3A86A

Crystal structure of trypsin complexed with (e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 30 seconds)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a86A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a86A02
3LKWA 1ZOMA 1ELCA 4GVUA 3RUOA 3A86A 2GZ8A 3TVJB 3VGCC 1BJVA 4IN2A 1D3QB 1AWFH 4BAMB 2QXJA 2FLBH 4K60A 5JBCS 1KXCA 2O8MA 1C1TA 3SV8A 1P04A 5AHGH 1O38A 4BAKB 3QGNB 1IQJA 1JWTA 5C5OA 1AFQC 2C4FH 3SJKA 6GCHG 1DSUA 2FX4A 2ANWA 1BOQA 4JZFH 4XOJA 1Q3XA 3TK5A 1Z8JB 1P03A 5DP7A 3SHCH 1O5EH 2FM2A 3Q76A 4FUCA 2ZC9H 1EASA 2OBQA 3O8DA 1TB6H 5HXFA 4AZ2B 4YESB 5BPEA 1HAIH 1TPPA 5ETXA 1P02A 5EQRA 1GVZA 1C2JA 1LDTT 5TCCA 1GHZA 1GBCA 3A8BA 5EXMA 1C5VA 1CA8B 3K2UA 4U01A 4I8GA 4GCHF 5FXLA 2EI6A 3T2NA 3GCNA 3MYWA 1C1WH 3A7WA 5A2MH 2CN0H 1K2I1 3RMNH 2ZF0H 3CS7A 4BANB 1C1NA 3SNEA 3EGKH 1O3MA 1K1OA 2QIQA 1ESAA 8GCHF 3ODFA 3RXDA 2HNTF 1PPZA 1BUIA 1GBAA 2FP7B 4GUXA 2BDHA 3O8CA 2TPIZ 3SJ9A 1GCTC 1FAKH 1L1GA 2XWAA 1AIXH 2FEQH 3SV7A 1BMMH 1SPJA 4YLQH 1GJ5H 3M7UA 2A7JA 5C67A 1AWHB 4BTUB 1C1SA 1TBZH 2B7DH 2ZECA 1FLEE 4A1VA 1UTMA 1MTUA 1GBEA 1O32A 2BB4A 2PTNA 1YP9A 3KHVA 2A4QA 2AMPA 2QY0B 1DM4B 1C2GA 2RCEA 2O8WA 3D62A 3K9XB 1SGFG 2AIPA 1N6XA 1O3GA 2Y7ZA 3KF2A 1K1IA 1SOTA 2O8LA 2HWLB 3UNQA 3OTJE 3BTGE 1ANEA 1H4WA 1HJ9A 2ZCKP 2BD7A 1BRAA 4D7FA 2R0LA 4ABEA 3SV9A 1E38B 1QFKH 3PMJA 4ZHLU 3RXLA 2ZHDA 4TPYA 1QB6A 4B76A 1P12E 1G3CA 1EZSC 1OX1A 1V2UT 2QXGA 2GV7A 5H4IB 2O8UA 4FUJA 5EPNA 4YOGA 1LVOA 1AGJA 1W11U 1CSOE 3FZDA 2TGPZ 1XUGA 4LZ4B 5JBTA 3PMAB 1ZSJA 2ESTE 1OP8A 1GHBF 1P2MA 5ESBA 3B23B 2OQUA 2Y81A 3KQCA 1GBBA 3GCHB 3LONA 1CGJE 1EQ9A 5I25A 3TJNA 2RA0A 2BXTH 1GVLA 1ETTH 5LPFA 2PKSC 1EZUC 2FS9A 2STBE 1SGTA 1ESBA 1O39A 4B71A 3STIA 4TPIZ 3SUGA 2A32A 1QHRB 4CRDA 3RLWH 3ITIA 4WMFA 3VPKA 3U8TH 3VB6A 5F6MA 1E34B 4E7NA 1N8OC 1TRNA 1B0FA 2AH4X 4AFQA 1UTNA 1FN8A 3ELAH 3M36A 1C5SA 4IC5A 4X2XA 4ISLA 3AAVA 5A8YA 2ILNA 2NU1E 2ODPA 1C1PA 1EB2A 1ZR0A 2BQ7B 2F91A 2J4IA 1PPBH 3KCGH 2BXUH 1LCYA 1VGCC 2VVUA 4JZEH 1DX5M 1Q31A 1C1UH 4FUEA 4Y8ZA 2XC4A 5HGGA 4IC6A 4WJG2 1TGTA 2VIWA 3E91A 5T6FA 1O2LA 1HUTH 1T32A 4X1NU 3KNXA 1O3CA 1FMGA 2FYQA 4U30A 2PGBB 3MTYA 3LT3A 1O5DH 3MNSA 2ZU5A 1W3CA 2GTBA 4D9RA 1IOEA 2CGAA 3NZIA 3TK6A 4GSOA 1H9HE 3MNBA 7LPRA 3TU7H 4KELA 4ZKRU 3TJOA 2PUXB 1C4Y2 1SSXA 4AN7A 3BTFE 1FY8E 1YPLH 5HM2A 3MH5A 2J92A 3MFJA 3V0XA 4FUGA 3UUZA 3TJUA 3P95A 1XX9A 4F49A 4IGDA 1KYNA 2XWBI 2ZO3H 4FU9A 1W0YH 2BHGA 1F0RA 1GI5A 1XMNB 2F9BH 3S9AA 2AMQA 1P09A 3FP8E 1HAOH 1D4PB 2V6NA 1SGNE 1QQ4A 2ODYB 4R8TB 2OBOA 4GLYA 1AO5A 1FY4A 1BITA 1G9IE 4U32A 1O3EA 1FONA 1OWIA 3GYMA 4JZDH 2P16A 1P9SA 2F3CE 3LH1A 1QJ6B 1SGDE 3TK9A 2W5EA 3E16B 1W8BH 2EI8A 3K6YA 1WOFA 2QF3A 4FVBA 3ZYEA 5CHAB 2F83A 2GMTB 1RFNA 3ZZ7A 2F9OA 2J9NA 1W0ZU 2P8OC 1WTGH 1OXGA 1EZXC 1BT7A 4BXSA 3MNXA 4YOIA 3M5OA 1EJMA 4OGXA 1O35A 2IN2A 5C20A 4MDSA 1QB1A 2V3OH 1ZZZA 1HGTH 1UCYH 2ZQ1A 1H8IH 3P8GA 2XC5A 3CS0A 3KIDU 5DP6A 1Z8GA 1INCA 2LNCA 6LPRA 4Z6AH 1DS2E 2BZAA 3M35A 1CHGA 1TAWA 4X6MA 2UWPA 3QLPH 2H9EH 3RXHA 4ABBA 1V3XA 3EA9A 1SG8B 3W95A 1DXPA 1EATA 1LHDH 1MKWK 1T8NA 1A1RA 1ZTLA 5JB9S 1AKSB 4NA8A 3MO3A 4QT8C 1SC8U 4X8TH 8ESTE 3LJOA 1TQ7B 2D8WA 4UFEH 2OINA 3E8LA 1NFUA 2W3KA 2ZQ2A 4B1TA 4WMDA 2EA3A 4B75A 1O2UA 3F1SB 1O3HA 2Z9JA 4CRAA 1AHTH 2ZGHA 3A83A 4LZ1H 3Q00A 2QCYA 1FY5A 1A4WH 3RXCA 1HV7A 1P8VC 2EC9H 4DJZB 2J38A 1QA7A 1VITH 3T27A 3GY8A 1MD7A 3U98H 1ELBA 3RLYH 7GCHF 2A5IA 1HXFH 4ABAA 1YLCA 4ZKNU 1HAVA 1SQTA 1HPGA 2GZ7A 1PJPA 1ELEE 2GD4B 4DY7B 1VJAU 1ANDA 4ABFA 2FS8A 1DUEA 2WPJS 1W10U 1ZSKA 3E6PH 4VGCB 1J17T 3E1XB 3A8CA 3TPIZ 2BD8A 3NCLA 4WH6A 1Y3WA 3NPSA 3BTME 5JB8S 1KXFA 2FDAA 1V2VT 4NA9H 3MO9A 1BBRK 4NFEA 1P2IA 1P01A 4THNH 2TGDA 1U6QA 3T25A 3M5LA 1GBIA 1NZQH 4M7GA 4PROA 3UQVA 1GI2A 2PV9B 4JZ1A 1MTWA 1PQAA 1TBQH 1W7GH 1O0DH 4I8KA 2XCNA 3FFGA 2WUCA 4I33A 1LMWB 6GCHF 2WPLS 2SNWA 1G3BA 4FVDA 5G4BA 1SGFA 2B5TB 2BY7X 2ZIQH 3FAOA 3SUDA 5C5NA 1AFEH 1A7SA 4Y7AA 5JDUB 1TRYA 3KQEA 2DUCA 4AORA 2BMGB 1P11E 1L2EA 3SZNA 1HNEE 2Z6BD 3AAUA 4AFUA 1ELFA 1ELAA 2GT7A 2XXLA 3BTQE 3SU0A 3ZZBA 1MAYA 1ZTKA 1UHBA 4D7GA 1WBGB 3DA9B 3RMOH 4ZAEA 3RP2A 4AYYB 1CGHA 1H9LB 2KAIB 2DE8A 2BY6X 2VGCB 5DP3A 2FOGA 4YOJA 2F9PA 2GCTC 2QC2A 2HNTE 1OWHA 1F5LA 3S7KB 2A4RA 3ZVAA 1O2HA 1RJXB 3QWCH 3VB7A 4Y0YE 1MMJN 3PLKA 1FY3A 2BYAX 3F6UH 2WV4A 2B8OH 1K22H 1TGBA 3U8RH 3A80A 1TNLA 1KXAA 5K7RA 5PTPA 1BIOA 1ZJKA 2GP9B 2G5VA 3PB1E 1J9CH 3SU6A 4ABIA 4WY3A 1BCUH 3BEUA 3KL6A 2Y5GA 1SB1H 1ELGA 1L4ZA 2I6QA 3NK8A 2BM2A 1O2YA 5B6OA 2Z7FE 2ZGBH 2ANMH 2YNAA 4K69A 3PLBA 4BTIB 1EP6A 4O3TA 1OP2A 4NIVA 2O8TA 1JMOH 1EKBB 1O34A 1CO7E 1KLTA 1UTPA 1ZMJA 4AOQA 1YPHC 1AUJA 1RIWB 4ZH8A 3M7QA 3RU4E 3STJA 1GGDB 1V2QT 1ZRKA 1THRH 2H6MA 2A1DB 1C5UA 3LOXA 1B7XB 1HIAA 1O3IA 2D2DA 5EPYA 1WTHD 1GI7B 2ZHEH 3UQOA 1VR1H 3GY7A 1C1RA 4AG2A 3MU4A 1EAIA 3LGIA 4A5TS 1LKAA 4ISHH 1XM1A 1FDPA 1GGDC 2XBVA 2RG3A 1JXPA 4IMQA 3B9FH 3A8AA 1CBWC 2J94A 3UWJH 2C8XB 2EEKA 1ANCA 2FOMB 1AMHA 5EXNA 4CHAC 1RTLA 4ZHMU 1BMAA 3SNBA 5C1UA 4MVNA 4WXVA 1P2KA 1O2JA 5J4SA 4MNYA 