E 1GI1A 3F9GA 1W13U 1BA8B 7GCHG 1DLEA 4K3JA 1NRSH 5C17A 4TWWA 1VCWA 1O3DA 2OBOA 2I6QA 1GHAF 3CNRA 4Y8ZA 1ZMLA 1SLVB 3A8CA 2VIWA 2GP9B 1IQKA 2CK3D 1ETSH 2GKVE 2PUXB 1DPOA 1IHTH 4AX9H 1IQNA 4AG2A 3TK5A 1RD3B 1TPAE 4AG1A 4IBLH 1ELEE 1X7AC 5L2YH 1GBDA 1GG6B 4WXIA 1P03A 2H9HA 1V2MT 4ZH8A 1OHHD 2WUBA 2C4FH 1PPZA 4SGAE 4DT4A 1HJ8A 4MLFB 3AK5A 1GDQA 5EXNA 3T27A 3RLWH 1IAUA 3PRBA 1EUFA 1F7ZA 1TWXB 2BLWA 1O3GA 5ESBA 3A8DA 1G3DA 4NFEA 1CT0E 3LT3A 2P94A 2ZDVH 1TRNA 1XUKA 3ZZCA 4AN7A 3OU0A 3PB1E 2ODQA 3ZVAA 4AB8A 5J4QA 4K8YA 2H9EH 1ZGVA 3A89A 4ZMAH 3U1IB 4FUJA 1QIXB 3RXQA 4ZUHA 1GBKA 3LGWA 4JCNA 3M3SA 3GCTF 2KCOA 3ODFA 1P04A 2ZCLP 2RDEA 5I25A 3F2FA 5EODA 3QUMP 3NWUA 8ESTE 5LPRA 3H09A 1BDAA 1W0JD 2ZHEH 1SC8U 1O2XA 1THRH 2GCHF 5C0TA 4NSYA 1SGYE 3PWCA 1E37B 2ANKH 4RN6A 4O3UA 2W6ID 1HCGA 3MU8A 4X6MA 1QJ7B 1O34A 3SJOA 4F55A 1DOJA 1QL7A 1C1MA 4B6EA 3E0PB 2Z3CA 1S6LA 3QZRA 2OP9A 5HXFA 1DE7H 2ZCHP 2ZQ2A 1Y5BT 4CRBA 5A8ZA 2ZTZA 1VR1H 1ELFA 3TGJE 1C2FA 4H42U 5C0UA 3VB6A 1MQ5A 1GDUA 1BMNH 1Y3WA 1XUJA 1XVMA 1KLTA 4NCYA 1CBWB 2A0QB 1BOQA 4DY7B 4J2YB 1A0LA 5JPMH 1LMWB 3SGQE 4KP0A 1AZZA 3KQ5A 1J15A 2BDCA 4ISHH 3FFGA 5FX6A 4X1RU 3KGPA 3U8RH 3RMMH 2BDBA 3MH6A 3KNXA 1IQFA 1QL8A 2ZZUH 2O8TA 2BY7X 3UPEA 2BLQA 5IDKA 1O5AB 5GCHG 2HPQH 2WV4A 4MTBA 3UB0A 2Y6TA 1W0KD 1F92A 1YPHC 1QQ4A 3SQHE 2JIZD 3RC6A 1YBWA 4QT8C 1SBWA 3ATIA 1OSSA 1PQ5A 3FAOA 1OWDA 3EAJA 1QB6A 2GJGA 1SLXB 5GPIB 1MBMA 1BJVA 1O2KA 1D6RA 3GY2A 1O2YA 3F0OA 1A3EH 2YMSC 3SU6A 1TBZH 3SUGA 1HIAB 1GHXH 6ESTA 1CSOE 1B5GH 2PV9B 2ZFQH 4TY6A 1O3LA 5I46H 1VITG 2A2QH 1QRZA 2QN5T 1JRTA 3OSYA 4BAHB 4X1QU 2LPRA 3ITIA 1MTVA 1SQRA 1NRQH 1VCQA 4B6FA 1ZPCA 1GI7B 1EASA 5C94A 1O2ZA 1C1VH 2CV3A 1O32A 1FIZA 1JXPA 4NWLA 4O97A 4ZKNU 1JOUB 3FZDA 3DSGA 2PTNA 2JH5D 1QHRB 2WPHS 1FN6A 2ZFTA 2W7SA 2ZGJA 3DSOA 1RJXB 3LH1A 4XRNA 2NWNA 4TYDA 3P95A 1VZQH 