3A8HB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8hB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8hB02
2DXCA 3QZ9B 4Y28E 4RKUE 1UGRB 4XK8E 2ZPBB 4OB0B 2DD4B 2DD5A 3QZ5B 1PSFA 2DPPB 4L6V5 1UGPB 1UGQB 2PUOB 3VYGB 4OB1B 2CZ6B 4OB3B 2ZPHB 2AHJB 4ZGDB 2ZPEB 5L8RE 1QP3A 1GXIE 2PVDB 2DXBB 3VYHB 4ZGEB 3WVEB 2WSCE 1PSEA 2ZPGB 3A8HB 3X20B 2PUKB 1QP2A 2D0QB 3A8OB 2DD4A 3LW5E 2ZPFB 1JB0E 3HHTB 3WVDB 2ZZDB 1UGSB 3VYGA 2O01E 2CZ0B 3A8MB 3X25B 2ZPIB 4OB2B 3X26B 1AHJB 2DXCB 2DXBA 3QYGB 4FM4B 2CZ7B 2PVGB 3QXEB 1IREB 2PU9B 2QDYB 2DD5B 3X24B 2WSEE 2CZ1B 3X28B 3QYHB 2PVOB 3A8GB 2ZZDA 4KT0E 1V29B 2CYZB 3A8LB 2ZCFB 2WSFE 4ZGJB 1DJ7B
chains in the Genus database with same CATH superfamily
2JOYA 1KD1U 2COWA 4J5YA 2OAUA 3A98A 1LVKA 5GMKi 3V8LA 3OYAA 3QHWB 5HKCA 4O5VA 1QQJA 2D9TA 2ECZA 4LDXA 1R0CB 3R6NA 1RL2A 3QHSA 3THKA 1WNLA 4LE9A 1UGQB 4E7LA 2WEVB 5EG2A 2LNHB 4M7DG 2I40B 3CCEQ 3EGDB 4FW2A 3PIOA 2XICA 3OYLA 3G7ZA 2C06A 1VQOQ 1UUEA 3OMGA 1SSHA 4C5IA 3CCUT 3OYFA 1WIEA 4F17A 2DXBB 3VJPA 9ATCB 4BCIB 2F69A 3WVEB 5CQXA 4GY5A 1WHGA 1ZUYA 1NLPC 4CFVB 1H1SB 3C0CA 3GPLA 2O2OA 1AD5A 1GCQC 3C94A 3VRZA 4M7DD 4PL6A 3JB9I 3I55T 1ZP2A 2RH2A 2GF7A 1Z9QA 4M77B 3I56A 4F70B 5EFQB 3GNFB 1O75A 4UC4A 4DBRA 2ED0A 1VQPT 2HMAA 2P0PA 2PZ1A 4PJOG 4OP0A 3CCSA 1TUDA 1NE8A 4E7SA 5GAOl 1TS9A 3GNGA 3VS2A 5KYXA 1D1CA 1RAFB 3E9FA 2I2LA 3NHNA 4GLKA 2DNUA 4IUTA 3C12A 1QWFA 3ZBDA 4HVVA 4RTXA 2RK1A 4C92E 3CC2A 4J7FA 4PJOD 1BI2A 3V8JA 4OR5B 4EOPB 3QKJA 2JVVA 5GMKl 4M7DE 2VWFA 3BHVB 3CBMA 1VQ5A 4I3ZB 2X51A 2RHUA 1YI2T 4RTZA 3JCMc 3L2QA 4C5HA 4AFSC 1OZ3A 3O0GD 1K9MC 1Z9ZA 1QVGP 4M75G 1GBRA 4II5B 5ICPB 2XG8D 2F5TX 2X1NB 3CCMT 4HCCA 4ORZA 4KUDK 4J7IA 1TSFA 4AKHA 2KMTA 1SEMA 2PNIA 4OF1A 2X4YA 4BUGA 2PMIB 4OB0B 4M78G 5FU7B 2JJ9A 3M58A 2VVKA 3HFOA 1M2OA 2LQNA 4M75D 2MWOA 4OGRB 3CMAQ 4LDVA 1JKWA 1PCXA 4HNVA 1ARKA 4EOJB 1X75C 3OMCA 2XMFA 4ELLA 1M5Q1 2MYSA 3OYBA 4F7UG 2PVDB 4M78D 4E7IA 4CC7A 1RI0A 4X1VA 3LX7A 3HBLA 4K11A 1X2QA 5BNJB 3SFMA 5KE3A 2AKKA 2B86A 4E7ZA 1QP2A 4F6UB 1N8RC 1IXDA 3DB4A 1IGQA 2VGNA 2YHTA 4F7NB 4CFWB 2YUOA 1MNEA 1TUGB 2DFUA 5HY6A 2EKOA 3CCUQ 2DXTA 3QDRB 2CKKA 1QLBA 3JB9G 2NUPB 4AFZC 1QVFS 4Z89A 4M75E 1NYFA 2KBTA 3CBOA 4HNUA 4PFOA 