5FX5A 4NCYA 4KTUA 3KQBA 1GI6A 1EP5A 1NPMA 1GMDG 3Q3XA 2ODQA 5LH8A 2A4GA 2SFAA 1C2EA 1BA8B 4YT6H 4TWYA 1YPKH 1C2KA 3MWIU 1ABJH 3K65B 4CRCA 4YT7H 1OP0A 2R0KA 3GDSA 1GJ6A 3UOPA 3L3TA 4D8NA 1C1VH 1O3PB 2F9VA 3UNSA 1ZLRA 4NA7A 1EPTB 1QL9A 3BIVH 2ZGCA 1BB0B 2G52A 2FTLE 3C27B 3K6ZA 1O2OA 5E8EH 3ZVEA 1LO6A 4ISNA 2JETB 2SGPE 5DJ7A 3QO6A 3T26A 5LPEA 2XNIA 1KIGH 5EXLA 1TFXA 3H7OA 1CHOG 2BVRH 2HGTH 1TBRH 4X1PU 3A8DA 1TOCB 3P8FA 1E37B 2GGVB 4I31A 1UO6A 1FV9A 2VWMA 1SGYE 4ABHA 1NRSH 1SR5C 3ZV8A 2ZU4A 4IS5A 4O3UA 4MPXA 2C8YB 2G51A 1KDQB 4E06H 1ANBA 1JBUH 4X6PA 5C3NA 1AVWA 4INLA 4K8BA 1Y5BT 2PTCE 4MQAA 3LIWA 1VJ9U 1Z71A 5GCHG 3SJIA 1V2LT 4AGKA 2WYJA 1NFXA 3DUXH 1GMHG 3PYHA 5E2OA 3AASA 1GBTA 1O2KA 3URCA 2HPPH 4GAWA 1DWCH 9LPRA 1QRWA 3PO1B 4MTBA 1IQHA 1EJAA 4X8UH 1TX8A 2G00A 1SL3A 1O2RA 3ATMA 1GL0E 1DITH 2ZPSA 4ZMAH 4Q2KA 1O36A 4DCDA 5F8XA 3F9EA 2RDLA 2C90B 1IQMA 2J2UA 3SQEE 1ORFA 3PMBB 2FMJA 3IG6B 1ZMLA 4WVPE 3BG4B 3UFAA 1CT0E 1TMTH 1XUJA 3M37A 1A0JA 1GI1A 1D6WA 1KTSB 1O37A 2ZHFH 3FP7E 1MZAA 1RD3B 1GJCB 3D49H 1C2IA 3M3TA 1AB9B 1N1LA 1WSSH 1TIOA 1T31A 5A0AE 3SNCA 4MPWA 1C5PA 1YF4A 3FZZA 4E05H 4Y8XA 3OU0A 1TPAE 2VIDA 4K5ZA 2BD5A 3U1JB 1UK2A 1UVOA 3H7TA 1SMFE 5HM9A 1EX3A 1DXWA 3TH4H 3ZZCA 3SV6A 1PQ7A 4WWYA 4DOQA 1TLDA 1HJ8A 1C2LA 4F4OC 4DG4A 3HKJB 1HAZB 1G37A 1QCPA 4A6LA 1RS0A 1VCQA 5DKMA 3TIUA 1XVMA 4K1SA 1TNKA 2V35A 5JBBS 4B2CA 2ZGJA 4DW2U 1HBTH 2ZU1A 2BDYA 1ARBA 4XSKU 3ZZ9A 4Y0ZE 4NFFA 1PPFE 3BTEE 2OXSA 2ZDLA 4UEHH 5J4QA 3P8OA 3NXPA 1VITG 4X6NA 1TGSZ 4YO9A 4ABDA 3SU2A 5LGOA 3FVFB 2BD2A 2VH0A 2A5KA 5F8TA 1ELVA 4Y10E 1OPHB 2Y5HA 1G32B 1TOMH 1TMBH 1GJDB 2BD4A 1EJNA 1ETRH 1G3EA 1PPGE 3UNRA 2AGGX 2AS9A 1UTQA 2VVVA 4OS4A 4NSVA 3H5CB 2QXHA 2WPHS 2XBWA 5L2ZH 4CRGA 1AE5A 2ZFPH 5GJ4B 1G3DA 1GMCG 2ZEBA 3GY6A 4XBDA 3SI4H 1SGQE 3SNDA 1O3LA 1CU1A 3UIRA 1GWAA 1YCPH 1ZGVA 4OS5A 1JOUB 1QB9A 1S6HA 2Q6DA 1O2NA 2NWNA 3Q3YA 1W7XH 1C4V2 1V2PT 2STAE 3LC3A 1GHVH 1RTFB 2PW8H 1ELDE 1LPKB 4A92A 2XYAA 5FBEA 4UFFH 3B8JA 1RGQA 1BHXB 1MQ5A 4NWLA 1UCYK 2ZTXA 1NS3A 2Z9GA 3QTOH 1P3EA 4R0IA 3BV9B 1HJAB 1EZQA 1C5WB 3VFEA 1EB1H 5C1XA 1ZJDA 1A0LA 1BTPA 3BTKE 3GCHC 1QR3E 3VEQB 3ATLA 4AB8A 2GV6A 1DPOA 3AW1A 2BDAA 4BAOB 2FOFA 4I8HA 1GHAF 1LVMA 4DT7B 5A8XA 1EAXA 1C2HA 3SU4A 4ABGA 1OSSA 3QZRA 2QN5T 1NY22 1DWEH 4RKJB 3SGAE 4DURA 1FNIA 1LVYA 1L4DA 4KP0A 3ZZ3A 4JCNA 3M5MA 2JH6D 1GI9B 1C5YB 1W13U 1CA0B 3CENA 4H6TA 5E0JA 3P70B 3I78A 1FQ3A 1DVAH 3SBKA 2BVSH 5AFZH 1D3DB 3MU0A 1OWJA 3P8NA 2VNTA 1IAUA 2BY5X 2J34A 2W26A 5DPAA 2PKAA 1EUFA 1QRXA 3M3VA 5E0HA 1P05A 1DFPA 2BDIA 1SLXB 2QA9E 3GOVB 4HTCH 4FUBA 1DUAA 1MTNB 1GDNA 3ZYDA 7ESTE 1IQGA 1PQ5A 2SGEE 3C1KA 3A85A 5EW1H 3SGBE 3ESTA 2GDDA 1JRTA 1C4U2 1WV7H 3ATKA 3ZZ5A 1NU9A 2ZTZA 3PWBA 4ZUHA 3I29A 4FUFA 1K1NA 2I6SA 1D3TB 2ZDVH 1UTJA 3UR9A 2ZI2H 3HGNA 4LOYH 5C2ZA 3HK3B 2ALPA 1O2WA 2PR3A 2PWXA 2FESH 3LGWA 2ZG0H 3RMLH 2M5TA 2ZDNA 1EAWA 2FI3E 3P17H 2OCVB 2BDCA 4BOHA 4SGAE 1UK3A 1YPEH 1C5MD 1VZQH 1MKXK 1UK4A 2Z3DA 2VIQA 2R3YA 1ZGIA 3SV2H 3TH2H 3RXPA 1HB0B 2BX3A 1SGPE 8GCHG 4RSPA 1QGFA 1D3PB 5EQSA 4BTTB 1GDUA 3MU1A 1EAUA 5DG6A 3RXBA 1UMAH 3U9AH 1YM0A 2R3UA 1C9PA 2Z94A 3RM2H 1O3DA 1DSTA 3T62A 5FCKA 1NTPA 6CHAB 1P0SH 1G2MA 1TRMA 1S5SA 3QK1A 3KGPA 2BQ6B 1TA6A 4TY7A 3HATH 1DE7H 1F92A 3ATWA 4TY6A 1AN1E 4CBOA 2NU4E 1THPB 1GHYH 1BQYA 2AERH 1KLIH 1DLKB 1SQOA 2CJIA 2FLRH 1TNGA 1YCPM 1E35B 1A3EH 1QL8A 2CHAB 4MNXA 1IQNA 5CHAC 4MNWA 4ZXXH 1QBVH 1GL1A 2GMTC 1TYNA 3IWMA 1ARCA 1SLVB 2ZA5A 1DWBH 2TIOA 1QTFA 2C3SA 1MCVA 3A89A 3LDXH 1KY9A 1J16A 2ALVA 2H9TH 1FIZA 3LGYA 1V2KT 1ABIH 4JYUH 2A0QB 4TWWA 1HAGE 1JRSA 1LQEA 3MMGA 2PFEA 1RXPA 2XCFA 4O9VA 3A7XA 3OY5U 2W3IA 2BDGA 2H5CA 4I8JA 1BTYA 3P6ZB 3D65E 4ZHAA 1GI4A 2OP9A 2G5NA 3RXSA 2FWWA 1NRRH 1GMDF 5A09A 2OC0A 2UUYA 4GPGA 1LKBA 1IQIA 2AMDA 5EODA 4OGYA 1S0RA 2OC7A 1A2CH 3D23A 2VINA 5ABWA 5JPMH 1GBHA 1A61H 1TMUH 1J14A 1YYY1 3SU5A 4HZHA 3A88A 2G81E 2ZCHP 1GBLA 4K1TA 1SI5H 3LJJA 3BTHE 3EAJA 1KLJH 5SGAE 3SO3A 2NU2E 4K1EA 1SBWA 1SHYA 1HRTH 1CHOF 1J15A 3EA7A 2LPRA 2B0FA 2BTCE 3S69A 4I8LA 1QA0A 5AF9H 3F9FA 5DP9A 2FI4E 3S7HB 2G55A 3E0PB 1GJ8B 3MU8A 4X1QU 4NGAH 3TGKE 3QN7A 4VGCC 4X1SU 3O8RA 4NWKA 2WYGA 2AIQA 4Z0KA 4H6SB 4ISIH 5EU8A 2VWNA 4NIXA 4GHTA 3EE0B 3VXFH 5F03A 3BTTE 4ZKSU 3T28A 5GCHF 2CF8H 1W2KH 2QV1A 3E0NB 4JYTA 1Y3YA 4BAHB 2ZFFH 1GMHF 1T4UH 1UVSH 1QBNA 1TONA 5HYOA 1QJ7B 4JK6A 3E90B 3SI3H 4AFSA 1GJ7B 4NIWA 3V13A 4XFQA 1K21H 3VXEH 4INKA 2GX4A 2CXVA 2W7SA 2OD3B 4JMYA 3NWUA 3MH6A 3SJOA 1UTKA 2FO9A 4Y71A 3VB3A 2WUBA 4UDWH 4SGBE 1OYQA 3LC5A 5GIBA 3TLOA 1EOJA 4J2YB 4NZQA 2XC0A 4BXWA 1T8MA 2VIPA 1Y3VA 3BEIB 1AZZA 5AFYH 3LH3A 1O3BA 2HLCA 1GBJA 4X8VH 1WAYB 2B9LA 1O2MA 2PLXA 2VGCC 3LGTA 4OS1A 4J1YA 3LU9B 1ACBE 1AVXA 4ZROA 2VWLA 1BBRE 3PM3A 5K0HA 1YPJH 2ZPRA 4IBLH 4U2WA 3RM0H 1LHEH 3PTNA 3M3SA 5FAHA 4K2YA 3T29A 3VB5A 1O3KA 1OOKB 3RMMH 1P06A 1G36A 1ZHPA 3ZVFA 1NFWA 1BTWA 2P95A 2Z3CA 1GG6B 2H1UA 1SGRE 2PUQH 1XUKA 1VCWA 1NRNH 4XDEA 1ZSLA 1UJ1A 3AW0A 4FUDA 2IJOB 2IPHA 2ZZUH 3TGJE 1H8DH 4JZIA 2BQWB 3A81A 3A7VA 4RN6A 