1AVWA 2KFWA 1ELAA 2FLBH 3RC5A 5FCKA 1C5LH 2J2UA 4A6LA 1ESTA 4XDEA 3QWCH 1K0HA 1FDPA 5A2MH 2C8WB 1RTLA 4P02A 4M7GA 3S9AA 1HJAC 3TK6A 4CBNA 4X2YA 2XBVA 2KAIB 2W3KA 1HB0B 1GI3A 2XWAA 1ETTH 1YPKH 4WWYA 1GBFA 1WDIA 1Z1IA 2QC2A 1GHBG 1MU6B 1SGFA 4I8LA 3Q76A 2BD7A 1GBLA 1QR3E 1GHBF 1GHZA 1BTHH 1OWEA 2KZ4A 3MO3A 2O9QA 2UUJB 4INHA 1T4VH 1GJ6A 1AWHB 1MAYA 3NKKA 1XUFA 5GWZA 4MVNA 1PPHE 2VGCC 3EYDA 2ZWLH 2ZDLA 3V13A 2FP7B 4KTSA 4ISIH 3ZVCA 5A8YA 2VU8E 3BEUA 2YMSD 5E0GA 1JMOH 1SQTA 2PSXA 1AU8A 1GJ5H 1O39A 1P01A 1N6XA 1DUAA 5L6NH 1XUGA 4NIVA 4OGXA 3MYWA 2ZU3A 4ISOA 4NZQA 2FYQA 1DXWA 1F2SE 1AVGH 1QBNA 1BMLA 1FPCH 2GDEH 5HIZA 2GTBA 2PSYA 1ELCA 3EDXB 3RXFA 1SFQB 1J14A 4HG6A 4DIHH 4IN1A 1UK3A 1C5XB 5DP7A 6CHAC 2V6NA 1UVTH 2BQ7B 1O3JA 1C1WH 4BAKB 2IJOB 2FXRA 2PKSB 2AYWA 1VCPA 5EGMA 3UNSA 1RTFB 1UHBB 2Z3EA 1AKSB 2A45B 1EOJA 4Q7ZA 4MPXA 5C1XA 3B9FH 4KTCA 2ZDAH 1C5MD 3Q3KA 3QK1A 4H6TA 1KXAA 2A5IA 5EOKA 1A4WH 1YCPK 2D26C 4FU7A 3V7TA 1GI9B 3ELAH 2WUCA 2WV9A 1KTSB 1LPGB 3FOAA 5EW2H 3F2HA 5PTPA 1P06A 2A5KA 3MHWU 3PMHB 5CDFE 7ESTE 1QJ1B 1TX8A 2P95A 2CXVA 2Q1JA 3DHKH 3SJ9A 1IQHA 1AFQB 3W95A 1TGBA 2PR3A 2F9BH 1O36A 1YLNA 2F9VA 2TGDA 4IMZA 2V3HH 1SGIB 3A86A 2O8WA 2AGGX 1TRYA 1HRTH 1YPHE 1C5TA 3RXUA 1W7GH 1FMGA 5FAHA 1BTWA 1EP5A 1EP6A 1UVPA 6LPRA 1XXFA 3KEEA 1WQSA 2ZGBH 1SGFG 3A7VA 3LGVA 4NFFA 1KXDA 4B2BA 3FO8D 3K6ZA 1NN6A 1DANH 2VB0A 3V3MA 1GBMA 1P9SA 2EI8A 2GCHG 1BTZA 1C1NA 1UJ1A 2IPQX 2UWLA 1O2HA 3A82A 1O5BB 2H5DA 3EE0B 4AYYB 2VVVA 4K69A 4YTAA 1ZZZA 3GY7A 2OLGA 1AHTH 1BITA 1H8ED 1GBBA 1P2NA 4Y7AA 1GBCA 5LPEA 3MO6A 2Y81A 3A7XA 1DSTA 1LKAA 1MTNC 5AFZH 5JB9S 1O2JA 5F53A 4E7RG 2ASUB 2BM2A 2FM2A 2WHXA 3U28C 1ZR0A 1RS0A 1V2UT 3JZ2B 4YLQH 4ABDA 4B74A 2RFKC 2Z94A 5GNDA 1AO5A 9LPRA 1AUTC 2HWLB 4MQAA 1GBJA 4Y10E 2JH6D 1DFPA 2BB4A 1YPEH 1CBWC 3JZ1B 2ZGXH 1DICA 4JYVH 2AIQA 3SNAA 3T29A 1SLWB 