3A87A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 5 minutes)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule keywords Cationic trypsin
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a87A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a87A02
1TB6H 2JH0D 2C8XB 1O36A 2A4GA 3SNAA 3SUFA 3RXMA 2PFEA 1ESBA 3TJVA 1FDPA 3F6UH 3LC3A 1GBBA 1KLTA 1YCPH 1D6RA 3GDSA 3TVJB 1O32A 4X6PA 3RP2A 4PROA 4K1SA 1C5NH 1UTOA 3WY8A 3U1IB 4WH6A 1K1JA 3LH1A 3PLBA 1O0DH 1O3JA 2VVCA 2A4OA 2PR3A 5LGOA 2RA3A 1C5SA 4FUBA 1P02A 3F9EA 1NTPA 1NY22 1LVMA 5EGMA 2ANWA 4TWYA 2BM2A 3DD2H 3BTFE 5HGGA 2NU2E 3VB5A 4H6TA 1S6FA 2QGRA 1ETSH 3M5NA 4CRGA 2WPHS 1FAXA 1GMCG 1C1SA 1GBJA 1ANBA 3O8CA 1LKBA 3EA9A 1ZMJA 1TBQH 1Y3YA 1TPOA 4B2BA 1C2GA 4JZ1A 2ALPA 2ZQ1A 2P8OB 1UVUH 3ZZBA 4GHTA 5GJ4B 1J8AA 1ETRH 2Y7XA 4UE7H 1GBDA 2ULLA 1ZLRA 3CS0A 1J9CH 3D23A 4IMZA 2TPIZ 3UWJH 2TRMA 1QBOA 1NU9A 4AYVB 1O2KA 1Z7KA 5H4IB 3MU4A 4JYVH 4ASHA 1GJ8B 1K1IA 4UDWH 1CHOG 3MU0A 2IPHA 3LGYA 1BOQA 3S7KB 5JDUB 1V2TT 2RDLA 1T31A 1O34A 4GHQA 1S6HA 2O8TA 1VCPA 2PSXA 3TH2H 1IAUA 1GG6B 1HJ9A 2ZDMA 2UWOA 1TBZH 1QB6A 1KLIH 1MH0A 3IWMA 1YPJH 4WXIA 3S9AA 1A61H 3RU4T 1O3IA 1QHRB 1FLEE 1HAIH 3SI3H 2QC2A 3LONA 1Y5AT 1S0QA 4MTBA 3UQOA 3LJOA 2GGVB 2V3HH 3GY3A 3GICB 1XX9A 4NA9H 1C4U2 1LDTT 2JH6D 2BOKA 3LKWA 3P95A 1GHAG 1QL9A 1ZGVA 4MNVA 1XUFA 1UCYH 4YLUA 4D8NA 5T6DA 3RDZA 1GJCB 1MTVA 1NFYA 5K7RA 2HWLB 4Y10E 3A88A 1V2OT 3HPTB 2VIOA 2VU8E 1W0ZU 2ZDVH 5JBCS 2AEIH 1GVLA 2ZDLA 5JBAS 1TQ0B 1NESE 1QY6A 2F9PA 3BTGE 1WQVH 3RXRA 2OD3B 5G4BA 3Q76A 3A82A 1O2NA 1ELCA 4X8VH 2XC0A 5J4QA 1ESAA 1MBMA 1EAUA 2PGBB 4BAHB 2GVFA 1GI6A 2GD4B 3SN8A 1LCYA 2HGTH 3AASA 3GDVA 1GBHA 2Y7ZA 5EXMA 4WMDA 3SUGA 1BCUH 5HXFA 1BJVA 1PPEE 1S82A 2HALA 2Y82A 4Y6DA 3TJUA 3PMHB 3SO3A 1SFIA 2GCHG 1P2NA 4OS5A 1MZDA 1HCGA 4GPGA 5BRRE 2DE8A 3A7YA 5C1XA 1P09A 5EQQA 3SU0A 5T6GA 2A7HA 4INKA 1ANCA 1C2IA 3BEUA 1YBWA 1RTLA 4BAOB 1L0ZA 2ZFTA 4UFGH 2BXTH 4KGAA 4GVUA 4A1XA 2W5EA 3PTNA 2W26A 4NIYA 8ESTE 1IOEA 1D3QB 3NZIA 4GUXA 1HYLA 1P2JA 1HAZB 3KQCA 5E0JA 1GCTC 1EPTA 1TAWA 2A0QB 1MKWH 3JZ1B 4Y7AA 1C5ZB 3MNXA 2QXIA 3BEFB 5SGAE 2R0LA 4I8LA 1DANH 3GY2A 1EQ9A 3PTBA 3P6ZB 2H5CA 3GCTF 1XUIA 2PUQH 2H5DA 2ODPA 3BG4C 2FI3E 3UR9A 1DT2A 1CO7E 1AFEH 1DWDH 1HFDA 2FS9A 2SGFE 4HZHA 6LPRA 2F9OA 2DUCA 2VNTA 1O33A 1OOKB 1UCYE 2GV6A 1NRPH 2GZ8A 5CE1A 1GHZA 2BQ6B 4WJG2 1D3DB 4A7IB 1SB1H 3U69H 3KQDA 1ABIH 2A4QA 2C93B 3GCNA 3MO9A 1O39A 1Q3XA 4NIWA 5E0GA 4UFFH 3MH5A 4BXSA 1KDQA 4INHA 1Z1JA 1C5MD 5FPTA 1CT0E 4I8HA 2AGEX 1GHVH 3E16B 4Y0YE 3STJA 4X1PU 3M35A 4DW2U 1G3EA 3ZVCA 1BTYA 3E0PB 1C1NA 2C4FH 1AGJA 4GSOA 4AFQA 1WAYB 2BY9X 2ANYA 3SU1A 1KXAA 5PTPA 1O2IA 4IN2A 2CJIA 1O2SA 4ZUHA 2FX4A 3A81A 3TJOA 3RXAA 1EOLA 3FFGA 1E0FD 4AB8A 4FUFA 1QJ6B 1MQ6A 2JKHA 1AUTC 5EU8A 2ZG0H 1O3MA 4HI3A 1DSTA 2BVRH 4OGXA 1B5GH 4XOJA 2NU3E 1Z6EA 1KY9A 2CXVA 1J15A 3PYHA 4ZHLU 2A7JA 2OC8A 4X2VA 1MCTA 3L3TA 4MLFB 2ODQA 1BMNH 1C2KA 4MDSA 2P16A 2J38A 1YLDA 1NRSH 4I32A 1HAVA 1C9PA 1O5CB 1ZTLA 1CHGA 2BLOA 5JB8S 5F03A 1FUJA 2OBQA 3M37A 5LPEA 4ABJA 2XRCA 4BXWA 1P2IA 2ZHDA 1ZRBA 3BSQA 1C5VA 1DICA 1O3GA 2FO9A 3ZVGA 1PFXC 2O8MA 4F4OC 1SGRE 2FYRA 2ZGBH 5ETXA 4Y8XA 2PWXA 2XTTB 2Z9LA 1VCQA 1GBFA 4U32A 4F49A 1E37B 1ZOMA 1T8OA 4UD9H 2Y6TA 3HKIB 2ZGXH 4ABIA 1A1RA 3VXFH 4TPIZ 2HPQH 3A89A 4MPVA 2Y5FA 2VVVA 1FIWA 1LHDH 1O3FA 3QDZB 4GAWA 2B7DH 4U30A 1QURH 1V2JT 2BZ6H 5A8XA 1FY5A 2W7UA 1HAVB 1G37A 1ETTH 3SGAE 2WV4A 5FXLA 1NM6A 4ABDA 1BRAA 4D7GA 2SNVA 4UFEH 1YCPM 3UUZA 3T29A 3QGNB 2BDBA 2AERH 3MWIU 5FX6A 2QXGA 4K8BA 1O2XA 1LO6A 3P92A 1A3BH 1D3TB 2PKSB 2VWMA 4X1SU 2TGPZ 2ZPRA 3BG8A 1CSOE 1A46H 3GCHC 1DXPA 1P04A 3U1JB 3ODDA 1YCPK 1TOCB 1Y5BT 2FEQH 4WXVA 2ZHEH 3SUEA 1TPSA 2BDYA 1MKXK 2OC0A 1WOFA 2TGAA 1ZHRA 2F3CE 2C90B 1AKSA 2FMJA 4FVBA 1ZGIA 1L1NA 4MPXA 2NU4E 2BY6X 4YT7H 3TH3H 3ITIA 2OBOA 3KGPA 2P3FH 1W12U 4X8SH 1P2OA 1GI8B 1GI7B 2OLGA 1L1JA 5A09A 1AZZA 1GI1A 1HPGA 3LGWA 1HIAA 3E6PH 4DIIH 5EPYA 1G32B 4BAQB 5E2OA 1K1LA 3GCTG 3LGIA 3RXLA 2OUAA 1YP9A 1Z6JH 4NZLA 3P8GA 1CGJE 3EA8A 3RUOA 1FV9A 1Z8IB 4NIXA 5JBTA 4CR5A 5B6OA 1SGFG 4RSPA 2WPIS 1TGNA 3GOVB 1K1MA 1SGFA 3LT3A 4I7YH 5IYTA 4UFDH 1DLEA 1JRTA 1NRNH 2BDGA 1GJ6A 3IITA 4WVPE 3A80A 1UVSH 1XKAC 1LHCH 4NCYA 1EZQA 5EODA 1IQFA 1K22H 1VZQH 1IQMA 2P8OC 3SI4H 4Y71A 2Q6FA 1EZUC 1ZPZA 3HK6B 1C4Y2 3RXCA 3PMJA 4A1VA 4FU9A 2HPPH 3ZVFA 1NC6A 3MNSA 1CA8B 2ZGHA 1T8MA 1AHTH 1S0RA 5A0CA 2ZGJA 4Z6AH 1CHOF 1K1OA 1THSH 2G81E 3AAVA 2PTNA 5EW2H 3U8TH 3RXQA 4Y8YA 2FWWA 5DPAA 2STBE 1FY1A 2ZFPH 2TGDA 1MCVA 1UCYK 2AIPA 2NU1E 1GG6C 3VGCB 4AOQA 3F1SB 1O2UA 2IOTA 1TX6A 2AYWA 1WQSA 1YF4A 5L2YH 2BMGB 5DO4H 1GHWH 2VIQA 4JYUH 2XXLA 1HGTH 1P9UA 3MU8A 1SI5H 5FHTA 1H9IE 5FBIA 4ISHH 3A8BA 2A45B 4ZKSU 1GHAF 3FP7E 1PYTD 2QXHA 1X7AC 1FN6A 1OYTH 1O2YA 1JBUH 1BTXA 2PTCE 2FP7B 5DJ7A 3QTOH 1MTUA 2FOMB 3UNRA 3RXKA 1ZZZA 4H4FA 5DP7A 3SNDA 2J2UA 1O3EA 1UMAH 1C2FA 3A7TA 5FPYA 3TJNA 2WPMS 4OS7A 4RKJB 1SG8B 1KTTB 2BDCA 4X2YA 4I8KA 3QX5H 5HYOA 2BVXH 4XSKU 4ABFA 1QL8A 1AWHB 4ZHMU 1MTWA 1UVOA 1C1OA 