3KQDA 1E0FD 2CMYA 2C8WB 5HMAA 1Z6JH 2VU8E 1RIWC 1PQ8A 1A5HA 3QUMP 1V2MT 1C2FA 1VITF 1GI3A 1HAHH 2Y82A 4UFGH 1PYTC 3A82A 1S83A 1LHCH 4CH2B 3AVZA 1K1MA 3V3MA 3GY5A 1IQEA 2BLVA 4ESTE 2XRCA 1XXFA 3ZZ4A 1O2VA 2BZ6H 1OWKA 1AZ8A 1JIRA 5DP5A 2G4UA 2ZCLP 1S84A 4A7IB 3RXUA 4GHQA 1AUTC 1GMCF 1O3AA 1P2QA 1HAYB 1XKBC 1FPCH 1OYTH 3RU4D 1UTOA 3RXJA 1PPCE 1DWDH 2GCHG 2BOHB 1ZPBA 1ID5H 4WH8A 1MH0A 5L6NH 2ZDMA 2R9PA 2CF9H 4YTAA 3S9BA 2O9QA 3CP7A 2WPMS 3RXVA 2BLWA 1YPMH 3LPRA 5FBIA 1G30B 1SFIA 3PWCA 2WPIS 3FP6E 1TABE 4E7RG 1GI8B 1ZHMA 1G2LA 1EPTC 3SORA 1K1PA 4YLUA 2R2MB 4KGAA 2JETC 2V0BA 3PV4A 3TNTA 1AKSA 2OLGA 3VGCB 4H42U 3UR6A 1P9UA 1GBMA 4FXGH 1YPHE 1YCPK 1W12U 5FCRA 3PMHB 4Y7BA 4CR5A 2H5DA 4TYDA 1MTSA 1MU8B 2VJ1A 1O33A 3F68H 5EGMA 1AFQB 2AYWA 3HPTB 4DVAU 5EW2H 3SNAA 1V2OT 1XKAC 2Q6GA 3PLPA 3EA8A 3SUFA 1QL7A 2PGQB 4I32A 1T8OA 2AGIX 1S82A 2XW9A 1MQ6A 2AEIH 1E36B 4JK5A 3WY8A 2AGEX 4FU7A 1AU8A 1O5BB 3BTDE 4RKOB 4B73A 3RXFA 1FUJA 4Y79A 2BY9X 4DIIH 1V2NT 3RXAA 1XUFA 1W14U 1EXFA 1HFDA 2V3HH 3PO1C 1CGIE 3VB4A 1TNIA 4A1XA 2DE9A 4MPVA 3U8OH 3ZZDA 1GJ4H 1F0UA 1TALA 2BD9A 2ULLA 4AX9H 3GICB 2WPKS 3P92A 1K1LA 1PYTD 1NN6A 3SUEA 1YKTA 2AFQB 1CE5A 1FPHH 1HAXB 1SLUB 3BG4C 3QX5H 1FI8A 2PSXA 2SGQE 2NU3E 1IHSH 1S85A 2YNBA 1HYLA 1TPOA 3ENSB 1NRPH 4MLFB 3RXRA 1SFQB 3BN9A 3NUMA 1A5GH 3U1IB 1Y3UA 1JIMA 1AB9C 1MU6B 1LHGH 1GCTB 4FU8A 5T6GA 2HALA 3ATIA 4Q7ZA 3SU1A 1SVPA 3RU4T 2UWLA 1S0QA 2RA3A 2D26C 2WINI 4WMEA 2KAIA 1LVBA 4OS6A 5EG4A 4UE7H 2Z3EA 5EQQA 1C1MA 5JBAS 3GYLB 3FANA 4Y11E 2R2WU 4X8SH 1F7ZA 1IHTH 3ZZ8A 1O2GH 1O5CB 4NZLA 1C5XB 1Q2WA 3GISB 1Z6EA 1NRQH 1V2ST 2GZ9A 1GHWH 1FAXA 3M7TA 1NO9H 5DP8A 1T4VH 1MBMA 2P94A 2ZGXH 3ZVDA 1D6RA 1XUIA 2FOCA 3Q3KA 3RXQA 2FI5E 4IMZA 3MH4A 3GCOA 4CRFA 1O3JA 3F9GA 3S9CA 1PPHE 5CMXH 4DGJA 1BMLA 4D9QA 1HAVB 2C93B 4UONA 3UOUA 1KXDA 2BX4A 1GJ9B 3SU3A 1IQFA 4O97A 1MAXA 4UFDH 1F2SE 2P3UB 4H4FA 4XBBA 3DD2H 2XTTB 3EQ0H 3EYDA 2P59A 1GBFA 1MTVA 4CREA 2A5AA 3F9HA 2QAAA 1TPSA 3A7YA 1WCZA 2A45B 4ISOA 1BJUA 3RC5A 3QTVH 5LPRA 3OYPA 3ZVBA 1SGEE 3RXTA 2D1JA 1CT4E 2FPZA 1BMNH 1TA2A 1DLEA 2Z9KA 1FIWA 2UWOA 2FOHA 2BDBA 2SGDE 4WXIA 1IQLA 2OC1A 1H1BA 3GCTG 1NROH 1O5FH 2XBYA 4FUIA 1FN6A 2ZWLH 2PKSB 5TJXA 3OY6U 1ZMNA 2JH0D 3R3GB 3I77A 1P2JA 4BAQB 4AYVB 1O2IA 1V2TT 1HJAC 1UVPA 2A7CA 2VIVA 1T7CA 1GHXH 3L33A 3W94A 1DY8A 3BSQA 2Y80A 1UHBB 1N8OB 4XE4A 2CV3A 3OSYA 4MG3A 1LPGB 1ZPCA 2NU0E 1O2XA 2SGFE 1O2ZA 4ZXYH 8KME2 1WU1A 4DIHH 1GBDA 1SGIB 4X2VA 1D9IA 2ZNKH 3UREA 2IOTA 1A3BH 3RXIA 2P3FH 4MPUA 4Y6DA 1EOLA 5FX6A 4AFZA 3SQHE 1EPTA 1VGCB 1HXEH 3M61U 5E0GA 1C5TA 1TNJA 1F5KU 4HGCA 5EOKA 1QJ1B 1CA0C 2ZHWH 1A5IA 1O3OA 1C5QA 3DFLA 4I7YH 3GY2A 1WQSA 1FJSA 2TBSA 1TWXB 3UPEA 4Q7XA 1C5RA 4CRBA 5A8ZA 3BTWE 1FXYA 2SGAA 4ABJA 1UCYE 3Q77A 1TGCA 1YGCH 2FIRH 3A7TA 2VVCA 1XXDA 1KDQA 2BLQA 2UUFB 2W7UA 2PHBA 1MBQA 1UTLM 4AGJA 2OTVA 1V2JT 1MTNC 3ZZ6A 2C8ZB 1WUNH 1A0HB 1P57B 1C2DA 4GCHG 1O2QA 3RXOA 1QURH 1AD8H 2THFB 1DANH 1HIAB 1Y5AT 1C9TA 3U69H 3MOCA 4X1RU 4ZKOU 1H9IE 3NKKA 1AY6H 4NG9H 2A2XH 2Y5FA 4CBNA 1ZPZA 1O30A 5BRRE 1OS8A 3URDA 3V12A 2JKHA 5CE1A 1O5AB 5ESTE 4CH8B 1NU7B 1OKXA 2Z9LA 1AVGH 1WQVH 3JZ2B 1MUEB 5TCAA 1P10A 4FUHA 1LTOA 1F5RA 2VB0A 1SQAA 1MCTA 3SGQE 3MU5A 3HGPA 1AE8H 1NESE 2BVXH 3GDUA 3DFJA 3HK6B 3TJVA 3QGJA 2P8OB 2SNVA 1T8LA 1ZRBA 2OC8A 2UUKB 6CHAC 3GY4A 2GKVE 1XUHA 3KEEA 1Z7KA 1DICA 1X7AC 1LQDB 4X0WU 4K3JA 1C1OA 1ELTA 2WV5A 4OS7A 1GPZA 7KMEH 1HAPH 2TGAA 8LPRA 5I46H 1DT2A 4UD9H 1N6YA 1P3CA 1B0EA 1UVTH 3G01A 3E3TA 5IYTA 5A0BA 1XVOA 1O3NA 2GT8A 2CHAC 1C1QA 3M5NA 1O2SA 1Z8IB 2PSYA 1YC0A 5L2YH 3MO6A 1S6FA 6ESTA 3A87A 2BLOA 2GVFA 2ZFTA 4IW4E 3TH3H 3BG8A 4B2BA 4IN1A 4OS2A 4KTSA 2FZZA 3GDVA 4HI3A 2ANYA 2GCHF 1C5ZB 2Z9IA 2HNTC 4NIYA 3V7TA 1BRBE 3DHKH 4INHA 2ZDKA 1GHBG 1O2TA 1C5OH 2A4OA 1ESTA 1V2WT 4ASHA 5DP4A 1Y3XA 3ZV9A 4LK4A 4Y8YA 1AI8H 5JYIA 2HOBA 5AVDA 3SN8A 1Z1JA 3KN2A 3SJ8A 2ZPQA 2ZP0H 3RXMA 2ZTYA 3UY9A 1YBWA 2YOLA 3N7OA 1AQ7A 4JYVH 1QBOA 1A46H 4CR9A 4X6OA 1YLDA 2HPQH 1SLWB 2QXIA 3TITA 3UWIA 2BY8X 5F8ZA 2FTMA 3A7ZA 1NT1A 3TGIE 4Q80A 2VWOA 1GHAG 1RRKA 3PTBA 1VCPA 1C2MA 1ZHRA 1GI0A 1BTUA 1GJBB 2TRMA 1KTTB 2BOKA 3UTUH 1CT2E 1K9OE 2HVXA 1P2NA 2FX6A 2H2ZA 4WF8A 1DDJA 1BRUP 1TX7A 2QF0A 3SOSA 4B74A 3BF6H 3RDZA 1CVWH 1SHHB 1WYKA 2TGTA 4AB9A 1KXBA 2K1QA 1BZXE 1TE0A 1B5GH 2P93A 2EI7A 1P2OA 5T3HA 3RXGA 5GWZA 4KKDA 2F9UA 2ZDAH 1MKXH 2Q6FA 2ZFSA 1F0SA 2GCTB 2A2QH 2P3TB 1LPZB 1BDAA 4NSYA 2VIOA 2Y6TA 3SW2B 1QIXB 2F9NA 2A7HA 3R0FA 4YZUA 4AG1A 1TX6A 4BNRA 2G4TA 1Y5UT 1KSNA 1PFXC 1Y59T 5FPSA 1Y8TA 2FODA 1O5GH 3T5FH 1GVKB 4K8YA 1GDQA 2ZU3A 4X2YA 2XBXA 3LGUA 2FOAA 1C5NH 3MHWU 4D76A 1NM6A 2Y7XA 2ZU2A 1HLTH 1L1JA 4LXBH 5C1YA 1O31A 1NFYA 4O03A 3ZZAA 5DK1A 2ZFQH 1GCDA 1TGNA 2FYRA 1ETSH 1FZZA 1QNJA 2UUJB 1BTXA 1QY6A 1QRZA 4MNVA 3O8BA 1V2RT 1THSH 3QDZB 5T6DA 1MKWH 1GG6C 5GXPA 2ZHQH 3PROA 2Q1JA 4B2AA 5FPYA 5FHTA 5DO4H 3RC4A 3BIUH 2QYIA 4Q7YA 3OX7U 5L30H 2HRVA 1SOZA 2G8TA 3BEFB 1OWEA 1KXEA 3RC6A 1HDTH 2FOBA 1BHXF 4X2WA 1BRCE 2ZFRH 4HFPB 3A84A 1CBWB 1GBKA 3RXEA 1NC6A 1RTKA 4CHAB 2J95A 1O3FA 2ASUB 3LGVA 2OQ5A 1K1JA 1L0ZA 3DT0H 5IDKA 4A1TA 1BTHH 1CQQA 1PPEE 3JZ1B 5A0CA 1DY9A 4XBCA 1LHFH 2OUAA 3ZVCA 9ESTA 1L1NA 2H9HA 3HKIB 1Z8RA 2A31A 1BTZA 1IQKA 3SHAH 3TNSA 1MD8A 1BBRH 2FOEA 5E2PA 1C5LH 3L6PA 3RXKA 1M9UA 2BD3A 1O2PA 1UVUH 1V6DA 5GDSH 5FPTA 2FXRA 1HCGA 1GJAB 3QZQA 1TNHA 5GPIB 1FY1A 4YM9A 1S81A 2JH5D 1DOJA 7GCHG 3EDXB 3MI4A 3MNCA 1K28D 3GCTF 3IITA 1QQUA 3ZVGA 3MH7A 3ODDA 1ZTJA 2ANKH 1ZYOA 1YPGH 1MZDA 4KTCA 2PKAB 2QGRA 1SGCA 3GY3A 3S0NA 1TQ0B 4Y76A 2VH6A 5DGJA 1F0TA 2ZKSA 2GDEH 1OWDA 1Z1IA 1J8AA
