3A87A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 5 minutes)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a87A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a87A02
5HM2A 3TJVA 4MTBA 4IS5A 3ATMA 1MTNC 4AYYB 3NK8A 3RXPA 1ELTA 1GDQA 3H7TA 4FUHA 2V0BA 3AW0A 4F49A 2FP7B 1V2QT 5T3HA 2ZKSA 4NGAH 3O8RA 2HNTF 4U01A 1DOJA 2UUFB 1TX6A 1L1JA 3ZYEA 1C5ZB 1OWHA 3QUMP 1XVMA 1O2YA 1O37A 1D6RA 1RD3B 5HM9A 4RN6A 1HAOH 1C5SA 1ZMLA 3MWIU 4NSYA 1VGCB 1QRZA 1HAYB 1W7GH 1WBGB 1DXWA 3SGBE 2QF0A 2KAIB 4DY7B 1O2XA 5A8XA 1C5QA 1QJ6B 4X8SH 1K1LA 1ZPCA 3SNAA 3BTWE 3VB5A 1JBUH 1BZXE 1O2JA 2J4IA 3F9FA 1LQDB 4GCHF 4B74A 5F6MA 3BTFE 5DKMA 1O2LA 1GL0E 1MTNB 1VR1H 4ZHLU 4ISIH 1GHAF 2ZTYA 1GCTC 1GMHG 1YCPH 2JH0D 1ETSH 5BRRE 1OYTH 1OWIA 3ATLA 1A5IA 1MBMA 2VIOA 2EA3A 3E6PH 1AN1E 4X6PA 3A7VA 3QZQA 4I32A 3T25A 4CRCA 1H9IE 1HAVB 4BTIB 3UNQA 2D8WA 2Q6GA 1LDTT 2F3CE 1HJ8A 2RDLA 2AIPA 1Y5UT 3DHKH 4I8HA 3SV7A 2PUQH 1AQ7A 3ZV9A 5C1XA 3GY8A 3QX5H 4TWYA 3FP7E 4DT7B 3L6PA 3TVJB 4AGJA 3D62A 4AZ2B 4BAKB 1JIMA 3Q77A 1VJ9U 5EQSA 3MU0A 1BITA 1O34A 1IQFA 1WUNH 3LT3A 1NESE 4ISLA 3MMGA 1F0RA 2ZU5A 2W7SA 1S83A 1GCTB 2R0LA 1AZ8A 1KIGH 4MVNA 2O8TA 2F9VA 1O38A 1BTYA 4Q7XA 3VB3A 1SLXB 2XYAA 1Z6EA 2ASUB 4ASHA 1NU7B 4WF8A 1JMOH 1UVSH 1W10U 3RXKA 1YBWA 1FAKH 2ZU4A 3VFEA 2XBXA 3P92A 4MPVA 3KQCA 4YT7H 1SPJA 3MTYA 4X2YA 2P94A 1C5UA 4ABBA 5JBTA 1C2GA 2BX4A 2NU1E 1HPGA 1WQVH 2BZAA 2ZHWH 2PKSC 3URDA 3F9HA 1TYNA 3UUZA 1BBRH 1KLTA 3SJKA 3MOCA 1HJAC 3K65B 2J38A 2CXVA 4JCNA 3A81A 5A0CA 1C9PA 2NU4E 1CE5A 4INKA 3B8JA 1B5GH 3ZZ9A 4JZEH 5GWZA 1E34B 3MH7A 4NIXA 3RXAA 3BSQA 4GAWA 1P2JA 2QYIA 4E7RG 3PLBA 2ZHEH 5EXNA 2VB0A 1HLTH 1Z8GA 3FZZA 2VVUA 3BEUA 3P8NA 4CHAC 1PPHE 3D23A 2CHAC 3RXHA 1FQ3A 1IQNA 1T32A 2ZU3A 3SUDA 2A4RA 4ZAEA 2A31A 2PKSB 3EDXB 2OBQA 3PMAB 4H6TA 3SO3A 3E1XB 3M37A 1ELAA 4KP0A 4NA8A 5EODA 1HJAB 1SGNE 1SGQE 4JZIA 2GZ7A 2ANWA 3SUEA 3P95A 4XSKU 3QDZB 1C2HA 5EW1H 1D6WA 3S0NA 2ZA5A 2O8WA 2ZFPH 2QCYA 1V2NT 1SGYE 1ZSJA 1IOEA 2B5TB 4ZKOU 4H6SB 1DT2A 1C2JA 1FIZA 1G3BA 1V2LT 1ESBA 2FZZA 1H9HE 1A0JA 1P09A 1WTGH 4CHAB 2WPMS 2GCTC 1IHSH 2CHAB 2ODYB 1H9LB 7ESTE 1TRYA 1G9IE 2WUCA 2BQ6B 2FMJA 1OSSA 3GY4A 2ZEBA 4F4OC 1HAGE 2JH6D 4ZKRU 5LGOA 1HB0B 1PPZA 1F5RA 3QTOH 4BOHA 4Y71A 1HAXB 5J4QA 1C1SA 1C5LH 2BD8A 4OS4A 1BJUA 3A8BA 4YOJA 1MTUA 2PKAA 5DK1A 1GJDB 2H9EH 2P95A 1EUFA 1AD8H 1P9SA 1CU1A 3Q76A 5PTPA 1O2TA 2ALVA 5H4IB 1O39A 2Q6DA 2BXUH 3S7KB 3SI3H 1D9IA 1Z7KA 3U1IB 1O2GH 2CV3A 2EI6A 2GCTB 3GISB 3BTGE 1J15A 1GPZA 3BG8A 1V3XA 3H5CB 2J95A 1V2UT 2G52A 2ESTE 1P02A 1C9TA 2ODPA 3LOXA 2BDHA 1HJ9A 2XRCA 1NFYA 2XTTB 1LKBA 1MQ6A 1LHCH 3TNSA 1AVXA 1HDTH 1C2IA 3MU1A 5ETXA 3N7OA 3MNCA 1C5XB 1UTOA 4WJG2 2G51A 4Y11E 2GMTC 4Y7AA 2Y5FA 1VCPA 4E06H 4ZROA 2P3FH 4XBDA 3T28A 1G32B 5F8XA 1WYKA 2Y81A 1P2IA 1TB6H 1GBKA 1KY9A 2XCFA 2IJOB 1MTVA 1TA6A 2GTBA 1AY6H 3MO6A 2H5DA 4JMYA 1IQKA 1X7AC 4X2WA 2BD4A 1HAHH 2VWMA 1TPAE 1A5HA 2OC7A 1KXDA 1AUTC 2FPZA 5EW2H 1TGCA 3MH6A 1FN6A 1CGIE 4WMFA 2AFQB 1BT7A 1JRTA 1G3CA 5FHTA 1PQ8A 2ANMH 2AMDA 3ZZAA 3KQDA 3SJ8A 2BY8X 3F1SB 1RJXB 1E0FD 1THPB 2ZPRA 3T5FH 3KQEA 1V2JT 1BHXF 3U8OH 9LPRA 1ZMJA 3ZVDA 4THNH 1C1PA 1FY4A 2GMTB 5DJ7A 1V2WT 3GY5A 1BRAA 1QA0A 1MTWA 3P8GA 4Y76A 3RXIA 1O3KA 2PV9B 2BDYA 1O3LA 1BB0B 2VWNA 4WXVA 1BTZA 2DE9A 2ZO3H 6LPRA 3RC5A 1O5DH 1O3IA 2A4OA 3LGIA 5DGJA 5DPAA 4LZ1H 1EZXC 1C5WB 5B6OA 1WQSA 5LPEA 1TRNA 1M9UA 2R0KA 4I31A 1HGTH 1TE0A 2GT7A 3AW1A 3V13A 1ZLRA 1C5NH 1SQTA 1V6DA 4X1SU 1MD8A 1GJ7B 2J2UA 3SGAE 1TBQH 3JZ1B 2J94A 4JK5A 1D3DB 1C1QA 3GYMA 3LGUA 3DA9B 3T27A 4YO9A 3RXTA 2UWOA 1BDAA 2A7JA 3M7UA 1MZDA 3RXMA 2Z3CA 4ZXYH 1Y3YA 2GT8A 2G5VA 5F8TA 1QB9A 1O3AA 3WY8A 2FI3E 3DFLA 1GHVH 2KAIA 3PO1C 3STIA 1O2MA 1O2ZA 3IWMA 3RDZA 3ZVGA 1KSNA 4GCHG 2WPHS 3NXPA 1QRXA 2DE8A 3R0FA 2HOBA 4K1SA 1GHAG 1GVLA 5FPSA 4J1YA 3L3TA 4OGXA 3V0XA 1UK4A 4I8KA 5DP8A 4Y8YA 2GGVB 4PROA 3ZZ4A 4I8GA 3OY6U 1RRKA 4FUFA 1MMJN 1YF4A 1ZGIA 5ESBA 2BDAA 4OS1A 4Y79A 2FWWA 1Z8JB 1HAVA 1AVWA 1KYNA 1MKWK 4OS6A 5FXLA 1NPMA 2ZTZA 3RC6A 3RXRA 5GPIB 2D2DA 1O2RA 2BDGA 3ZZ6A 3LPRA 1LTOA 3PO1B 4ZMAH 2Y80A 2G4UA 1OOKB 2EI8A 3OYPA 1B7XB 1PJPA 2ZGBH 1ESTA 1K1JA 1HUTH 1G3EA 1BTXA 1ZRBA 3RMOH 1JIRA 4X1QU 3ZV8A 1QL7A 1XUKA 1AIXH 2NU3E 3NKKA 1EX3A 2ZHQH 3RXEA 4JYTA 1JWTA 2HVXA 2PUXB 1O5BB 2BY7X 1GHZA 1YPLH 2WPJS 3SU6A 1NU9A 3VEQB 4ABAA 1YPJH 1WU1A 1EQ9A 1PYTC 1FPCH 1TRMA 1QJ7B 3RUOA 1QQUA 3BTEE 2BXTH 4KTSA 4AFSA 2XCNA 1EASA 1DWBH 1THRH 2STBE 3IITA 1AVGH 1DITH 4A1XA 1LKAA 2FOHA 1G36A 1KXFA 5AFYH 1TPPA 1MBQA 1AE8H 3RP2A 5DP3A 1CQQA 3MU5A 3VB4A 4AG2A 3MFJA 4UDWH 4GSOA 1C2LA 3TGIE 2Y82A 1P10A 4UFEH 1WTHD 1FI8A 1XUGA 1NT1A 1K1IA 1TX8A 4O03A 4ABFA 1P01A 3NPSA 2ZP0H 1PPGE 2K1QA 1UK3A 1SLUB 3W95A 1RGQA 2W3KA 3UWIA 1KXCA 3QGNB 4K1TA 1XM1A 3RC4A 2GD4B 1PQAA 3BG4C 4B2AA 5FX6A 4WWYA 3UNSA 3AASA 3FANA 3O8DA 2BQWB 1PYTD 4FUBA 2SNVA 1EP5A 1TQ7B 5A0AE 1C1TA 1DS2E 2P3UB 5AVDA 1O32A 1EB1H 4GUXA 3FVFB 4R8TB 1TPSA 3TJOA 1P0SH 5T6FA 4AB8A 3A83A 1K21H 4H4FA 2NWNA 1CBWC 1O3BA 1XMNB 2ZGXH 8GCHG 1GJ5H 1LCYA 