2VJ1A 1KIGH 2FOFA 1GGDC 1PQ5A 5FBEA 1JWTA 1V2PT 1ANDA 4B73A 1PPCE 3OTJE 4THNH 3BTTE 3PLKA 2WPKS 4NFEA 1O35A 5C5NA 2XBWA 4OGYA 1UTMA 3SV2H 1MKWK 1SGEE 3B8JA 1GWAA 1C9TA 1O2TA 3H7TA 5TCCA 2V0BA 1W0YH 3T26A 1DVAH 2ZDKA 4YOIA 1UK3A 2H9TH 1BB0B 1P0SH 3A7ZA 1O5DH 1LVYA 3BTHE 1DM4B 3T27A 1O3HA 5C3NA 2Z9KA 3NUMA 2ODYB 1DX5M 1O2HA 5JYIA 1SGCA 1EX3A 1BBRH 1SGYE 2DE9A 3LU9B 2VGCB 1GI0A 3UR6A 1GMHG 2Z9JA 1VCWA 3RXTA 1ELTA 1SHHB 4ISOA 1CBWB 1HNEE 2H1UA 1DFPA 2BTCE 2ZDAH 1NS3A 3ATMA 2P3UB 3DFLA 1FI8A 1GJ9B 1BTPA 4RN6A 3AW0A 2W3KA 3GYMA 3ZZ3A 1P06A 2QN5T 3Q00A 2C8WB 3SJ8A 3FANA 1FNIA 4E06H 4AG1A 1EPTC 3DT0H 2OCVB 2WPLS 2O8UA 5E2PA 1SGDE 1F0RA 1TRMA 1AZ8A 3W94A 1B7XB 1J17T 1XMNB 3W95A 1O3CA 2BB4A 1A5HA 2XCNA 3F9GA 1NRQH 7LPRA 4IW4E 3KEEA 1PQ7A 2W3IA 4X8TH 1GHYH 1FMGA 2XC5A 1LTOA 3NKKA 2PGQB 3V0XA 3RMNH 2QF0A 1KXDA 3F9HA 5C20A 2VH0A 1AE5A 1OP2A 1ELDE 4H42U 3VXEH 3QZRA 1O3LA 1KLJH 1O3OA 1K1NA 2B5TB 2ZPQA 3K2UA 2CMYA 3RXHA 1INCA 4X8UH 3UNQA 1C5XB 2AMQA 1BTHH 3TU7H 1BUIA 1GI4A 3MU1A 4JCNA 3QLPH 1ELBA 1TPAE 1EP5A 1PPZA 1OKXA 1SBWA 6ESTA 1H9LB 1HAGE 1NT1A 1O5BB 3AVZA 1W14U 2H9EH 2BD7A 3RXIA 3SUDA 1N6YA 1SL3A 1JXPA 2QY0B 3M36A 1HAPH 1G3DA 3ZV9A 1HAOH 5DG6A 2G52A 1O2WA 1O5GH 2JETB 3A8DA 4CRDA 1MU8B 3MNCA 3RXVA 2R9PA 3ZVAA 4I8GA 1CT2E 1ZPBA 2FOCA 3SQEE 2BX4A 2UWPA 2Z3DA 1PPBH 1BBRE 6CHAB 1M9UA 2ZIQH 1ACBE 1GDNA 3RU4D 1SMFE 1EP6A 4ZMAH 1W11U 1ARBA 1GCDA 3IG6B 1O2PA 2XBYA 2J4IA 1EB2A 2XNIA 3NCLA 4O3UA 1OP0A 1GI9B 2GDEH 2Z6BD 1MMJN 3QZQA 5K0HA 3H5CB 3CS7A 2Y80A 2BZAA 3BEIB 2R3UA 3BTWE 1MU6B 3LGUA 1Y5UT 3LDXH 2ZI2H 3SJKA 4UONA 3A83A 1AUJA 3RXFA 1KSNA 2I6SA 2V35A 4I8JA 1W7GH 2I6QA 1GGDB 3Q3KA 1Z71A 5GWZA 2C3SA 3ATLA 5DGJA 2J95A 1GBEA 1O2LA 1TE0A 1C2LA 5AFYH 1GBKA 4CHAC 2XWBI 5DP3A 4SGBE 2IN2A 2PKSC 3LJJA 4Y11E 1EATA 1OWHA 1D3PB 2OQ5A 3ZYDA 2WPJS 1SPJA 4QT8C 3KL6A 3VB4A 1W13U 4O9VA 4YZUA 1GDQA 1SLVB 3SBKA 1DPOA 1Y3UA 3RXJA 4ABEA 1MTSA 1CGHA 2ZFSA 5GCHG 4XBDA 3UOPA 1P2KA 5EG4A 4KP0A 1FXYA 1CVWH 3LOXA 4O97A 4RKOB 4B74A 2FPZA 1ID5H 4B71A 1ELEE 1C5RA 3PWBA 2ZTXA 1F0UA 1YKTA 1TA2A 3M3TA 1V2UT 1WBGB 1O30A 1KXEA 2GX4A 1EAWA 1AVWA 2CF9H 1G3BA 2ALVA 2FXRA 1RRKA 2ZU1A 1AU8A 3BN9A 5JB9S 4XDEA 2Z3CA 2AIQA 2FLBH 4B2CA 3LC5A 2STAE 1TWXB 2RA0A 3MO3A 1G2LA 4ZROA 1AIXH 1C1RA 3PROA 2FOEA 1QIXB 5A2MH 1SOZA 1TPPA 2AH4X 5L2ZH 4DY7B 4BTUB 3FZZA 3SNCA 1N8OB 1EPTB 4Y8ZA 2SGDE 1DITH 3VFEA 1SOTA 1PPGE 1MBQA 1AVXA 1O2JA 1MUEB 1A5IA 3RC4A 1EJNA 1ELGA 3PO1B 2F9BH 1YPKH 3UOUA 4XFQA 4HFPB 3S9CA 3ZVDA 1BQYA 3OY5U 2AFQB 1T8LA 1UVPA 2Q6DA 4FUJA 2G4UA 1NFWA 3TITA 1QRXA 1C2EA 1GVKB 3SZNA 4DGJA 4WY3A 1Q31A 1TLDA 9LPRA 1JIMA 3E0NB 2A32A 2BD5A 3SU5A 1GHBG 5CHAC 1AD8H 4LXBH 4YM9A 3SW2B 1B0FA 1TQ7B 4BNRA 1QQ4A 1VJ9U 4J2YB 1G3CA 4XBBA 2VIVA 4IC5A 3VGCC 4FUDA 5LPFA 1HLTH 1AFQB 3EYDA 1PQ8A 2ZGCA 3MH6A 2BDIA 1GI3A 4DG4A 5FX5A 2G51A 1BDAA 1KDQB 3SORA 1PYTC 3RMLH 3ZZCA 5F6MA 1A3EH 1C5QA 1MD7A 1T7CA 2IJOB 1O2VA 1HDTH 1EAXA 4X1RU 3KQBA 2FOBA 1K2I1 1DUAA 3Q3YA 1ORFA 4B1TA 2BOHB 3TGIE 2XC4A 4D9QA 3TLOA 1SLXB 1S84A 2Q6GA 1IQEA 3LIWA 1F0SA 2GCTC 4INLA 2BDAA 1NPMA 3S0NA 4HTCH 4K5ZA 4MNWA 3RMOH 2GDDA 1TYNA 4KKDA 4DURA 1JRSA 1XVMA 4CRFA 1LVOA 2FODA 2O8WA 1TGCA 1P12E 4ABBA 1TNHA 4AFZA 1O5AB 3ZZ9A 4XE4A 1G9IE 1YPMH 2H6MA 1SQOA 2BQWB 2YNBA 2H9HA 1SVPA 3D49H 3K65B 2K1QA 3UQVA 4NGAH 2VB0A 4Q7XA 2FESH 1H1BA 1C1VH 3P8FA 2ZCHP 2GZ9A 1Z1IA 2BX3A 2AS9A 1QNJA 3HGNA 4TY6A 2Q1JA 4X2WA 4YT6H 4DJZB 2XW9A 3EAJA 4CHAB 4JZIA 3R3GB 1DXWA 1BBRK 4KTSA 2XBVA 2F83A 5F8TA 4A5TS 3RM2H 1BZXE 4K2YA 3UFAA 4OS2A 1TRYA 3SU4A 1O3PB 3RXEA 4ISLA 4I31A 2Y81A 2ZU4A 3SV9A 1ZMNA 1EB1H 2P59A 5F8ZA 1O3KA 1TOMH 1C1UH 1SHYA 3OSYA 2UUJB 4IGDA 2Z9GA 1P05A 1ZJKA 3E1XB 5DP5A 3A8AA 1BMMH 2UUYA 4A1TA 4BTIB 2ZQ2A 1H9HE 3UTUH 3V7TA 2VGCC 1AY6H 1GMHF 5DP8A 2AMPA 2J94A 1DS2E 3NPSA 4AGKA 3ATKA 2WINI 3T62A 3D62A 1CBWC 1NROH 4I33A 1GJDB 2LNCA 1TNIA 3RXGA 1AO5A 3ZZDA 5TJXA 4CH2B 1C5UA 1WUNH 3QUMP 1P2MA 4FUHA 5A0AE 2FOAA 3GCOA 1O2QA 4WH8A 1HJAC 3K6YA 3SOSA 5L6NH 1AKSB 2G4TA 4AGJA 4U2WA 1ZHPA 2HOBA 1BMLA 4FUEA 1L1GA 1OX1A 2BD2A 3GY5A 4ABGA 1O3DA 1BRBE 1FPHH 1J16A 2O8LA 1XXFA 2ZO3H 1Y3XA 1VJAU 1HIAB 2VIPA 2TIOA 1NU7B 3FP8E 5GPIB 2TGTA 1GI5A 3BTKE 1DWEH 3BTEE 5ABWA 1THRH 1IQKA 4NA7A 4K3JA 2A5AA 3T28A 1O3AA 2QV1A 1EASA 1TABE 5CHAB 1F5KU 2UUFB 1E36B 5FPSA 1RS0A 2VIDA 3PM3A 7KMEH 2ZKSA 2QIQA 3LPRA 1YPHE 3I29A 2BDHA 3VPKA 1GMDG 2ZU2A 2R2WU 1O5FH 1S81A 1TNKA 5HM9A 1HRTH 2WUCA 2VINA 2Z3EA 4FXGH 2FIRH 4LK4A 2GZ7A 1BTUA 2JETC 3CENA 1P3CA 2C8ZB 2FM2A 1GPZA 2QA9E 3PMAB 4JK6A 1TNGA 1UHBA 3MMGA 1C5YB 1PJPA 1O2OA 1N1LA 6CHAC 4X6NA 1F7ZA 1DY9A 2BLWA 3TGKE 1GDUA 3SJIA 4BOHA 3LGVA 4DT7B 3VB7A 2GCTB 5JPMH 2UWLA 3P17H 1ELVA 1ZHMA 1WU1A 1FY3A 4TY7A 4CR9A 1EAIA 2A2QH 4OS4A 1JOUB 1SQTA 2Y5GA 2JH5D 1MAYA 3ZZAA 3TK6A 4Q7ZA 3VB6A 1RJXB 1RTKA 4YTAA 1MQ5A 3RLWH 2ZDNA 1VITG 2P93A 1O31A 2ZHFH 3HKJB 1DSUA 1T4UH 1YPHC 3E8LA 2XWAA 4BANB 3ZZ6A 3NK8A 2ASUB 3S9BA 1NRRH 5GIBA 1W10U 4E05H 1S5SA 1V2RT 1E38B 1P10A 2F91A 5TCAA 2PLXA 1QRZA 1GJBB 5DK1A 7GCHF 3RC5A 7ESTE 3EDXB 4JZDH 