1A61H 3GICB 4I8HA 1TRMA 2XW9A 1HAPH 4K1SA 5C3NA 4GCHG 2ODPA 4ASUD 3SV8A 1BCUH 1QQUA 2P3UB 5EPYA 3MH4A 1OWHA 3NPSA 1D3DB 1SG8B 4Z1MD 1EJNA 1XUIA 5FPSA 1L4ZA 1BQYA 2VJ1A 1RXPA 4D7GA 5DSFA 1HV7A 2GMTB 3WY8A 3RXBA 1S81A 1GI6A 2FOBA 4K1TA 1GBHA 4CRCA 3SJIA 2QCYA 3K65B 2KCPA 3L3TA 3TK9A 4CR9A 1QY6A 1QZ8A 4GUXA 3IITA 5C1UA 4Y71A 3ZIAD 1BB0B 1O2IA 1OP0A 1DITH 1QFKH 2V3OH 1O38A 2R2MB 2FOAA 3BF6H 1E0FD 3MU5A 2J97A 1O3IA 2VWLA 2H5CA 2J98B 2ZEBA 1K1LA 1C4U2 3QDZB 1YP9A 5KEDA 4Y6DA 1SOZA 1O33A 1NU9A 1O3BA 1UW7A 4X0WU 2H6MA 1IOEA 2BX4A 3UFAA 3CS0A 2OXSA 1O2GH 3S69A 1ZSLA 1DX5M 4BTTB 3S9CA 1LVOA 2OC8A 1BTUA 3PV2A 5B6OA 2BQWB 1PQ7A 1W11U 2JH0D 3SZNA 1EX3A 3AAUA 1TLDA 1LPKB 4CBOA 1K9OE 2BD2A 1H9LB 2IPHA 2J92A 4F49A 2ZA5A 3CS7A 1XKAC 5F03A 2AGEX 1ELTA 1H8DH 3HKIB 3TNTA 3RXEA 4LOYH 3H7TA 4CHAB 3ESTA 5EJ1A 2SGPE 3TGIE 3GDUA 4GSOA 1W14U 2GVFA 1EJMA 2FTLE 3T28A 3BTFE 1ZTJA 4ESTE 4Q80A 4IW4E 1GBEA 1W7XH 5LGOA 3TH4H 3M35A 2ODYB 5DP5A 1CGJE 2JJ1D 1BHXB 2EEKA 1Y59T 1E35B 5DP6A 1O2UA 3TJOA 2F9NA 1L1GA 3BTQE 1DLKB 3UIRA 1DWDH 4JZIA 1ANBA 2OQ5A 1G36A 4HFPB 2J98A 1ESBA 5EW1H 1O3OA 4MNWA 2PKAA 5DK1A 4MNYA 1DDJA 4CRAA 1MU8B 3H5CB 1MUEB 1SKYE 2BXTH 1RTKA 2EI7A 2F83A 3T2NA 3UNRA 4OM9A 4INKA 1BBRE 2VIOA 2VH0A 3TJVA 4OS5A 2C8YB 1UTJA 2BDAA 5C67A 3V0XA 1HUTH 3OFND 1Z8IB 1NRNH 1Q3XA 3LGIA 4Z0KA 2ZQ1A 5J4SA 1O2VA 1FN8A 1LO6A 1C2DA 2WINI 4IC6A 1Z8JB 2KX4A 1SGCA 4ZCNA 4FUFA 1TYNA 3QLPH 2G81E 1OKXA 1GCDA 2W3IA 4YOJA 3EA9A 3OTPA 1GJDB 3SUEA 3SOSA 3KQBA 3BG4B 2C93B 1UCYK 3BTHE 2GZ7A 2Y82A 2Z3DA 4ZAEA 4BNRA 4F4OC 2GZ9A 1NBME 1GJ8B 1VITH 3F0PA 3STIA 1AWFH 5FPTA 1H1BA 4GVUA 1G3CA 1ID5H 4H4FA 2PHBA 4CH2B 4Y7BA 1YPGH 4CREA 1C1PA 5FL7D 5EIYA 3IWMA 1GGDB 1ZRKA 1T8MA 1ARCA 4IMQA 4JYTA 2Y5GA 1SHHB 2A5AA 4AYVB 2F4LA 1RGQA 4Y8XA 4X8SH 2VINA 3W1EA 1MCTA 4GCHF 3ATKA 2ZHWH 4K2YA 3UQVA 2K8IA 2P3FH 2ZP0H 2GMTC 