4J83A 4CFMB 4ZTFA 4IIOA 4OMPA 1AWOA 2EGEA 3S6WA 3GF5A 5A0LA 2JTMA 1RUWA 1AOJA 2YRCA 3X24B 3NTIA 1UHFA 3JB9D 3NGPA 4EOQB 3G71T 3X28B 1D0ZA 4F7JB 3NTHA 3I35A 3HFNA 4M77C 5AT1B 5KCHA 3CCLA 2EYQA 2ZCFB 2HSPA 4DBFA 3OB9A 3GLXA 5FWCA 3REBB 4HCZA 3OQ5A 1KQSP 1W98B 1ZHIA 2BKDN 1ZQ1A 3S3NA 2X4WA 4XK8E 3KXTA 2VGMA 1WHKA 2WIHB 1OV3A 3VKIA 2MI6A 1YI2Q 5HQ0B 1UGPB 1X6OA 1KK7A 2EQKA 2G9XB 3VYGB 4E47A 1C6VX 5CAIA 2EYWA 1ZSZB 2EFIA 3PGGA 4M7AG 3ER0A 4WF2A 1OI1A 3LGFA 2CUDA 3U23A 5HK0A 1VQMT 4C0GA 1Q81C 1BU1A 4ZTJA 3EG9A 3QO3A 4C0DC 2CSQA 3QJ6A 2OTJA 2VKNA 3UPUA 1VQ6A 4PJOB 3JB9H 1OI9B 2X35A 2KE9A 1J3TA 4C8QE 3TNIB 2F2CA 2BIVA 4Y92A 4CFNB 3PO3S 3G4SA 1OPLA 2HQXA 5J39A 1EIFA 2DILA 3TSWA 4EPCA 1MNDA 5LJ5f 3QWXX 2IVWA 4J9IA 2EGCA 2RN8A 1GUXA 2C0OA 3CXCS 3DB3A 2V22B 1GBQA 4RTVA 2CREA 2QTVA 4DBQA 4OMOA 2DYIA 1NZ9A 1ENWA 3MPUB 3QXEB 2IW6B 4JJBA 3URGA 3PFSA 1I8FA 1YHQT 3OYKA 5IN1A 1K76A 1LNXA 3MEAA 5FU6C 1H1QB 4MZPA 4HA8A 2K7AA 4M7AE 1EX4A 4M78B 3HRTA 4EOOB 2E4HA 1C1AA 2CUBA 5LJ3j 1YFNA 2V8JA 3TN8B 3OBWA 4N4GA 1NBEB 1RAAB 1M4ZA 5KYYA 1M2VA 1KG1A 4RKUE 1FYNA 2MOXA 4QKUA 1S72A 3QJYA 2E41A 2PK2A 3G71Q 3A1PA 2LZ6B 3RMSA 4F7UB 5GAOm 3QG1A 3L42A 2G77A 5IDNB 3CC4A 1JBMA 2ENMA 3FRNA 1PKTA 2ATCB 2A37A 4B9WA 1H8KA 1ZBXA 3SWNB 3J7AF 1U3OA 2PHGA 1TFBA 4J9GA 3LLRA 2DL7A 1O9KA 2MCNA 1K4US 2HD0A 1SG5A 1YN8A 4OMNA 4FYWB 1RADB 3G33B 2J7IA 5GAMf 1YJWT 1K73C 2VASA 3EIDB 1Y57A 1G3WA 1HD3A 4MDXA 3KFVA 1CSKA 4M7DC 2BPMB 1YJ9Q 4JRPA 4QQDA 3CMEA 1QVFA 2BUDA 2UUEB 1JB0E 2ROTA 5LJ5e 3HHTB 1VQ8A 2JGZB 2VXFA 3GOXA 1K9MU 4AFQC 3EGDA 2WHBB 1VQMQ 1OYXA 4OB2B 2EJGA 1WFWA 3RIRA 2E70A 1TXQA 1ZSZC 2DXBA 2VUBA 3RKXA 2PVGB 1W1FA 4KH0B 2FZGB 4C5GA 4UN0A 2DM1A 3CCRT 1SSFA 3VS1A 3RKWA 1Y0MA 5IT9E 3VRYA 1N9RA 2F2XA 5GAOp 4PJOC 5GJWB 1RLQC 3VS4A 3UF4A 4M77A 1URCB 2LJ1A 3CC7T 2EQIA 2HAXA 1QW1A 2RJEA 4JX4A 4BE2A 4KGZB 1B3QA 1VQNT 1QKWA 5CKHA 4BI3A 2DTIA 4C0ZA 2C5XB 4F14A 1BCOA 4EDUA 2Y4YA 4ZGJB 1N8RR 3K7AM 3MY1B 2R58A 2L2PA 2VC8A 2YRDA 4EOLB 1YHQQ 1N8RU 3UWNA 2QQRA 2HQEA 1VQ4Q 2MMPA 3H41A 2C0IA 2EQJA 4EMKC 2DPPB 1JXMA 2LVMA 4JDSA 3MEUA 4M77F 1OL1B 1S1NA 2NLUA 3H9NA 4N4IA 1UTIA 4M75C 4OB1B 1IRXA 5GAMe 1YCSB 1VQOT 3OYYA 1JQQA 2R7GA 2CP0A 1GRIA 4CC2A 5HBHB 2RM4A 