2F9NA 3BTQE 1F5RA 2ZCKP 2SFAA 4XBCA 3S7HB 1TMTH 1GHXH 1MTNC 1T8NA 2CV3A 2G00A 1OXGA 1AMHA 1W8BH 4IMQA 1TGSZ 5A8ZA 3MO6A 5FCKA 1LHEH 1O37A 3B9FH 2FS8A 1EXFA 1RIWB 3M7UA 4X6OA 1BT7A 1Z8RA 5GCHF 1A0JA 1G30B 2HVXA 2HNTE 4MG3A 3TNTA 4BAMB 4E7RG 2G5NA 2HNTF 1MZAA 1P03A 2A1DB 1LPGB 4TYDA 3N7OA 2NU0E 2OQUA 1BMAA 2VIWA 3RXPA 4DVAU 4R0IA 4ZKOU 2GP9B 1C2HA 2ZTYA 1FQ3A 1KXCA 3UREA 3BIUH 2RCEA 3KCGH 1QJ7B 4Q7YA 4IBLH 1H8DH 1HAHH 4X2XA 4JZEH 1GBIA 1SC8U 3PWCA 5EQSA 3GY6A 2SGAA 2BLVA 2CHAB 3KHVA 1LPKB 1HJAB 1B0EA 1XUGA 1MKXH 1FONA 3ODFA 4FU7A 2PHBA 1LQDB 2D8WA 1VGCB 5DP4A 1AB9B 1XUHA 1A2CH 2EI7A 5C5OA 2ANKH 1KXBA 1O3BA 1N8OC 1NO9H 2HNTC 2V6NA 2AGIX 1UO6A 1TRNA 3SV7A 3GISB 2OTVA 3PO1C 9ESTA 3P70B 1C2JA 2H2ZA 3ATWA 2ZHQH 3URCA 1AWFH 1WTGH 2YNAA 4ZH8A 1IQIA 1WYKA 8LPRA 4LOYH 3E90B 1A0LA 1O5EH 3H7OA 1S85A 4E7NA 3U8RH 1F5LA 1XVOA 2HLCA 1GHBF 3ZZ4A 5AVDA 2NWNA 4IC6A 2PUXB 1HBTH 1W3CA 1YLCA 2EI6A 4AB9A 3DUXH 3UIRA 3SJOA 5C67A 5A8YA 1IHSH 1AFQC 2A7CA 2BD9A 1BITA 4IN1A 1DUEA 1HXFH 1OPHB 2VH6A 2OC7A 5IDKA 3QTVH 3L33A 1V3XA 3A8CA 5T3HA 1XUKA 8GCHF 3PMBB 2EA3A 1ZYOA 1TX7A 3PLPA 2ZECA 4LZ1H 1E35B 1LKAA 2OP9A 4O03A 2G55A 1ANEA 3FZDA 5DP9A 1FJSA 1EUFA 1OWJA 3PV4A 3B23B 1J14A 2CF8H 1UTKA 4K8YA 1BHXB 1ZSJA 1AN1E 5LPRA 4R8TB 3SHCH 1V2LT 5HM2A 5JBBS 2J9NA 1O38A 4Y79A 3F9FA 1D6WA 4GLYA 3SQHE 3BIVH 3ELAH 1A0HB 4AORA 4AYYB 1OYQA 3T2NA 2B0FA 2A2XH 4AZ2B 1QFKH 1OP8A 4CRAA 3KIDU 4MVNA 1MD8A 5HMAA 3EQ0H 4M7GA 3SJ9A 1QJ1B 3TNSA 1ELFA 3SU3A 3OY6U 1YM0A 4UEHH 3MYWA 2BHGA 1D4PB 2J34A 1HJ8A 1K1PA 1AQ7A 1SGNE 1SSXA 1V2VT 1W2KH 2VWNA 4Z0KA 1ZMLA 2WV5A 1K9OE 7GCHG 3M3SA 4YESB 3E91A 2R3YA 4YO9A 1ARCA 3M5MA 3BF6H 2OINA 4AFSA 2WYGA 1MTNB 2GV7A 4U01A 1GJAB 1TMBH 1YPLH 2P3TB 3SV6A 1TA6A 5L30H 1UTNA 2EC9H 2C8YB 1RGQA 1UTJA 1GL0E 5E0HA 3RMMH 1C1PA 3VEQB 4VGCB 2D26C 1V2MT 1QRWA 3SNBA 5C1YA 3QO6A 3M7QA 3BV9B 3GDUA 2THFB 5EOKA 1ZRKA 1TNJA 4GCHF 3M5OA 2BLQA 1NZQH 4OS6A 2HRVA 5EW1H 4TPYA 2ZFRH 2XCFA 2PKAA 1GJ4H 3BTDE 1P57B 1HB0B 3AW1A 3ZZ8A 2PV9B 5ESBA 1DE7H 2ZTZA 1THPB 1ZJDA 4Q80A 2GMTB 3T25A 1AVGH 3SGQE 3U98H 5EQRA 1ZTJA 4YLQH 1VITH 1LQEA 4BTTB 1BRCE 1OS8A 1SGIB 3T5FH 4B2AA 2ZU5A 4NSYA 1F92A 2BQ7B 1QL7A 2G5VA 4MPWA 1DY8A 1V2ST 3U8OH 1CU1A 1ZTKA 1L4DA 2TBSA 1PPHE 4ABHA 1FZZA 2A4RA 1C2DA 1GVZA 3RM0H 3QGJA 3UWIA 4YOJA 4BAKB 3O8BA 2BD4A 2ZZUH 2QYIA 4FVDA 3MHWU 5ESTE 2ZA5A 2PKAB 2ANMH 3RXDA 4B75A 1XKBC 1SQAA 1EJMA 1GBCA 4NG9H 1BTZA 1C4V2 3U9AH 3RXBA 3UPEA 1ESTA 1G36A 1QA7A 5A0BA 1XXDA 4DOQA 5F8XA 1GJ7B 2ZFQH 3S69A 1C5LH 1EZSC 2FTMA 1V6DA 3HATH 1YC0A 2R2MB 2B8OH 3MU5A 3M5LA 1LVBA 2FZZA 1K28D 2FDAA 2PSYA 4WF8A 1GMDF 1P9SA 3FP6E 1DDJA 2GTBA 3ENSB 3EGKH 1ZSLA 2VWLA 1UTPA 4AG2A 1Y8TA 2BD3A 1YPGH 2BY8X 5LH8A 1A4WH 1O2RA 1SGTA 3FAOA 2R0KA 4JMYA 1OWKA 5DP6A 1P8VC 8GCHG 3KQEA 3TK9A 1UTLM 2XBXA 3TH4H 1CT4E 3MNBA 3OX7U 1YPEH 1TX8A 1A5GH 2FI4E 1EOJA 2BXUH 1O3NA 1CQQA 1TALA 1QBNA 1TMUH 2B9LA 1TGTA 3P8NA 4CRBA 3A84A 3HK3B 3A85A 1CA0C 1Y3WA 3EA7A 1UK2A 2F9UA 3QK1A 4KELA 4K69A 4NWLA 4WMFA 5FAHA 2BYAX 2A5KA 1GJ5H 4AX9H 1GBLA 4CRCA 1IHTH 1SGPE 5CMXH 1VITF 1HAXB 5AHGH 3DHKH 3ZVEA 1HUTH 1O2MA 1F2SE 2G8TA 3E3TA 4IS5A 1WTHD 5AFZH 1EZXC 2FX6A 1K21H 4Y7BA 3SHAH 3A87A 2QCYA 1IQLA 1Y59T 3V12A 1H4WA 1PQAA 2Z7FE 8KME2 3FVFB 1WCZA 1H8IH 1BTWA 3SU6A 1Z8GA 2ZHWH 2Z9IA 5C2ZA 2M5TA 4X6MA 2FI5E 1GI2A 2FOHA 2AGGX 1WV7H 4MNXA 2FYQA 5C1UA 3STIA 1VR1H 4Y76A 5EXLA 1Z8JB 2ZP0H 4WMEA 1C1TA 5T6FA 3O8RA 1GBAA 1DWCH 4AN7A 1TONA 1C5WB 1RIWC 1T32A 1YGCH 3C1KA 4K1TA 4H6SB 1FY4A 2VWOA 1HV7A 2EEKA 4ISNA 4D9RA 1FPCH 2ZF0H 1C1QA 5I46H 2SGEE 1XM1A 1FN8A 1QCPA 5FCRA 3URDA 1V2NT 2ZU3A 6GCHF 3DFJA 1W7XH 1NN6A 4GCHG 1CGIE 3M7TA 4MQAA 2BD8A 3OYPA 1JMOH 1SR5C 4KTUA 1YYY1 1IQJA 4YOGA 3PB1E 3RXOA 1EJAA 1F0TA 1TBRH 2SGQE 1P2QA 4B76A 4NIVA 2QXJA 2SNWA 3Q3XA 3AAUA 2WUBA 4FUGA 3VB3A 5I25A 2FOGA 2XYAA 1QBVH 3KF2A 4LZ4B 4ZKRU 3D65E 3F68H 1SFQB 4NFFA 1S83A 4FU8A 1PPFE 1P01A 3ZV8A 1GCTB 3SV8A 1E34B 2D2DA 1IQHA 2A31A 2ZFFH 4DCDA 1LPZB 2ESTE 4HGCA 2CHAC 3GY7A 2ZEBA 2P94A 3RU4E 4ESTE 2PW8H 1QQUA 4AFUA 3GY4A 4ZXYH 3SGBE 5J4SA 2FTLE 1VGCC 3BG4B 1AB9C 1ABJH 4WWYA 3ZVBA 3UY9A 5DKMA 3K6ZA 1L2EA 4SGAE 2ZCLP 3ZZ7A 1DWBH 4ABAA 2SGPE 3A86A 1QB9A 1P11E 1C5PA 1SLUB 4CREA 1BHXF 1TFXA 4ZXXH 1GMCF 4D76A 3KN2A 1V2KT 1AI8H 3SNEA 1V2QT 3O8DA 1UK4A 2AMDA 3GY8A 1HAYB 2EI8A 1DLKB 3NWUA 5EPNA 1O2GH 1QR3E 3G01A 2UUKB 1G2MA 3A7XA 1OWDA 1QGFA 2FLRH 1FIZA 1C5OH 3KNXA 3UNSA 1MAXA 3RXUA 3TIUA 1UVTH 3R0FA 2Z94A 1IQGA 2ZNKH 1GBTA 1FAKH 1DOJA 1TGBA 3OU0A 3MTYA 4JYTA 3Q77A 3M61U 1IQNA 1SGQE 2CGAA 2QAAA 3HGPA 5AF9H 4NSVA 1OWIA 3RLYH 3I77A 2Y5HA 2OXSA 2YOLA 1BA8B 3ATIA 3P8OA 1WSSH 2P95A 4MPUA 3C27B 1KTSB 1O2ZA 3SU2A 3MOCA 5GDSH 4D7FA 4ZAEA 5EXNA 2BY7X 4CH8B 3A7VA 2GT7A 1U6QA 1D9IA 3JZ2B 2O9QA 1C2MA 4DIHH 4KTCA 2VVUA 4J1YA 1TIOA 1LHFH 4FUCA 4NWKA 1GBMA 3TPIZ 4OS1A 1CA0B 3ZYEA 1KYNA 2BY5X 4NZQA 1Q2WA 1UJ1A 1BIOA 1KXFA 1OWEA 4ISIH 1CE5A 2BVSH 1BJUA 4MNYA 2W7SA 2LPRA 2KAIA 1QTFA 1Y3VA 2CN0H 3NXPA 4K60A 3TK5A 3L6PA 3RC6A 1NFXA 3EE0B 4JZFH 1RFNA 4ZHAA 1EKBB 1NFUA 2QF3A 2F9VA 2D1JA 4Y0ZE 3RXSA 3V13A 5E8EH 4JK5A 1JIRA 4ZKNU 3TGJE 1UHBB 3K9XB 3MH4A 3LH3A 2V3OH 5BPEA 4O3TA 4X1NU 3M3VA 1RXPA 3A7WA 3BTME 2GKVE 1QA0A 1ZR0A 4NA8A 1OSSA 3QWCH 3ZZ5A 5GXPA 4CBOA 4CBNA 3GYLB 1RTFB 4TWWA 1C5TA 2OC1A 1ELAA 3MH7A 1BRUP 1GL1A 1SLWB 2KAIB 1RD3B 1UTQA 1V2WT 3LGTA 4VGCC 4X1QU 1L4ZA 1FY8E 3MFJA 4X0WU 1LMWB 3V3MA 1TNLA 3DA9B 2ILNA 2GT8A 1N6XA 3GCHB 3QN7A 1ZPCA 2GCHF 1P3EA 3ESTA 6GCHG 2WYJA 4A92A 2A5IA 1ZSKA 2J92A 2ZC9H 1C1MA 3I78A 4K1EA 4FUIA 1XUJA 1QB1A 1C1WH 1T4VH 1LHGH 2ZWLH 4Q2KA 2RG3A 4A6LA 3MI4A 2GMTC 1A7SA 1HXEH 3CP7A 2ZPSA 1AE8H