3GY6A 1UHBA 4I32A 3PLKA 4X8TH 5E8EH 1TPSA 3LU9B 1O2TA 3SU2A 3T62A 1DWBH 4FUEA 1H9IE 4BTUB 1CT4E 1WUNH 1Z1JA 2V0BA 4WJG2 1ZRBA 4XFQA 1MBQA 1Z8RA 1BTXA 3HGNA 4NGAH 4UE7H 1AZ8A 3ODDA 4KKDA 3NRLA 1P57B 4DCDA 4GHQA 2A7HA 3PLBA 2FOMB 3SGAE 3MI4A 5DG6A 1S0QA 3RXSA 3F9HA 4J1YA 1C2HA 1COWD 2SGAA 2OINA 1CGIE 5TCAA 4AFUA 5ABWA 1S5SA 2NU0E 3ZYDA 2DUCA 1NRPH 1YWUA 1YPJH 2QY0B 2A4QA 3C27B 4CR5A 1W12U 1ZOMA 3PTBA 2ZHFH 1C1TA 4NA9H 2A7CA 4ACAA 1TA2A 1T8OA 4ZKRU 3SYJA 1HBTH 1B7XB 3ZZ6A 1MAXA 1AD8H 4BTIB 1PPEE 1BTPA 3P8FA 2BZAA 2ZGHA 1FZZA 3PMAB 3RMLH 1FONA 2LELA 1P0SH 1A0HB 1PPGE 1E36B 2Q6DA 3KHVA 1O30A 1ANCA 3MU0A 1HLTH 1C1SA 4LK4A 4WH6A 2OC1A 1C5PA 5A0AE 1DWEH 4R8TB 1ZPBA 3U9AH 4E7NA 2P3TB 1QB1A 5DJ7A 1Q31A 2W5EA 1ZMJA 2C8ZB 3N7EA 2JETB 1LKBA 1DXPA 1NRRH 3L6PA 1AN1E 4FUGA 2Q6GA 4ABGA 2QV1A 4D76A 1V6DA 3UTUH 2FS8A 1KLJH 3NXPA 3N7OA 2FOGA 3W94A 2FMJA 3ATMA 3OEED 2PTCE 1NT1A 1HPGA 4ISLA 3STJA 2UWPA 1EFRD 1FXYA 2PWXA 3NCLA 2P16A 1K28D 2FI5E 3V12A 1JRSA 3SNCA 1ZYOA 2HNTC 5T6FA 1FV9A 4Y8YA 2A2XH 3VG8A 4ACBA 2SFAA 2IN2A 3PLPA 2R2WU 2VVCA 1BBRK 1LVMA 1UK4A 2ZCKP 3M7TA 1TGNA 5T6GA 3UAIC 1MKXK 5JBTA 3A7WA 3AW1A 1S6HA 2B9LA 2PKAB 1JIMA 1Y5UT 3LJJA 1GJ7B 2BD3A 1Z6EA 1O2NA 2AH4X 1LPZB 2RG3A 1C5ZB 3SN8A 3RP2A 1KXBA 1HAHH 2QE7D 4DVAU 1GMHF 1TBQH 2AERH 2XBXA 1O2LA 2Y7XA 5A0BA 3Q3XA 1PQAA 3E3TA 4ZXYH 4UFDH 2TPIZ 2XC4A 4AB9A 4D8NA
chains in the Genus database with same CATH topology
3A7TA 2ZFPH 5T6DA 2ANMH 1HIAA 1QA7A 2QGRA 4IS5A 4ZHAA 4GPGA 1Z71A 3LDXH 4YESB 4A92A 3O8CA 1QURH 5T3HA 3M37A 1C5WB 3TPIZ 2OUAA 1FQ3A 1A0JA 1QGFA 3SORA 1H4WA 2FDAA 2R3YA 2ILNA 3LGUA 5AVDA 2R9PA 1EAIA 3VGCB 1AGJA 3P17H 4B71A 2HALA 3MH5A 5DKMA 1MKWH 2CHAB 2K1QA 3MTYA 4GHTA 1UK2A 2F3CE 4DGJA 1XX9A 1W2KH 5GXPA 1AE5A 1FY4A 1GL0E 5DPAA 5FBEA 4IGDA 2J4IA 3E91A 1B0EA 4UDWH 3ZZ7A 1CVWH 1MH0A 1SR5C 3RU4T 4K60A 