chains in the Genus database with same CATH superfamily
3LKWA 1ZOMA 1ELCA 4GVUA 3RUOA 3A86A 2GZ8A 3TVJB 3VGCC 1BJVA 4IN2A 1D3QB 1AWFH 4BAMB 2QXJA 2FLBH 4K60A 5JBCS 1KXCA 2O8MA 1C1TA 3SV8A 1P04A 5AHGH 1O38A 4BAKB 3QGNB 1IQJA 1JWTA 1OHHD 5C5OA 1AFQC 2C4FH 3SJKA 6GCHG 1DSUA 2FX4A 2ANWA 1BOQA 4JZFH 4XOJA 1Q3XA 3TK5A 1Z8JB 1P03A 5DP7A 3SHCH 1O5EH 2FM2A 3Q76A 4FUCA 2ZC9H 1EASA 2JJ1D 2OBQA 3O8DA 1TB6H 5HXFA 4AZ2B 4YESB 5BPEA 1HAIH 1TPPA 3NRLA 5ETXA 1P02A 5EQRA 1GVZA 1C2JA 1LDTT 3WWBA 5TCCA 1GHZA 1GBCA 3A8BA 5EXMA 1C5VA 1CA8B 3K2UA 4U01A 4I8GA 4GCHF 5FXLA 2EI6A 3T2NA 3GCNA 3MYWA 1C1WH 3A7WA 5A2MH 2CN0H 1W0JD 1K2I1 3RMNH 2ZF0H 3CS7A 4BANB 1C1NA 3SNEA 3EGKH 1O3MA 1K1OA 2QIQA 1ESAA 1FX0B 8GCHF 3ODFA 3RXDA 2HNTF 3UB0A 1PPZA 1BUIA 1GBAA 2FP7B 4GUXA 2BDHA 3O8CA 2TPIZ 3SJ9A 1GCTC 1FAKH 1L1GA 2XWAA 1AIXH 2FEQH 3SV7A 1BMMH 1SPJA 4YLQH 1GJ5H 3M7UA 2A7JA 5C67A 1AWHB 4BTUB 1C1SA 1TBZH 2B7DH 2ZECA 1FLEE 4A1VA 2L74A 1UTMA 1MTUA 1GBEA 1O32A 2BB4A 2PTNA 1YP9A 3KHVA 2A4QA 2AMPA 2QY0B 1DM4B 1C2GA 2RCEA 2O8WA 3D62A 3K9XB 1SGFG 2AIPA 1N6XA 1O3GA 2Y7ZA 3KF2A 1K1IA 1SOTA 2O8LA 2HWLB 3UNQA 3OTJE 3BTGE 1ANEA 1H4WA 1HJ9A 2ZCKP 2BD7A 1BRAA 4D7FA 2R0LA 4ABEA 3SV9A 1E38B 1QFKH 3PMJA 2J5UA 4ZHLU 3RXLA 2ZHDA 4TPYA 3OAAD 1QB6A 4B76A 1P12E 3F2FA 1G3CA 1EZSC 1OX1A 1V2UT 2KM0A 2GV7A 2QXGA 2O8UA 5H4IB 4FUJA 5EPNA 4YOGA 1LVOA 1AGJA 1W11U 1CSOE 3FZDA 2TGPZ 1XUGA 4LZ4B 5JBTA 1H8HD 1ZSJA 3PMAB 4ACBA 2ESTE 1OP8A 5C0TA 1GHBF 1P2MA 5ESBA 3B23B 2OQUA 2Y81A 3KQCA 1GBBA 3GCHB 1SKYE 3LONA 1CGJE 1EQ9A 5I25A 3TJNA 3KQ5A 2RA0A 2BXTH 1GVLA 1ETTH 5LPFA 2PKSC 1EZUC 2FS9A 2STBE 4XD7D 1SGTA 1ESBA 1VKYA 2V7QD 1O39A 4Q63A 3STIA 4B71A 4TPIZ 3SUGA 2KCAA 2A32A 1QHRB 4CRDA 3RLWH 3ITIA 4WMFA 3VPKA 3U8TH 3VB6A 5F6MA 1E34B 4E7NA 1N8OC 1TRNA 1B0FA 2AH4X 4AFQA 1UTNA 1FN8A 3ELAH 3M36A 1C5SA 4IC5A 4X2XA 4ISLA 3AAVA 5A8YA 2ILNA 2NU1E 2ODPA 1C1PA 1EB2A 1ZR0A 2BQ7B 2F91A 2J4IA 1PPBH 3KCGH 2BXUH 1LCYA 2W6JD 1VGCC 2VVUA 4JZEH 1DX5M 1Q31A 1C1UH 4FUEA 4Y8ZA 2XC4A 5HGGA 4IC6A 4WJG2 1TGTA 2VIWA 3E91A 5T6FA 1O2LA 3EE7A 1HUTH 1T32A 4X1NU 2XOKD 3KNXA 1O3CA 1FMGA 2FYQA 4U30A 2PGBB 3MTYA 3LT3A 1O5DH 1BMFD 3MNSA 2ZU5A 4HG6A 1W3CA 2GTBA 2KCOA 4D9RA 1IOEA 2CGAA 3NZIA 3TK6A 2EQNA 4GSOA 1H9HE 3MNBA 7LPRA 3TU7H 4KELA 4ZKRU 3TJOA 2PUXB 1C4Y2 1SSXA 4AN7A 3BTFE 1FY8E 1YPLH 5HM2A 3MH5A 2J92A 3MFJA 3V0XA 4FUGA 3UUZA 3TJUA 3P95A 1XX9A 4F49A 4IGDA 1KYNA 2XWBI 2ZO3H 4FU9A 1W0YH 2BHGA 1F0RA 3GS9A 1GI5A 1XMNB 1YY3A 2F9BH 3S9AA 2AMQA 1P09A 4FOUC 3FP8E 1HAOH 1D4PB 2V6NA 1SGNE 1QQ4A 2ODYB 4R8TB 2OBOA 4GLYA 1AO5A 1FY4A 2YMSB 1BITA 1G9IE 4U32A 1O3EA 1FONA 1OWIA 3GYMA 4JZDH 2P16A 1P9SA 2F3CE 3LH1A 1QJ6B 1SGDE 3TK9A 2W5EA 3E16B 1W8BH 2EI8A 3K6YA 1WOFA 2QF3A 4FVBA 3ZYEA 5CHAB 2F83A 2GMTB 1RFNA 3ZZ7A 2F9OA 2J9NA 1W0ZU 2P8OC 1WTGH 1OXGA 1EZXC 1BT7A 4BXSA 3MNXA 4YOIA 3M5OA 1EJMA 4OGXA 1O35A 3SZEA 2IN2A 5C20A 4MDSA 1QB1A 2V3OH 1ZZZA 1HGTH 1UCYH 2KCYA 2ZQ1A 5FL7D 1H8IH 3P8GA 2XC5A 3CS0A 3KIDU 5DP6A 1Z8GA 1INCA 2WSSD 2LNCA 6LPRA 4Z6AH 1DS2E 2BZAA 3M35A 1CHGA 1TAWA 4X6MA 2UWPA 3QLPH 2H9EH 3RXHA 4ABBA 1V3XA 3EA9A 1SG8B 3W95A 1DXPA 1EATA 1LHDH 1MKWK 1T8NA 1A1RA 1ZTLA 5JB9S 1AKSB 4NA8A 3MO3A 2RDEA 4QT8C 1SC8U 4X8TH 8ESTE 3LJOA 1TQ7B 2D8WA 4UFEH 2OINA 3E8LA 1NFUA 2W3KA 2ZQ2A 4B1TA 1NBMD 4WMDA 2EA3A 4B75A 1O2UA 3F1SB 1O3HA 2Z9JA 4CRAA 1AHTH 2ZGHA 3A83A 4LZ1H 3VG8A 3Q00A 2QCYA 1FY5A 1A4WH 3RXCA 3DSPA 1HV7A 1P8VC 2EC9H 4DJZB 2J38A 1QA7A 1VITH 3T27A 3GY8A 1MD7A 3U98H 1ELBA 3RLYH 7GCHF 2A5IA 1HXFH 4ABAA 1YLCA 4ZKNU 1HAVA 1SQTA 1HPGA 2GZ7A 1PJPA 1ELEE 2GD4B 4DY7B 1VJAU 1ANDA 4ABFA 2FS8A 1DUEA 2WPJS 1W10U 1ZSKA 3E6PH 4VGCB 1J17T 3E1XB 3A8CA 5KECA 1SQRA 3TPIZ 2BD8A 3NCLA 4WH6A 1Y3WA 3NPSA 3BTME 5JB8S 1KXFA 2FDAA 1V2VT 4NA9H 3MO9A 1BBRK 1W0KD 4NFEA 1P2IA 1P01A 4THNH 2TGDA 1U6QA 3T25A 1H8ED 3M5LA 1GBIA 1NZQH 4M7GA 4PROA 3UQVA 1GI2A 2PV9B 4JZ1A 1MTWA 1PQAA 1TBQH 1W7GH 1O0DH 4I8KA 2XCNA 3FFGA 2WUCA 4I33A 1LMWB 6GCHF 2J98B 2WPLS 3W1EA 2SNWA 1G3BA 4FVDA 5G4BA 1SGFA 2B5TB 2BY7X 2ZIQH 3FAOA 3SUDA 5C5NA 1AFEH 3SYJA 1A7SA 4Y7AA 5JDUB 1TRYA 3KQEA 2WHXA 2DUCA 4AORA 2BMGB 1P11E 1L2EA 3SZNA 1HNEE 2Z6BD 3AAUA 4AFUA 1ELFA 1ELAA 2GT7A 2XXLA 3BTQE 3SU0A 3ZZBA 1MAYA 1ZTKA 1UHBA 4D7GA 1WBGB 3DA9B 3RMOH 4ZAEA 3RP2A 4AYYB 1CGHA 1H9LB 2KAIB 2DE8A 2BY6X 2VGCB 5DP3A 2FOGA 4YOJA 2F9PA 2GCTC 2QC2A 2HNTE 1OWHA 1F5LA 3S7KB 2A4RA 3ZVAA 1O2HA 1RJXB 3QWCH 3VB7A 5DSFA 4Y0YE 1MMJN 3FN8A 1FY3A 3PLKA 2BYAX 3F6UH 1E79D 2WV4A 5HKKD 2B8OH 1K22H 