chains in the Genus database with same CATH superfamily
1TB6H 2JH0D 2C8XB 1O36A 2A4GA 3SNAA 3NRLA 3SUFA 3RXMA 2PFEA 1ESBA 2W6JD 3TJVA 1FDPA 3F6UH 3LC3A 1GBBA 1KLTA 1YCPH 5CHBA 1D6RA 3GDSA 3TVJB 1O32A 4X6PA 3RP2A 4PROA 4K1SA 1C5NH 1UTOA 3WY8A 3U1IB 4WH6A 1K1JA 3LH1A 3PLBA 1O0DH 1O3JA 2VVCA 2A4OA 2PR3A 5LGOA 2RA3A 1C5SA 4FUBA 1P02A 3F9EA 1NTPA 1NY22 3DCLA 1LVMA 5EGMA 2ANWA 4TWYA 2BM2A 3DD2H 3BTFE 5HGGA 2NU2E 3VB5A 4H6TA 1S6FA 2QGRA 1ETSH 3M5NA 4CRGA 2WPHS 1FAXA 1GMCG 1C1SA 1GBJA 1ANBA 3O8CA 1LKBA 3EA9A 5F53A 1ZMJA 1TBQH 1Y3YA 1TPOA 4B2BA 1K0HA 1C2GA 4JZ1A 2ALPA 2ZQ1A 2P8OB 1UVUH 3ZZBA 4GHTA 5GJ4B 1J8AA 1ETRH 2Y7XA 4UE7H 1GBDA 2ULLA 1ZLRA 3CS0A 1J9CH 3D23A 4IMZA 2TPIZ 3UWJH 2TRMA 1QBOA 1NU9A 4AYVB 1O2KA 1Z7KA 5H4IB 3MU4A 4JYVH 4ACBA 4ASHA 1GJ8B 1K1IA 4UDWH 1CHOG 3MU0A 2IPHA 3LGYA 1BOQA 3S7KB 5JDUB 4ZCNA 1V2TT 2RDLA 1T31A 1O34A 4GHQA 1S6HA 2O8TA 1VCPA 2PSXA 3TH2H 1IAUA 1GG6B 1HJ9A 2ZDMA 2UWOA 1TBZH 1QB6A 1KLIH 1MH0A 3IWMA 1YPJH 4WXIA 3S9AA 1A61H 3RU4T 1O3IA 2JJ1D 1FLEE 1HAIH 1QHRB 3SI3H 1E1RD 2QC2A 3LONA 1Y5AT 1S0QA 4MTBA 3UQOA 3LJOA 2GGVB 2V3HH 3GY3A 3GICB 1XX9A 4NA9H 1C4U2 2CK3D 1LDTT 2JH6D 2BOKA 3LKWA 2L74A 3P95A 1GHAG 1QL9A 1ZGVA 4MNVA 1XUFA 1UCYH 4YLUA 4D8NA 5T6DA 3RDZA 1GJCB 1MTVA 1NFYA 5K7RA 2HWLB 4Y10E 3A88A 1V2OT 3HPTB 2VIOA 2VU8E 1W0ZU 2ZDVH 5JBCS 2AEIH 1GVLA 2ZDLA 5JBAS 1TQ0B 1NESE 1QY6A 2F9PA 3BTGE 1WQVH 3RXRA 2OD3B 5G4BA 3Q76A 3A82A 1O2NA 1ELCA 1YY3A 4X8VH 2XC0A 5J4QA 1ESAA 1MBMA 1EAUA 2PGBB 4BAHB 2GVFA 1GI6A 2GD4B 3SN8A 1LCYA 2HGTH 3AASA 3GDVA 1GBHA 2Y7ZA 5EXMA 4WMDA 3SUGA 3DSGA 1BCUH 5HXFA 2HLDD 1BJVA 1PPEE 1S82A 2HALA 2Y82A 4Y6DA 3TJUA 2GJGA 3PMHB 4YXWD 3SO3A 1SFIA 2KCOA 2GCHG 1P2NA 4OS5A 1MZDA 1HCGA 4GPGA 5BRRE 2DE8A 3A7YA 5C1XA 1P09A 5EQQA 3SU0A 5T6GA 2A7HA 1MABB 4INKA 1ANCA 1C2IA 3BEUA 1YBWA 1RTLA 3ZIAD 4BAOB 1L0ZA 2ZFTA 4UFGH 2BXTH 4KGAA 4GVUA 4A1XA 2W5EA 3PTNA 2W26A 4NIYA 8ESTE 1IOEA 1D3QB 3NZIA 4GUXA 1HYLA 1P2JA 1HAZB 3KQCA 5E0JA 1GCTC 1EPTA 1TAWA 3DSPA 2A0QB 1MKWH 3JZ1B 4Y7AA 1C5ZB 3MNXA 2QXIA 3BEFB 5SGAE 2R0LA 4I8LA 1DANH 3GY2A 1EQ9A 3PTBA 3P6ZB 2H5CA 3GCTF 1XUIA 2PUQH 2H5DA 2ODPA 3BG4C 2FI3E 3UR9A 1DT2A 1CO7E 1AFEH 1DWDH 1HFDA 2FS9A 2SGFE 4HZHA 6LPRA 2F9OA 2DUCA 2VNTA 1O33A 1OOKB 1UCYE 2GV6A 1NRPH 2GZ8A 5CE1A 1GHZA 2BQ6B 4WJG2 1D3DB 4A7IB 1SB1H 3U69H 3KQDA 1ABIH 2A4QA 2C93B 3GCNA 3MO9A 1O39A 1Q3XA 4NIWA 5E0GA 4UFFH 3MH5A 4BXSA 1KDQA 4INHA 1Z1JA 1C5MD 5FPTA 1CT0E 4I8HA 2AGEX 1GHVH 3E16B 4Y0YE 3STJA 4X1PU 3M35A 3N99A 4DW2U 1G3EA 3ZVCA 1BTYA 3E0PB 1C1NA 2C4FH 1AGJA 4GSOA 4AFQA 1WAYB 2BY9X 2ANYA 3SU1A 1W0KD 1KXAA 5PTPA 4Q63A 1O2IA 4IN2A 4XRNA 2CJIA 1O2SA 4ZUHA 2FX4A 3A81A 3TJOA 3RXAA 1EOLA 3FFGA 1E0FD 4AB8A 4B6EA 4FUFA 4F48B 1QJ6B 1MQ6A 2JKHA 1AUTC 5EU8A 2ZG0H 1O3MA 4HI3A 1DSTA 2BVRH 4OGXA 1B5GH 4XOJA 2NU3E 1Z6EA 1KY9A 2CXVA 1J15A 3PYHA 4ZHLU 2A7JA 2OC8A 4X2VA 1MCTA 3L3TA 4MLFB 2ODQA 1BMNH 1C2KA 4MDSA 2P16A 2J38A 1YLDA 1NRSH 4I32A 1HAVA 1C9PA 1O5CB 1ZTLA 1CHGA 2BLOA 5JB8S 5F03A 1FUJA 2OBQA 3M37A 5LPEA 4ABJA 2XRCA 4BXWA 1P2IA 2ZHDA 1ZRBA 3BSQA 1C5VA 1DICA 1O3GA 2FO9A 3ZVGA 1PFXC 3F2GA 2O8MA 4F4OC 1SGRE 2FYRA 2ZGBH 5ETXA 2WSSD 4Y8XA 2PWXA 2XTTB 2Z9LA 1VCQA 1GBFA 4U32A 4F49A 1E37B 1ZOMA 1T8OA 4UD9H 2Y6TA 3HKIB 2ZGXH 4ABIA 1A1RA 3VXFH 4TPIZ 2HPQH 2QF4A 3A89A 4MPVA 3GS9A 2Y5FA 2VVVA 1FIWA 1LHDH 1O3FA 3QDZB 4GAWA 2B7DH 4U30A 1QURH 1V2JT 2BZ6H 5A8XA 1FY5A 2W7UA 1HAVB 1G37A 1ETTH 3SGAE 2WV4A 5FXLA 1NM6A 4ABDA 1BRAA 4D7GA 2SNVA 4UFEH 1YCPM 3UUZA 3T29A 3QGNB 2BDBA 2AERH 3MWIU 5FX6A 2QXGA 3PV2A 4K8BA 1O2XA 1LO6A 3P92A 1A3BH 1D3TB 2PKSB 2VWMA 4X1SU 2TGPZ 2ZPRA 3BG8A 1CSOE 1A46H 3GCHC 1DXPA 1P04A 3U1JB 3ODDA 1YCPK 1TOCB 1Y5BT 2FEQH 4WXVA 2ZHEH 3SUEA 1TPSA 2BDYA 1MKXK 2OC0A 1WOFA 2TGAA 1ZHRA 2F3CE 2XNDD 2C90B 2AHME 1AKSA 2FMJA 4FVBA 1ZGIA 1L1NA 2KX4A 4MPXA 2NU4E 2BY6X 4YT7H 3TH3H 3ITIA 2OBOA 3KGPA 2P3FH 1W12U 4X8SH 1P2OA 1GI8B 1GI7B 1L1JA 2OLGA 5A09A 1AZZA 1GI1A 1HPGA 3LGWA 1HIAA 3E6PH 4DIIH 5EPYA 1G32B 4BAQB 1WDIA 5E2OA 1K1LA 3GCTG 3LGIA 3RXLA 2OUAA 1YP9A 1Z6JH 4NZLA 3P8GA 1CGJE 3EA8A 3RUOA 1FV9A 1Z8IB 4NIXA 5JBTA 4CR5A 5B6OA 1SGFG 4RSPA 1H8HD 2WPIS 1TGNA 3GOVB 1K1MA 1SGFA 3LT3A 4I7YH 5IYTA 4UFDH 1DLEA 1JRTA 1NRNH 2BDGA 1YLNA 1GJ6A 3IITA 4WVPE 3A80A 1UVSH 1XKAC 1LHCH 4NCYA 1EZQA 3N7EA 5EODA 1IQFA 1K22H 1VZQH 1IQMA 2P8OC 3SI4H 2J98B 4Y71A 2Q6FA 1EZUC 1ZPZA 3HK6B 3VG8A 1C4Y2 3RXCA 3PMJA 4A1VA 4FU9A 3OFND 2HPPH 3ZVFA 1NC6A 3MNSA 2VBCA 2V7QD 1CA8B 2ZGHA 1T8MA 