1TNGA 1LHDH 1BHXF 3B23B 3A8AA 1P2MA 2OD3B 3SV2H 1BT7A 1GJ9B 1VJ9U 4NA7A 2ZHQH 3BIVH 3A8BA 1BMMH 1SPJA 3SU3A 1AB9C 3H7OA 4ABBA 1OYQA 3HPTB 1A2CH 2HRVA 3I77A 1SSXA 2RDLA 3F68H 1V2PT 3F6UH 2BQ6B 3P92A 2O8LA 3R3GB 5CHAC 2F9PA 3RXIA 1TNJA 1J9CH 1GG6C 5GCHF 3M3VA 1TNIA 3GYLB 5HM2A 3TNSA 4ABJA 1O2WA 3LH3A 1NS3A 1UTOA 1QJ6B 3BSQA 3MH7A 1AKSA 2XWBI 1TMUH 3ZYEA 2ZDNA 1C2GA 1GHWH 3HK3B 2D2DA 4FUHA 4VGCC 8GCHF 1FUJA 1SB1H 1ZHMA 2XRCA 8KME2 3ZVGA 1MD7A 3VXFH 3BTKE 4AFQA 1OX1A 4CRDA 1FY5A 2HOBA 3PV4A 2ZO3H 1WOFA 3I29A 3M7UA 1ZJKA 4BOHA 2AMQA 1Y3UA 1BUIA 1SQOA 1GHVH 1NM6A 1P02A 1XM1A 1G32B 2OC0A 4HZHA 3LONA 2R0LA 2ZTYA 2EA3A 2BY9X 4AGKA 1C5UA 2BDGA 1HNEE 1C2JA 2BY6X 2WYJA 2IOTA 4X6PA 2BVRH 1K2I1 3RLYH 2GT8A 1GI8B 4BXWA 1GI0A 1LQDB 3E0NB 1YLDA 3UUZA 3T5FH 6GCHG 4I7YH 3LKWA 2ZU1A 4NIWA 1GVZA 2G4UA 4BAQB 3OTJE 2THFB 2TGAA 3BEIB 4Q7YA 2VNTA 3SV7A 3O8RA 1OWJA 3KQEA 4WMDA 4MDSA 3KN2A 3GCOA 2GZ8A 1U6QA 2B7DH 2BTCE 3BG4C 3PO1B 3RXKA 1P2KA 3LGTA 4OS4A 1CU1A 1P3EA 1AFEH 4A7IB 1NU7B 1LVYA 1O2RA 4FUDA 4ZHLU 1SGDE 2GX4A 3GCHB 3M5OA 1K1OA 2OBQA 1NPMA 2FEQH 3QO6A 4MPWA 5C1YA 1EAXA 1TAWA 3QZQA 5HYOA 2FTMA 1F5RA 1SFIA 3GY3A 5GDSH 3SBKA 2BHGA 1IQLA 3VEQB 4YT7H 4Y76A 1TB6H 1TONA 2DE8A 1A3BH 1HJ9A 1C1QA 1FIWA 2A31A 1E34B 1RRKA 3SI4H 5JYIA 3RXPA 1C2LA 4UD9H 4UFEH 3T25A 1KXFA 3O8BA 5DP9A 1O2QA 5EPNA 5A8XA 3A84A 1G3EA 1ELVA 3A87A 1GBAA 1C4V2 3A83A 1O5DH 1FY8E 3GISB 3S7HB 1IHSH 2CF8H 3ZZDA 2A1DB 2BX3A 2STAE 1Z8GA 1KY9A 3FANA 2STBE 2QXHA 2TBSA 3GYMA 4I8KA 1FAKH 1IQEA 1C5QA 1BRBE 2ALPA 1MQ6A 3QX5H 4Q2KA 2OC7A 1YGCH 3ZVBA 1QBOA 3PMBB 1KTTB 1FY1A 1XXDA 2Z9IA 1ABJH 1DUEA 2BZ6H 2XXLA 3RC4A 1O2OA 1MD8A 1F0TA 1O3NA 1SVPA 1HAOH 1DT2A 2FI3E 1NZQH 3M3TA 3TLOA 1ANDA 1FI8A 3M5MA 2BMGB 2I6SA 2VIDA 2BXUH 1K1MA 5K0HA 3RXOA 5K7RA 4UEHH 3MMGA 2AGIX 2BLOA 1P2IA 2VWOA 1SGRE 4K8BA 3UR6A 3TVJB 2PGBB 5EQSA 1W3CA 