1FV9A 3BIVH 1KTTB 3M5LA 3UIRA 1CHOG 1NY22 1MCVA 1RXPA 3E3TA 3EYDA 1AGJA 1UVUH 4M7GA 2Z6BD 3U69H 2RCEA 1UK2A 1GJCB 1AFQC 1GI5A 2ZFSA 5T6DA 1OWDA 1F5KU 4NA9H 5E2OA 3BG4B 3SQEE 4NIYA 3M35A 3UQVA 3D65E 1OS8A 4X6NA 1ZR0A 1GJBB 1HIAB 1O3DA 3VB6A 2VIDA 1TWXB 4WXIA 1SGEE 2J9NA 1ZRKA 1O3GA 1CBWB 5EQRA 1TGTA 1AFEH 3VXEH 2RA0A 3F9EA 3MHWU 1RIWB 3A82A 4HGCA 4UFFH 1BA8B 5L2YH 1DM4B 3KN2A 3LC5A 4GVUA 4Y8ZA 1TX7A 2Z94A 3EQ0H 2C90B 5EU8A 1FXYA 1JOUB 1AFQB 2GZ8A 3QN7A 1F0SA 1P05A 1QTFA 3E0NB 2CN0H 3P8FA 4H42U 1C2EA 3RU4D 4YT6H 2A5AA 1TLDA 1Y8TA 1YPGH 5CHAC 1O3EA 3QTVH 2FXRA 1YYY1 5IDKA 2G00A 1MUEB 3IG6B 1VCQA 3O8CA 2JETB 2P8OB 1W8BH 1W12U 1EOLA 2XC4A 1A7SA 2B9LA 4GLYA 2BY9X 1GI4A 4NFFA 5JYIA 5LPFA 2OTVA 2GV6A 1YPEH 3C27B 1IQGA 1GBHA 3GICB 1GBDA 1O2PA 1ZSKA 1NS3A 4B75A 2FX4A 4MPWA 3RXFA 1LHDH 1KTSB 3A7TA 4FU9A 3SJIA 5GJ4B 3H7OA 3TK6A 4IW4E 4D7FA 3M5OA 3SJ9A 1SB1H 1ANBA 3I29A 2ZTXA 1C5RA 1WAYB 2VWLA 2XBVA 3KNXA 1B0EA 3EA7A 2FYQA 3HGPA 5E2PA 3FAOA 4Y0ZE 2Q6FA 1L4ZA 5CHAB 2ZIQH 1J17T 3A7YA 1CA0C 3DD2H 1C1RA 2CGAA 3KQBA 1UTPA 3BTKE 4UEHH 1UHBB 2XWBI 2FODA 3SV6A 2H5CA 1O5CB 1QQ4A 3KCGH 1FUJA 3BTTE 2XC5A 1F0TA 1O0DH 3UWJH 1NROH 1BRBE 2BOKA 3ZZDA 2UUJB 3BTDE 1O5GH 1Y59T 2W5EA 1ELBA 3A7WA 1DVAH 5A8YA 1TFXA 5I25A 2CF8H 2TGTA 1OP0A 4U2WA 3MNSA 1S82A 1BRCE 3BEIB 1TMTH 5A8ZA 1C1MA 3RLWH 3NZIA 1AB9C 2W26A 5G4BA 2ZI2H 5I46H 1L2EA 2H2ZA 3M36A 1GI9B 1GVKB 1P9UA 3F6UH 4KGAA 1AMHA 5FX5A 1F2SE 1E35B 2UUYA 3ZVAA 1CA0B 2OXSA 3KEEA 2F9BH 1S84A 1YCPK 2SGQE 1BMLA 1SSXA 1HAIH 3FFGA 1XUHA 1INCA 3UY9A 1OWJA 5JB9S 2SFAA 1GI6A 2H1UA 1A1RA 1GBFA 5A2MH 1UO6A 3A80A 2FOAA 2OBOA 3TGKE 1TGNA 4CBOA 4QT8C 1JXPA 2BD9A 2CJIA 3F68H 2Z3EA 1O2QA 5EPYA 4B2BA 3ESTA 3SHAH 2C8YB 2FDAA 3A84A 3PYHA 3UTUH 1TA2A 3KGPA 1AB9B 2ZDAH 3CS0A 2Z9GA 1GDUA 1UMAH 4HZHA 1GHXH 3SI4H 1CVWH 2TGPZ 6ESTA 3LGTA 2C8ZB 1WCZA 4I8JA 1C1WH 3R3GB 1FIWA 1FN8A 1GMCF 8ESTE 4OS7A 1QBNA 1SGFA 1ABJH 2FESH 3MO9A 1GGDC 5EOKA 2FLRH 4UONA 1UTNA 1J8AA 2A4QA 2AYWA 2OQUA 4MNVA 4LK4A 4D7GA 4MG3A 3RXOA 3LGVA 2HALA 4I7YH 4CH8B 2Y6TA 1CT4E 3EE0B 1NC6A 2STAE 1ZSLA 2JKHA 5L2ZH 2G5NA 5FCKA 1J9CH 4AN7A 3ZZ3A 4K5ZA 1BTUA 4JZDH 2QGRA 1MAYA 8GCHF 3RLYH 1JRSA 4ZXXH 2BB4A 1W0ZU 1K1NA 2OUAA 1CHOF 1N8OC 2AERH 3RU4T 1A5GH 4NZQA 2O9QA 1EP6A 1DPOA 1BBRK 1O35A 2ZQ1A 3A8DA 3PWBA 1S85A 1IHTH 3HPTB 1O2NA 3SW2B 3QLPH 1GGDB 2XWAA 2QY0B 3TJNA 1NRSH 3AAUA 4DOQA 5JBAS 5DP5A 1S0QA 4ISOA 5C20A 2ZCHP 3LJJA 2ZDVH 1QCPA 2WV4A 1O3CA 3DUXH 1XUFA 1T7CA 1P2KA 3ELAH 4CH2B 1EATA 2GZ9A 1GJ8B 2QXJA 1EZQA 1OP8A 2O8UA 1O2IA 3SQHE 1O3FA 2HGTH 5EGMA 3A7XA 1G2MA 2ZCKP 3V3MA 1N8OB 1DSUA 3SUFA 3UPEA 3T29A 1NRNH 3RXSA 2A5IA 4WY3A 1Z6JH 1H8IH 4BAMB 5J4SA 4ABIA 1S5SA 1KXBA 5C5NA 4KELA 1DWCH 3Q3KA 1O5EH 4TYDA 3B23B 3K9XB 3A7ZA 5IYTA 4A6LA 3A89A 2ZHDA 5GIBA 4FVDA 3RXLA 1CGJE 1O2VA 1TOMH 2F9UA 2V3OH 4K69A 3SNCA 5LPRA 4AYVB 4IC5A 1UTQA 1T31A 3E90B 3TJUA 1KDQB 1Z1JA 5DG6A 1BHXB 1ARBA 1DX5M 4TWWA 1AKSB 5GXPA 4UFGH 5ABWA 1GBTA 1HXFH 3U8RH 1GI7B 3KL6A 1NZQH 3GDVA 4A92A 2PGBB 3MI4A 4YTAA 1LVMA 3CP7A 4NWLA 2WPLS 2R2MB 1Y3XA 1TBZH 4FXGH 2FI4E 4JZ1A 1LHGH 1GJAB 3TITA 1YKTA 2BTCE 1CO7E 1Y5AT 1J14A 1LVOA 3VB7A 4DW2U 1NFWA 1GHBG 1W13U 2OQ5A 4K2YA 2A2XH 3BF6H 3HATH 2VVCA 3BEFB 1YLCA 1FZZA 5FBEA 2VWOA 4ABHA 2Q1JA 2BD2A 3ITIA 2FX6A 2QAAA 2BQ7B 4YZUA 1C5VA 2BLOA 1P3EA 1UTLM 2OD3B 3VPKA 1O2OA 1ZPZA 3GCOA 4JYUH 1SG8B 4YLUA 2QF3A 1FY3A 4YLQH 4TY7A 3A85A 1A0HB 1DXPA 4BTUB 1A0LA 2W7UA 3HK3B 1ZYOA 1FJSA 1WOFA 1TBRH 4BXSA 1TNIA 1O30A 1NN6A 1ANEA 2NU2E 1RS0A 2FI5E 1VITF 1GI0A 4AG1A 4CRFA 1DWEH 1SLWB 4TPYA 1T8NA 1O3HA 1RTLA 4J2YB 1BJVA 2ZWLH 5HMAA 4NWKA 4ABEA 3GCNA 1YPKH 3PMJA 1AO5A 1QFKH 1OX1A 4X8VH 5F8ZA 2GDEH 2FOGA 3TPIZ 4LOYH 2W3IA 1C2MA 4UFDH 1K1PA 3F9GA 2G8TA 2YOLA 1RTKA 3ATIA 2SNWA 3M7TA 3EAJA 5SGAE 2WINI 2EI7A 1HAPH 3EGKH 2A5KA 4VGCC 3PMHB 1G30B 3RXQA 4TY6A 4X2XA 5DO4H 1BUIA 2ZGHA 4RKOB 3RM0H 1ELDE 1SR5C 1CGHA 3SU5A 1MCTA 3DFJA 2CF9H 2AMQA 3RM2H 2BVSH 1GDNA 1C4Y2 1EAWA 1TALA 1B0FA 5LH8A 2ANKH 4ZH8A 1O3PB 5K7RA 1K2I1 2Z9IA 1G3DA 1GHWH 3UOPA 1ZOMA 3VGCC 4FUEA 1QRWA 1FMGA 1O5AB 2CMYA 1MKWH 4AB9A 2B8OH 1P04A 2IOTA 5HYOA 4I8LA 3P6ZB 3GDSA 1YM0A 1FONA 4VGCB 2AS9A 3OX7U 2VH6A 2VVVA 3V7TA 5F03A 4K8BA 3QO6A 4NSVA 3UQOA 1T8MA 1TNHA 3SUGA 3GYLB 4JK6A 1C1UH 7GCHF 1W3CA 4X8TH 4WH8A 4SGBE 1Q31A 4Q2KA 4Z0KA 2BHGA 6GCHG 1GI8B 1ANDA 1XKBC 2QIQA 5C1YA 2V6NA 4OGYA 3SNDA 1SHHB 4A5TS 1FAXA 1O31A 1KLIH 2C3SA 3QZRA 3ENSB 2C8XB 1UCYK 1QURH 4IBLH 3VGCB 5JBCS 1ESAA 1XVOA 1XX9A 1MTSA 1C5OH 2P59A 3AVZA 1G37A 3SGQE 1GG6C 3SV2H 3TIUA 1HXEH 4I33A 3DT0H 1K9OE 3SU3A 1VITH 4YOIA 2BVRH 1O2HA 1E38B 3M3TA 3T62A 1MH0A 2XW9A 3UOUA 1LHEH 1GJ4H 3NUMA 2C4FH 5EPNA 1ORFA 1SFIA 2A1DB 1GBBA 1DE7H 2ZGCA 3RMNH 1DFPA 1SMFE 4B2CA 1EXFA 2THFB 2GV7A 2R3UA 1HNEE 3HK6B 3MO3A 2TRMA 4NIWA 4X1RU 1SC8U 3PTBA 3HKIB 3KF2A 1FNIA 3U9AH 2ODQA 4K3JA 2ZFFH 2WUBA 2GX4A 4WH6A 4D9QA 2F9OA 2SGAA 2AH4X 1GG6B 5C67A 2HNTC 1GMCG 1HRTH 1J16A 2SGFE 3U8TH 2PKAB 1PPBH 2HPQH 3RU4E 3CS7A 1GJ9B 4D76A 1O2UA 2B7DH 4ZKSU 2BX3A 1XXDA 3ZVFA 1CSOE 