1AHTH 1S0RA 5A0CA 2ZGJA 4Z6AH 1CHOF 1K1OA 1THSH 2IJD1 2G81E 3AAVA 2PTNA 5EW2H 3U8TH 3RXQA 4Y8YA 2FWWA 5DPAA 2STBE 5KECA 1FY1A 2ZFPH 2TGDA 1MCVA 1UCYK 2AIPA 2NU1E 1GG6C 3VGCB 2WZQA 4AOQA 3F1SB 1O2UA 2IOTA 1TX6A 2AYWA 1WQSA 1YF4A 3FOAA 5L2YH 2BMGB 5DO4H 1GHWH 2VIQA 1SKYE 2WPDD 4JYUH 2XXLA 1HGTH 1P9UA 3MU8A 1SI5H 5FHTA 1H9IE 5FBIA 4ISHH 3A8BA 2A45B 4ZKSU 1GHAF 3FP7E 1PYTD 2QXHA 1X7AC 1FN6A 1OYTH 1O2YA 1JBUH 1BTXA 2PTCE 2FP7B 5DJ7A 3QTOH 1MTUA 2FOMB 3UNRA 3RXKA 1S6LA 1ZZZA 4H4FA 5DP7A 3SNDA 2J2UA 1O3EA 1UMAH 1C2FA 3A7TA 5FPYA 3TJNA 2WPMS 4OS7A 1H8ED 4RKJB 1SG8B 1KTTB 2BDCA 4X2YA 4I8KA 3QX5H 5HYOA 2BVXH 4XSKU 4ABFA 1QL8A 1AWHB 4ZHMU 1MTWA 1UVOA 1C1OA 2VJ1A 1KIGH 2FOFA 1GGDC 1YWUA 1PQ5A 5FBEA 1JWTA 1V2PT 1ANDA 4B73A 1PPCE 3OTJE 4THNH 3BTTE 3PLKA 2WPKS 4NFEA 1OHHD 5FL7D 1O35A 5C5NA 2XBWA 4OGYA 1UTMA 3SV2H 1MKWK 1SGEE 3B8JA 1GWAA 1C9TA 1O2TA 3H7TA 5TCCA 2V0BA 1W0YH 3T26A 1DVAH 2ZDKA 4YOIA 1UK3A 2H9TH 1BB0B 1P0SH 3A7ZA 3OTPA 1O5DH 1LVYA 3BTHE 1DM4B 3T27A 1O3HA 5C3NA 2Z9KA 3NUMA 2ODYB 1DX5M 3PRDA 1O2HA 5JYIA 1SGCA 1EX3A 1BBRH 1SGYE 2DE9A 3LU9B 2VGCB 1GI0A 3UR6A 1GMHG 2Z9JA 1VCWA 3CNRA 3RXTA 1ELTA 1SHHB 4ISOA 1CBWB 1HNEE 2H1UA 1DFPA 2BTCE 2KCYA 2ZDAH 1NS3A 3ATMA 2P3UB 3DFLA 1FI8A 1GJ9B 1BTPA 4RN6A 3AW0A 2W3KA 2V3MA 3GYMA 2QE7D 3ZZ3A 1P06A 2IPQX 2QN5T 3Q00A 2C8WB 3SJ8A 3FANA 1FNIA 4E06H 4AG1A 1EPTC 3DT0H 2OCVB 2WPLS 2O8UA 5E2PA 1SGDE 1F0RA 1TRMA 1AZ8A 3W94A 1B7XB 1J17T 1XMNB 3W95A 1O3CA 2BB4A 1A5HA 2XCNA 3F9GA 1NRQH 7LPRA 4IW4E 3KEEA 1PQ7A 2W3IA 2J5UA 4X8TH 1NBMD 1GHYH 1FMGA 2XC5A 1LTOA 3NKKA 5EJZA 2PGQB 3V0XA 3RMNH 2QF0A 1KXDA 3F9HA 5C20A 2VH0A 1AE5A 2L6OA 1OP2A 1ELDE 4H42U 3VXEH 3QZRA 1O3LA 1KLJH 1O3OA 1K1NA 2B5TB 2ZPQA 5EIYA 3K2UA 2CMYA 4B6FA 3RXHA 1INCA 4X8UH 3UNQA 1C5XB 2AMQA 1BTHH 3TU7H 1BUIA 1GI4A 3MU1A 4JCNA 3QLPH 4ASUD 1ELBA 1TPAE 1EP5A 1PPZA 1OKXA 1SBWA 6ESTA 1H9LB 1HAGE 1NT1A 1O5BB 3AVZA 1W14U 2H9EH 2BD7A 3RXIA 3SUDA 1N6YA 1SL3A 1JXPA 2QY0B 3M36A 1HAPH 1G3DA 2K8IA 3ZV9A 1HAOH 2J97A 5DG6A 2G52A 1O2WA 1O5GH 2JETB 3A8DA 4CRDA 1MU8B 3MNCA 3RXVA 2R9PA 3ZVAA 2YMSD 4I8GA 1CT2E 1ZPBA 2FOCA 3SQEE 2BX4A 2UWPA 2Z3DA 1PPBH 1BBRE 4FETA 6CHAB 1M9UA 2ZIQH 1ACBE 1GDNA 3RU4D 1SMFE 1EP6A 4ZMAH 1W11U 1ARBA 1GCDA 3IG6B 1O2PA 2XBYA 2J4IA 1EB2A 2XNIA 3NCLA 4O3UA 1OP0A 1GI9B 2GDEH 2Z6BD 1MMJN 3QZQA 3F2FA 5K0HA 3H5CB 3CS7A 2Y80A 2BZAA 3BEIB 2R3UA 3BTWE 1MU6B 3LGUA 1Y5UT 5C94A 3LDXH 2ZI2H 3SJKA 4UONA 3A83A 1AUJA 3RXFA 1KSNA 2I6SA 2V35A 4I8JA 4HG6A 1W7GH 2I6QA 1GGDB 3W1EA 3Q3KA 1Z71A 5GWZA 2C3SA 2KCPA 3ATLA 5DGJA 2J95A 1GBEA 1O2LA 1TE0A 1C2LA 5AFYH 1GBKA 1COWD 2XWBI 5DP3A 4CHAC 4SGBE 2IN2A 2PKSC 3LJJA 4Y11E 1EATA 1OWHA 1D3PB 2OQ5A 1EFRD 3ZYDA 2WPJS 1SPJA 4QT8C 3KL6A 3N7DA 3VB4A 1W13U 3WWFA 4O9VA 4YZUA 1GDQA 1SLVB 3SBKA 1DPOA 1Y3UA 3RXJA 4ABEA 1MTSA 1CGHA 2ZFSA 5GCHG 4XBDA 3UOPA 1P2KA 5EG4A 4KP0A 1FXYA 1CVWH 3LOXA 4O97A 4RKOB 2LELA 4B74A 5IK2D 2KM0A 2FPZA 1ID5H 4B71A 1ELEE 1C5RA 3PWBA 2ZTXA 1F0UA 1YKTA 1TA2A 3M3TA 1V2UT 1WBGB 1O30A 1KXEA 2GX4A 1EAWA 1AVWA 2CF9H 1G3BA 2ALVA 2FXRA 1RRKA 2ZU1A 1AU8A 2EQNA 3BN9A 5JB9S 4XDEA 2Z3CA 2AIQA 2FLBH 2W6ID 4B2CA 3LC5A 2STAE 1TWXB 2RA0A 3MO3A 1G2LA 4ZROA 1AIXH 2QF5A 1C1RA 3PROA 2FOEA 1QIXB 2RFKC 5A2MH 1SOZA 2KFWA 1TPPA 2AH4X 5L2ZH 4DY7B 4BTUB 3FZZA 3SNCA 1N8OB 1EPTB 4Y8ZA 2SGDE 1DITH 3VFEA 1SOTA 1PPGE 1MBQA 5HKKD 1AVXA 1O2JA 1MUEB 1A5IA 3RC4A 1EJNA 1ELGA 3PO1B 2F9BH 1YPKH 3UOUA 4XFQA 4HFPB 3S9CA 3ZVDA 1BQYA 3OY5U 3UAIC 2AFQB 1T8LA 1UVPA 2Q6DA 4FUJA 2G4UA 1NFWA 3TITA 1QRXA 1C2EA 1GVKB 3SZNA 4DGJA 4WY3A 1Q31A 1TLDA 9LPRA 1JIMA 3E0NB 2A32A 2BD5A 3SU5A 1GHBG 5CHAC 1AD8H 4LXBH 4YM9A 3SW2B 1B0FA 1TQ7B 4BNRA 1QQ4A 1VJ9U 4J2YB 1G3CA 4XBBA 2VIVA 4IC5A 3VGCC 4FUDA 5LPFA 4FOUC 1HLTH 1AFQB 3EYDA 1PQ8A 2ZGCA 3MH6A 2BDIA 1GI3A 4DG4A 5FX5A 2G51A 1BDAA 1KDQB 3SORA 1PYTC 3RMLH 3ZZCA 5F6MA 1A3EH 1C5QA 1MD7A 1T7CA 2IJOB 3EE7A 1O2VA 1HDTH 4Q4LA 1EAXA 4X1RU 3KYGA 3KQBA 2FOBA 1K2I1 1DUAA 3Q3YA 1ORFA 2M2AA 4B1TA 2BOHB 3TGIE 2XC4A 4D9QA 3TLOA 1SLXB 1S84A 2Q6GA 1IQEA 3LIWA 1F0SA 2GCTC 4INLA 2BDAA 1NPMA 3S0NA 4HTCH 4K5ZA 4MNWA 3RMOH 2GDDA 1TYNA 4KKDA 4DURA 1JRSA 1XVMA 4CRFA 1LVOA 2FODA 2O8WA 1TGCA 1P12E 4ABBA 1TNHA 4AFZA 1O5AB 3ZZ9A 2F43B 4XE4A 1G9IE 1YPMH 2H6MA 1SQOA 2BQWB 2YNBA 2H9HA 1SVPA 3D49H 3K65B 2K1QA 2F4LA 3UQVA 4NGAH 2VB0A 4Q7XA 2FESH 1H1BA 1C1VH 3P8FA 2ZCHP 2GZ9A 1Z1IA 2BX3A 3SYJA 2AS9A 1QNJA 3HGNA 4TY6A 2Q1JA 4X2WA 4YT6H 4DJZB 2XW9A 3EAJA 4CHAB 4JZIA 3R3GB 2LP6A 1DXWA 1BBRK 4KTSA 2XBVA 2F83A 5F8TA 4A5TS 3RM2H 1BZXE 4K2YA 3UFAA 4OS2A 1TRYA 3SU4A 1O3PB 3RXEA 3FO8D 4ISLA 4I31A 2Y81A 2ZU4A 3SV9A 1ZMNA 1EB1H 2P59A 5F8ZA 1O3KA 1TOMH 3SZEA 1C1UH 1SHYA 3OSYA 1BMFD 2UUJB 3H09A 4IGDA 2Z9GA 1P05A 1ZJKA 3E1XB 5DP5A 3A8AA 1BMMH 2UUYA 4A1TA 4BTIB 2ZQ2A 1H9HE 3UTUH 3V7TA 2VGCC 1AY6H 1GMHF 5DP8A 2AMPA 2RDEA 2J94A 1DS2E 3NPSA 4AGKA 3ATKA 2WINI 3T62A 3KYFA 3D62A 1CBWC 1NROH 4I33A 1GJDB 2LNCA 1TNIA 3RXGA 1AO5A 3ZZDA 5TJXA 4CH2B 1C5UA 3PRBA 1WUNH 3QUMP 1P2MA 4FUHA 5A0AE 2FOAA 3GCOA 1O2QA 4WH8A 1HJAC 3K6YA 3SOSA 5L6NH 1AKSB 5B6LA 