4YO9A 2SNWA 1H8IH 1M9UA 4XBCA 1GBIA 4INLA 2PLXA 2EC9H 1KIGH 3MU1A 2J9NA 4VGCB 1GHYH 1Y8TA 2NU2E 3OYPA 1NC6A 3RXRA 1EPTC 1V2VT 1O5GH 2GD4B 2VVUA 1P10A 3DT0H 4ISNA 2AIPA 4Q7XA 4TWYA 3TJUA 1LHCH 5C2ZA 4I33A 1HAXB 2AMPA 3UY9A 1SOTA 2XC5A 1T31A 2JKHA 5E2OA 1WTHD 4CRGA 5H4IB 1UCYE 2HNTE 4UFFH 4U32A 5F8TA 1GI2A 1OPHB 1LDTT 4IN2A 1ZGIA 2UUKB 5E2PA 1HAIH 3U98H 2VIQA 3PROA 1AI8H 1EJAA 1UTKA 3SO3A 2ZPSA 1KYNA 5E0JA 1DVAH 3VGCC 1ZTKA 3UR9A 1CA8B 3ZVEA 1VGCC 3SI3H 3MWIU 1O3KA 2ZPRA 3MOCA 2GV6A 5JB8S 1BBRH 2F91A 2Z9JA 3RMOH 2ESTE 1HAVA 3ZVDA 1C2EA 1V2JT 5F8XA 4YOGA 2ZPQA 4XE4A 1FJSA 3BN9A 1GWAA 1IQJA 1LHGH 2Q6FA 1INCA 1J16A 1AUJA 4B73A 4H6SB 1BZXE 2FZZA 1NY22 2F9UA 4UFGH 2BVXH 8LPRA 2WV5A 1NFYA 5DGJA 2RA3A 2GGVB 3F9FA 1HAYB 1ABIH 2SNVA 1MTWA 4AZ2B 1Q2WA 1F5KU 1SMFE 2ZIQH 3SNBA 4LZ1H 4JK6A 3E6PH 4KGAA 2FOHA 4BAOB 3P8GA 5LPFA 1E38B 2ZGCA 3DD2H 3BIUH 3SNEA 4ZKSU 2O8UA 2BD5A 1TOMH 5JDUB 5DP3A 1P2QA 4X8VH 3S9BA 4Z6AH 1W8BH 1O5EH 2XCNA 3M5NA 4DW2U 1DY8A 3RDZA 2H2ZA 2FIRH 1P3CA 1K1PA 4DJZB 1LVBA 5CHAB 1LHEH 1DSUA 3U8OH 3SW2B 2ZNKH 3TU7H 1TNHA 1MZAA 1C2IA 1V2KT 3A88A 3P70B 1EZXC 1YPMH 2BDYA 1EATA 2QXJA 3Q3YA 1L1JA 4MNVA 1C9TA 2CMYA 3Q77A 2HNTF 2ZFFH 5FX5A 1XVOA 3A85A 3HATH 2ZFSA 1GDNA 1TNLA 3HKJB 1O2SA 2VWNA 2P8OB 3M61U 1P2OA 2TIOA 4U2WA 2VWMA 3SJ8A 1GCTC 5BPEA 3RXGA 3ZZ8A 5F8ZA 1GI4A 3F9EA 1O3MA 4UONA 4X6NA 5A0CA 4U01A 3SQEE 4GAWA 1P05A 3KCGH 1WQVH 1IQMA 1O5FH 1TPPA 3DFLA 3ZZBA 2OQUA 2QF0A 1OWKA 1PPFE 4YOIA 3P8NA 3TGKE 1D3QB 1PYTD 2EI6A 2WPLS 3EA8A 3VB4A 4ZROA 3NUMA 3SHCH 2B8OH 2QAAA 3M7QA 3RXCA 2J34A 5A09A 1C1OA 1OXGA 1THSH 1AE8H 2ZG0H 3SU4A 1GMCG 1TFXA 1OYTH 5EU8A 3VB5A 5EQQA 5AF9H 3FP7E 1TNKA 1UTQA 3SUFA 2FESH 4O3TA 3VB7A 3DFJA 1ESAA 1C5YB 1V2QT 3RM0H 1ZSJA 4OS1A 3KL6A 4WH8A 3BG8A 3RUOA 2BD9A 2P59A 1EZQA 1WBGB 3VFEA 1SGPE 5F6MA 1UCYH 1VITF 2ZECA 1G2MA 1NO9H 1ZJDA 4FXGH 