2PTNA 2Y7XA 1H4WA 3RXVA 1WSSH 5L30H 4GPGA 5HGGA 1P57B 2FTMA 5DP7A 5GDSH 2AMPA 1TABE 3Q3YA 2FOMB 4XE4A 4Z6AH 1UJ1A 1GHBF 3EA9A 3M7QA 1RIWC 3QK1A 1LVYA 1RFNA 2HLCA 4D8NA 3RXBA 2FOFA 1AU8A 2VIWA 5GCHF 2FEQH 2BOHB 1GWAA 3UR9A 4AFUA 2LPRA 2BY5X 2VINA 2ZPSA 3GCTF 4CRDA 1SGRE 1NFUA 4LXBH 1F5LA 1CA8B 3K6ZA 4K1EA 1OWKA 1GI1A 4U30A 1U6QA 1OXGA 2ZDLA 1F92A 1FPHH 2JETC 1ETRH 4ISNA 2P8OC 4X2VA 2ZPQA 5JDUB 2PLXA 1V2PT 3URCA 1C1OA 1BTHH 1DY9A 3SNBA 3LONA 2OCVB 3AAVA 1C2KA 1GVZA 2VJ1A 1MKXK 3A87A 2OC8A 4FUGA 2AEIH 2GDDA 1ZJDA 1Z1IA 2A7CA 4HI3A 2R3YA 3RXJA 4E05H 3RXCA 5C5OA 1F0UA 1GBJA 4XBBA 1T4UH 2QXHA 1GBCA 1MZAA 4A7IB 2ZC9H 3MH5A 1DUEA 3QWCH 2C8WB 1H8DH 1TNGA 1P06A 2XBWA 2PW8H 4OS2A 2A2QH 3QGJA 3LKWA 4JYVH 4U32A 1MU6B 2P16A 1VCWA 1NM6A 1TGBA 1NFXA 2BLQA 3PV4A 3W94A 1KDQA 1T4VH 4FU7A 2BD3A 5FBIA 4X6OA 3PROA 3MNXA 1YLDA 1S81A 2PSYA 3OY5U 4B71A 3SHCH 1PQ5A 2ZDNA 4MNXA 2HWLB 3GCHC 1A4WH 4NZLA 5A0BA 1ZMNA 3SNEA 1KXEA 1EAUA 1BMMH 2A7HA 5HXFA 5BPEA 3LGYA 1ZTJA 2SGDE 2FOBA 1HAZB 2NU0E 3OSYA 1C2FA 2A4GA 3TK5A 1SL3A 1IQJA 2TPIZ 1OPHB 3E8LA 2F91A 1L1NA 1IQLA 2WPKS 1MU8B 3M5MA 1BQYA 2BDIA 1AE5A 1K22H 3ZZ8A 3STJA 4DVAU 1ANCA 1O3MA 6GCHF 1AZZA 4BAOB 4IC6A 3S9CA 3GCHB 3TH3H 3SV8A 1UVOA 2Y7ZA 1MD7A 3SU0A 3I78A 2OC1A 3ZZ5A 1O33A 1VITG 1A2CH 4IN2A 2ULLA 1TMBH 2Y5HA 1V2MT 2BMGB 4ABDA 1YP9A 1GMDG 1EJNA 4IN1A 2GP9B 3SU2A 1OYQA 2FOEA 5JBBS 4ZUHA 1LPKB 1SVPA 2Z3DA 1C5TA 1DSTA 3UR6A 1SOZA 1GCDA 1TNKA 2PFEA 1BCUH 1A61H 1N6YA 1T8LA 2V3HH 2BD7A 1DDJA 3P17H 5EXLA 3O8BA 1SI5H 1QHRB 1XUJA 3GDUA 1SGDE 5E8EH 3SU4A 1UCYE 2AGEX 3NWUA 2XC0A 2VIVA 1UVTH 5JPMH 3Q3XA 4KTUA 1C5YB 2ANYA 2G81E 3LJOA 2F83A 5L6NH 1C1NA 2SGEE 2Y5GA 1UTJA 3SU1A 3L33A 2LNCA 2O8MA 1EPTC 1TNLA 1V2KT 2PHBA 2PWXA 3MYWA 1HCGA 3OTJE 3ZZCA 1Z8RA 1L0ZA 2FM2A 4BAHB 1PFXC 1T8OA 4X0WU 1C5MD 3LC3A 4RSPA 5DP6A 3KHVA 3G01A 1LPGB 1A46H 1P2NA 1EAIA 4MNWA 1PPEE 2ALPA 1FY8E 5DP9A 4ZHAA 1NRPH 2FO9A 1ABIH 4B76A 2PGQB 1P2OA 3TH2H 1D3PB 4FVBA 4AORA 1UVPA 3FZDA 4AOQA 4X1PU 3ZVBA 1SGTA 1PQ7A 1NO9H 4NIVA 1ZGVA 2EC9H 3RXUA 2YNBA 2F9PA 2I6SA 4IMQA 1EPTB 1LMWB 1VZQH 3GY7A 2RG3A 7GCHG 1SGIB 4AFQA 1HFDA 1K28D 1THSH 1IQHA 4MNYA 1OKXA 4BANB 1Z71A 1UTMA 3RMMH 3U1JB 3LH3A 4CRBA 3JZ2B 3ODDA 2D26C 1ID5H 1EZSC 1UTKA 3M3VA 4Y10E 4TPIZ 4DG4A 4AGKA 1AWHB 2F9NA 3MH4A 4NCYA 4X1NU 2BYAX 4INLA 1C5PA 1AWFH 1Y3WA 5EG4A 1HBTH 4XDEA 1ELGA 3NCLA 2BDBA 4WVPE 1E37B 4CRGA 4ZKNU 1SLVB 4Y7BA 3PLKA 2VNTA 1V2ST 3GY6A 4Q7YA 3BIUH 2BVXH 1TAWA 2BLWA 1SGFG 2O8LA 2TGDA 2WYGA 3M61U 4IGDA 3SORA 2UUKB 2ZU1A 1W2KH 3ZYDA 1D3TB 4LZ4B 2Z9KA 4ZHMU 3U98H 2GCHG 2BD5A 1KLJH 4MPXA 3V12A 5EXMA 5AF9H 3RXDA 3OU0A 1ELFA 2VH0A 4A1VA 1YC0A 1EJAA 1QA7A 1ZHRA 1H1BA 1FY5A 3ATWA 3PM3A 1GL1A 1V2VT 4KKDA 1LQEA 1ZZZA 5CE1A 4K60A 4BXWA 3TH4H 3GY3A 1GBLA 3A86A 3S7HB 2BLVA 2UWPA 1NTPA 1DY8A 3HKJB 1ZTLA 4FU8A 1TMUH 2ZG0H 1BRUP 2FIRH 5K0HA 1W0YH 1WV7H 2ILNA 4FUIA 4MLFB 5FPTA 2ZZUH 2BZ6H 3LDXH 1SHYA 3MU8A 7LPRA 1ARCA 1QBOA 1AUJA 5GCHG 1NRQH 1GBAA 1P8VC 1LHFH 3CENA 3PMBB 1DANH 1YPHE 4XFQA 3BV9B 4DJZB 3GCTG 8LPRA 2FLBH 2Z9JA 1S0RA 5TCCA 3S9AA 4B1TA 1PPFE 2ZNKH 1GHYH 2ZDMA 2ZU2A 1LVBA 1GMHF 2RA3A 4KTCA 2UWLA 4Q7ZA 1HIAA 3VXFH 4B73A 1O2WA 3MNBA 4XBCA 1O2KA 5E0JA 2ZFTA 4OS5A 2ZCLP 2B0FA 1GMDF 2I6QA 1V2RT 1V2OT 1GJ6A 1N1LA 5E0HA 3TNTA 2XXLA 3ZZBA 4AFZA 2FTLE 1YPHC 2BY6X 2Z7FE 1ZJKA 4E7NA 4WMEA 2BDCA 1IQMA 1G2LA 2V35A 4Y6DA 1HV7A 1N6XA 4INHA 1P2MA 4BTTB 4NG9H 4WMDA 1IQIA 4X8UH 7KMEH 4CRAA 1D4PB 4MDSA 2PTCE 2D1JA 3BN9A 1BMAA 1A3EH 2VIPA 3P8OA 2FYRA 1BTWA 1FY1A 5CMXH 5AHGH 4AX9H 4CR9A 4IMZA 5A09A 3GOVB 3K6YA 2SGPE 2C93B 4NA7A 3T2NA 3ATKA 4JZFH 2AGGX 1QL9A 4UE7H 3TLOA 5E0GA 3ZVCA 2XNIA 1ZHPA 1S6FA 3ODFA 4ABJA 2WV5A 1BMNH 2GVFA 5T6GA 3SV9A 3UNRA 1A3BH 1SGCA 1GBIA 1GI3A 2ZECA 2PSXA 1DUAA 2DUCA 1Y3UA 1ELCA 4SGAE 3TGJE 3S69A 1OWEA 1NRRH 1TOCB 1BOQA 1DLEA 5FPYA 1O3OA 1YCPM 2FOCA 3I77A 1CHGA 2ZHFH 3K2UA 2P93A 3BTME 1QR3E 1UHBA 4DIHH 4K8YA 2PR3A 4MQAA 4MPUA 1RTFB 1SBWA 1FLEE 3M3SA 4O3UA 5EQQA 3TU7H 9ESTA 5C3NA 5DP4A 1EJMA 1UCYH 1ACBE 2ZF0H 4CR5A 1DLKB 1P03A 2Z9LA 3RXGA 1QY6A 2FS8A 1GBMA 3UFAA 3SZNA 1AI8H 5ESTE 1TPOA 1P11E 3HGNA 2WPIS 1TGSZ 1TQ0B 2OP9A 1EB2A 3RMLH 1SQAA 1C2DA 3A88A 1ZPBA 2VGCC 4GHTA 1E36B 3UREA 4O9VA 2HRVA 2EEKA 1O3NA 1C4V2 1MQ5A 1Y5BT 3SBKA 2HNTE 1BBRE 1ELVA 2H9HA 1EKBB 5TJXA 2ZFRH 3T26A 2WYJA 4CREA 2IN2A 2G4TA 2R9PA 1CT0E 1TONA 1QJ1B 3C1KA 3FP8E 1F7ZA 4BNRA 5AFZH 4O97A 2OINA 1EOJA 3SOSA 3BTQE 4NFEA 1W11U 3LH1A 1DWDH 4O3TA 3P70B 3ZVEA 1GI2A 1SGPE 1IAUA 1QNJA 1V2TT 3A8CA 2VU8E 4DGJA 1BIOA 1D3QB 3FP6E 1MAXA 2GCHF 1L1GA 2VGCB 2QC2A 3Q00A 4ABGA 3M5NA 3E91A 1GBEA 4X6MA 1SOTA 4FUCA 1CT2E 1DICA 2GKVE 4YM9A 2IPHA 3B9FH 1QGFA 2QXIA 3LU9B 1L4DA 4R0IA 3BTHE 2ZGJA 3A8AA 3ZZ7A 3LGWA 1W7XH 1EAXA 1OP2A 1QB6A 2G55A 4HTCH 4D9RA 2QN5T 3S9BA 3E0PB 2J34A 1P2QA 1O3JA 2H9TH 1AHTH 4HFPB 1BTPA 1Y3VA 1Q2WA 4UD9H 2P3TB 3E16B 3PTNA 2BM2A 1EPTA 1XXFA 1QL8A 2A0QB 2QXGA 1QIXB 1PPCE 2HPPH 1O36A 1EZUC 1ZHMA 4YOGA 2R2WU 2A45B 2ZFQH 1QB1A 2H6MA 1Q3XA 4Y0YE 3EA8A 3KIDU 1MKXH 6CHAC 2TGAA 2AIQA 4XOJA 4A1TA 3SJOA 4DURA 3GY2A 1YGCH 5FCRA 1TIOA 2M5TA 2QA9E 4RKJB 1TNJA 1LPZB 4DIIH 1K1OA 1K1MA 4FUJA 1HYLA 1P3CA 1YPMH 5FAHA 2ZQ2A 1SFQB 1W14U 1XUIA 2FS9A 1FDPA 2AGIX 2ZDKA 1O2SA 1O5FH 4Y8XA 4ESTE 1C4U2 1ZTKA 1Z8IB 4FUDA 3TK9A 1XKAC 5C2ZA 3PB1E 4GHQA 1KXAA 2JH5D 1P12E 2OLGA 3D49H 5JB8S 1QBVH 2TIOA 3MU4A 1ETTH 5TCAA 1SQOA 4YESB 6CHAB 1IQEA 1VGCC 1VJAU 4Q80A 2J92A 4CBNA 8KME2 4BAQB 4ISHH 1C1VH 3LIWA 2QV1A 2XBYA 3SN8A 3PLPA 2A32A 3PWCA 2VIQA 5C1UA 1S6HA 1ELEE 2TBSA 1LO6A 1AKSA 2OC0A 2YNAA 4DCDA