2G4TA 4AGJA 4U2WA 1ZHPA 2HOBA 1BMLA 4FUEA 1L1GA 1OX1A 2BD2A 3GY5A 4ABGA 1O3DA 1BRBE 1FPHH 1J16A 2O8LA 1XXFA 2ZO3H 1Y3XA 1VJAU 1HIAB 2VIPA 2TIOA 1NU7B 3FP8E 5GPIB 2TGTA 3OAAD 1GI5A 3BTKE 3OEHD 1DWEH 3BTEE 5ABWA 1THRH 1IQKA 4NA7A 4K3JA 2A5AA 3T28A 1O3AA 2QV1A 1EASA 1TABE 5CHAB 1F5KU 2UUFB 1E36B 5FPSA 1RS0A 2VIDA 3PM3A 7KMEH 2ZKSA 2YMSC 2QIQA 3LPRA 1YPHE 3I29A 2BDHA 3VPKA 1GMDG 2ZU2A 4OM9A 2R2WU 1O5FH 1S81A 2PP6A 1TNKA 5HM9A 1HRTH 2WUCA 2VINA 2Z3EA 4FXGH 2FIRH 4LK4A 2GZ7A 1BTUA 2JETC 3CENA 3OEED 1P3CA 2C8ZB 2FM2A 1GPZA 2QA9E 3PMAB 4JK6A 5HIZA 1TNGA 1UHBA 3MMGA 1C5YB 1PJPA 1O2OA 5DSFA 1N1LA 6CHAC 4X6NA 1F7ZA 3DSOA 1DY9A 2BLWA 3TGKE 1GDUA 3SJIA 4BOHA 3LGVA 4DT7B 3VB7A 2GCTB 5JPMH 2UWLA 3P17H 1ELVA 1ZHMA 1WU1A 1FY3A 4TY7A 4CR9A 1EAIA 2A2QH 4OS4A 4RT0A 1JOUB 1SQTA 2Y5GA 2JH5D 1MAYA 3ZZAA 3TK6A 4Q7ZA 3VB6A 1RJXB 1RTKA 4YTAA 1MQ5A 3RLWH 2ZDNA 1VITG 2P93A 1O31A 2ZHFH 3HKJB 1DSUA 1T4UH 1YPHC 3E8LA 2XWAA 4BANB 3ZZ6A 3NK8A 2ASUB 3S9BA 1NRRH 5GIBA 1W10U 4P02A 5C0TA 4E05H 1S5SA 1V2RT 1E38B 1P10A 2F91A 5TCAA 2PLXA 1QRZA 1GJBB 5DK1A 7GCHF 3RC5A 7ESTE 3EDXB 4JZDH 2F9NA 3BTQE 1F5RA 2ZCKP 2SFAA 4XBCA 3S7HB 1TMTH 1GHXH 1MTNC 1T8NA 2CV3A 2G00A 1OXGA 1AMHA 1W8BH 4IMQA 1TGSZ 5A8ZA 3MO6A 5FCKA 1LHEH 1O37A 3B9FH 2FS8A 1EXFA 1RIWB 3M7UA 4X6OA 1BT7A 1Z8RA 5GCHF 1A0JA 1G30B 2HVXA 4Z1MD 2HNTE 4MG3A 3TNTA 4BAMB 4E7RG 2G5NA 2HNTF 1MZAA 1P03A 2A1DB 1LPGB 4XD7D 4TYDA 3N7OA 2NU0E 2OQUA 4RT1A 1BMAA 2VIWA 3RXPA 4DVAU 4R0IA 2JIZD 4ZKOU 2GP9B 1C2HA 2ZTYA 1FQ3A 1KXCA 3UREA 3BIUH 2RCEA 3KCGH 1QJ7B 4Q7YA 4IBLH 1H8DH 1HAHH 4X2XA 4RI0A 4JZEH 1GBIA 1SC8U 3PWCA 5EQSA 3GY6A 4M9FA 2SGAA 1QZ8A 2BLVA 2CHAB 3KHVA 1LPKB 1HJAB 1B0EA 1XUGA 1MKXH 1FONA 3ODFA 4FU7A 2PHBA 1LQDB 2D8WA 1VGCB 5DP4A 1AB9B 1XUHA 1A2CH 2EI7A 2KZ4A 5C5OA 5EJ1A 2ANKH 1KXBA 1O3BA 1N8OC 1NO9H 2HNTC 2V6NA 2AGIX 1UO6A 1TRNA 3SV7A 3GISB 2OTVA 3PO1C 9ESTA 3P70B 1C2JA 2H2ZA 3ATWA 2ZHQH 3URCA 1AWFH 1WTGH 2YNAA 4ZH8A 1IQIA 1WYKA 8LPRA 4LOYH 3E90B 1A0LA 1O5EH 3H7OA 1S85A 4E7NA 3U8RH 1F5LA 4P00A 1XVOA 2HLCA 1GHBF 3ZZ4A 5AVDA 2NWNA 4IC6A 2PUXB 1HBTH 1W3CA 1YLCA 2EI6A 3F0OA 4AB9A 3DUXH 2WV9A 3UIRA 3SJOA 5C67A 5A8YA 2YMSB 1IHSH 1AFQC 2A7CA 2BD9A 1BITA 4IN1A 1DUEA 1HXFH 1OPHB 2VH6A 2OC7A 5IDKA 3QTVH 3L33A 1V3XA 3A8CA 5T3HA 1XUKA 8GCHF 3PMBB 2EA3A 1ZYOA 1TX7A 3PLPA 2ZECA 4LZ1H 1E35B 1LKAA 2OP9A 4O03A 2G55A 1ANEA 3FZDA 5DP9A 1FJSA 1EUFA 1OWJA 3PV4A 1WXRA 3B23B 1J14A 2CF8H 1UTKA 4K8YA 1BHXB 1ZSJA 1AN1E 5LPRA 5DN6D 4R8TB 3SHCH 1V2LT 5HM2A 5JBBS 2J9NA 1O38A 4Y79A 3F9FA 1D6WA 4GLYA 3SQHE 3BIVH 3ELAH 1A0HB 4AORA 4AYYB 1OYQA 3T2NA 2B0FA 2A2XH 4AZ2B 1QFKH 1OP8A 4CRAA 1W0JD 3KIDU 4MVNA 1MD8A 5HMAA 3EQ0H 4M7GA 3SJ9A 1QJ1B 3TNSA 1ELFA 3SU3A 3OY6U 1YM0A 4UEHH 3MYWA 2BHGA 1D4PB 2J34A 1HJ8A 1K1PA 1AQ7A 1SGNE 1SSXA 1V2VT 1W2KH 2VWNA 4Z0KA 1ZMLA 2WV5A 1SQRA 1K9OE 7GCHG 3M3SA 4YESB 3E91A 2R3YA 4YO9A 1ARCA 3M5MA 3BF6H 3PV5A 2OINA 4AFSA 2WYGA 1MTNB 2GV7A 4U01A 1GJAB 1TMBH 1YPLH 2P3TB 3SV6A 1TA6A 5L30H 1UTNA 2EC9H 2C8YB 1RGQA 1UTJA 1GL0E 5E0HA 3RMMH 1C1PA 3VEQB 4VGCB 5CDFE 2D26C 1V2MT 1QRWA 3SNBA 5C1YA 1E1QD 3QO6A 3M7QA 3BV9B 3GDUA 2THFB 5EOKA 1ZRKA 1TNJA 4GCHF 3M5OA 2BLQA 1NZQH 4OS6A 2HRVA 5EW1H 4TPYA 2ZFRH 2XCFA 2PKAA 1GJ4H 3BTDE 1P57B 1HB0B 3AW1A 3ZZ8A 2PV9B 5ESBA 1DE7H 2ZTZA 1THPB 1ZJDA 3WWBA 3F2HA 4Q80A 2GMTB 3T25A 1AVGH 3SGQE 3U98H 5EQRA 1ZTJA 4YLQH 1VITH 1LQEA 4BTTB 1BRCE 1OS8A 1SGIB 3T5FH 4B2AA 2ZU5A 2KCAA 2XOKD 4NSYA 1F92A 2BQ7B 1QL7A 2G5VA 4MPWA 1DY8A 1V2ST 3U8OH 5KEDA 1CU1A 1ZTKA 4TT3D 1L4DA 2TBSA 1PPHE 4ABHA 1FZZA 1FX0B 2A4RA 1C2DA 1GVZA 3RM0H 3QGJA 3UWIA 4YOJA 4BAKB 3O8BA 2BD4A 2ZZUH 2QYIA 4FVDA 3MHWU 5ESTE 2ZA5A 2PKAB 2ANMH 3RXDA 4B75A 4ACAA 1XKBC 1SQAA 1EJMA 5EJLA 1GBCA 4NG9H 1BTZA 1C4V2 3U9AH 3RXBA 3UPEA 2JDID 1ESTA 1G36A 1QA7A 5A0BA 4TSFD 1XXDA 4DOQA 5F8XA 1GJ7B 2ZFQH 3S69A 1C5LH 1EZSC 5GNDA 3MQKC 2FTMA 1V6DA 3HATH 1YC0A 2R2MB 2B8OH 3MU5A 3M5LA 1LVBA 2FZZA 1K28D 2FDAA 2PSYA 4WF8A 1GMDF 1P9SA 3FP6E 1DDJA 2GTBA 3ENSB 3EGKH 1ZSLA 2VWLA 1UTPA 4AG2A 3F3BA 1Y8TA 1VKYA 2BD3A 1YPGH 2BY8X 5LH8A 1A4WH 1O2RA 4DT4A 1SGTA 3FAOA 2R0KA 4JMYA 1OWKA 5DP6A 1P8VC 8GCHG 3KQEA 3TK9A 1UTLM 2XBXA 3TH4H 1CT4E 3MNBA 3OX7U 5C0UA 1YPEH 1TX8A 1A5GH 2FI4E 1EOJA 2BXUH 1O3NA 1CQQA 1TALA 1QBNA 1TMUH 2B9LA 1TGTA 3P8NA 4CRBA 3A84A 3HK3B 3A85A 1CA0C 1Y3WA 3EA7A 1UK2A 2F9UA 3QK1A 4KELA 4K69A 4NWLA 4WMFA 5FAHA 2BYAX 2A5KA 1GJ5H 4AX9H 1GBLA 4CRCA 3KQ5A 1IHTH 1SGPE 5CMXH 1VITF 1HAXB 5AHGH 3DHKH 3ZVEA 1HUTH 1O2MA 1F2SE 2G8TA 3E3TA 4IS5A 1WTHD 5AFZH 1EZXC 2FX6A 1K21H 4Y7BA 3SHAH 3A87A 2QCYA 1IQLA 1Y59T 4I86A 3V12A 1H4WA 1PQAA 2Z7FE 8KME2 3FVFB 1WCZA 1H8IH 1BTWA 2JJ2D 3SU6A 1Z8GA 2ZHWH 2Z9IA 5C2ZA 2M5TA 4X6MA 2FI5E 1GI2A 2FOHA 2AGGX 1WV7H 4MNXA 2FYQA 5C1UA 3STIA 1VR1H 4Y76A 5EXLA 1Z8JB 2ZP0H 1KMHB 4WMEA 1C1TA 5T6FA 3O8RA 1GBAA 1DWCH 2OK5A 1TONA 1C5WB 4AN7A 1RIWC 1T32A 1YGCH 1NBME 3C1KA 4K1TA 4H6SB 1FY4A 2VWOA 1HV7A 2EEKA 4ISNA 4D9RA 1FPCH 2ZF0H 1C1QA 5I46H 2SGEE 3AK5A 1XM1A 1FN8A 1QCPA 5FCRA 3URDA 1V2NT 3F0PA 2ZU3A 6GCHF 3DFJA 1W7XH 1NN6A 