1O5CB 1A5HA 4ABFA 1V2ST 2XCFA 1L0ZA 2H1UA 3CP7A 1RIWB 1C5VA 1Z7KA 2P93A 3C1KA 3L33A 3A81A 6CHAB 5FXLA 1P8VC 1AIXH 3SGBE 4THNH 5LH8A 3E1XB 3GOVB 2PKSC 5FBIA 1QBVH 1THPB 4YM9A 1HXEH 2FYRA 1V2WT 1YCPM 5JBCS 2ZHDA 2RCEA 3M36A 4X2VA 3S0NA 5GJ4B 1EPTA 4ZHMU 1CHOG 2BDIA 4CH8B 3URCA 2FLRH 1UVSH 2Y7ZA 1C9PA 1TBRH 2TGTA 1F5LA 1JBUH 2VIVA 4B1TA 3FZZA 3NK8A 4A1VA 1TABE 1UTMA 1O31A 1S6FA 4X1SU 5E0HA 2W7UA 3Q00A 3GDSA 1EAWA 3U8TH 1HGTH 5BRRE 4HGCA 1C5RA 2Z7FE 1HFDA 1K1IA 1MTSA 3DA9B 4I8GA 2BD8A 1C2KA 1SLUB 4O03A 3UOUA 1Y3YA 4WVPE 1FPHH 2D8WA 1L4DA 2FODA 1G2LA 2BDHA 1TE0A 2AMDA 5ESTE 1SHYA 1TALA 2FOFA 2F9OA 2PW8H 1NROH 5HMAA 1K21H 2BOHB 1EPTB 1SQAA 1GJCB 3GCTG 1BRUP 4R0IA 3OY5U 2ANWA 3ATWA 2FS9A 1GMDF 1XMNB 1UVOA 4ABHA 2TRMA 3GCHC 5EQRA 3LC5A 1AY6H 1ZSKA 2D1JA 4RSPA 2C90B 1MTNB 2Z9LA 1C1UH 3TITA 1F0SA 3D49H 3LOXA 2FI4E 1CA0C 1TOCB 1ZMNA 4A1XA 1MMJN 1QRWA 3FP8E 3SJKA 3OX7U 4BAMB 2R0KA 1J17T 2ZTXA 4OS7A 3CENA 4HTCH 1NESE 4JZFH 2SGQE 1BJUA 1UTLM 1V2RT 1NFUA 5DP8A 2CGAA 1TX6A 1N1LA 1TPOA 3ZV8A 1Y5AT 5CMXH 1EKBB 2GV7A 3B8JA 1PJPA 3SNDA 4BXSA 2NU3E 1CT2E 3LIWA 2GCTB 1PFXC 3HK6B 4NWKA 3RMNH 1AMHA 3RXLA 4MG3A 1K1NA 3SV9A 1NFWA 2WPJS 1O35A 5L30H 2G8TA 4NIXA 5L2ZH 1HAZB 1MKXH 3LC3A 3MFJA 1EQ9A 5JBAS 3GY8A 1MCVA 1BMAA 1G9IE 3TIUA 5FCRA 1A5IA 1C2MA 4OS2A 4ABAA 5EG4A 4ABEA 4X2WA 4NA8A 3EGKH 1YC0A 4DOQA 3F1SB 4B75A 7GCHF 5CE1A 4AFZA 1S0RA 1YLCA 1QRXA 4MPUA 2BY5X 1C5OH 3D65E 2OCVB 1PPCE 3FP6E 1YKTA 1G37A 3OY6U 1ELDE 3I78A 2AS9A 2HPPH 1QL9A 1ELGA 1SGNE 2Z9KA 4RKOB 3BTEE 4ABIA 3BTME 2W26A 1WYKA 4NIYA 2NU4E 3KQCA 2BYAX 1EZSC 3BEFB 3ZZAA 2Z6BD 3GCNA 2XBWA 5FPYA 1GL1A 3SU0A 1BRAA 2SGEE 4JZ1A 1UVUH 2QF3A 1F0RA 2XNIA 3SV6A 1GMCF 4OS6A 1DY9A 1OS8A 1CO7E 1NFXA 4CHAC 2A4RA 3T26A 4KTUA 1W0YH 2WPKS 1BRCE 4ZXXH 4RKJB 1WSSH 1ETRH 1KXEA 4FUIA 3A7YA 2XYAA 1WU1A 3AASA 1HYLA 4X8UH 1GCTB 5AHGH 