1TGBA 3U8RH 3A80A 1TNLA 1KXAA 5K7RA 2KR7A 5PTPA 1BIOA 1ZJKA 2GP9B 2G5VA 3PB1E 1J9CH 3SU6A 4ABIA 4WY3A 1BCUH 3BEUA 3KL6A 2XNDD 2Y5GA 1SB1H 1ELGA 1L4ZA 2I6QA 3NK8A 2BM2A 1O2YA 4AC9A 5B6OA 2Z7FE 2ZGBH 2ANMH 2YNAA 4K69A 3PLBA 4BTIB 1EP6A 4O3TA 1OP2A 4NIVA 2O8TA 1JMOH 1EKBB 1O34A 1CO7E 1KLTA 1UTPA 1ZMJA 4AOQA 1YPHC 1AUJA 1RIWB 4ZH8A 3M7QA 3RU4E 3STJA 2QF5A 4M9FA 1GGDB 1V2QT 1ZRKA 1THRH 2H6MA 2A1DB 1C5UA 3LOXA 1B7XB 1HIAA 1O3IA 2D2DA 5EPYA 1WTHD 1GI7B 2ZHEH 3UQOA 1VR1H 3GY7A 1C1RA 4AG2A 3MU4A 1EAIA 3LGIA 4A5TS 1LKAA 4ISHH 1XM1A 1FDPA 1GGDC 2XBVA 2RG3A 1JXPA 4IMQA 3B9FH 3A8AA 1CBWC 2J94A 3UWJH 2C8XB 2EEKA 1ANCA 2FOMB 1AMHA 2IPQX 5EXNA 4CHAC 1RTLA 4ZHMU 1BMAA 3SNBA 5C1UA 4MVNA 4WXVA 1P2KA 1O2JA 4F48B 5J4SA 4MNYA 3OE7D 5FX5A 4NCYA 4KTUA 3KQBA 1GI6A 1EP5A 1NPMA 1GMDG 3Q3XA 2ODQA 5LH8A 2A4GA 2SFAA 1C2EA 1BA8B 4YT6H 4TWYA 1YPKH 1C2KA 3MWIU 1ABJH 3K65B 4CRCA 4YT7H 1OP0A 2W6ID 2R0KA 3GDSA 1GJ6A 3UOPA 3L3TA 4D8NA 1C1VH 1O3PB 2F9VA 3UNSA 1ZLRA 4NA7A 1EPTB 1QL9A 3BIVH 4I86A 2ZGCA 1BB0B 2G52A 2FTLE 3C27B 3K6ZA 1O2OA 5E8EH 5B6LA 3ZVEA 1LO6A 4ISNA 2JETB 2SGPE 5DJ7A 3QO6A 3T26A 5LPEA 2XNIA 1KIGH 5EXLA 1TFXA 3H7OA 1CHOG 2BVRH 2HGTH 1TBRH 4X1PU 3A8DA 1TOCB 3P8FA 1E37B 2GGVB 4I31A 1UO6A 1FV9A 2VWMA 1SGYE 4ABHA 2WZQA 1NRSH 1SR5C 3ZV8A 2ZU4A 4IS5A 4O3UA 4MPXA 2C8YB 2G51A 1KDQB 3DSGA 4E06H 2EY4C 1ANBA 1JBUH 4X6PA 5C3NA 1AVWA 4INLA 4K8BA 1Y5BT 2AHME 2PTCE 4MQAA 3LIWA 1VJ9U 1Z71A 5GCHG 3SJIA 1V2LT 4AGKA 2WYJA 1NFXA 3DUXH 1GMHG 3PYHA 5E2OA 3AASA 3DCLA 1GBTA 4P02A 1O2KA 3URCA 2HPPH 4GAWA 1DWCH 9LPRA 1QRWA 3AK5A 3PO1B 3UAIC 4MTBA 1IQHA 1EJAA 4X8UH 1TX8A 2G00A 1SL3A 1O2RA 3ATMA 1GL0E 1DITH 2ZPSA 4ZMAH 4Q2KA 1O36A 5T1VA 4DCDA 5F8XA 3F9EA 2RDLA 2C90B 1IQMA 2J2UA 3SQEE 1ORFA 3PMBB 2FMJA 3IG6B 5F53A 1ZMLA 4WVPE 3BG4B 3UFAA 1CT0E 1TMTH 1XUJA 3M37A 2HVYB 1A0JA 1GI1A 1D6WA 1KTSB 1O37A 2ZHFH 3FP7E 1MZAA 1RD3B 1GJCB 3D49H 1C2IA 3M3TA 1AB9B 1N1LA 1WSSH 1TIOA 1T31A 5A0AE 3SNCA 2LELA 4MPWA 1C5PA 1YF4A 3FOAA 3FZZA 4E05H 4Y8XA 3OU0A 1TPAE 2VIDA 4K5ZA 2BD5A 3U1JB 1UK2A 1UVOA 3H7TA 1SMFE 5HM9A 1EX3A 1DXWA 3TH4H 3ZZCA 3SV6A 1PQ7A 3N7DA 4WWYA 4DOQA 1TLDA 1HJ8A 1C2LA 4F4OC 4DG4A 3HKJB 1HAZB 1G37A 1QCPA 4A6LA 1RS0A 1VCQA 5DKMA 3TIUA 1XVMA 4K1SA 1TNKA 2V35A 5JBBS 4B2CA 2ZGJA 4DW2U 1HBTH 2ZU1A 2BDYA 1ARBA 4XSKU 3ZZ9A 4Y0ZE 4NFFA 1PPFE 3BTEE 2OXSA 3PV2A 2WPDD 2ZDLA 4UEHH 5J4QA 3P8OA 3NXPA 1VITG 4X6NA 1TGSZ 4YO9A 4ABDA 3SU2A 5LGOA 3FVFB 2BD2A 2VH0A 2A5KA 5F8TA 1ELVA 4Y10E 1OPHB 2Y5HA 1G32B 1TOMH 1TMBH 5DN6D 1GJDB 2BD4A 1EJNA 1ETRH 1G3EA 1PPGE 3UNRA 2AGGX 2AS9A 1UTQA 2VVVA 4OS4A 4NSVA 3H5CB 2QXHA 2IJD1 2WPHS 2XBWA 2QE7D 5L2ZH 4CRGA 1AE5A 2ZFPH 5GJ4B 1G3DA 1GMCG 2ZEBA 3GY6A 3F0PA 4XBDA 3SI4H 1SGQE 3SNDA 1O3LA 1CU1A 3UIRA 1GWAA 1YCPH 1ZGVA 4OS5A 1JOUB 1QB9A 1S6HA 3WW7A 2Q6DA 1O2NA 2NWNA 3Q3YA 1W7XH 3F2GA 1C4V2 1V2PT 2STAE 3LC3A 1GHVH 1RTFB 2PW8H 1ELDE 1YLNA 1LPKB 2PP6A 4A92A 2XYAA 5FBEA 4UFFH 3B8JA 1RGQA 1BHXB 1MQ5A 4NWLA 1UCYK 2ZTXA 1NS3A 2Z9GA 3QTOH 1P3EA 4R0IA 3BV9B 1HJAB 1EZQA 1C5WB 3VFEA 1EB1H 4ACAA 1ZJDA 5C1XA 1A0LA 1BTPA 3BTKE 3GCHC 1QR3E 3VEQB 3ATLA 4AB8A 2GV6A 1DPOA 3AW1A 2BDAA 4BAOB 2FOFA 4I8HA 1GHAF 1LVMA 4DT7B 5A8XA 1EAXA 1C2HA 3F0OA 3SU4A 4ABGA 1OSSA 3QZRA 2QN5T 1NY22 1DWEH 4RKJB 3SGAE 4DURA 1FNIA 1LVYA 1L4DA 4KP0A 3ZZ3A 4JCNA 3M5MA 2KZ4A 2JH6D 1GI9B 1C5YB 1W13U 1CA0B 3CENA 4H6TA 5E0JA 3P70B 3I78A 1FQ3A 1DVAH 3SBKA 2BVSH 5AFZH 1D3DB 3MU0A 1OWJA 3P8NA 2VNTA 1IAUA 2BY5X 2J34A 2W26A 5DPAA 1EUFA 1QRXA 2PKAA 3M3VA 5E0HA 1P05A 1DFPA 2BDIA 1SLXB 2QA9E 3GOVB 4HTCH 4FUBA 1DUAA 1MTNB 1GDNA 3ZYDA 7ESTE 1IQGA 1PQ5A 2SGEE 3C1KA 3A85A 5EW1H 3SGBE 3ESTA 2GDDA 1JRTA 1C4U2 1WV7H 3ATKA 3ZZ5A 1NU9A 2ZTZA 3PWBA 4ZUHA 3I29A 4FUFA 1K1NA 2I6SA 1D3TB 2ZDVH 1UTJA 3UR9A 2ZI2H 3HGNA 4LOYH 5C2ZA 3HK3B 3FKSD 2ALPA 1O2WA 2PR3A 2PWXA 2FESH 3LGWA 2ZG0H 3RMLH 2M5TA 2ZDNA 1EAWA 2FI3E 3P17H 2OCVB 2BDCA 4BOHA 4SGAE 1UK3A 1YPEH 1C5MD 1VZQH 1MKXK 1UK4A 2Z3DA 2VIQA 2R3YA 5C17A 1ZGIA 3SV2H 3TH2H 3RXPA 1HB0B 2BX3A 1SGPE 8GCHG 4RSPA 1QGFA 1D3PB 5EQSA 4BTTB 1GDUA 3MU1A 1EAUA 5DG6A 3RXBA 1UMAH 3U9AH 1YM0A 2R3UA 1C9PA 2Z94A 3RM2H 1O3DA 1DSTA 3T62A 5FCKA 1NTPA 6CHAB 1P0SH 1G2MA 1TRMA 1S5SA 3QK1A 3KGPA 2BQ6B 1TA6A 4TY7A 3HATH 1DE7H 1F92A 3OEED 3ATWA 4TY6A 1WDIA 1AN1E 4CBOA 2NU4E 1THPB 1GHYH 1BQYA 2AERH 3FO8D 2K8IA 2YMSC 1KLIH 1DLKB 1SQOA 2CJIA 4Z1MD 2FLRH 1NBME 1TNGA 1YCPM 1E35B 1A3EH 1QL8A 2CHAB 4MNXA 1IQNA 5CHAC 4MNWA 4ZXXH 1QBVH 1GL1A 2GMTC 1TYNA 3IWMA 1ARCA 1SLVB 2ZA5A 1DWBH 2TIOA 1QTFA 2C3SA 5GNDA 1MCVA 2HLDD 3A89A 3LDXH 1KY9A 1J16A 2ALVA 2H9TH 1FIZA 3LGYA 1V2KT 1ABIH 4JYUH 2A0QB 4TWWA 1HAGE 1JRSA 1LQEA 3MMGA 2PFEA 1RXPA 2XCFA 4O9VA 3A7XA 3OY5U 2W3IA 2BDGA 2H5CA 4I8JA 1BTYA 3P6ZB 3D65E 4ZHAA 1GI4A 2OP9A 2G5NA 3RXSA 2FWWA 1NRRH 1GMDF 5A09A 3KYFA 2OC0A 2UUYA 4GPGA 1LKBA 1IQIA 2AMDA 5EODA 4OGYA 1S0RA 2OC7A 1A2CH 3D23A 2VINA 5ABWA 5JPMH 1GBHA 1A61H 3PRBA 1K0HA 1TMUH 1J14A 1YYY1 3SU5A 4HZHA 3A88A 2G81E 2ZCHP 1GBLA 4K1TA 1SI5H 2GJGA 3BTHE 3LJJA 3EAJA 1KLJH 3DSOA 5SGAE 3SO3A 2NU2E 4K1EA 1SBWA 