chains in the Genus database with same CATH superfamily
5HM2A 3TJVA 3SYJA 4MTBA 4IS5A 3ATMA 1MTNC 4AYYB 3NK8A 3RXPA 1ELTA 1GDQA 3UAIC 3H7TA 4FUHA 2V0BA 3AW0A 4F49A 2FP7B 1V2QT 5T3HA 2ZKSA 4NGAH 3O8RA 2HNTF 4U01A 1DOJA 2UUFB 1TX6A 1L1JA 3ZYEA 1C5ZB 1OWHA 3QUMP 1XVMA 1O2YA 1O37A 1D6RA 1RD3B 5HM9A 4RN6A 1HAOH 1C5SA 1ZMLA 3MWIU 4NSYA 1VGCB 5CDFE 1QRZA 1HAYB 1W7GH 1WBGB 1DXWA 3SGBE 2QF0A 2KAIB 4DY7B 1O2XA 5A8XA 4Q63A 1C5QA 1QJ6B 4X8SH 1K1LA 1ZPCA 3SNAA 3BTWE 3VB5A 1JBUH 1BZXE 1O2JA 2J4IA 3F9FA 1LQDB 4GCHF 4B74A 5F6MA 3BTFE 5DKMA 1O2LA 1GL0E 1MTNB 1VR1H 4ZHLU 4ISIH 1GHAF 2ZTYA 1GCTC 1GMHG 1YCPH 2JH0D 1ETSH 5BRRE 5KEDA 1OYTH 1OWIA 3ATLA 1A5IA 1MBMA 2VIOA 2EA3A 3E6PH 1AN1E 4X6PA 3A7VA 2QF5A 3QZQA 4I32A 3T25A 4CRCA 1H9IE 1HAVB 4BTIB 3UNQA 2D8WA 3F2HA 2Q6GA 1LDTT 2F3CE 1HJ8A 2RDLA 2AIPA 1Y5UT 3DHKH 4I8HA 3SV7A 2PUQH 1AQ7A 3ZV9A 5C1XA 3GY8A 3QX5H 4TWYA 3FP7E 4DT7B 3L6PA 3TVJB 4AGJA 3D62A 4AZ2B 4BAKB 1JIMA 3UB0A 3Q77A 1VJ9U 5EQSA 3MU0A 3AK5A 1BITA 1O34A 1IQFA 1WUNH 3LT3A 1NESE 4ISLA 3MMGA 1F0RA 2ZU5A 2W7SA 1S83A 2LP6A 1GCTB 4P02A 2R0LA 1AZ8A 1KIGH 4MVNA 2O8TA 2F9VA 1O38A 1BTYA 4Q7XA 3VB3A 1SLXB 2QF4A 4B6FA 2XYAA 1Z6EA 2ASUB 4ASHA 1NU7B 4WF8A 1JMOH 1UVSH 1W10U 3RXKA 1S6LA 1YBWA 1FAKH 2ZU4A 3VFEA 3DSOA 2XBXA 3P92A 4MPVA 3KQCA 4YT7H 1SPJA 3MTYA 4X2YA 2P94A 1C5UA 4ABBA 5JBTA 1C2GA 2BX4A 2NU1E 1HPGA 1WQVH 2BZAA 2ZHWH 2PKSC 3URDA 3F9HA 1TYNA 3FN8A 3UUZA 1BBRH 4M9FA 1KLTA 3SJKA 3MOCA 1HJAC 3K65B 2J38A 4Z1MD 2CXVA 4JCNA 3A81A 5A0CA 1C9PA 2NU4E 1CE5A 4INKA 3B8JA 1B5GH 3ZZ9A 4JZEH 5GWZA 1E34B 3MH7A 4NIXA 3RXAA 3BSQA 4GAWA 1P2JA 2QYIA 4E7RG 3PLBA 2ZHEH 5EXNA 2VB0A 1HLTH 1Z8GA 3F2FA 3FZZA 2VVUA 3BEUA 3P8NA 4CHAC 1PPHE 3D23A 3MQKC 2CHAC 3RXHA 1FQ3A 1IQNA 1T32A 2ZU3A 3SUDA 2A4RA 4ZAEA 2A31A 2PKSB 3EDXB 2OBQA 3PMAB 4H6TA 3SO3A 3E1XB 3M37A 1ELAA 4KP0A 4NA8A 5EODA 1HJAB 1SGNE 1SGQE 4JZIA 2GZ7A 2ANWA 3SUEA 3P95A 4XSKU 3QDZB 1C2HA 5EW1H 1D6WA 3S0NA 2ZA5A 2O8WA 2ZFPH 2QCYA 1V2NT 1SGYE 1ZSJA 1IOEA 2B5TB 4ZKOU 4H6SB 1DT2A 1C2JA 1FIZA 1G3BA 1V2LT 1ESBA 2FZZA 1H9HE 1A0JA 1P09A 1WTGH 4CHAB 2WPMS 2GCTC 1IHSH 2CHAB 2ODYB 1H9LB 7ESTE 1TRYA 1G9IE 2WUCA 2BQ6B 2FMJA 1OSSA 3GY4A 2ZEBA 4F4OC 1HAGE 2JH6D 4FETA 4ZKRU 5LGOA 1HB0B 1PPZA 1F5RA 3QTOH 4BOHA 4Y71A 1HAXB 5J4QA 1C1SA 1C5LH 2BD8A 4OS4A 1BJUA 3A8BA 4YOJA 1MTUA 2PKAA 5DK1A 1GJDB 2H9EH 2P95A 1EUFA 1AD8H 1P9SA 1CU1A 3Q76A 5PTPA 1O2TA 2ALVA 5H4IB 1O39A 2Q6DA 2BXUH 3S7KB 3SI3H 1D9IA 1Z7KA 3U1IB 1O2GH 2CV3A 2EI6A 2GCTB 3GISB 3BTGE 1J15A 1GPZA 3BG8A 1V3XA 3H5CB 2J95A 1V2UT 2G52A 2ESTE 1P02A 1C9TA 2ODPA 3LOXA 2BDHA 1HJ9A 2XRCA 1NFYA 2XTTB 1LKBA 1MQ6A 1LHCH 3TNSA 1AVXA 1HDTH 1C2IA 3MU1A 5ETXA 3N7OA 3MNCA 1C5XB 1UTOA 4WJG2 2G51A 4Y11E 2GMTC 4Y7AA 2Y5FA 1VCPA 4E06H 4ZROA 2P3FH 4XBDA 3T28A 1G32B 5F8XA 1WYKA 2Y81A 1P2IA 1TB6H 1GBKA 1KY9A 2XCFA 2IJOB 1MTVA 1TA6A 2GTBA 1AY6H 3MO6A 2H5DA 4JMYA 1IQKA 1X7AC 4X2WA 2BD4A 1HAHH 2VWMA 1TPAE 1A5HA 2OC7A 1KXDA 1AUTC 2FPZA 4RT1A 5EW2H 1TGCA 3MH6A 1FN6A 1CGIE 4WMFA 2AFQB 1BT7A 1JRTA 2JDID 1G3CA 5FHTA 3OAAD 1PQ8A 2ANMH 2AMDA 3ZZAA 1H8HD 3KQDA 3SJ8A 2BY8X 3F1SB 1RJXB 5FL7D 1E0FD 1THPB 2ZPRA 3T5FH 3KQEA 1V2JT 1BHXF 3U8OH 9LPRA 1ZMJA 3ZVDA 4THNH 1C1PA 1FY4A 2GMTB 5DJ7A 1V2WT 3GY5A 1BRAA 1QA0A 1MTWA 3P8GA 4Y76A 3RXIA 1O3KA 2PV9B 2BDYA 1O3LA 1BB0B 2VWNA 4WXVA 3EE7A 1BTZA 2DE9A 2ZO3H 6LPRA 3RC5A 2HVYB 1O5DH 1O3IA 2A4OA 3LGIA 5DGJA 5DPAA 4LZ1H 1EZXC 1C5WB 5B6OA 1WQSA 5LPEA 1TRNA 5EJLA 1M9UA 2R0KA 4I31A 1HGTH 1TE0A 2GT7A 3FO8D 3AW1A 3V13A 1ZLRA 1C5NH 1SQTA 1V6DA 4X1SU 1MD8A 1GJ7B 5EJ1A 2J2UA 3SGAE 1TBQH 3JZ1B 2J94A 4JK5A 1D3DB 1C1QA 3GYMA 3LGUA 3DA9B 3T27A 4YO9A 3RXTA 2UWOA 1BDAA 2A7JA 3M7UA 1MZDA 3RXMA 2Z3CA 4ZXYH 1Y3YA 2GT8A 2G5VA 5F8TA 1QB9A 1O3AA 2IPQX 3WY8A 2FI3E 3DFLA 1GHVH 2KAIA 3PO1C 3STIA 1O2MA 1O2ZA 2W6JD 3IWMA 3RDZA 3ZVGA 1KSNA 4GCHG 2WPHS 3NXPA 1QRXA 2DE8A 3R0FA 2HOBA 4K1SA 1GHAG 1GVLA 5FPSA 4J1YA 3L3TA 4OGXA 3V0XA 1UK4A 4I8KA 5DP8A 4Y8YA 2GGVB 4PROA 3ZZ4A 4I8GA 3OY6U 1RRKA 3KQ5A 4FUFA 1MMJN 1YF4A 1ZGIA 5ESBA 2BDAA 4OS1A 4Y79A 2FWWA 1Z8JB 1HAVA 2RFKC 1AVWA 1KYNA 1MKWK 4OS6A 5FXLA 1NPMA 2ZTZA 3RC6A 3RXRA 1SQRA 5GPIB 2GJGA 2D2DA 1O2RA 2BDGA 3ZZ6A 3LPRA 2F43B 1LTOA 3PO1B 4ZMAH 2Y80A 2G4UA 1OOKB 2EI8A 3OYPA 1B7XB 1PJPA 1VKYA 1ESTA 1K1JA 2ZGBH 4ACBA 1HUTH 1G3EA 1BTXA 1ZRBA 3RMOH 1JIRA 4X1QU 3ZV8A 1QL7A 1XUKA 1AIXH 2NU3E 3NKKA 3OTPA 1EX3A 2ZHQH 3RXEA 4JYTA 1JWTA 3WW7A 2HVXA 2PUXB 1O5BB 2BY7X 1GHZA 1YPLH 2WPJS 3SU6A 1NU9A 3VEQB 4ABAA 1YPJH 1WU1A 1EQ9A 1PYTC 1QZ8A 1FPCH 