4B76A 3RU4D 1V2TT 4JZDH 1TGTA 1HXFH 1KXCA 3QTVH 2OTVA 1EAUA 3MNCA 1LHFH 1P2JA 4AGJA 1VGCB 1XKBC 1TGCA 1FY3A 5C20A 3KIDU 1JWTA 2ZI2H 1WV7H 2VH6A 1D3TB 5GIBA 2WPIS 2CF9H 1T4UH 1AQ7A 1EOLA 1T8LA 3G01A 1CE5A 5TJXA 1T32A 3GDVA 1YM0A 4FVDA 1TQ0B 3S7KB 1TMBH 4K1EA 3R0FA 1GPZA 1CHGA 3FVFB 1GMHG 2ALVA 4K5ZA 2H9TH 3ZV9A 1OP2A 4DIIH 2RA0A 3AW0A 1KLIH 4X1PU 3U69H 5DP4A 1ZTLA 4U30A 1ELBA 1A7SA 2PGQB 4FVBA 1QTFA 1TQ7B 4MNXA 3TH2H 2SGDE 1QNJA 1O3HA 2JETC 2ZDKA 2GDDA 4A1TA 1CHOF 3A80A 3MNSA 1ACBE 1O3EA 4X2XA 5DO4H 3GY5A 1DWCH 1A5GH 1HDTH 2G4TA 3ZZ5A 4WF8A 3MNXA 1GGDC 1PPBH 5C5NA 2G55A 2BLVA 5JBBS 3QN7A 3TJNA 2B0FA 1V2LT 2FPZA 3HGPA 1ARBA 1YCPH 3M5LA 2ZU2A 1T8NA 2UUFB 3P6ZB 4IC5A 5HGGA 3ZZ3A 4MPVA 1C5SA 3UQOA 2ZKSA 2XC0A 1GJ4H 2G51A 3VPKA 2FWWA 1C1RA 2NU1E 2B5TB 2ZC9H 4D7FA 4I8JA 2P8OC 4D9RA 3LPRA 3PWBA 2ZDMA 2QXIA 2QYIA 4DG4A 1LCYA 3UNQA 3SU1A 3EQ0H 4E06H 4LXBH 4O9VA 3RU4E 3ATLA 3KF2A 1L1NA 5AFYH 1SGQE 2HGTH 1VJAU 3VXEH 4AOQA 4X6OA 2FX4A 2G52A 4FU9A 1A46H 1S84A 1Y3VA 1PQ8A 1ZHRA 1TMTH 4Y79A 1KSNA 9ESTA 1GMDG 1YPLH 1GVKB 1YYY1 3IG6B 3QGJA 2UUYA 2BVSH 1EXFA 1SI5H 1IQGA 1UO6A 2WYGA 1UMAH 3MO9A 4WY3A 3URDA 1O2MA 5EXLA 1S82A 4B2CA 2A32A 4NZLA 1WCZA 1N8OB 1T7CA 2C3SA 1Y3XA 1GVLA 2J95A 2UWOA 3TH3H 1IQIA 3PTNA 4TY7A 1QCPA 3QGNB 1P11E 1O3AA 1TGSZ 2BD4A 3U1JB 2HLCA 5C5OA 3K2UA 5FHTA 4X1NU 4JZEH 3E16B 1ZHPA 2PFEA 1AVXA 1SGTA 1GI5A 1J8AA 1TX7A 4XBDA 4AORA 3GY4A 4A5TS 1WAYB 2WPMS 7LPRA 1ZPZA 3LJOA 4DT7B 2ZU4A 2TGPZ 3MU4A 3SUDA 3EA7A 3NZIA 3PMJA 4WMFA 1FLEE 7KMEH 2FOCA 1GJAB 2Y5FA 2PUQH 1RIWC 3RXDA 2CHAC 1OOKB 1LQEA 2FO9A 3QTOH 2XTTB 1K22H 2VIPA 4AFSA 4GLYA 3RXJA 1G30B 4XSKU 1O2PA 1QB9A 2YOLA 1S85A 3RXTA 1P09A 1WTGH 3KQDA 1O3FA 1EB1H 2ZFRH 1P12E 1YF4A 1QA0A 5TCCA 3UWIA 8GCHG 4NG9H 4PROA 1FNIA 1XUHA 3RXVA 1EZUC 1UTNA 3AVZA 3D62A 3D23A 3E8LA 2V35A 1A1RA 1D3PB 2R3UA 1HAVB 3BTDE 2GCTC