3TNHB 1VQ9T 4HLQA 3RESA 4M78C 3CPWS 4J6XA 4JS5A 2JM8A 3VU3C 1WLPB 4P5NA 2QYZA 2HQHA 4V2SA 1OULA 2K57A 2P84A 2JS0A 1PNJA 3LW5E 3CXCA 2WJ9A 2KRMA 4WTOB 1KIKA 3OS1A 1QKXA 3JCMJ 1WA7A 2CZ0B 3EH1A 1QVPA 1YJWQ 5CKEA 2KXCA 1JRIA 1UNLD 5IDPB 2CP2A 3T9NA 3CD6A 3KHIA 3CCQA 1MHNA 1VUBA 2Y4XA 1Q7YC 2D8JA 3OS2A 1VOLA 3H6ZA 5FWBA 4ZNXA 1YIJA 4XTZA 1IREB 3OSSC 2K3BA 2W0ZA 2L0AA 2QGGA 2DZ9A 5GMKe 3NFCA 5CQYA 4BCND 1Q81R 5KYWB 2J6FA 1WI7A 2HNIA 1WYXA 5GANh 2GFAA 3I5SA 4NOYA 1VQ7Q 4KT0E 3TQ7P 2E5QA 2BZXA 2EVRA 4JX6A 2CYZB 1Y07A 4XTYA 2KRNA 4QW2A 1Q81U 4Z8AA 1WQWA 2NUPA 1ZA1B 1Y96A 2VB6A 2PTKA 2X4JA 3CCRQ 4NSTB 3IQLA 4A63B 3QSUA 1GL5A 3EGXB 3EG2A 2QTXA 5CO7A 3HKSA 4FX3B 2DZCA 3PNWC 3C95A 3RERA 3OW2P 4A4FA 2M16A 1AZGB 2DD4B 2QEXT 3LYIA 5GAOq 1UNHD 1KJWA 1WX6A 2FZKB 4EIKA 4BCQD 4IUVA 4R0KA 1H27B 1C9BA 2DVEA 2JM9A 2AK5A 4B6MA 4MZMA 5L8RE 3MI9B 3L2RA 1QP3A 3GP8A 3G6ET 4HVWA 2DBMA 2KQWA 2C4GB 5GJVB 1PKSA 4XU1A 4YTLA 1FMVA 4ZN1A 2LW4A 1VQLQ 2L5QA 3JCMf 4M7DA 2DMOA 8ATCB 4C92G 1KSWA 1Y7XA 2JTFA 1UDLA 3I55A 2PUKB 3OYIA 1PRMC 1BI1A 1YP5A 4YOZA 1AWXA 4M7AC 3TCJA 1WHHA 2DL8A 5GAMd 3JAME 1IHWA 3QYBA 2M02A 3WVDB 1PC0A 2ZZDB 3RKYA 1VQPA 3VYGA 1B34B 4XTVA 5L23A 1HSQA 2JMAA 4B9XA 2IN3A 1VQ9Q 3A8MB 3PVLA 2RHXA 2LJ0A 4HCKA 1ZSZA 4C92D 5HK3A 1BI0A 3Q1JA 3MCAB 3M57A 2RHIA 3NPFA 2J6KA 1D3UB 1W70A 2DXCB 3EH2A 3QYGB 5GANf 2AZSA 3JRZA 5LQFB 1H24B 4M7DF 4PJOA 4M4ZA 3TU4K 1H641 2PU9B 5LL6S 1AWWA 1IGUA 2W96A 4Q5WA 3BHTB 1JSUB 2DL4A 4Z6YA 3EG1A 1WZOA 1RAGB 4EOSB 1K73R 1W2BS 2FHDA 2PVOB 4FSSA 2GCXA 5GAN8 5D6YA 2X3WD 3L2UA 3HB9A 3BG9A 5CKDA 1G5VA 2ESWA 1K73U 1OIUB 4BDZA 4EORB 4JUVA 2OTLQ 1G2BA 3CCMA 1JJ2S 4GBQA 1X6GA 1OU9A 5CKFA 2J6OA 1RAIB 4BD3A 4PJOF 2KAFA 3VV0A 4Y72B 3VUZA 2KEAA 3H8ZA 4XTWA 3ME9A 4M75A 1UG1A 3GIBA 2HL5C 4KRTA 2LMJA 2KY9A 1OKWB 4AKGA 1N4MA 2DF6A 4C0DB 3QWLA 3CPWA 1XO2A 3NTKA 4QQGA 3JCMW 3I56T 1NEGA 2QQSA 4JZ3A 4M78A 5LJ5g 1TWBA 1JSTB 4J6YA 2J05A 2AHJB 3JCMe 1JXOA 2ZPEB 3O5ZA 1H28B 1XQHA 5DM7R 1SF9A 4BCFB 2ZAEA 1WPYA 5HBEB 4BB7A 5GAOn 2QEXQ 4XU3A 1PSEA 2LCSA 2JUFA 3HO8A 1PD0A 2QASA 4FU6A 4C0FA 5DQVA 4BCNB 1OEBA 2YUQA 2KYBA 4HNTA 4F7UA 2K2MA 3E19A 4M75F 2LDMA 2YXYA 2WIPB 2HL3A 2QA4Q 1JEGA 2KXDA 3M9QA 1RACB 2RK2A 1UE9A 2RJCA 3G6EQ 