1TRMA 1QJ7B 3RUOA 1QQUA 3BTEE 2BXTH 4KTSA 4AFSA 2XCNA 1EASA 1DWBH 1THRH 2STBE 3IITA 1AVGH 1DITH 4A1XA 1LKAA 2FOHA 1G36A 1KXFA 5AFYH 1TPPA 1MBQA 1AE8H 3RP2A 5DP3A 1CQQA 3MU5A 5HIZA 3VB4A 4AG2A 3MFJA 4UDWH 4GSOA 1C2LA 3TGIE 2Y82A 1P10A 4UFEH 1WTHD 1FI8A 1XUGA 1NT1A 1K1IA 1TX8A 2KCAA 4O03A 4ABFA 4B6EA 1P01A 3NPSA 2ZP0H 1PPGE 2K1QA 1UK3A 1SLUB 3W95A 1RGQA 2W3KA 3UWIA 1KXCA 3QGNB 4K1TA 1XM1A 3RC4A 2GD4B 1PQAA 3BG4C 4B2AA 5FX6A 4WWYA 3UNSA 1YWUA 3AASA 3FANA 3O8DA 2BQWB 1EFRD 1PYTD 2SNVA 4FUBA 1EP5A 1TQ7B 5A0AE 1C1TA 1DS2E 2P3UB 5AVDA 1O32A 1EB1H 4GUXA 3FVFB 4R8TB 1TPSA 3TJOA 1P0SH 5T6FA 1MABB 4AB8A 3A83A 1K21H 4H4FA 2NWNA 2KM0A 1CBWC 2QE7D 1O3BA 1XMNB 2ZGXH 8GCHG 1GJ5H 1LCYA 1FV9A 3BIVH 1KTTB 3M5LA 3UIRA 1CHOG 1NY22 1MCVA 1RXPA 3E3TA 3EYDA 1AGJA 2YMSB 1UVUH 4M7GA 2Z6BD 3U69H 2RCEA 1UK2A 1GJCB 1AFQC 1GI5A 2ZFSA 5T6DA 1OWDA 1F5KU 4NA9H 5E2OA 3BG4B 3SQEE 4RI0A 4NIYA 3M35A 3UQVA 3D65E 1OS8A 4X6NA 1ZR0A 1GJBB 1HIAB 1O3DA 2L74A 3VB6A 5DN6D 2VIDA 1TWXB 4WXIA 1SGEE 2J9NA 1ZRKA 1O3GA 1CBWB 5EQRA 1TGTA 1AFEH 3VXEH 2RA0A 3F9EA 3MHWU 1RIWB 1SKYE 2WPDD 3A82A 4HGCA 4UFFH 1BA8B 5L2YH 1DM4B 3KN2A 3LC5A 4GVUA 4Y8ZA 1TX7A 2Z94A 1FX0B 3EQ0H 2C90B 5EU8A 1FXYA 1JOUB 1AFQB 2GZ8A 3QN7A 1F0SA 1COWD 1P05A 1QTFA 3E0NB 2CN0H 3P8FA 4H42U 1C2EA 3RU4D 4YT6H 2A5AA 1TLDA 1Y8TA 1YPGH 4XRNA 5CHAC 1O3EA 3QTVH 2FXRA 1YYY1 5IDKA 2G00A 1MUEB 3IG6B 1VCQA 3O8CA 2JETB 2P8OB 2WZQA 1W8BH 1W12U 1EOLA 2XC4A 3N7EA 1A7SA 2B9LA 4GLYA 2BY9X 1GI4A 4NFFA 1WXRA 5JYIA 5LPFA 2OTVA 2GV6A 1YPEH 3C27B 1IQGA 1GBHA 3GICB 1GBDA 1O2PA 1ZSKA 1NS3A 4B75A 2FX4A 4MPWA 3RXFA 1LHDH 1KTSB 3A7TA 4FU9A 3SJIA 5GJ4B 3F0OA 3H7OA 3TK6A 4IW4E 4D7FA 3M5OA 3SJ9A 1SB1H 1ANBA 3I29A 2ZTXA 1C5RA 1WAYB 2VWLA 2XBVA 3KNXA 1B0EA 3EA7A 2FYQA 3HGPA 5E2PA 3FAOA 4Y0ZE 2Q6FA 1L4ZA 5CHAB 2ZIQH 1J17T 3A7YA 1CA0C 3DD2H 1C1RA 2CGAA 3KQBA 1UTPA 3BTKE 4UEHH 1UHBB 3F2GA 2XWBI 2FODA 3SV6A 2H5CA 1O5CB 1QQ4A 3KCGH 1FUJA 3BTTE 2XC5A 1F0TA 4ZCNA 1O0DH 3UWJH 1OHHD 1NROH 1BRBE 2BOKA 3ZZDA 2UUJB 3BTDE 1O5GH 1Y59T 2W5EA 1ELBA 3A7WA 1DVAH 5A8YA 1TFXA 5I25A 2CF8H 2TGTA 1OP0A 4U2WA 3MNSA 1S82A 1BRCE 3BEIB 1TMTH 5A8ZA 1C1MA 3RLWH 3NZIA 1AB9C 2W26A 5G4BA 2ZI2H 5I46H 1L2EA 2H2ZA 3M36A 1GI9B 1GVKB 1P9UA 3F6UH 4KGAA 1AMHA 1E1QD 5FX5A 1F2SE 2M2AA 1E35B 2UUYA 3ZVAA 1CA0B 2OXSA 3KEEA 2F9BH 1S84A 1YCPK 4F48B 2SGQE 1BMLA 1SSXA 1HAIH 3FFGA 1XUHA 1INCA 3UY9A 1OWJA 5JB9S 2SFAA 1GI6A 2H1UA 1A1RA 1GBFA 3PRDA 5A2MH 1UO6A 3A80A 2FOAA 2OBOA 3TGKE 1TGNA 4CBOA 4QT8C 1JXPA 2BD9A 2CJIA 3F68H 2Z3EA 1O2QA 5EPYA 4B2BA 3ESTA 3SHAH 5KECA 2C8YB 2FDAA 3A84A 3PYHA 3UTUH 1TA2A 3KGPA 3DSGA 1AB9B 2ZDAH 3CS0A 2Z9GA 1GDUA 1UMAH 4HZHA 1GHXH 3SI4H 1CVWH 2TGPZ 6ESTA 3LGTA 2C8ZB 1WCZA 4I8JA 1C1WH 3R3GB 1FIWA 1FN8A 1KMHB 1GMCF 8ESTE 4OS7A 1QBNA 1SGFA 1ABJH 2FESH 3MO9A 1GGDC 5EOKA 2FLRH 4UONA 1UTNA 1J8AA 2A4QA 2AYWA 2OQUA 4MNVA 4LK4A 4D7GA 4MG3A 3RXOA 3LGVA 2HALA 4I7YH 4CH8B 2Y6TA 1CT4E 3EE0B 1NC6A 2STAE 1ZSLA 2JKHA 5L2ZH 2G5NA 5FCKA 1J9CH 4AN7A 3ZZ3A 4K5ZA 1BTUA 4JZDH 2QGRA 1MAYA 8GCHF 2V7QD 1JRSA 3RLYH 4ZXXH 2BB4A 1W0ZU 1K1NA 2OUAA 1CHOF 1N8OC 2AERH 3RU4T 1A5GH 4NZQA 2O9QA 1EP6A 1DPOA 2F4LA 1BBRK 1O35A 2ZQ1A 3A8DA 3PWBA 1S85A 4OM9A 1IHTH 3HPTB 1O2NA 3SW2B 4XD7D 1GGDB 2XWAA 2QY0B 3TJNA 1NRSH 3AAUA 4DOQA 5JBAS 5DP5A 1S0QA 4ISOA 5C20A 1YY3A 2ZCHP 3LJJA 2ZDVH 1QCPA 2WV4A 3OEED 1O3CA 3DUXH 1XUFA 1T7CA 1P2KA 3ELAH 4CH2B 1EATA 2GZ9A 1GJ8B 2QXJA 1EZQA 1OP8A 2O8UA 1O2IA 3SQHE 1O3FA 5F53A 2HGTH 5EGMA 3A7XA 1G2MA 2ZCKP 3V3MA 1N8OB 1DSUA 3SUFA 3UPEA 3T29A 5C0TA 1NRNH 3RXSA 2A5IA 4WY3A 3WWBA 1Z6JH 1H8IH 2J98B 4BAMB 5J4SA 4ABIA 1S5SA 1KXBA 2KFWA 5C5NA 4KELA 1DWCH 3Q3KA 1O5EH 4TYDA 3B23B 3K9XB 3A7ZA 5IYTA 4A6LA 3A89A 2ZHDA 5GIBA 4FVDA 3RXLA 1CGJE 1O2VA 1TOMH 2F9UA 2V3OH 4K69A 3SNCA 5LPRA 4AYVB 4IC5A 1UTQA 1T31A 3E90B 3TJUA 1KDQB 1Z1JA 5DG6A 1BHXB 1ARBA 1DX5M 4TWWA 1AKSB 4DT4A 5GXPA 4UFGH 5ABWA 2J5UA 1GBTA 1HXFH 3U8RH 1GI7B 3KL6A 1NZQH 3GDVA 4A92A 2PGBB 3MI4A 4YTAA 1LVMA 3CP7A 4NWLA 2WPLS 4TSFD 2R2MB 1Y3XA 1TBZH 4FXGH 2FI4E 4JZ1A 1LHGH 1GJAB 2XNDD 3TITA 1YKTA 2BTCE 1CO7E 1Y5AT 1J14A 1LVOA 3VB7A 4DW2U 1NFWA 2PP6A 1GHBG 3PV5A 1W13U 2OQ5A 4K2YA 2A2XH 3BF6H 3HATH 2VVCA 3BEFB 1YLCA 1FZZA 5FBEA 2VWOA 4ABHA 2Q1JA 2BD2A 3ITIA 2FX6A 4FOUC 2QAAA 2BQ7B 4YZUA 1C5VA 2BLOA 1P3EA 1UTLM 2OD3B 3VPKA 1O2OA 1ZPZA 3GCOA 4JYUH 1SG8B 4YLUA 2QF3A 1FY3A 4YLQH 4TY7A 3A85A 1A0HB 1DXPA 4BTUB 1A0LA 2W7UA 3HK3B 1ZYOA 1FJSA 1WOFA 3N7DA 1TBRH 4BXSA 1TNIA 1O30A 1NN6A 1ANEA 2NU2E 1RS0A 2FI5E 1VITF 2JJ1D 1GI0A 4AG1A 4CRFA 1DWEH 1SLWB 4TPYA 1T8NA 1O3HA 1RTLA 4J2YB 1W0JD 1BJVA 2ZWLH 5HMAA 4NWKA 4ABEA 3GCNA 1YPKH 3PMJA 1AO5A 1QFKH 1OX1A 4X8VH 5F8ZA 3OFND 2GDEH 2FOGA 3TPIZ 4LOYH 2W3IA 1C2MA 4UFDH 1K1PA 3F9GA 2G8TA 2YOLA 1RTKA 3ATIA 3NRLA 2SNWA 3M7TA 3EAJA 5SGAE 2WINI 4HG6A 2EI7A 1HAPH 3EGKH 2A5KA 4VGCC 3PMHB 1G30B 3RXQA 4TY6A 4X2XA 5DO4H 1BUIA 2ZGHA 4RKOB 3RM0H 1ELDE 1SR5C 1CGHA 3SU5A 1MCTA 3DFJA 1BMFD 2CF9H 2AMQA 3RM2H 2BVSH 1GDNA 1C4Y2 3SZEA 1EAWA 1TALA 1B0FA 5LH8A 2ANKH 4ZH8A 1O3PB 5K7RA 1K2I1 