1SHYA 1HRTH 1CHOF 1J15A 3EA7A 2LPRA 2B0FA 2BTCE 3S69A 4I8LA 1QA0A 5AF9H 3F9FA 5DP9A 2FI4E 2JDID 3S7HB 2G55A 3E0PB 1GJ8B 3MU8A 4X1QU 4NGAH 3TGKE 3QN7A 4VGCC 4X1SU 3O8RA 4NWKA 2WYGA 2AIQA 4Z0KA 4H6SB 4ISIH 5EU8A 2VWNA 4NIXA 4GHTA 3EE0B 3VXFH 5F03A 3BTTE 4ZKSU 3T28A 5GCHF 2CF8H 1W2KH 2QV1A 3E0NB 4JYTA 1Y3YA 4BAHB 2ZFFH 1GMHF 1T4UH 1UVSH 1QBNA 1TONA 5HYOA 1QJ7B 4JK6A 3E90B 3SI3H 4AFSA 1GJ7B 4NIWA 3V13A 4XFQA 1K21H 3VXEH 4INKA 2GX4A 2CXVA 4DT4A 2W7SA 2OD3B 4JMYA 2JIZD 3NWUA 3MH6A 3SJOA 1UTKA 2FO9A 4Y71A 3VB3A 2WUBA 4UDWH 4SGBE 1OYQA 3LC5A 5GIBA 3TLOA 1EOJA 2YMSD 4J2YB 4NZQA 2XC0A 4BXWA 1T8MA 2VIPA 1Y3VA 5KEDA 4P00A 3BEIB 1AZZA 5AFYH 3LH3A 1O3BA 2HLCA 1GBJA 4X8VH 1WAYB 2B9LA 1O2MA 2PLXA 2VGCC 3LGTA 4OS1A 3CNRA 4J1YA 3LU9B 1ACBE 1AVXA 4ZROA 2VWLA 1BBRE 3PM3A 5K0HA 1YPJH 2ZPRA 4IBLH 4U2WA 3RM0H 1LHEH 3PTNA 3M3SA 5FAHA 4K2YA 3T29A 3VB5A 1O3KA 1OOKB 3RMMH 1P06A 1G36A 1ZHPA 2WV9A 3ZVFA 1NFWA 1BTWA 2P95A 2Z3CA 4RT0A 1GG6B 1S6LA 2H1UA 1SGRE 2KFWA 2PUQH 1XUKA 1VCWA 1NRNH 4XDEA 1ZSLA 1UJ1A 3AW0A 4FUDA 2IJOB 2F4LA 2IPHA 2ZZUH 3PRDA 3TGJE 1H8DH 4JZIA 2BQWB 3A81A 1UW7A 3A7VA 4RN6A 3KQDA 1E0FD 2CMYA 2C8WB 5HMAA 1Z6JH 2VU8E 1RIWC 1PQ8A 1A5HA 3QUMP 1V2MT 1C2FA 1VITF 1GI3A 1HAHH 2Y82A 4UFGH 1PYTC 3A82A 5HIZA 1S83A 5C0UA 1WXRA 1LHCH 2KX4A 4CH2B 3AVZA 1K1MA 3V3MA 3GY5A 1IQEA 2BLVA 4ESTE 2XRCA 1XXFA 3ZZ4A 1O2VA 2BZ6H 1OWKA 1AZ8A 1JIRA 1YWUA 5DP5A 2G4UA 2ZCLP 1S84A 4A7IB 5EJLA 3RXUA 4GHQA 1AUTC 1GMCF 1O3AA 1P2QA 1HAYB 1XKBC 1FPCH 1OYTH 3RU4D 1UTOA 3RXJA 1PPCE 1DWDH 2GCHG 2BOHB 1ZPBA 1ID5H 4WH8A 1MH0A 5L6NH 2ZDMA 2R9PA 2CF9H 4YTAA 3S9BA 4RI0A 2O9QA 3CP7A 2WPMS 3RXVA 2BLWA 1YPMH 4B6FA 3U28C 3LPRA 5FBIA 1G30B 1SFIA 3PWCA 2WPIS 2J97A 3FP6E 1TABE 4E7RG 1GI8B 1ZHMA 1EFRD 1G2LA 1EPTC 3SORA 1K1PA 4YLUA 2R2MB 4KGAA 2JETC 2V0BA 3PV4A 3TNTA 1AKSA 2OLGA 3VGCB 4H42U 3UR6A 5EIYA 1P9UA 1GBMA 4FXGH 1YPHE 1YCPK 1W12U 5FCRA 3PMHB 4Y7BA 4CR5A 2H5DA 4TYDA 1MTSA 1MU8B 2VJ1A 1O33A 3F68H 5EGMA 1AFQB 2AYWA 3HPTB 4DVAU 5EW2H 2JJ2D 3SNAA 1V2OT 1XKAC 2Q6GA 3PLPA 3EA8A 3SUFA 1QL7A 2PGQB 4I32A 1T8OA 2AGIX 1S82A 2XW9A 1MQ6A 2AEIH 1E36B 1QZ8A 4JK5A 3WY8A 2AGEX 3KYGA 4FU7A 1AU8A 1O5BB 3BTDE 4RKOB 3OEHD 3RXFA 1FUJA 4Y79A 4B73A 2BY9X 4DIIH 1V2NT 3RXAA 2KCPA 1XUFA 1W14U 1EXFA 1HFDA 2V3HH 3PO1C 1CGIE 3VB4A 1TNIA 4A1XA 2DE9A 2V3MA 4MPVA 3U8OH 3ZZDA 1GJ4H 4ZCNA 1F0UA 1TALA 2BD9A 2ULLA 4AX9H 3GICB 2WPKS 3P92A 1K1LA 1PYTD 1NN6A 3SUEA 1YKTA 2AFQB 1CE5A 1FPHH 5HIYA 1HAXB 1SLUB 3BG4C 3QX5H 1FI8A 2PSXA 2J98A 2SGQE 2NU3E 1IHSH 1S85A 2YNBA 1HYLA 1TPOA 3ENSB 1NRPH 4MLFB 3RXRA 1SFQB 3BN9A 3NUMA 1A5GH 3U1IB 1Y3UA 1JIMA 1AB9C 1COWD 1LHGH 1MU6B 1GCTB 4FU8A 5T6GA 2HALA 3ATIA 4Q7ZA 3SU1A 1SVPA 3RU4T 2UWLA 1S0QA 2RA3A 2D26C 2WINI 4WMEA 2KAIA 1LVBA 4OS6A 5EG4A 4UE7H 2Z3EA 5EQQA 1C1MA 5JBAS 3GYLB 3FANA 4Y11E 2R2WU 4X8SH 1F7ZA 3H09A 1IHTH 3ZZ8A 1O2GH 1O5CB 4NZLA 1C5XB 1Q2WA 3GISB 1Z6EA 1NRQH 1V2ST 2GZ9A 1GHWH 1FAXA 3M7TA 1NO9H 5DP8A 1T4VH 1MBMA 2P94A 2ZGXH 3ZVDA 1D6RA 1XUIA 2FOCA 3Q3KA 3RXQA 2FI5E 4IMZA 3MH4A 3GCOA 4CRFA 2OK5A 1O3JA 3F9GA 3S9CA 1PPHE 5CMXH 4DGJA 1BMLA 4D9QA 1HAVB 2C93B 4UONA 3UOUA 1KXDA 2BX4A 1GJ9B 3SU3A 4ASUD 1IQFA 4O97A 1MAXA 4UFDH 1F2SE 2P3UB 4H4FA 4XBBA 3DD2H 2XTTB 3EQ0H 3EYDA 2P59A 1GBFA 1MTVA 4CREA 2A5AA 3F9HA 2QAAA 1TPSA 3A7YA 1WCZA 2A45B 4ISOA 1BJUA 3RC5A 3QTVH 5LPRA 3OYPA 3ZVBA 1SGEE 3RXTA 2D1JA 1CT4E 2FPZA 1BMNH 1TA2A 1DLEA 2Z9KA 1FIWA 2UWOA 2FOHA 4YXWD 2BDBA 2SGDE 4WXIA 1IQLA 2OC1A 1H1BA 3GCTG 1NROH 1O5FH 2XBYA 4FUIA 1FN6A 2M2AA 2ZWLH 2PKSB 5TJXA 3OY6U 1ZMNA 2JH0D 3R3GB 3I77A 1P2JA 4BAQB 4AYVB 1O2IA 1V2TT 1HJAC 1UVPA 2A7CA 2VIVA 1T7CA 1GHXH 3L33A 3W94A 1DY8A 3BSQA 2Y80A 1UHBB 1N8OB 4XE4A 2CV3A 3OSYA 4MG3A 1LPGB 1ZPCA 2NU0E 1O2XA 2SGFE 1O2ZA 4ZXYH 8KME2 1WU1A 4DIHH 1GBDA 1SGIB 4X2VA 1D9IA 2ZNKH 3UREA 2IOTA 1A3BH 3RXIA 2P3FH 4MPUA 4Y6DA 1EOLA 5KGOA 5FX6A 4AFZA 3SQHE 1EPTA 1VGCB 1HXEH 3M61U 5E0GA 1C5TA 1TNJA 1F5KU 4HGCA 5EOKA 1QJ1B 1CA0C 2ZHWH 1A5IA 1O3OA 1C5QA 3DFLA 4I7YH 3GY2A 1WQSA 1FJSA 2TBSA 1TWXB 3UPEA 4XRNA 4Q7XA 1C5RA 4CRBA 5A8ZA 3BTWE 1FXYA 2SGAA 4ABJA 4TT3D 1UCYE 3Q77A 1TGCA 1YGCH 2FIRH 3A7TA 2VVCA 1XXDA 1KDQA 2BLQA 2UUFB 2W7UA 2PHBA 1MBQA 1UTLM 4AGJA 2OTVA 1V2JT 1MTNC 3ZZ6A 2C8ZB 1WUNH 1A0HB 1P57B 1C2DA 4GCHG 1O2QA 3RXOA 3ZIAD 1QURH 1AD8H 2THFB 4RT1A 1DANH 5CDFE 1HIAB 1Y5AT 1C9TA 3WWFA 3U69H 3MOCA 4X1RU 4F55A 4ZKOU 1H9IE 3NKKA 1AY6H 4NG9H 2A2XH 2Y5FA 4CBNA 1ZPZA 1O30A 5BRRE 1OS8A 3URDA 3V12A 2JKHA 5CE1A 1O5AB 5ESTE 4CH8B 1NU7B 1OKXA 5C94A 2Z9LA 1AVGH 1WQVH 3JZ2B 1MUEB 5TCAA 1P10A 4FUHA 1LTOA 1F5RA 2VB0A 1SQAA 1MCTA 3SGQE 3MU5A 3MQKC 3HGPA 1AE8H 4OM9A 1NESE 2BVXH 3GDUA 3DFJA 3HK6B 3TJVA 3QGJA 2P8OB 2SNVA 1T8LA 1ZRBA 2OC8A 2UUKB 6CHAC 3GY4A 2GKVE 1XUHA 3KEEA 1Z7KA 1DICA 1X7AC 1LQDB 4X0WU 4K3JA 1C1OA 1ELTA 2WV5A 4OS7A 1GPZA 7KMEH 1HAPH 2TGAA 8LPRA 5I46H 1DT2A 2VBCA 4UD9H 1N6YA 1P3CA 1B0EA 1UVTH 3G01A 3E3TA 5IYTA 1MABB 1XVOA 1O3NA 5A0BA 2GT8A 2CHAC 1C1QA 3M5NA 1O2SA 1Z8IB 2PSYA 1YC0A 5L2YH 3MO6A 1S6FA 6ESTA 3A87A 2BLOA 2GVFA 2ZFTA 4IW4E 3TH3H 3BG8A 