5I2SA 2CSIA 2M51A 4HXJA 2LJ3A 4QQ6A 3SWNA 4M78F 5GANe 2JW4A 4HT9A 1VYUA 1VQ5T 2KNBB 4O6JA 2SEMA 1X69A 4ZN3A 3M55A 4ANJA 4BCOB 2UZEB 3META 3JCMb 2IW9B 1H3HA 1M90C 5FU6B 2QQ8A 2XK0A 3MP1A 3M5AA 4BCQB 3OYCA 4BCPB 4DOWA 4F7UF 4JRQA 4HL4A 1XNIA 2CGHA 3TSZA 4MFDA 1NJIC 1UJYA 2LT1A 1D0XA 3UDCA 3O8VA 4R55A 2PQWA 4D8KA 1Y96B 3H0HA 2H3JA 3VS5A 2BE9B 2CJMB 1QCOA 1BYMA 3VKGA 3QBYA 2YDLA 4L59A 3WXMB 5GAMg 1GFCA 2QQAA 3VS6A 1M1KC 1PM3A 1N9SA 2KK4A 5DY9A 4C8QG 2C0TA 3ZL7C 2L8DA 5LJ3h 3JB9F 3M4YA 2W9FA 1MMNA 3H4CA 3FC3A 3M53A 1PHTA 2CH4W 4C92B 4A4KA 2HEQA 2W9ZA 4PLIA 1RABB 1Q7YR 1AVZC 2FPDA 4PFZA 3BLRB 3E1SA 2V8KA 2K3YA 1PKDB 4C8QD 2YWWA 1BI3A 4BBRM 3FB9A 4M7DB 1Q7YU 2KRSA 5FRMA 4BI4A 4ZGEB 2DIQA 2HCKA 3I9QA 4YOOA 3GTMS 4QSHA 3QPHA 2O88A 2ZPGB 2VV5A 4PJJA 4XTXA 1M9SA 3LWHA 1YJ9T 2E65A 2R5AA 3NDQA 2X4XA 4AT1B 1BKBA 3I56Q 2RD1A 4XU0A 4KUIA 3JCMd 3J80E 4J8OA 3EOCB 4WCIA 3CCSQ 4KBMB 1GCQA 3UATA 1AEYA 1Q82R 1X6BA 5GAOr 3M0RA 3CCLT 2CCHB 4FSXA 2L3QA 2JTEA 4X9DA 1GFDA 3PTAA 1BB9A 1W2BA 4HCBA 1B7TA 2KGTA 4M7AD 4PJNA 1KFZA 1ZLMA 3I5RA 4M7AF 3CC2Q 2LX7A 1M30A 3DLLA 2K5LA 1HK9A 1HJDA 4E2FB 3DTOA 4BXXX 1NM7A 1MMDA 4MFEA 2EAYA 4AMCA 1JJ2A 1BBZA 1VQ5Q 3CCJA 2E5KA 1M8VA 5LJ3f 1N5ZA 1PWTA 1VIEA 2E6NA 4MMKA 5IHYA 1DJ7B 3TW7A 2JMCA 3DDPB 1QCNA 2DRMA 2K3XA 1OX9A 4EMKB 5GAN7 5FROA 4Y28E 4EMHA 1YWOA 2YRVA 3FJ5A 1NG2A 4M75B 3MO8A 2RNAA 1X01A 2RO0A 4RTUA 1VQ4T 3BLHB 1OX8A 4F16A 1VQ6T 1SRMA 2K6DA 1PSFA 4PNOA 3L2ZA 2DL3A 3GBQA 4II1A 5KYWA 2LC4A 2E10A 1G3NC 2K4YA 2H8HA 2OI3A 4PLLA 4XQ3A 3LH0A 3G4ST 1H3ZA 2AKLA 3INZA 1BK2A 2LP5A 3M56A 1TUCA 2X3XD 6AT1B 1ABOA 1WJSA 5A0DA 4TVRA 2BS4A 3M0TA 4BACA 3MEWA 4RTYA 1QWEA 5LJ5j 1M27C 5CVIA 2P0QA 2O31A 1EFNA 2ZGWA 3EGXA 3JB9J 2QK0A 5KYNA 3LQ5B 4JLIA 2CS7A 4D6WA 2DD4A 4PK4A 2QQ9A 3CQTA 3M0SA 1YJNA 4AFUC 1VQKA 2KDSA 1UHCA 5EJCA 2CP6A 1P92A 1WJQA 4A4GA 5GMKm 3DKMA 3CCVA 4C92C 4BCHB 4FW1A 2F2WA 1P5EB 1BIBA 4IURA 5GAN5 1YITA 1WXBA 4OGCA 4BCGB 4Z88A 1KQ1A 2AT1B 2JN0A 3EG0A 3JSCA 4XTUA 3P8HA 1U8RA 2E6ZA 1X2KA 3MHXA 3HRUA 3TREA 3TNWB 4YC3B 4LD6A 3A5ZB 2F2VA 3J81E 2DX1A 2XDBA 1S72T 2EBPA 3CC7A 2GQVA 2BZ8A 4L5GA 2ZZDA 4C8QB 1VQNA 1B34A 1VQ7T 1V29B 2LCCA 3PMIA 3CC4T 4KRCB 5ACBA 3FIFA 5I22A 3CCLQ 4BY7X 2RI5A 