4GCHG 1CGIE 3M7TA 4MQAA 2BD8A 3OYPA 1JMOH 1SR5C 4KTUA 1YYY1 1IQJA 4YOGA 3PB1E 3RXOA 1EJAA 1F0TA 1TBRH 2SGQE 1P2QA 4B76A 4NIVA 2QXJA 2SNWA 3Q3XA 3AAUA 2WUBA 4FUGA 3VB3A 5I25A 2FOGA 2XYAA 1QBVH 3KF2A 4LZ4B 4ZKRU 3D65E 3F68H 1SFQB 4NFFA 1S83A 4FU8A 1PPFE 1P01A 3ZV8A 1GCTB 3SV8A 1E34B 2D2DA 1IQHA 2A31A 2ZFFH 4DCDA 1LPZB 2ESTE 4HGCA 2CHAC 3GY7A 2J98A 2ZEBA 2P94A 3RU4E 4ESTE 2PW8H 1QQUA 4AFUA 3GY4A 4ZXYH 3SGBE 5J4SA 2FTLE 1VGCC 3BG4B 1AB9C 1ABJH 4WWYA 2HVYB 3ZVBA 3UY9A 5DKMA 3K6ZA 1L2EA 1UW7A 4SGAE 4AC9A 2ZCLP 3ZZ7A 1DWBH 4ABAA 2SGPE 3A86A 1QB9A 5HIYA 1P11E 1C5PA 1SLUB 4CREA 3U28C 1BHXF 1TFXA 4ZXXH 1GMCF 4D76A 3KN2A 1V2KT 1AI8H 3SNEA 1V2QT 3O8DA 1UK4A 2AMDA 3GY8A 1HAYB 2EI8A 1DLKB 3NWUA 5EPNA 1O2GH 1QR3E 3G01A 4F55A 2UUKB 1G2MA 3A7XA 1OWDA 1QGFA 2FLRH 1FIZA 1C5OH 3KNXA 3UNSA 1MAXA 3RXUA 3TIUA 1UVTH 3R0FA 2Z94A 1IQGA 2ZNKH 1GBTA 1FAKH 1DOJA 1TGBA 3OU0A 3MTYA 4JYTA 3Q77A 3M61U 1IQNA 1SGQE 2CGAA 2QAAA 3HGPA 5AF9H 4NSVA 1OWIA 2K0QA 3RLYH 3I77A 2Y5HA 2OXSA 2YOLA 1BA8B 3ATIA 3P8OA 1WSSH 2P95A 1E79D 3C27B 1KTSB 1O2ZA 4MPUA 3SU2A 3MOCA 5GDSH 4D7FA 4ZAEA 5EXNA 2BY7X 4CH8B 3A7VA 2GT7A 1U6QA 1D9IA 3JZ2B 2O9QA 1C2MA 4DIHH 4KTCA 2VVUA 4J1YA 1TIOA 1LHFH 4FUCA 4NWKA 1GBMA 3TPIZ 4OS1A 1CA0B 3ZYEA 1KYNA 2BY5X 2WHXA 4NZQA 1Q2WA 1UJ1A 3UB0A 1BIOA 3WW7A 2KR7A 1KXFA 1OWEA 4ISIH 1CE5A 2BVSH 1BJUA 4MNYA 2W7SA 2LPRA 2KAIA 1QTFA 1Y3VA 2CN0H 3NXPA 4K60A 3TK5A 3L6PA 3RC6A 1NFXA 3EE0B 4JZFH 3OE7D 1RFNA 4ZHAA 1EKBB 1NFUA 2QF3A 2F9VA 2D1JA 4Y0ZE 3RXSA 3V13A 5E8EH 4JK5A 1JIRA 4ZKNU 3TGJE 1UHBB 3K9XB 3MH4A 3LH3A 2V3OH 5BPEA 4O3TA 4X1NU 3M3VA 5C17A 1RXPA 3A7WA 3BTME 2GKVE 1QA0A 1ZR0A 4NA8A 1OSSA 3QWCH 3ZZ5A 5GXPA 4CBOA 4CBNA 3GYLB 1RTFB 3FKSD 4TWWA 1C5TA 2OC1A 1ELAA 3MH7A 1BRUP 1GL1A 1SLWB 2KAIB 1RD3B 1UTQA 1V2WT 3LGTA 4VGCC 4X1QU 1L4ZA 1FY8E 3MFJA 4X0WU 1LMWB 3V3MA 1TNLA 3DA9B 5KGOA 2ILNA 2GT8A 1N6XA 3GCHB 3QN7A 1ZPCA 2GCHF 3FN8A 1P3EA 3ESTA 6GCHG 2WYJA 4A92A 2A5IA 1ZSKA 2J92A 2ZC9H 1C1MA 3I78A 4K1EA 4FUIA 1XUJA 1QB1A 1C1WH 1T4VH 1LHGH 2ZWLH 4Q2KA 2RG3A 5T1VA 4A6LA 3MI4A 2GMTC 1A7SA 1HXEH 3CP7A 2ZPSA 1AE8H 2EY4C
chains in the Genus database with same CATH topology
1TB6H 2JH0D 2C8XB 1O36A 2A4GA 3SNAA 3SUFA 3RXMA 2PFEA 1ESBA 3TJVA 1FDPA 3F6UH 3LC3A 1GBBA 1KLTA 1YCPH 1D6RA 3GDSA 3TVJB 1O32A 4X6PA 3RP2A 4PROA 4K1SA 1C5NH 1UTOA 3WY8A 3U1IB 4WH6A 1K1JA 3LH1A 3PLBA 1O0DH 1O3JA 2VVCA 2A4OA 2PR3A 5LGOA 2RA3A 1C5SA 4FUBA 1P02A 3F9EA 1NTPA 1NY22 1LVMA 5EGMA 2ANWA 4TWYA 2BM2A 3DD2H 3BTFE 5HGGA 2NU2E 3VB5A 4H6TA 1S6FA 2QGRA 1ETSH 3M5NA 4CRGA 2WPHS 1FAXA 1GMCG 1C1SA 1GBJA 1ANBA 3O8CA 1LKBA 3EA9A 1ZMJA 1TBQH 1Y3YA 1TPOA 4B2BA 1C2GA 4JZ1A 2ALPA 2ZQ1A 2P8OB 1UVUH 3ZZBA 4GHTA 5GJ4B 1J8AA 1ETRH 2Y7XA 4UE7H 1GBDA 2ULLA 1ZLRA 3CS0A 1J9CH 3D23A 4IMZA 2TPIZ 3UWJH 2TRMA 1QBOA 1NU9A 4AYVB 1O2KA 1Z7KA 5H4IB 3MU4A 4JYVH 4ASHA 1GJ8B 1K1IA 4UDWH 1CHOG 3MU0A 2IPHA 3LGYA 1BOQA 3S7KB 5JDUB 1V2TT 2RDLA 1T31A 1O34A 4GHQA 1S6HA 2O8TA 1VCPA 2PSXA 3TH2H 1IAUA 1GG6B 1HJ9A 2ZDMA 2UWOA 1TBZH 1QB6A 1KLIH 1MH0A 3IWMA 1YPJH 4WXIA 3S9AA 1A61H 3RU4T 1O3IA 1QHRB 1FLEE 1HAIH 3SI3H 2QC2A 3LONA 1Y5AT 1S0QA 4MTBA 3UQOA 3LJOA 2GGVB 2V3HH 3GY3A 3GICB 1XX9A 4NA9H 1C4U2 1LDTT 2JH6D 2BOKA 3LKWA 3P95A 1GHAG 1QL9A 1ZGVA 4MNVA 1XUFA 1UCYH 4YLUA 4D8NA 5T6DA 3RDZA 1GJCB 1MTVA 1NFYA 5K7RA 2HWLB 4Y10E 3A88A 1V2OT 3HPTB 2VIOA 2VU8E 1W0ZU 2ZDVH 5JBCS 2AEIH 1GVLA 2ZDLA 5JBAS 1TQ0B 1NESE 1QY6A 2F9PA 3BTGE 1WQVH 3RXRA 2OD3B 5G4BA 3Q76A 3A82A 1O2NA 1ELCA 4X8VH 2XC0A 5J4QA 1ESAA 1MBMA 1EAUA 2PGBB 4BAHB 2GVFA 1GI6A 2GD4B 3SN8A 1LCYA 2HGTH 3AASA 3GDVA 1GBHA 2Y7ZA 5EXMA 4WMDA 3SUGA 1BCUH 5HXFA 1BJVA 1PPEE 1S82A 2HALA 2Y82A 4Y6DA 3TJUA 3PMHB 3SO3A 1SFIA 2GCHG 1P2NA 4OS5A 1MZDA 1HCGA 4GPGA 5BRRE 2DE8A 3A7YA 5C1XA 1P09A 5EQQA 3SU0A 5T6GA 2A7HA 4INKA 1ANCA 1C2IA 3BEUA 1YBWA 1RTLA 4BAOB 1L0ZA 2ZFTA 4UFGH 2BXTH 4KGAA 4GVUA 4A1XA 2W5EA 3PTNA 2W26A 4NIYA 8ESTE 1IOEA 1D3QB 3NZIA 4GUXA 1HYLA 1P2JA 1HAZB 3KQCA 5E0JA 1GCTC 1EPTA 1TAWA 2A0QB 1MKWH 3JZ1B 4Y7AA 1C5ZB 3MNXA 2QXIA 3BEFB 5SGAE 2R0LA 4I8LA 1DANH 3GY2A 1EQ9A 3PTBA 3P6ZB 2H5CA 3GCTF 1XUIA 2PUQH 2H5DA 2ODPA 3BG4C 2FI3E 3UR9A 1DT2A 1CO7E 1AFEH 1DWDH 1HFDA 2FS9A 2SGFE 4HZHA 6LPRA 2F9OA 2DUCA 2VNTA 1O33A 1OOKB 1UCYE 2GV6A 1NRPH 2GZ8A 5CE1A 1GHZA 2BQ6B 4WJG2 1D3DB 4A7IB 1SB1H 3U69H 3KQDA 1ABIH 2A4QA 2C93B 3GCNA 3MO9A 1O39A 1Q3XA 4NIWA 5E0GA 4UFFH 3MH5A 4BXSA 1KDQA 4INHA 1Z1JA 1C5MD 5FPTA 1CT0E 4I8HA 2AGEX 1GHVH 3E16B 4Y0YE 3STJA 4X1PU 3M35A 4DW2U 1G3EA 3ZVCA 1BTYA 3E0PB 1C1NA 2C4FH 1AGJA 4GSOA 4AFQA 1WAYB 2BY9X 2ANYA 3SU1A 1KXAA 5PTPA 1O2IA 4IN2A 2CJIA 1O2SA 4ZUHA 2FX4A 3A81A 3TJOA 3RXAA 1EOLA 3FFGA 1E0FD 4AB8A 4FUFA 1QJ6B 1MQ6A 2JKHA 1AUTC 5EU8A 2ZG0H 1O3MA 4HI3A 1DSTA 2BVRH 4OGXA 1B5GH 4XOJA 2NU3E 1Z6EA 1KY9A 2CXVA 1J15A 3PYHA 4ZHLU 2A7JA 2OC8A 4X2VA 1MCTA 3L3TA 4MLFB 2ODQA 1BMNH 1C2KA 4MDSA 2P16A 2J38A 1YLDA 1NRSH 4I32A 1HAVA 1C9PA 1O5CB 1ZTLA 1CHGA 2BLOA 5JB8S 5F03A 1FUJA 2OBQA 3M37A 5LPEA 4ABJA 2XRCA 4BXWA 1P2IA 2ZHDA 1ZRBA 3BSQA 1C5VA 1DICA 1O3GA 2FO9A 3ZVGA 1PFXC 