4B2BA 4IN1A 4OS2A 3F3BA 4KTSA 2FZZA 3GDVA 4HI3A 2ANYA 2GCHF 1C5ZB 2Z9IA 2HNTC 4NIYA 3V7TA 1BRBE 3DHKH 4INHA 2ZDKA 1GHBG 1O2TA 1C5OH 2A4OA 1ESTA 1V2WT 4ASHA 5DP4A 1Y3XA 3ZV9A 4LK4A 4Y8YA 1AI8H 5JYIA 2HOBA 5AVDA 3SN8A 1Z1JA 3KN2A 3SJ8A 2ZPQA 2ZP0H 3RXMA 2ZTYA 3UY9A 1YBWA 2YOLA 3N7OA 1AQ7A 4JYVH 1QBOA 1A46H 4CR9A 4X6OA 1YLDA 2HPQH 1SLWB 2QXIA 3TITA 3UWIA 2BY8X 5F8ZA 2FTMA 3A7ZA 1NT1A 2L6OA 3TGIE 4Q80A 2VWOA 1GHAG 1RRKA 3PTBA 1VCPA 1C2MA 1ZHRA 1GI0A 1BTUA 1GJBB 2TRMA 1KTTB 2BOKA 3UTUH 1CT2E 1K9OE 2HVXA 1P2NA 2FX6A 2H2ZA 4WF8A 1DDJA 1BRUP 1TX7A 2QF0A 3SOSA 4B74A 3BF6H 3RDZA 5EJ1A 1CVWH 1SHHB 1WYKA 2TGTA 4AB9A 1KXBA 2K1QA 1BZXE 1TE0A 1B5GH 2P93A 2EI7A 1P2OA 3OFND 5T3HA 3RXGA 5GWZA 4KKDA 2F9UA 2ZDAH 3N7EA 1MKXH 2Q6FA 2ZFSA 1F0SA 2GCTB 5CHBA 2A2QH 2P3TB 1LPZB 1BDAA 4NSYA 2VIOA 2Y6TA 3SW2B 1QIXB 2F9NA 4TSFD 2A7HA 3R0FA 4YZUA 4AG1A 1TX6A 4BNRA 2K0QA 2G4TA 1Y5UT 1KSNA 1PFXC 1Y59T 5FPSA 1Y8TA 2FODA 1O5GH 3T5FH 1GVKB 4K8YA 1GDQA 2ZU3A 4Q4LA 4X2YA 2XBXA 3LGUA 2FOAA 1C5NH 3MHWU 3PV5A 5IK2D 4D76A 1E1QD 1NM6A 2Y7XA 2ZU2A 5EJZA 1HLTH 1L1JA 4LXBH 5C1YA 1O31A 1NFYA 4O03A 3ZZAA 5DK1A 3OTPA 2ZFQH 1GCDA 1TGNA 2FYRA 1ETSH 1FZZA 1QNJA 2UUJB 1BTXA 1QY6A 1QRZA 4MNVA 3O8BA 1V2RT 1THSH 3QDZB 5T6DA 1MKWH 1GG6C 5GXPA 2ZHQH 3PROA 2Q1JA 4B2AA 5FPYA 5FHTA 5DO4H 3RC4A 3BIUH 2QYIA 4Q7YA 3OX7U 4FETA 5L30H 2HRVA 1SOZA 2G8TA 3BEFB 1OWEA 1KXEA 3RC6A 1HDTH 2FOBA 1BHXF 4X2WA 1BRCE 2ZFRH 4HFPB 3A84A 1CBWB 1GBKA 3RXEA 1NC6A 1RTKA 4CHAB 2J95A 2F43B 1O3FA 2ASUB 3LGVA 2OQ5A 1K1JA 2RFKC 1L0ZA 3DT0H 5IDKA 4A1TA 1BTHH 1CQQA 1PPEE 3JZ1B 5A0CA 1DY9A 4XBCA 2CK3D 1LHFH 3N99A 2OUAA 3ZVCA 9ESTA 2QF4A 1L1NA 2H9HA 3HKIB 1Z8RA 2A31A 1BTZA 1IQKA 3SHAH 3TNSA 1MD8A 1BBRH 2FOEA 5E2PA 1C5LH 3L6PA 3RXKA 1M9UA 2BD3A 1O2PA 1UVUH 1V6DA 5GDSH 1E1RD 5FPTA 2FXRA 4B6EA 1HCGA 1GJAB 3QZQA 1TNHA 5GPIB 1FY1A 1KMHB 4YM9A 3F2HA 1S81A 2JH5D 1DOJA 7GCHG 3EDXB 3MI4A 3MNCA 1K28D 3GCTF 3IITA 1QQUA 3ZVGA 2LP6A 3MH7A 3ODDA 1ZTJA 2ANKH 1ZYOA 1YPGH 1MZDA 4KTCA 2PKAB 2QGRA 1SGCA 3GY3A 3S0NA 1TQ0B 4Y76A 2VH6A 5DGJA 1F0TA 2ZKSA 2GDEH 1OWDA 1Z1IA 1J8AA
chains in the Genus database with same CATH topology
3LKWA 1ZOMA 1ELCA 4GVUA 3RUOA 3A86A 2GZ8A 3TVJB 3VGCC 1BJVA 4IN2A 1D3QB 1AWFH 4BAMB 2QXJA 2FLBH 4K60A 5JBCS 1KXCA 2O8MA 1C1TA 3SV8A 1P04A 5AHGH 1O38A 4BAKB 3QGNB 1IQJA 1JWTA 5C5OA 1AFQC 2C4FH 3SJKA 6GCHG 1DSUA 2FX4A 2ANWA 1BOQA 4JZFH 4XOJA 1Q3XA 3TK5A 1Z8JB 1P03A 5DP7A 3SHCH 1O5EH 2FM2A 3Q76A 4FUCA 2ZC9H 1EASA 2OBQA 3O8DA 1TB6H 5HXFA 4AZ2B 4YESB 5BPEA 1HAIH 1TPPA 5ETXA 1P02A 5EQRA 1GVZA 1C2JA 1LDTT 5TCCA 1GHZA 1GBCA 3A8BA 5EXMA 1C5VA 1CA8B 3K2UA 4U01A 4I8GA 4GCHF 5FXLA 2EI6A 3T2NA 3GCNA 3MYWA 1C1WH 3A7WA 5A2MH 2CN0H 1K2I1 3RMNH 2ZF0H 3CS7A 4BANB 1C1NA 3SNEA 3EGKH 1O3MA 1K1OA 2QIQA 1ESAA 8GCHF 3ODFA 3RXDA 2HNTF 1PPZA 1BUIA 1GBAA 2FP7B 4GUXA 2BDHA 3O8CA 2TPIZ 3SJ9A 1GCTC 1FAKH 1L1GA 2XWAA 1AIXH 2FEQH 3SV7A 1BMMH 1SPJA 4YLQH 1GJ5H 3M7UA 2A7JA 5C67A 1AWHB 4BTUB 1C1SA 1TBZH 2B7DH 2ZECA 1FLEE 4A1VA 1UTMA 1MTUA 1GBEA 1O32A 2BB4A 2PTNA 1YP9A 3KHVA 2A4QA 2AMPA 2QY0B 1DM4B 1C2GA 2RCEA 2O8WA 3D62A 3K9XB 1SGFG 2AIPA 1N6XA 1O3GA 2Y7ZA 3KF2A 1K1IA 1SOTA 2O8LA 2HWLB 3UNQA 3OTJE 3BTGE 1ANEA 1H4WA 1HJ9A 2ZCKP 2BD7A 1BRAA 4D7FA 2R0LA 4ABEA 3SV9A 1E38B 1QFKH 3PMJA 4ZHLU 3RXLA 2ZHDA 4TPYA 1QB6A 4B76A 1P12E 1G3CA 1EZSC 1OX1A 1V2UT 2QXGA 2GV7A 5H4IB 2O8UA 4FUJA 5EPNA 4YOGA 1LVOA 1AGJA 1W11U 1CSOE 3FZDA 2TGPZ 1XUGA 4LZ4B 5JBTA 3PMAB 1ZSJA 2ESTE 1OP8A 1GHBF 1P2MA 5ESBA 3B23B 2OQUA 2Y81A 3KQCA 1GBBA 3GCHB 3LONA 1CGJE 1EQ9A 5I25A 3TJNA 2RA0A 2BXTH 1GVLA 1ETTH 5LPFA 2PKSC 1EZUC 2FS9A 2STBE 1SGTA 1ESBA 1O39A 4B71A 3STIA 4TPIZ 3SUGA 2A32A 1QHRB 4CRDA 3RLWH 3ITIA 4WMFA 3VPKA 3U8TH 3VB6A 5F6MA 1E34B 4E7NA 1N8OC 1TRNA 1B0FA 2AH4X 4AFQA 1UTNA 1FN8A 3ELAH 3M36A 1C5SA 4IC5A 4X2XA 4ISLA 3AAVA 5A8YA 2ILNA 2NU1E 2ODPA 1C1PA 1EB2A 1ZR0A 2BQ7B 2F91A 2J4IA 1PPBH 3KCGH 2BXUH 1LCYA 1VGCC 2VVUA 4JZEH 1DX5M 1Q31A 1C1UH 4FUEA 4Y8ZA 2XC4A 5HGGA 4IC6A 4WJG2 1TGTA 2VIWA 3E91A 5T6FA 1O2LA 1HUTH 1T32A 4X1NU 3KNXA 1O3CA 1FMGA 2FYQA 4U30A 2PGBB 3MTYA 3LT3A 1O5DH 3MNSA 2ZU5A 1W3CA 2GTBA 4D9RA 1IOEA 2CGAA 3NZIA 3TK6A 4GSOA 1H9HE 3MNBA 7LPRA 3TU7H 4KELA 4ZKRU 3TJOA 2PUXB 1C4Y2 1SSXA 4AN7A 3BTFE 1FY8E 1YPLH 5HM2A 3MH5A 2J92A 3MFJA 3V0XA 4FUGA 3UUZA 3TJUA 3P95A 1XX9A 4F49A 4IGDA 1KYNA 2XWBI 2ZO3H 4FU9A 1W0YH 2BHGA 1F0RA 1GI5A 1XMNB 2F9BH 3S9AA 2AMQA 1P09A 3FP8E 1HAOH 1D4PB 2V6NA 1SGNE 1QQ4A 2ODYB 4R8TB 2OBOA 4GLYA 1AO5A 1FY4A 1BITA 1G9IE 4U32A 1O3EA 1FONA 1OWIA 3GYMA 4JZDH 2P16A 1P9SA 2F3CE 3LH1A 1QJ6B 1SGDE 3TK9A 2W5EA 3E16B 1W8BH 2EI8A 3K6YA 1WOFA 2QF3A 4FVBA 3ZYEA 5CHAB 2F83A 2GMTB 1RFNA 3ZZ7A 2F9OA 2J9NA 1W0ZU 2P8OC 1WTGH 1OXGA 1EZXC 1BT7A 4BXSA 3MNXA 4YOIA 3M5OA 1EJMA 4OGXA 1O35A 2IN2A 5C20A 4MDSA 1QB1A 2V3OH 1ZZZA 1HGTH 1UCYH 2ZQ1A 1H8IH 3P8GA 2XC5A 3CS0A 3KIDU 5DP6A 1Z8GA 1INCA 2LNCA 6LPRA 4Z6AH 1DS2E 2BZAA 3M35A 1CHGA 1TAWA 4X6MA 2UWPA 3QLPH 2H9EH 3RXHA 4ABBA 1V3XA 3EA9A 1SG8B 3W95A 1DXPA 1EATA 1LHDH 1MKWK 1T8NA 1A1RA 1ZTLA 5JB9S 1AKSB 