3ASKA 4MDWA 1VIFA 5M9OA 4A54A 2DXCA 1QVFP 3CBPA 3JCMg 2ED1A 2RQVA 3E2UA 2MK5A 2RF0A 4LNPA 3PT9A 2LX9A 1OQKA 1OU8A 2DTOA 5GAMj 1MMGA 2CH4A 1HYOA 3DL1A 1N27A 2B9RA 2BS2A 4FYYB 1I0CA 3VS0A 1X27A 1JU5C 4EOMB 1WHLA 2FPEA 2MF2A 3VS7A 5DLOA 4NL3A 3CCEA 5CYIB 2CP3A 2D0NA 4AG2C 3CMET 1M90R 2V8IA 1VQOA 5I5ZB 2EYXA 1ZX6A 1IO6A 4JRIA 4BE0A 4ZGDB 3SD4A 1WXTA 1M90U 5I2MA 1YWPA 1V1CA 3VYHB 2ROLA 2YSQA 4EONB 4NL2A 4M7AB 5GANg 1VQLT 3M4GA 4RUGA 1NJIR 2OTJQ 2CCIB 2WSCE 3OYGA 1VQ6Q 2FVUA 3A8HB 1FINB 1FXXA 1X43A 4BE1A 4R56A 4LD9K 4CC4B 1NJIU 4LXCA 2RA2A 2CDTA 1LPLA 3G4SQ 3OBYA 4PJLA 2X9HA 4KRDB 1JOWA 2O01E 1UJ0A 4A4EA 1M1KR 2D6FA 3L2WA 1UFFA 1KHIA 3F70A 1SRLA 2FRYA 1QVGS 4ELYC 3HTRA 4LUDA 2EJ9A 5GMKj 1U06A 2BTTA 2CP5A 1M1KU 5IXBA 3CCJQ 1E9HB 4J6WA 4QT7A 2YLBA 4KULA 1AZEA 1WHMA 2LQKA 1OOTA 2KYMA 3M0QA 4CFXB 3PMTA 1XJWB 4LDWA 1VOMA 2DD5B 3UA6A 1WXUA 1H4LD 2KT8A 3L2VA 2DBKA 3TVTA 2RJFA 4E6RA 3E9GA 3SB2A 3HPWA 2F5KA 2GFUA 3PE0A 4DOVA 1K8AC 1BCMA 2FPFA 4JJCA 3JCMX 2MAMA 2JNGA 3PVQA 1D1BA 5L2WB 2LNVA 2DA9A 2RI3A 2YLCA 2OTLT 5IF1B 2BZYA 2Z0WA 5LJ5d 3CXCP 1D3BA 3BE3A 2K2VA 3EHRA 1NLOC 4M77E 2UZLB 1S72Q 5FLXE 2DL5A 1PD1A 2KT1A 2KMGA 2K5FA 2QGFB 4ELJA 1OPKA 1OGUB 4PKCC 3QZ5B 2YT6A 3AT1B 2DJQA 2DAQA 3PIPA 4OGEA 2XDDA 3CC4Q 2RQWA 1KXUA 4ROCA 1EZZB 3CMAA 3OY9A 4F6WB 1I81A 1WHJA 2COYA 4C8QC 2G6FX 3S3MA 2W2HA 2DO3A 3VUBA 1N6AA 2A08A 5C6SA 4EOKB 1AT1B 3CD6T 1V76A 2LT4A 1Q82C 2OX7A 4OMMA 3CCQT 2A36A 1ABQA 2HSEB 3X20B 2D0QB 2JXBA 4BCMD 3CMEQ 2O9VA 4LDUA 4CRLB 2QA4T 1RAEB 2FYKA 1LCKA 4C92A 1M8MA 1UGSB 1VQ8Q 2JS2A 3CCUA 3MIAB 5HVYB 5A2QE 1NPRA 2EWNA 1KQSS 4IIMA 2MPXC 2J06A 2XIDA 2Y90A 3QYEA 5C0MA 5I21A 4J9HA 1WJRA 2EKHA 1FVVB 2W10A 3KBGA 3OSVA 4RODA 2FEIA 5GAN6 3SHWA 3NMZC 4FYXB 2BKZB 2ABLA 5FW9A 3EFSA 5GAN4 4E7HA 3RGFB 3SDZA 1M1FA 1SPKA 2EQMA 4QVZA 2VXEA 2RHYA 2BS3A 4C92F 1JO8A 4EOIB 2M9UA 3OS0A 2WPAB 2FB7A 2NYSA 3HZJA 4G6LB 3MJXA 2E3IA 2GNCA 4AKIA 1G8XA 3QZ9B 2CT3A 1MUZA 2RHZA 4FL6A 3EJ1B 4RTWA 1YBYA 1GCPA 3M0UA 3OYJA 2OAWA 1CKBA 2QDLA 3FJPA 7AT1B 4CFUD 1YI2A 3H0FA 2M0OA 4E7KA 2IIMA 4J9CA 3OYNA 3BFMA 3EHQA 2DETA 2DJZA 3DOGB 2MIOA 4BY1X 2F1LA 3OS5A 3H0IA 1SHFA 1UECA 1VA7A 4EMKA 4IUUA 2WFYB 3KUFA 2BE7D 5FRNA 1OKVB 1KHCA 2FRWA 2XDPA 2QXFA 