2Z9IA 1G3DA 1GHWH 3UOPA 1ZOMA 3VGCC 4FUEA 1QRWA 1FMGA 1O5AB 2CMYA 1MKWH 4AB9A 2B8OH 1P04A 2IOTA 5HYOA 4I8LA 3P6ZB 3WWFA 3GDSA 1YM0A 1FONA 4VGCB 2AS9A 3OX7U 2VH6A 2VVVA 3V7TA 5F03A 4K8BA 3QO6A 4NSVA 3UQOA 4TT3D 1T8MA 1TNHA 3SUGA 3GYLB 4JK6A 1C1UH 7GCHF 1W3CA 4X8TH 4WH8A 4SGBE 1Q31A 4Q2KA 4Z0KA 2BHGA 6GCHG 1GI8B 1ANDA 1XKBC 2QIQA 5C1YA 2V6NA 4OGYA 3SNDA 1SHHB 4A5TS 1FAXA 1O31A 1KLIH 2C3SA 3QZRA 3ENSB 3PRBA 2C8XB 1UCYK 1QURH 4IBLH 3VGCB 5JBCS 1ESAA 1XVOA 1XX9A 1MTSA 1C5OH 2P59A 3AVZA 1G37A 3SGQE 1GG6C 3SV2H 3TIUA 1HXEH 4I33A 3DT0H 1K9OE 3SU3A 1VITH 4YOIA 2BVRH 1O2HA 1E38B 3M3TA 3T62A 1MH0A 2XW9A 3UOUA 1LHEH 1GJ4H 3NUMA 2C4FH 5EPNA 1ORFA 1SFIA 2A1DB 1GBBA 1DE7H 2ZGCA 3RMNH 1DFPA 1SMFE 3KYFA 4B2CA 1EXFA 2THFB 2GV7A 2R3UA 1HNEE 3HK6B 3MO3A 2TRMA 4NIWA 4X1RU 1SC8U 5IK2D 3PTBA 3HKIB 3QLPH 3KF2A 1FNIA 3U9AH 2ODQA 4K3JA 2ZFFH 2WUBA 2GX4A 2YMSC 4WH6A 4D9QA 2F9OA 2SGAA 2AH4X 1GG6B 5C67A 2HNTC 1GMCG 1W0KD 1HRTH 1J16A 2SGFE 3U8TH 2PKAB 4ASUD 1PPBH 2HPQH 3RU4E 3CS7A 1GJ9B 4D76A 1O2UA 2B7DH 4ZKSU 2BX3A 1XXDA 3ZVFA 1CSOE 2PTNA 2Y7XA 1H4WA 3RXVA 1WSSH 5L30H 4GPGA 5HGGA 2AHME 1P57B 2FTMA 5DP7A 5GDSH 2AMPA 1TABE 3Q3YA 2FOMB 4XE4A 4Z6AH 1UJ1A 1GHBF 3EA9A 3M7QA 1RIWC 3QK1A 1LVYA 1RFNA 2HLCA 4D8NA 3RXBA 2FOFA 1AU8A 2VIWA 2YMSD 5GCHF 2FEQH 2BOHB 1GWAA 3UR9A 3VG8A 4AFUA 2LPRA 2BY5X 2VINA 2ZPSA 3GCTF 4CRDA 1SGRE 1NFUA 4LXBH 1F5LA 1CA8B 3K6ZA 4K1EA 1OWKA 1GI1A 4U30A 1U6QA 1OXGA 2ZDLA 1F92A 1FPHH 2JETC 1ETRH 4ISNA 2P8OC 4X2VA 2ZPQA 5JDUB 2PLXA 1V2PT 3URCA 1C1OA 1BTHH 1DY9A 3SNBA 3LONA 2OCVB 3AAVA 1C2KA 1GVZA 2VJ1A 1MKXK 3A87A 4F55A 2OC8A 4FUGA 2AEIH 2GDDA 1ZJDA 1Z1IA 2A7CA 4HI3A 2R3YA 3RXJA 4E05H 3RXCA 5C5OA 1F0UA 1GBJA 4XBBA 2KCYA 1T4UH 2QXHA 1GBCA 1MZAA 4A7IB 2EY4C 2ZC9H 3MH5A 1DUEA 3QWCH 2C8WB 1H8DH 2KX4A 1TNGA 1P06A 5HKKD 2XBWA 2PW8H 2RDEA 4OS2A 2A2QH 1YLNA 3QGJA 1NBMD 3LKWA 4JYVH 4U32A 1MU6B 2P16A 1VCWA 1NM6A 1TGBA 1NFXA 2BLQA 3PV4A 3W94A 1KDQA 1T4VH 4FU7A 2BD3A 5FBIA 4X6OA 3PROA 3MNXA 1YLDA 1S81A 2PSYA 3OY5U 4B71A 1H8ED 3SHCH 2IJD1 1PQ5A 5B6LA 2ZDNA 4MNXA 2HWLB 3GCHC 1UW7A 1A4WH 4NZLA 5A0BA 1ZMNA 3SNEA 1KXEA 2JJ2D 1EAUA 1BMMH 2A7HA 5HXFA 2J97A 5BPEA 3LGYA 1ZTJA 3OEHD 2SGDE 2FOBA 1HAZB 2NU0E 3OSYA 1C2FA 2A4GA 1E1RD 3TK5A 1SL3A 1IQJA 2TPIZ 1OPHB 3E8LA 2F91A 1L1NA 1IQLA 2WPKS 1MU8B 3M5MA 1BQYA 2BDIA 1AE5A 1K22H 3ZZ8A 3STJA 4DVAU 1ANCA 1O3MA 6GCHF 1AZZA 4BAOB 4IC6A 3S9CA 3GCHB 3TH3H 3SV8A 1UVOA 2Y7ZA 1MD7A 3SU0A 3I78A 2OC1A 3ZZ5A 1O33A 1VITG 1A2CH 4IN2A 2ULLA 1TMBH 2Y5HA 1V2MT 2BMGB 4ABDA 1YP9A 1GMDG 1EJNA 4IN1A 2GP9B 3SU2A 1OYQA 2FOEA 5JBBS 4ZUHA 1LPKB 1SVPA 2Z3DA 1C5TA 1DSTA 3UR6A 1SOZA 1GCDA 1TNKA 2PFEA 1BCUH 1A61H 1N6YA 1T8LA 2V3HH 2BD7A 1DDJA 3P17H 5EXLA 3O8BA 1SI5H 1QHRB 1XUJA 3GDUA 1SGDE 4Q4LA 5E8EH 3SU4A 1UCYE 2AGEX 3NWUA 2XC0A 2VIVA 1UVTH 5JPMH 3Q3XA 4KTUA 1C5YB 2ANYA 2G81E 3LJOA 2F83A 5L6NH 1C1NA 2SGEE 2Y5GA 1UTJA 3SU1A 3L33A 1EPTC 2LNCA 2O8MA 1TNLA 1V2KT 2PHBA 2PWXA 3MYWA 1HCGA 3OTJE 3ZZCA 1Z8RA 1L0ZA 3FOAA 2FM2A 4BAHB 1PFXC 1T8OA 4X0WU 1C5MD 3LC3A 4RSPA 5DP6A 3KHVA 3G01A 1LPGB 1A46H 1P2NA 1EAIA 4MNWA 1PPEE 2ALPA 1FY8E 5DP9A 4ZHAA 1NRPH 2FO9A 1ABIH 4B76A 2PGQB 1P2OA 3TH2H 1D3PB 4FVBA 4AORA 1UVPA 3FZDA 4AOQA 4X1PU 3ZVBA 1SGTA 1PQ7A 1NO9H 4NIVA 1ZGVA 2EC9H 3RXUA 2YNBA 2F9PA 2I6SA 4IMQA 1EPTB 1LMWB 1VZQH 3GY7A 5DSFA 2RG3A 7GCHG 1SGIB 4AFQA 1HFDA 1K28D 1THSH 2WV9A 1IQHA 4MNYA 1OKXA 4BANB 1Z71A 1UTMA 3RMMH 3U1JB 3LH3A 4CRBA 3JZ2B 3ODDA 2D26C 1ID5H 1EZSC 1UTKA 3M3VA 4Y10E 4TPIZ 4DG4A 4AGKA 1AWHB 2F9NA 3MH4A 4NCYA 3F0PA 4X1NU 2BYAX 4INLA 2K0QA 2WHXA 1C5PA 1AWFH 1Y3WA 5EG4A 1HBTH 4XDEA 1ELGA 3NCLA 2BDBA 4WVPE 1E37B 2CK3D 4ZKNU 4CRGA 1SLVB 2LELA 4Y7BA 3PLKA 2VNTA 1V2ST 3GY6A 4Q7YA 3DCLA 3BIUH 2BVXH 1TAWA 2BLWA 1SGFG 2O8LA 2TGDA 2WYGA 3M61U 4IGDA 3SORA 2UUKB 2ZU1A 1W2KH 3ZYDA 1D3TB 3GS9A 4LZ4B 2Z9KA 4ZHMU 3U98H 2GCHG 2BD5A 1KLJH 4MPXA 3V12A 5EXMA 5AF9H 3RXDA 3OU0A 1ELFA 2VH0A 4A1VA 1YC0A 1EJAA 1QA7A 1ZHRA 1H1BA 1FY5A 3ATWA 3PM3A 1GL1A 1V2VT 4KKDA 1LQEA 1ZZZA 5CE1A 4K60A 4BXWA 3TH4H 3GY3A 1GBLA 3A86A 3S7HB 2BLVA 2UWPA 1NTPA 1DY8A 3HKJB 1ZTLA 4FU8A 1TMUH 2ZG0H 1BRUP 2FIRH 3W1EA 5K0HA 1W0YH 1WV7H 2ILNA 4FUIA 4MLFB 5FPTA 2ZZUH 2BZ6H 3LDXH 1SHYA 3MU8A 7LPRA 1ARCA 1QBOA 1AUJA 3H09A 1NRQH 5GCHG 1GBAA 1P8VC 1LHFH 3CENA 3PMBB 1DANH 1YPHE 4XFQA 3BV9B 4DJZB 3GCTG 8LPRA 2FLBH 2Z9JA 1S0RA 5TCCA 3S9AA 4B1TA 1PPFE 2ZNKH 1GHYH 2ZDMA 2ZU2A 5C0UA 1LVBA 1GMHF 2RA3A 4KTCA 2UWLA 4Q7ZA 1HIAA 3VXFH 4B73A 1O2WA 3MNBA 4XBCA 1O2KA 5E0JA 2ZFTA 4OS5A 2ZCLP 2B0FA 1GMDF 2I6QA 5HIYA 1V2RT 1V2OT 1GJ6A 1N1LA 5E0HA 3TNTA 2XXLA 3ZZBA 4AFZA 2FTLE 1YPHC 2W6ID 2BY6X 2Z7FE 1ZJKA 4E7NA 4WMEA 2BDCA 1IQMA 1G2LA 2V3MA 2V35A 4Y6DA 1HV7A 1N6XA 4INHA 1P2MA 4BTTB 4NG9H 4WMDA 1IQIA 4X8UH 7KMEH 4CRAA 1D4PB 4MDSA 2PTCE 2D1JA 3BN9A 1BMAA 1A3EH 2HLDD 2VIPA 3P8OA 2FYRA 1BTWA 1FY1A 5CMXH 5AHGH 2WSSD 4AX9H 4RT0A 4CR9A 4IMZA 5A09A 3GOVB 3K6YA 2SGPE 2C93B 4NA7A 3T2NA 3ATKA 4JZFH 2AGGX 1QL9A 4UE7H 3TLOA 5E0GA 3ZVCA 2KZ4A 2XNIA 1ZHPA 1S6FA 3ODFA 4ABJA 5EIYA 2WV5A 1BMNH 2GVFA 