4NA8A 3MO3A 4QT8C 1SC8U 4X8TH 8ESTE 3LJOA 1TQ7B 2D8WA 4UFEH 2OINA 3E8LA 1NFUA 2W3KA 2ZQ2A 4B1TA 4WMDA 2EA3A 4B75A 1O2UA 3F1SB 1O3HA 2Z9JA 4CRAA 1AHTH 2ZGHA 3A83A 4LZ1H 3Q00A 2QCYA 1FY5A 1A4WH 3RXCA 1HV7A 1P8VC 2EC9H 4DJZB 2J38A 1QA7A 1VITH 3T27A 3GY8A 1MD7A 3U98H 1ELBA 3RLYH 7GCHF 2A5IA 1HXFH 4ABAA 1YLCA 4ZKNU 1HAVA 1SQTA 1HPGA 2GZ7A 1PJPA 1ELEE 2GD4B 4DY7B 1VJAU 1ANDA 4ABFA 2FS8A 1DUEA 2WPJS 1W10U 1ZSKA 3E6PH 4VGCB 1J17T 3E1XB 3A8CA 3TPIZ 2BD8A 3NCLA 4WH6A 1Y3WA 3NPSA 3BTME 5JB8S 1KXFA 2FDAA 1V2VT 4NA9H 3MO9A 1BBRK 4NFEA 1P2IA 1P01A 4THNH 2TGDA 1U6QA 3T25A 3M5LA 1GBIA 1NZQH 4M7GA 4PROA 3UQVA 1GI2A 2PV9B 4JZ1A 1MTWA 1PQAA 1TBQH 1W7GH 1O0DH 4I8KA 2XCNA 3FFGA 2WUCA 4I33A 1LMWB 6GCHF 2WPLS 2SNWA 1G3BA 4FVDA 5G4BA 1SGFA 2B5TB 2BY7X 2ZIQH 3FAOA 3SUDA 5C5NA 1AFEH 1A7SA 4Y7AA 5JDUB 1TRYA 3KQEA 2DUCA 4AORA 2BMGB 1P11E 1L2EA 3SZNA 1HNEE 2Z6BD 3AAUA 4AFUA 1ELFA 1ELAA 2GT7A 2XXLA 3BTQE 3SU0A 3ZZBA 1MAYA 1ZTKA 1UHBA 4D7GA 1WBGB 3DA9B 3RMOH 4ZAEA 3RP2A 4AYYB 1CGHA 1H9LB 2KAIB 2DE8A 2BY6X 2VGCB 5DP3A 2FOGA 4YOJA 2F9PA 2GCTC 2QC2A 2HNTE 1OWHA 1F5LA 3S7KB 2A4RA 3ZVAA 1O2HA 1RJXB 3QWCH 3VB7A 4Y0YE 1MMJN 3PLKA 1FY3A 2BYAX 3F6UH 2WV4A 2B8OH 1K22H 1TGBA 3U8RH 3A80A 1TNLA 1KXAA 5K7RA 5PTPA 1BIOA 1ZJKA 2GP9B 2G5VA 3PB1E 1J9CH 3SU6A 4ABIA 4WY3A 1BCUH 3BEUA 3KL6A 2Y5GA 1SB1H 1ELGA 1L4ZA 2I6QA 3NK8A 2BM2A 1O2YA 5B6OA 2Z7FE 2ZGBH 2ANMH 2YNAA 4K69A 3PLBA 4BTIB 1EP6A 4O3TA 1OP2A 4NIVA 2O8TA 1JMOH 1EKBB 1O34A 1CO7E 1KLTA 1UTPA 1ZMJA 4AOQA 1YPHC 1AUJA 1RIWB 4ZH8A 3M7QA 3RU4E 3STJA 1GGDB 1V2QT 1ZRKA 1THRH 2H6MA 2A1DB 1C5UA 3LOXA 1B7XB 1HIAA 1O3IA 2D2DA 5EPYA 1WTHD 1GI7B 2ZHEH 3UQOA 1VR1H 3GY7A 1C1RA 4AG2A 3MU4A 1EAIA 3LGIA 4A5TS 1LKAA 4ISHH 1XM1A 1FDPA 1GGDC 2XBVA 2RG3A 1JXPA 4IMQA 3B9FH 3A8AA 1CBWC 2J94A 3UWJH 2C8XB 2EEKA 1ANCA 2FOMB 1AMHA 5EXNA 4CHAC 1RTLA 4ZHMU 1BMAA 3SNBA 5C1UA 4MVNA 4WXVA 1P2KA 1O2JA 5J4SA 4MNYA 5FX5A 4NCYA 4KTUA 3KQBA 1GI6A 1EP5A 1NPMA 1GMDG 3Q3XA 2ODQA 5LH8A 2A4GA 2SFAA 1C2EA 1BA8B 4YT6H 4TWYA 1YPKH 1C2KA 3MWIU 1ABJH 3K65B 4CRCA 4YT7H 1OP0A 2R0KA 3GDSA 1GJ6A 3UOPA 3L3TA 4D8NA 1C1VH 1O3PB 2F9VA 3UNSA 1ZLRA 4NA7A 1EPTB 1QL9A 3BIVH 2ZGCA 1BB0B 2G52A 2FTLE 3C27B 3K6ZA 1O2OA 5E8EH 3ZVEA 1LO6A 4ISNA 2JETB 2SGPE 5DJ7A 3QO6A 3T26A 5LPEA 2XNIA 1KIGH 5EXLA 1TFXA 3H7OA 1CHOG 2BVRH 2HGTH 1TBRH 4X1PU 3A8DA 1TOCB 3P8FA 1E37B 2GGVB 4I31A 1UO6A 1FV9A 2VWMA 1SGYE 4ABHA 1NRSH 1SR5C 3ZV8A 2ZU4A 4IS5A 4O3UA 4MPXA 2C8YB 2G51A 1KDQB 4E06H 1ANBA 1JBUH 4X6PA 5C3NA 1AVWA 4INLA 4K8BA 1Y5BT 2PTCE 4MQAA 3LIWA 1VJ9U 1Z71A 5GCHG 3SJIA 1V2LT 4AGKA 2WYJA 1NFXA 3DUXH 1GMHG 3PYHA 5E2OA 3AASA 1GBTA 1O2KA 3URCA 2HPPH 4GAWA 1DWCH 9LPRA 1QRWA 3PO1B 4MTBA 1IQHA 1EJAA 4X8UH 1TX8A 2G00A 1SL3A 1O2RA 3ATMA 1GL0E 1DITH 2ZPSA 4ZMAH 4Q2KA 1O36A 4DCDA 5F8XA 3F9EA 2RDLA 2C90B 1IQMA 2J2UA 3SQEE 1ORFA 3PMBB 2FMJA 3IG6B 1ZMLA 4WVPE 3BG4B 3UFAA 1CT0E 1TMTH 1XUJA 3M37A 1A0JA 1GI1A 1D6WA 1KTSB 1O37A 2ZHFH 3FP7E 1MZAA 1RD3B 1GJCB 3D49H 1C2IA 3M3TA 1AB9B 1N1LA 1WSSH 1TIOA 1T31A 5A0AE 3SNCA 4MPWA 1C5PA 1YF4A 3FZZA 4E05H 4Y8XA 3OU0A 1TPAE 2VIDA 4K5ZA 2BD5A 3U1JB 1UK2A 1UVOA 3H7TA 1SMFE 5HM9A 1EX3A 1DXWA 3TH4H 3ZZCA 3SV6A 1PQ7A 4WWYA 4DOQA 1TLDA 1HJ8A 1C2LA 4F4OC 4DG4A 3HKJB 1HAZB 1G37A 1QCPA 4A6LA 1RS0A 1VCQA 5DKMA 3TIUA 1XVMA 4K1SA 1TNKA 2V35A 5JBBS 4B2CA 2ZGJA 4DW2U 1HBTH 2ZU1A 2BDYA 1ARBA 4XSKU 3ZZ9A 4Y0ZE 4NFFA 1PPFE 3BTEE 2OXSA 2ZDLA 4UEHH 5J4QA 3P8OA 3NXPA 1VITG 4X6NA 1TGSZ 4YO9A 4ABDA 3SU2A 5LGOA 3FVFB 2BD2A 2VH0A 2A5KA 5F8TA 1ELVA 4Y10E 1OPHB 2Y5HA 1G32B 1TOMH 1TMBH 1GJDB 2BD4A 1EJNA 1ETRH 1G3EA 1PPGE 3UNRA 2AGGX 2AS9A 1UTQA 2VVVA 4OS4A 4NSVA 3H5CB 2QXHA 2WPHS 2XBWA 5L2ZH 4CRGA 1AE5A 2ZFPH 5GJ4B 1G3DA 1GMCG 2ZEBA 3GY6A 4XBDA 3SI4H 1SGQE 3SNDA 1O3LA 1CU1A 3UIRA 1GWAA 1YCPH 1ZGVA 4OS5A 1JOUB 1QB9A 1S6HA 2Q6DA 1O2NA 2NWNA 3Q3YA 1W7XH 1C4V2 1V2PT 2STAE 3LC3A 1GHVH 1RTFB 2PW8H 1ELDE 1LPKB 4A92A 2XYAA 5FBEA 4UFFH 3B8JA 1RGQA 1BHXB 1MQ5A 4NWLA 1UCYK 2ZTXA 1NS3A 2Z9GA 3QTOH 1P3EA 4R0IA 3BV9B 1HJAB 1EZQA 1C5WB 3VFEA 1EB1H 5C1XA 1ZJDA 1A0LA 1BTPA 3BTKE 3GCHC 1QR3E 3VEQB 3ATLA 4AB8A 2GV6A 1DPOA 3AW1A 2BDAA 4BAOB 2FOFA 4I8HA 1GHAF 1LVMA 4DT7B 5A8XA 1EAXA 1C2HA 3SU4A 4ABGA 1OSSA 3QZRA 2QN5T 1NY22 1DWEH 4RKJB 3SGAE 4DURA 1FNIA 1LVYA 1L4DA 4KP0A 3ZZ3A 4JCNA 3M5MA 2JH6D 1GI9B 1C5YB 1W13U 1CA0B 3CENA 4H6TA 5E0JA 3P70B 3I78A 1FQ3A 1DVAH 3SBKA 2BVSH 5AFZH 1D3DB 3MU0A 1OWJA 3P8NA 2VNTA 1IAUA 2BY5X 2J34A 2W26A 5DPAA 2PKAA 1EUFA 1QRXA 3M3VA 5E0HA 1P05A 1DFPA 2BDIA 1SLXB 2QA9E 3GOVB 4HTCH 4FUBA 1DUAA 1MTNB 1GDNA 3ZYDA 7ESTE 1IQGA 1PQ5A 2SGEE 3C1KA 3A85A 5EW1H 3SGBE 3ESTA 2GDDA 1JRTA 1C4U2 1WV7H 3ATKA 3ZZ5A 1NU9A 2ZTZA 3PWBA 4ZUHA 3I29A 4FUFA 1K1NA 2I6SA 1D3TB 2ZDVH 1UTJA 3UR9A 2ZI2H 3HGNA 4LOYH 5C2ZA 3HK3B 2ALPA 1O2WA 2PR3A 2PWXA 2FESH 3LGWA 2ZG0H 3RMLH 2M5TA 2ZDNA 1EAWA 2FI3E 3P17H 2OCVB 2BDCA 4BOHA 4SGAE 1UK3A 1YPEH 1C5MD 1VZQH 1MKXK 1UK4A 2Z3DA 2VIQA 2R3YA 1ZGIA 3SV2H 3TH2H 3RXPA 1HB0B 2BX3A 1SGPE 8GCHG 4RSPA 1QGFA 1D3PB 5EQSA 4BTTB 1GDUA 3MU1A 1EAUA 5DG6A 3RXBA 1UMAH 3U9AH