5GANj 3DDQB 3B57A 3UT1A 1TG0A 1QVGA 5ECAA 3V7SA 3EFOB 3DLMA 4JLGA 1I4K1 2DEQA 3RBBB 3CCST 5LJ3g 1MV0B 4GLMA 8AT1B 4KH1B 4IUQA 3REAB 3RDVA 3CD6Q 2L3SA 2C6TB 3CCQQ 4FM4B 4BI8B 4PJMA 2OJ2A 1G83A 4XAXB 2CT4A 3CPWP 1YIJQ 2LCLA 2DYBA 5FGKB 1TU0B 4X9CA 1NEBA 2I53A 3CC2T 2RMOA 2EYZA 4DEXA 1RLPC 1G3TA 2DMEA 4IKFA 2DERA 2RQUA 1A0NB 3QYHB 2A28A 1O9SA 1BIAA 3HRSA 2C5VB 1PRLC 5CIUA 5D7UA 4PJOE 4JJNK 1D3BB 2JZ2A 3LGLA 1FMKA 1T3LA 2MWPA 2HKQB 4C5EA 2EYYA 3L1AA 4RCCA 3CEYA 1SHGA 1UGRB 2KSSA 2HBPA 4BCMB 3G71A 2AZVA 3ULRB 4JJDA 4QVDA 1ZUKA 1FX7A 1TD6A 1RAHB 5KYUB 3AHUA 3QIIA 3QWYA 4LUEA 2IG0A 2DKGA 4YOSA 4C8QA 4EC8B 1ZA2B 3BDLA 5GAN2 4MMLA 2QAZA 5D6WA 1VYWB 2ZPHB 2I0NA 1B07A 2DE0X 3MP8A 1GXIE 3JV3A 4MZTA 3VKHA 2A3LA 4ELZC 2EW3A 1R0BG 1GY3B 2P4RA 1K8AR 4JRKA 3P8BB 3LH5A 1M1GA 1M3CA 3I55Q 2P0KA 4F7LB 2WXVB 1YJ9A 1G3SA 3A8OB 2C5OB 2V1QA 3MKDA 5IHNA 1K8AU 1FWZA 1KQSA 4M78E 1I5OB 1H1RB 5LJ5h 2ZPFB 3BLQB 3EAEA 5DQWA 1VQPQ 4C8QF 1R8OB 5IH2A 3X25B 3TEEA 1VQMA 1HXDA 1WGSA 2ZPIB 3JCMV 4QVCA 4BCKB 4EC9B 5AYFA 1MMAA 3V8KA 2XKOC 1QLYA 1TTHB 2KR6A 4F7UE 5GAN3 4M7AA 3VS3A 1C0MA 1KQ2A 1PG5B 2WACA 1E6HA 1Q86C 1WQ7A 4CFUB 4Y91A 3RNJA 1OZ2A 5CEIB 2RQRA 3M0PA 4N0AC 2V26A 2NWMA 4OMLA 2GBQA 2KR3A 1UB4A 2NUTA 1M3BA 4JS4A 2QI2A 3BY7A 1VINA 1Q82U 5IHKA 2FO0A 3OA6A 4HKEA 1Q95G 3CCMQ 1YHQA 4RG8A 2E1HA 1M3AA 4PFPA 1YCYA 1VQ4A 4VUBA 2DXUA 5GANd 2DD5A 3HSBA 5CCAA 4BY6B 4L6V5 1LOJA 2VYTA 4RMOA 2CZ6B 1UGVA 1K0XA 4FT2A 2SRCA 1OIYB 3FLGA 5GAMh 1W2BP 5FU7C 2QDJA 5KYXB 1KC8C 5CKBA 4OMFB 4LDYA 1VYVA 4X34A 4JPBW 4FCYA 4RG2A 3D7SB 4ROEA 4FIBA 2O9SA 2L3RA 4J9FA 3OYEA 2OTJT 4ATOA 4KGXB 5KE2A 1KD1C 2D8HA 1JJ2P 1U1SA 2LQWA 2GTOA 2KROA 1K0SA 2WMAB 2QFZA 2DVJA 1I5LA 3BW1A 4IUPA 1SKUB 3BDUA 1YJWA 3QUIA 3DJBA 3X26B 5HCKA 2QF7A 4LOCA 3QDFA 2GQIA 2O4XA 3CCJT 3HP9A 3HL8A 2CZ7B 4BCJB 3JCMP 3OW2S 1H26B 4J9BA 2RI2A 1ZSGA 2L3PA 2UZBB 2QDYB 2H3EB 3RR6A 5GMKh 2WSEE 1CKAA 4HT8A 1AD6A 2CZ1B 2R5MA 2L89A 2WMBB 2DEUA 4KGVB 1ACMB 4FYVB 1VQ7A 5J26A 2IPOB 4EMGA 3A8LB 1RI9A 2QGSA 2HDAA 3M03A 4FT4A 2A7YA 3CCRA 2A0FB 5IAYA 4LN2A 2NUZA 2FL7A 2K79A 2LTOA 2ZPBB 1QMCA 4CC3A 5LJ3e 1H1PB 1TOVA 1XTDA 2YUNA 2QG9B 1FKMA 3F5XB 3MP6A 4F6SB 4CXAB 1GH6B 2PUOB 1K9MR 2C5NB 5IHIA 2HZYA 4BBSM 