5T6GA 3SV9A 3UNRA 1A3BH 1SGCA 2KCOA 1GBIA 3F3BA 1GI3A 2ZECA 2PSXA 1DUAA 2DUCA 1Y3UA 1ELCA 4SGAE 3TGJE 3S69A 5GNDA 1OWEA 1NRRH 1TOCB 5T1VA 1BOQA 1DLEA 5FPYA 1O3OA 1YCPM 2FOCA 3DSPA 3I77A 1CHGA 2ZHFH 3K2UA 2P93A 3BTME 1QR3E 1UHBA 4DIHH 4K8YA 2PR3A 4MQAA 4MPUA 1RTFB 1SBWA 1FLEE 3M3SA 4O3UA 5EQQA 3TU7H 9ESTA 5C3NA 2L6OA 5DP4A 1EJMA 1UCYH 1ACBE 2ZF0H 4CR5A 1DLKB 1P03A 2Z9LA 2JIZD 5CHBA 1QY6A 2FS8A 3RXGA 1GBMA 3UFAA 3SZNA 1AI8H 5ESTE 1TPOA 2OK5A 1P11E 3HGNA 2WPIS 1TGSZ 1TQ0B 2OP9A 1EB2A 3RMLH 1SQAA 1C2DA 3A88A 1ZPBA 2VGCC 4GHTA 1E36B 3UREA 4O9VA 2HRVA 2EEKA 4I86A 1O3NA 1C4V2 1MQ5A 1Y5BT 3SBKA 2HNTE 1BBRE 1ELVA 2H9HA 2VBCA 1EKBB 5TJXA 2ZFRH 3T26A 2WYJA 5KGOA 4CREA 2IN2A 2G4TA 2R9PA 1CT0E 1TONA 1QJ1B 3C1KA 3FP8E 5C94A 1F7ZA 4BNRA 5AFZH 4O97A 2OINA 1EOJA 3SOSA 3BTQE 4NFEA 1W11U 1WDIA 3LH1A 1DWDH 4O3TA 3P70B 3ZVEA 1GI2A 1SGPE 1IAUA 1QNJA 1V2TT 3A8CA 2VU8E 4DGJA 1BIOA 1D3QB 3FP6E 1MAXA 2GCHF 1L1GA 2XOKD 2VGCB 2QC2A 2K8IA 3Q00A 3ZIAD 3KYGA 4ABGA 3M5NA 3E91A 1GBEA 4X6MA 1SOTA 3FKSD 4FUCA 1CT2E 1DICA 2GKVE 4YM9A 2IPHA 3B9FH 5EJZA 1QGFA 2QXIA 3LU9B 1L4DA 4R0IA 3BTHE 2ZGJA 3A8AA 3ZZ7A 1NBME 3LGWA 1W7XH 1K0HA 1EAXA 2KR7A 1OP2A 1QB6A 2G55A 4HTCH 4D9RA 2QN5T 3S9BA 3CNRA 3E0PB 5C17A 2J34A 1P2QA 1O3JA 2H9TH 1AHTH 1E79D 4HFPB 1BTPA 1Y3VA 1Q2WA 3U28C 4UD9H 2P3TB 3E16B 3PTNA 2BM2A 1EPTA 1XXFA 1QL8A 2A0QB 2QXGA 1QIXB 1PPCE 2HPPH 1O36A 1EZUC 1ZHMA 4YOGA 2R2WU 2A45B 2ZFQH 1QB1A 2H6MA 1Q3XA 4Y0YE 4YXWD 3EA8A 3KIDU 1MKXH 6CHAC 2TGAA 2AIQA 4XOJA 4A1TA 3SJOA 4DURA 3GY2A 1YGCH 5FCRA 1TIOA 2M5TA 2QA9E 4RKJB 1TNJA 1LPZB 4DIIH 1K1OA 1K1MA 4FUJA 1HYLA 1P3CA 1YPMH 5FAHA 2ZQ2A 1SFQB 1W14U 2KCPA 1XUIA 4AC9A 2FS9A 1FDPA 2EQNA 4ACAA 2AGIX 2ZDKA 1O2SA 1O5FH 4Y8XA 4ESTE 1C4U2 1ZTKA 1Z8IB 4FUDA 3TK9A 1XKAC 5C2ZA 2J98A 3PB1E 4GHQA 1KXAA 2JH5D 1P12E 2OLGA 3D49H 5JB8S 1QBVH 2TIOA 3MU4A 1ETTH 5TCAA 1SQOA 4YESB 6CHAB 1IQEA 3N99A 1VGCC 1VJAU 4Q80A 2J92A 4CBNA 8KME2 4BAQB 4ISHH 1C1VH 3LIWA 2QV1A 2XBYA 3SN8A 3PLPA 2A32A 3PWCA 3OE7D 2VIQA 5C1UA 1S6HA 1ELEE 2TBSA 3PV2A 1LO6A 4P00A 1AKSA 2OC0A 2YNAA 4DCDA
chains in the Genus database with same CATH topology
5HM2A 3TJVA 4MTBA 4IS5A 3ATMA 1MTNC 4AYYB 3NK8A 3RXPA 1ELTA 1GDQA 3H7TA 4FUHA 2V0BA 3AW0A 4F49A 2FP7B 1V2QT 5T3HA 2ZKSA 4NGAH 3O8RA 2HNTF 4U01A 1DOJA 2UUFB 1TX6A 1L1JA 3ZYEA 1C5ZB 1OWHA 3QUMP 1XVMA 1O2YA 1O37A 1D6RA 1RD3B 5HM9A 4RN6A 1HAOH 1C5SA 1ZMLA 3MWIU 4NSYA 1VGCB 1QRZA 1HAYB 1W7GH 1WBGB 1DXWA 3SGBE 2QF0A 2KAIB 4DY7B 1O2XA 5A8XA 1C5QA 1QJ6B 4X8SH 1K1LA 1ZPCA 3SNAA 3BTWE 3VB5A 1JBUH 1BZXE 1O2JA 2J4IA 3F9FA 1LQDB 4GCHF 4B74A 5F6MA 3BTFE 5DKMA 1O2LA 1GL0E 1MTNB 1VR1H 4ZHLU 4ISIH 1GHAF 2ZTYA 1GCTC 1GMHG 1YCPH 2JH0D 1ETSH 5BRRE 1OYTH 1OWIA 3ATLA 1A5IA 1MBMA 2VIOA 2EA3A 3E6PH 1AN1E 4X6PA 3A7VA 3QZQA 4I32A 3T25A 4CRCA 1H9IE 1HAVB 4BTIB 3UNQA 2D8WA 2Q6GA 1LDTT 2F3CE 1HJ8A 2RDLA 2AIPA 1Y5UT 3DHKH 4I8HA 3SV7A 2PUQH 1AQ7A 3ZV9A 5C1XA 3GY8A 3QX5H 4TWYA 3FP7E 4DT7B 3L6PA 3TVJB 4AGJA 3D62A 4AZ2B 4BAKB 1JIMA 3Q77A 1VJ9U 5EQSA 3MU0A 1BITA 1O34A 1IQFA 1WUNH 3LT3A 1NESE 4ISLA 3MMGA 1F0RA 2ZU5A 2W7SA 1S83A 1GCTB 2R0LA 1AZ8A 1KIGH 4MVNA 2O8TA 2F9VA 1O38A 1BTYA 4Q7XA 3VB3A 1SLXB 2XYAA 1Z6EA 2ASUB 4ASHA 1NU7B 4WF8A 1JMOH 1UVSH 1W10U 3RXKA 1YBWA 1FAKH 2ZU4A 3VFEA 2XBXA 3P92A 4MPVA 3KQCA 4YT7H 1SPJA 3MTYA 4X2YA 2P94A 1C5UA 4ABBA 5JBTA 1C2GA 2BX4A 2NU1E 1HPGA 1WQVH 2BZAA 2ZHWH 2PKSC 3URDA 3F9HA 1TYNA 3UUZA 1BBRH 1KLTA 3SJKA 3MOCA 1HJAC 3K65B 2J38A 2CXVA 4JCNA 3A81A 5A0CA 1C9PA 2NU4E 1CE5A 4INKA 3B8JA 1B5GH 3ZZ9A 4JZEH 5GWZA 1E34B 3MH7A 4NIXA 3RXAA 3BSQA 4GAWA 1P2JA 2QYIA 4E7RG 3PLBA 2ZHEH 5EXNA 2VB0A 1HLTH 1Z8GA 3FZZA 2VVUA 3BEUA 3P8NA 4CHAC 1PPHE 3D23A 2CHAC 3RXHA 1FQ3A 1IQNA 1T32A 2ZU3A 3SUDA 2A4RA 4ZAEA 2A31A 2PKSB 3EDXB 2OBQA 3PMAB 4H6TA 3SO3A 3E1XB 3M37A 1ELAA 4KP0A 4NA8A 5EODA 1HJAB 1SGNE 1SGQE 4JZIA 2GZ7A 2ANWA 3SUEA 3P95A 4XSKU 3QDZB 1C2HA 5EW1H 1D6WA 3S0NA 2ZA5A 2O8WA 2ZFPH 2QCYA 1V2NT 1SGYE 1ZSJA 1IOEA 2B5TB 4ZKOU 4H6SB 1DT2A 1C2JA 1FIZA 1G3BA 1V2LT 1ESBA 2FZZA 1H9HE 1A0JA 1P09A 1WTGH 4CHAB 2WPMS 2GCTC 1IHSH 2CHAB 2ODYB 1H9LB 7ESTE 1TRYA 1G9IE 2WUCA 2BQ6B 2FMJA 1OSSA 3GY4A 2ZEBA 4F4OC 1HAGE 2JH6D 4ZKRU 5LGOA 1HB0B 1PPZA 1F5RA 3QTOH 4BOHA 4Y71A 1HAXB 5J4QA 1C1SA 1C5LH 2BD8A 4OS4A 1BJUA 3A8BA 4YOJA 1MTUA 2PKAA 5DK1A 1GJDB 2H9EH 2P95A 1EUFA 1AD8H 1P9SA 1CU1A 3Q76A 5PTPA 1O2TA 2ALVA 5H4IB 1O39A 2Q6DA 2BXUH 3S7KB 3SI3H 1D9IA 1Z7KA 3U1IB 1O2GH 2CV3A 2EI6A 2GCTB 3GISB 3BTGE 1J15A 1GPZA 3BG8A 1V3XA 3H5CB 2J95A 1V2UT 2G52A 2ESTE 1P02A 1C9TA 2ODPA 3LOXA 2BDHA 1HJ9A 2XRCA 1NFYA 2XTTB 1LKBA 1MQ6A 1LHCH 3TNSA 1AVXA 1HDTH 1C2IA 3MU1A 5ETXA 3N7OA 3MNCA 1C5XB 1UTOA 4WJG2 2G51A 4Y11E 2GMTC 4Y7AA 2Y5FA 1VCPA 4E06H 4ZROA 2P3FH 4XBDA 3T28A 1G32B 5F8XA 1WYKA 2Y81A 1P2IA 1TB6H 1GBKA 1KY9A 2XCFA 2IJOB 1MTVA 1TA6A 2GTBA 1AY6H 3MO6A 2H5DA 4JMYA 1IQKA 1X7AC 4X2WA 2BD4A 1HAHH 2VWMA 1TPAE 1A5HA 2OC7A 1KXDA 1AUTC 2FPZA 5EW2H 1TGCA 3MH6A 1FN6A 1CGIE 4WMFA 2AFQB 1BT7A 1JRTA 1G3CA 5FHTA 1PQ8A 2ANMH 2AMDA 3ZZAA 3KQDA 3SJ8A 2BY8X 3F1SB 