2O8MA 4F4OC 1SGRE 2FYRA 2ZGBH 5ETXA 4Y8XA 2PWXA 2XTTB 2Z9LA 1VCQA 1GBFA 4U32A 4F49A 1E37B 1ZOMA 1T8OA 4UD9H 2Y6TA 3HKIB 2ZGXH 4ABIA 1A1RA 3VXFH 4TPIZ 2HPQH 3A89A 4MPVA 2Y5FA 2VVVA 1FIWA 1LHDH 1O3FA 3QDZB 4GAWA 2B7DH 4U30A 1QURH 1V2JT 2BZ6H 5A8XA 1FY5A 2W7UA 1HAVB 1G37A 1ETTH 3SGAE 2WV4A 5FXLA 1NM6A 4ABDA 1BRAA 4D7GA 2SNVA 4UFEH 1YCPM 3UUZA 3T29A 3QGNB 2BDBA 2AERH 3MWIU 5FX6A 2QXGA 4K8BA 1O2XA 1LO6A 3P92A 1A3BH 1D3TB 2PKSB 2VWMA 4X1SU 2TGPZ 2ZPRA 3BG8A 1CSOE 1A46H 3GCHC 1DXPA 1P04A 3U1JB 3ODDA 1YCPK 1TOCB 1Y5BT 2FEQH 4WXVA 2ZHEH 3SUEA 1TPSA 2BDYA 1MKXK 2OC0A 1WOFA 2TGAA 1ZHRA 2F3CE 2C90B 1AKSA 2FMJA 4FVBA 1ZGIA 1L1NA 4MPXA 2NU4E 2BY6X 4YT7H 3TH3H 3ITIA 2OBOA 3KGPA 2P3FH 1W12U 4X8SH 1P2OA 1GI8B 1GI7B 2OLGA 1L1JA 5A09A 1AZZA 1GI1A 1HPGA 3LGWA 1HIAA 3E6PH 4DIIH 5EPYA 1G32B 4BAQB 5E2OA 1K1LA 3GCTG 3LGIA 3RXLA 2OUAA 1YP9A 1Z6JH 4NZLA 3P8GA 1CGJE 3EA8A 3RUOA 1FV9A 1Z8IB 4NIXA 5JBTA 4CR5A 5B6OA 1SGFG 4RSPA 2WPIS 1TGNA 3GOVB 1K1MA 1SGFA 3LT3A 4I7YH 5IYTA 4UFDH 1DLEA 1JRTA 1NRNH 2BDGA 1GJ6A 3IITA 4WVPE 3A80A 1UVSH 1XKAC 1LHCH 4NCYA 1EZQA 5EODA 1IQFA 1K22H 1VZQH 1IQMA 2P8OC 3SI4H 4Y71A 2Q6FA 1EZUC 1ZPZA 3HK6B 1C4Y2 3RXCA 3PMJA 4A1VA 4FU9A 2HPPH 3ZVFA 1NC6A 3MNSA 1CA8B 2ZGHA 1T8MA 1AHTH 1S0RA 5A0CA 2ZGJA 4Z6AH 1CHOF 1K1OA 1THSH 2G81E 3AAVA 2PTNA 5EW2H 3U8TH 3RXQA 4Y8YA 2FWWA 5DPAA 2STBE 1FY1A 2ZFPH 2TGDA 1MCVA 1UCYK 2AIPA 2NU1E 1GG6C 3VGCB 4AOQA 3F1SB 1O2UA 2IOTA 1TX6A 2AYWA 1WQSA 1YF4A 5L2YH 2BMGB 5DO4H 1GHWH 2VIQA 4JYUH 2XXLA 1HGTH 1P9UA 3MU8A 1SI5H 5FHTA 1H9IE 5FBIA 4ISHH 3A8BA 2A45B 4ZKSU 1GHAF 3FP7E 1PYTD 2QXHA 1X7AC 1FN6A 1OYTH 1O2YA 1JBUH 1BTXA 2PTCE 2FP7B 5DJ7A 3QTOH 1MTUA 2FOMB 3UNRA 3RXKA 1ZZZA 4H4FA 5DP7A 3SNDA 2J2UA 1O3EA 1UMAH 1C2FA 3A7TA 5FPYA 3TJNA 2WPMS 4OS7A 4RKJB 1SG8B 1KTTB 2BDCA 4X2YA 4I8KA 3QX5H 5HYOA 2BVXH 4XSKU 4ABFA 1QL8A 1AWHB 4ZHMU 1MTWA 1UVOA 1C1OA 2VJ1A 1KIGH 2FOFA 1GGDC 1PQ5A 5FBEA 1JWTA 1V2PT 1ANDA 4B73A 1PPCE 3OTJE 4THNH 3BTTE 3PLKA 2WPKS 4NFEA 1O35A 5C5NA 2XBWA 4OGYA 1UTMA 3SV2H 1MKWK 1SGEE 3B8JA 1GWAA 1C9TA 1O2TA 3H7TA 5TCCA 2V0BA 1W0YH 3T26A 1DVAH 2ZDKA 4YOIA 1UK3A 2H9TH 1BB0B 1P0SH 3A7ZA 1O5DH 1LVYA 3BTHE 1DM4B 3T27A 1O3HA 5C3NA 2Z9KA 3NUMA 2ODYB 1DX5M 1O2HA 5JYIA 1SGCA 1EX3A 1BBRH 1SGYE 2DE9A 3LU9B 2VGCB 1GI0A 3UR6A 1GMHG 2Z9JA 1VCWA 3RXTA 1ELTA 1SHHB 4ISOA 1CBWB 1HNEE 2H1UA 1DFPA 2BTCE 2ZDAH 1NS3A 3ATMA 2P3UB 3DFLA 1FI8A 1GJ9B 1BTPA 4RN6A 3AW0A 2W3KA 3GYMA 3ZZ3A 1P06A 2QN5T 3Q00A 2C8WB 3SJ8A 3FANA 1FNIA 4E06H 4AG1A 1EPTC 3DT0H 2OCVB 2WPLS 2O8UA 5E2PA 1SGDE 1F0RA 1TRMA 1AZ8A 3W94A 1B7XB 1J17T 1XMNB 3W95A 1O3CA 2BB4A 1A5HA 2XCNA 3F9GA 1NRQH 7LPRA 4IW4E 3KEEA 1PQ7A 2W3IA 4X8TH 1GHYH 1FMGA 2XC5A 1LTOA 3NKKA 2PGQB 3V0XA 3RMNH 2QF0A 1KXDA 3F9HA 5C20A 2VH0A 1AE5A 1OP2A 1ELDE 4H42U 3VXEH 3QZRA 1O3LA 1KLJH 1O3OA 1K1NA 2B5TB 2ZPQA 3K2UA 2CMYA 3RXHA 1INCA 4X8UH 3UNQA 1C5XB 2AMQA 1BTHH 3TU7H 1BUIA 1GI4A 3MU1A 4JCNA 3QLPH 1ELBA 1TPAE 1EP5A 1PPZA 1OKXA 1SBWA 6ESTA 1H9LB 1HAGE 1NT1A 1O5BB 3AVZA 1W14U 2H9EH 2BD7A 3RXIA 3SUDA 1N6YA 1SL3A 1JXPA 2QY0B 3M36A 1HAPH 1G3DA 3ZV9A 1HAOH 5DG6A 2G52A 1O2WA 1O5GH 2JETB 3A8DA 4CRDA 1MU8B 3MNCA 3RXVA 2R9PA 3ZVAA 4I8GA 1CT2E 1ZPBA 2FOCA 3SQEE 2BX4A 2UWPA 2Z3DA 1PPBH 1BBRE 6CHAB 1M9UA 2ZIQH 1ACBE 1GDNA 3RU4D 1SMFE 1EP6A 4ZMAH 1W11U 1ARBA 1GCDA 3IG6B 1O2PA 2XBYA 2J4IA 1EB2A 2XNIA 3NCLA 4O3UA 1OP0A 1GI9B 2GDEH 2Z6BD 1MMJN 3QZQA 5K0HA 3H5CB 3CS7A 2Y80A 2BZAA 3BEIB 2R3UA 3BTWE 1MU6B 3LGUA 1Y5UT 3LDXH 2ZI2H 3SJKA 4UONA 3A83A 1AUJA 3RXFA 1KSNA 2I6SA 2V35A 4I8JA 1W7GH 2I6QA 1GGDB 3Q3KA 1Z71A 5GWZA 2C3SA 3ATLA 5DGJA 2J95A 1GBEA 1O2LA 1TE0A 1C2LA 5AFYH 1GBKA 4CHAC 2XWBI 5DP3A 4SGBE 2IN2A 2PKSC 3LJJA 4Y11E 1EATA 1OWHA 1D3PB 2OQ5A 3ZYDA 2WPJS 1SPJA 4QT8C 3KL6A 3VB4A 1W13U 4O9VA 4YZUA 1GDQA 1SLVB 3SBKA 1DPOA 1Y3UA 3RXJA 4ABEA 1MTSA 1CGHA 2ZFSA 5GCHG 4XBDA 3UOPA 1P2KA 5EG4A 4KP0A 1FXYA 1CVWH 3LOXA 4O97A 4RKOB 4B74A 2FPZA 1ID5H 4B71A 1ELEE 1C5RA 3PWBA 2ZTXA 1F0UA 1YKTA 1TA2A 3M3TA 1V2UT 1WBGB 1O30A 1KXEA 2GX4A 1EAWA 1AVWA 2CF9H 1G3BA 2ALVA 2FXRA 1RRKA 2ZU1A 1AU8A 3BN9A 5JB9S 4XDEA 2Z3CA 2AIQA 2FLBH 4B2CA 3LC5A 2STAE 1TWXB 2RA0A 3MO3A 1G2LA 4ZROA 1AIXH 1C1RA 3PROA 2FOEA 1QIXB 5A2MH 1SOZA 1TPPA 2AH4X 5L2ZH 4DY7B 4BTUB 3FZZA 3SNCA 1N8OB 1EPTB 4Y8ZA 2SGDE 1DITH 3VFEA 1SOTA 1PPGE 1MBQA 1AVXA 1O2JA 1MUEB 1A5IA 3RC4A 1EJNA 1ELGA 3PO1B 2F9BH 1YPKH 3UOUA 4XFQA 4HFPB 3S9CA 3ZVDA 1BQYA 3OY5U 2AFQB 1T8LA 1UVPA 2Q6DA 4FUJA 2G4UA 1NFWA 3TITA 1QRXA 1C2EA 1GVKB 3SZNA 4DGJA 4WY3A 1Q31A 1TLDA 9LPRA 1JIMA 3E0NB 2A32A 2BD5A 3SU5A 1GHBG 5CHAC 1AD8H 4LXBH 4YM9A 3SW2B 1B0FA 1TQ7B 4BNRA 1QQ4A 1VJ9U 4J2YB 1G3CA 4XBBA 2VIVA 4IC5A 3VGCC 4FUDA 5LPFA 1HLTH 1AFQB 3EYDA 1PQ8A 2ZGCA 3MH6A 2BDIA 1GI3A 4DG4A 5FX5A 2G51A 1BDAA 1KDQB 3SORA 1PYTC 3RMLH 3ZZCA 5F6MA 1A3EH 1C5QA 1MD7A 1T7CA 2IJOB 1O2VA 1HDTH 1EAXA 4X1RU 3KQBA 2FOBA 1K2I1 1DUAA 3Q3YA 1ORFA 4B1TA 2BOHB 3TGIE 2XC4A 4D9QA 3TLOA 1SLXB 1S84A 2Q6GA 1IQEA 3LIWA 1F0SA 2GCTC 4INLA 2BDAA 1NPMA 3S0NA 4HTCH 4K5ZA 4MNWA 3RMOH 2GDDA 1TYNA 4KKDA 4DURA 1JRSA 1XVMA