2R57A 4OB3B 4AI6A 2FG0A 2CP7A 1F1BB 1YJNT 1H92A 2G3RA 4OMQA 1ZBJA 5D6XA 1VQKT 2PK9B 2HBWA 1R77A 1VQLA 3CCVT 2RPNA 4N4HA 4M6VA 1YITT 1WDXA 3EFRA 4HVUA 4CRIA 2UZDB 1QMZB 4DQ2A 1D1AA 5IXFA 1H25B 1K9AA 1E7OA 4F04B 2DLPA 2P4TA 4JZ4A 4DA4A 1K1ZA 1VQ8T 4BY6C 1VQ9A 1FMWA 1W4SA 2M0YA 1IHVA 1E7PA 1D0YA 5HNBB 1AHJB 2IVXA 4NS5A 1D09B 3S3OA 2GGRA 2KI7A 2K9GA 4D8DA 4DEYA 3M54A 4M77G 4OVAA 3EG3A 1E6GA 1UEBA 2E64A 3CPFA 4TTHA 3N5BB 3RMQA 4N0AA 2LRQA 3BG5A 1BU2A 2NUTB 2EJFA 3EFOA 1MGQA 4JX5A 3R6OA 1I07A 4M77D 1TH7A 4A53A 3BHUB 3V7RA 2KVQG 2XI9A 4ME7A 4RCBA 4XU2A 3V7CA 3UA7A 2RB6A 3CCET 5CK9A 1U5SA 2RQTA 2JT4A 2OTLA 1Y71A 3EG9B 3QHRB 1VYTA 3FDRA 2IW8B 5EC7A 2DIGA 2E12A 1T0HA 3OYMA 2YUPA 3ZFJA 4A4HA 5KH6A 1UNGD 1IB8A 1QCFA 2COZA 3P8DA 1ZUUA 3G1JA 5KCOA 4AG1C 3JCMQ 3SEMA 2DK3A 1T0JA 1YNZA 4CI0C 2EQUA 3MEVA 3FEOA 2GTJA 1Q86R 1GUXB 3JCMh 2PJQA 2DTHA 2XU8A 4MIMA 2EGAA 2D1XA 3POMA 3M59A 3TW6A 1Q86U 3OYHA 5LJ3d 3RUXA 2QEXA 2DRKA 1MV3A 3SWNC 4ESRA 2LQ8A 5CR2A 2HKNA 3EGUA 3BG3A 5LMKB 5J3BA 1I1JA 2V1RA 4J9EA 5KYUA 2QA4A 1YJNQ 4NC6A 5I11A 1VQKQ 3C4SA 2EIFA 2E3HA 3OW2A 4J9DA 3G6EA 4Z02A 4E7JA 2O4XB 1AWJA 3CCVQ 2XD0A 4IMYB 1W6XA 1YITQ 2FZCB 2M1HA 5KYYB 1G3YA 1NYGA 4RTTA 4F7SB 1M2VB 2XHCA 1IZ6A 1LJOA 2QQBA 2EUFA 1F5QB 1YIJT 2W99A 4BDYA 4DBHA 1U1TA 1OL2B 3LWIA 2AIRB 1KC8R 2K5IA 1XOVA 3CC7Q 3OYDA 3MY5B 1AISB 3A8GB 5HBJB 1VQNQ 1T3SA 1KC8U 2B8AA 1KD1R 2RJDA 1O9KB 1NPPA 2WSFE 5DLQE 3CMAT 2EPDA 3ZEHA 5A0GA
chains in the Genus database with same CATH topology
2JOYA 1KD1U 4J5YA 2R58A 4EMKB 2MWPA 5GAN7 5FROA 4C5EA 2OAUA 4Y28E 3L1AA 4RCCA 3CEYA 2VC8A 4EMHA 1UGRB 5GMKi 2KSSA 2YRVA 3V8LA 1N8RU 2HBPA 3UWNA 2QQRA 3OYAA 5HKCA 4M75B 4O5VA 3MO8A 2HQEA 1X01A 2RO0A 3G71A 2D9TA 2MMPA 1VQ4T 4LDXA 1VQ6T 2EQJA 1PSFA 4EMKC 2DPPB 1RL2A 2LVMA 1FX7A 4JDSA 4PNOA 3L2ZA 3QHSA 4QVDA 3AHUA 1WNLA 3MEUA 3QIIA 4M77F 1UGQB 4II1A 2LC4A 2NLUA 2IG0A 2DKGA 2E10A 2K4YA 5EG2A 4E7LA 4N4IA 4M75C 4OB1B 4C8QA 4PLLA 4XQ3A 3LH0A 3G4ST 4M7DG 3BDLA 5GAN2 3PIOA 1H3ZA 4MMLA 3INZA 2XICA 5D6WA 3OYLA 5GAMe 3G7ZA 2C06A 2ZPHB 3M56A 1VQOT 3OYYA 1WJSA 3OMGA 4TVRA 5A0DA 4C5IA 2BS4A 3MP8A 3CCUT 2RM4A 4BACA 3MEWA 4HLQA 3RESA 3OYFA 1VQ9T 1GXIE 2DXBB 4MZTA 4M78C 3VKHA 2A3LA 3VJPA 4ELZC 3CPWS 