1RJXB 1E0FD 1THPB 2ZPRA 3T5FH 3KQEA 1V2JT 1BHXF 3U8OH 9LPRA 1ZMJA 3ZVDA 4THNH 1C1PA 1FY4A 2GMTB 5DJ7A 1V2WT 3GY5A 1BRAA 1QA0A 1MTWA 3P8GA 4Y76A 3RXIA 1O3KA 2PV9B 2BDYA 1O3LA 1BB0B 2VWNA 4WXVA 1BTZA 2DE9A 2ZO3H 6LPRA 3RC5A 1O5DH 1O3IA 2A4OA 3LGIA 5DGJA 5DPAA 4LZ1H 1EZXC 1C5WB 5B6OA 1WQSA 5LPEA 1TRNA 1M9UA 2R0KA 4I31A 1HGTH 1TE0A 2GT7A 3AW1A 3V13A 1ZLRA 1C5NH 1SQTA 1V6DA 4X1SU 1MD8A 1GJ7B 2J2UA 3SGAE 1TBQH 3JZ1B 2J94A 4JK5A 1D3DB 1C1QA 3GYMA 3LGUA 3DA9B 3T27A 4YO9A 3RXTA 2UWOA 1BDAA 2A7JA 3M7UA 1MZDA 3RXMA 2Z3CA 4ZXYH 1Y3YA 2GT8A 2G5VA 5F8TA 1QB9A 1O3AA 3WY8A 2FI3E 3DFLA 1GHVH 2KAIA 3PO1C 3STIA 1O2MA 1O2ZA 3IWMA 3RDZA 3ZVGA 1KSNA 4GCHG 2WPHS 3NXPA 1QRXA 2DE8A 3R0FA 2HOBA 4K1SA 1GHAG 1GVLA 5FPSA 4J1YA 3L3TA 4OGXA 3V0XA 1UK4A 4I8KA 5DP8A 4Y8YA 2GGVB 4PROA 3ZZ4A 4I8GA 3OY6U 1RRKA 4FUFA 1MMJN 1YF4A 1ZGIA 5ESBA 2BDAA 4OS1A 4Y79A 2FWWA 1Z8JB 1HAVA 1AVWA 1KYNA 1MKWK 4OS6A 5FXLA 1NPMA 2ZTZA 3RC6A 3RXRA 5GPIB 2D2DA 1O2RA 2BDGA 3ZZ6A 3LPRA 1LTOA 3PO1B 4ZMAH 2Y80A 2G4UA 1OOKB 2EI8A 3OYPA 1B7XB 1PJPA 2ZGBH 1ESTA 1K1JA 1HUTH 1G3EA 1BTXA 1ZRBA 3RMOH 1JIRA 4X1QU 3ZV8A 1QL7A 1XUKA 1AIXH 2NU3E 3NKKA 1EX3A 2ZHQH 3RXEA 4JYTA 1JWTA 2HVXA 2PUXB 1O5BB 2BY7X 1GHZA 1YPLH 2WPJS 3SU6A 1NU9A 3VEQB 4ABAA 1YPJH 1WU1A 1EQ9A 1PYTC 1FPCH 1TRMA 1QJ7B 3RUOA 1QQUA 3BTEE 2BXTH 4KTSA 4AFSA 2XCNA 1EASA 1DWBH 1THRH 2STBE 3IITA 1AVGH 1DITH 4A1XA 1LKAA 2FOHA 1G36A 1KXFA 5AFYH 1TPPA 1MBQA 1AE8H 3RP2A 5DP3A 1CQQA 3MU5A 3VB4A 4AG2A 3MFJA 4UDWH 4GSOA 1C2LA 3TGIE 2Y82A 1P10A 4UFEH 1WTHD 1FI8A 1XUGA 1NT1A 1K1IA 1TX8A 4O03A 4ABFA 1P01A 3NPSA 2ZP0H 1PPGE 2K1QA 1UK3A 1SLUB 3W95A 1RGQA 2W3KA 3UWIA 1KXCA 3QGNB 4K1TA 1XM1A 3RC4A 2GD4B 1PQAA 3BG4C 4B2AA 5FX6A 4WWYA 3UNSA 3AASA 3FANA 3O8DA 2BQWB 1PYTD 4FUBA 2SNVA 1EP5A 1TQ7B 5A0AE 1C1TA 1DS2E 2P3UB 5AVDA 1O32A 1EB1H 4GUXA 3FVFB 4R8TB 1TPSA 3TJOA 1P0SH 5T6FA 4AB8A 3A83A 1K21H 4H4FA 2NWNA 1CBWC 1O3BA 1XMNB 2ZGXH 8GCHG 1GJ5H 1LCYA 1FV9A 3BIVH 1KTTB 3M5LA 3UIRA 1CHOG 1NY22 1MCVA 1RXPA 3E3TA 3EYDA 1AGJA 1UVUH 4M7GA 2Z6BD 3U69H 2RCEA 1UK2A 1GJCB 1AFQC 1GI5A 2ZFSA 5T6DA 1OWDA 1F5KU 4NA9H 5E2OA 3BG4B 3SQEE 4NIYA 3M35A 3UQVA 3D65E 1OS8A 4X6NA 1ZR0A 1GJBB 1HIAB 1O3DA 3VB6A 2VIDA 1TWXB 4WXIA 1SGEE 2J9NA 1ZRKA 1O3GA 1CBWB 5EQRA 1TGTA 1AFEH 3VXEH 2RA0A 3F9EA 3MHWU 1RIWB 3A82A 4HGCA 4UFFH 1BA8B 5L2YH 1DM4B 3KN2A 3LC5A 4GVUA 4Y8ZA 1TX7A 2Z94A 3EQ0H 2C90B 5EU8A 1FXYA 1JOUB 1AFQB 2GZ8A 3QN7A 1F0SA 1P05A 1QTFA 3E0NB 2CN0H 3P8FA 4H42U 1C2EA 3RU4D 4YT6H 2A5AA 1TLDA 1Y8TA 1YPGH 5CHAC 1O3EA 3QTVH 2FXRA 1YYY1 5IDKA 2G00A 1MUEB 3IG6B 1VCQA 3O8CA 2JETB 2P8OB 1W8BH 1W12U 1EOLA 2XC4A 1A7SA 2B9LA 4GLYA 2BY9X 1GI4A 4NFFA 5JYIA 5LPFA 2OTVA 2GV6A 1YPEH 3C27B 1IQGA 1GBHA 3GICB 1GBDA 1O2PA 1ZSKA 1NS3A 4B75A 2FX4A 4MPWA 3RXFA 1LHDH 1KTSB 3A7TA 4FU9A 3SJIA 5GJ4B 3H7OA 3TK6A 4IW4E 4D7FA 3M5OA 3SJ9A 1SB1H 1ANBA 3I29A 2ZTXA 1C5RA 1WAYB 2VWLA 2XBVA 3KNXA 1B0EA 3EA7A 2FYQA 3HGPA 5E2PA 3FAOA 4Y0ZE 2Q6FA 1L4ZA 5CHAB 2ZIQH 1J17T 3A7YA 1CA0C 3DD2H 1C1RA 2CGAA 3KQBA 1UTPA 3BTKE 4UEHH 1UHBB 2XWBI 2FODA 3SV6A 2H5CA 1O5CB 1QQ4A 3KCGH 1FUJA 3BTTE 2XC5A 1F0TA 1O0DH 3UWJH 1NROH 1BRBE 2BOKA 3ZZDA 2UUJB 3BTDE 1O5GH 1Y59T 2W5EA 1ELBA 3A7WA 1DVAH 5A8YA 1TFXA 5I25A 2CF8H 2TGTA 1OP0A 4U2WA 3MNSA 1S82A 1BRCE 3BEIB 1TMTH 5A8ZA 1C1MA 3RLWH 3NZIA 1AB9C 2W26A 5G4BA 2ZI2H 5I46H 1L2EA 2H2ZA 3M36A 1GI9B 1GVKB 1P9UA 3F6UH 4KGAA 1AMHA 5FX5A 1F2SE 1E35B 2UUYA 3ZVAA 1CA0B 2OXSA 3KEEA 2F9BH 1S84A 1YCPK 2SGQE 1BMLA 1SSXA 1HAIH 3FFGA 1XUHA 1INCA 3UY9A 1OWJA 5JB9S 2SFAA 1GI6A 2H1UA 1A1RA 1GBFA 5A2MH 1UO6A 3A80A 2FOAA 2OBOA 3TGKE 1TGNA 4CBOA 4QT8C 1JXPA 2BD9A 2CJIA 3F68H 2Z3EA 1O2QA 5EPYA 4B2BA 3ESTA 3SHAH 2C8YB 2FDAA 3A84A 3PYHA 3UTUH 1TA2A 3KGPA 1AB9B 2ZDAH 3CS0A 2Z9GA 1GDUA 1UMAH 4HZHA 1GHXH 3SI4H 1CVWH 2TGPZ 6ESTA 3LGTA 2C8ZB 1WCZA 4I8JA 1C1WH 3R3GB 1FIWA 1FN8A 1GMCF 8ESTE 4OS7A 1QBNA 1SGFA 1ABJH 2FESH 3MO9A 1GGDC 5EOKA 2FLRH 4UONA 1UTNA 1J8AA 2A4QA 2AYWA 2OQUA 4MNVA 4LK4A 4D7GA 4MG3A 3RXOA 3LGVA 2HALA 4I7YH 4CH8B 2Y6TA 1CT4E 3EE0B 1NC6A 2STAE 1ZSLA 2JKHA 5L2ZH 2G5NA 5FCKA 1J9CH 4AN7A 3ZZ3A 4K5ZA 1BTUA 4JZDH 2QGRA 1MAYA 8GCHF 3RLYH 1JRSA 4ZXXH 2BB4A 1W0ZU 1K1NA 2OUAA 1CHOF 1N8OC 2AERH 3RU4T 1A5GH 4NZQA 2O9QA 1EP6A 1DPOA 1BBRK 1O35A 2ZQ1A 3A8DA 3PWBA 1S85A 1IHTH 3HPTB 1O2NA 3SW2B 3QLPH 1GGDB 2XWAA 2QY0B 3TJNA 1NRSH 3AAUA 4DOQA 5JBAS 5DP5A 1S0QA 4ISOA 5C20A 2ZCHP 3LJJA 2ZDVH 1QCPA 2WV4A 1O3CA 3DUXH 1XUFA 1T7CA 1P2KA 3ELAH 4CH2B 1EATA 2GZ9A 1GJ8B 2QXJA 1EZQA 1OP8A 2O8UA 1O2IA 3SQHE 1O3FA 2HGTH 5EGMA 3A7XA 1G2MA 2ZCKP 3V3MA 1N8OB 1DSUA 3SUFA 3UPEA 3T29A 1NRNH 3RXSA 2A5IA 4WY3A 1Z6JH 1H8IH 4BAMB 5J4SA 4ABIA 1S5SA 1KXBA 5C5NA 4KELA 1DWCH 3Q3KA 1O5EH 4TYDA 3B23B 3K9XB 3A7ZA 5IYTA 4A6LA 3A89A 2ZHDA 5GIBA 4FVDA 3RXLA 1CGJE 1O2VA 1TOMH 2F9UA 2V3OH 4K69A 3SNCA 5LPRA 4AYVB 4IC5A 1UTQA 1T31A 3E90B 3TJUA 1KDQB 1Z1JA 5DG6A 1BHXB 1ARBA 1DX5M 4TWWA 1AKSB 5GXPA 4UFGH 5ABWA 1GBTA 1HXFH 3U8RH 1GI7B 3KL6A 1NZQH 3GDVA 4A92A 2PGBB 3MI4A 4YTAA 1LVMA 3CP7A 4NWLA 2WPLS 2R2MB 1Y3XA 1TBZH 4FXGH