5LJ5j 2F69A 5CVIA 3WVEB 2P0QA 4J6XA 4JS5A 5CQXA 2ZGWA 4GY5A 3VU3C 3JB9J 4P5NA 4JRKA 3P8BB 4V2SA 1M1GA 3GPLA 3C94A 2K57A 4M7DD 4PL6A 3JB9I 2P0KA 4JLIA 3I55T 1YJ9A 2CS7A 2RH2A 1G3SA 2DD4A 3A8OB 4D6WA 2QQ9A 1K8AU 1FWZA 2GF7A 3LW5E 4M78E 3CXCA 1KQSA 2WJ9A 1YJNA 4M77B 3I56A 5LJ5h 2ZPFB 3EAEA 3OS1A 3GNFB 3JCMJ 1VQKA 1O75A 4UC4A 2KDSA 1VQPT 5EJCA 4C8QF 1R8OB 2CZ0B 1P92A 2P0PA 4PJOG 3X25B 4OP0A 3TEEA 1VQMA 1QVPA 1HXDA 1WGSA 1WJQA 4A4GA 1NE8A 3DKMA 5CKEA 2ZPIB 3JCMV 4C92C 4QVCA 5GMKm 3CCVA 1JRIA 5GAOl 5AYFA 1BIBA 4IURA 3GNGA 3KHIA 3T9NA 5GAN5 3V8KA 4OGCA 1YITA 2XKOC 1I5LA 3CCQA 1MHNA 1VUBA 2KR6A 1KQ1A 2JN0A 3JSCA 2Y4XA 4XTUA 3E9FA 2I2LA 4F7UE 5GAN3 1KQ2A 4M7AA 2WACA 3P8HA 4GLKA 1U8RA 1Q7YC 2E6ZA 3OS2A 3H6ZA 4IUTA 3MHXA 1YIJA 3HRUA 3TREA 1Q86C 1WQ7A 3C12A 4XTZA 1IREB 3OSSC 4LD6A 4Y91A 2RK1A 3A5ZB 3ZBDA 4C92E 4J7FA 3CC2A 3J81E 4PJOD 1BI2A 1OZ2A 2DZ9A 3V8JA 3NFCA 5GMKe 3QKJA 2XDBA 1S72T 2JVVA 5CQYA 5GMKl 4N0AC 3CC7A 2GQVA 5GANh 2HNIA 3CBMA 4M7DE 4L5GA 2GFAA 2ZZDA 1UB4A 4NOYA 4C8QB 1VQNA 1B34A 4KT0E 1VQ7T 2E5QA 1VQ5A 1V29B 4JX6A 2CYZB 1Y07A 2LCCA 2RHUA 3PMIA 3JCMc 3L2QA 1YI2T 3CC4T 4C5HA 4XTYA 3FIFA 4QW2A 1Q81U 1OZ3A 2QI2A 4JS4A 2RI5A 1WQWA 3ASKA 4MDWA 1VIFA 1K9MC 3BY7A 5M9OA 1Y96A 1Q82U 4A54A 4M75G 2DXCA 2X4JA 2XG8D 3OA6A 4HKEA 2F5TX 3CBPA 3CCMT 4HCCA 3QSUA 3JCMg 1YHQA 4KUDK 4J7IA 4RG8A 2E1HA 2QTXA 5CO7A 3HKSA 3PT9A 2DZCA 2LX9A 3PNWC 2DTOA 4AKHA 2KMTA 3C95A 4OF1A 2X4YA 1YCYA 4BUGA 5GAMj 4VUBA 2DXUA 4A4FA 1VQ4A 3RERA 4OB0B 2M16A 4M78G 2DD4B 2DD5A 3DL1A 5FU7B 1N27A 5GANd 2QEXT 3M58A 2BS2A 3HSBA 3LYIA 5GAOq 5CCAA 4BY6B 4L6V5 1LOJA 2VYTA 3HFOA 4M75D 2MF2A 2MWOA 5DLOA 4RMOA 4NL3A 3CCEA 4LDVA 2CZ6B 4HNVA 4FT2A 3CMET 3FLGA 4IUVA 5GAMh 2DVEA 2V8IA 1VQOA 5FU7C 1X75C 3OMCA 4JRIA 1M5Q1 4BE0A 2QDJA 4ZGDB 3OYBA 4MZMA 5L8RE 3SD4A 3L2RA 4F7UG 1KC8C 1QP3A 3GP8A 3G6ET 2PVDB 4M78D 4OMFB 5CKBA 4LDYA 4E7IA 5I2MA 1M90U 2KQWA 1RI0A 4X34A 3VYHB 4XU1A 4NL2A 4RG2A 4YTLA 4M7AB 4ZN1A 5GANg 2L5QA 4FIBA 3JCMf 3M4GA 1VQLT 2L3RA 3LX7A 3OYEA 2WSCE 3OYGA 4C92G 4ATOA 3HBLA 4M7DA 1Y7XA 2OTJT 5KE2A 3SFMA 1KD1C 2FVUA 3A8HB 2JTFA 5KE3A 1FXXA 3I55A 1U1SA 2PUKB 3OYIA 4BE1A 4R56A 1QP2A 4LD9K 1NJIU 1BI1A 1N8RC 2RA2A 3DB4A 2VGNA 3OBYA 4M7AC 2YHTA 3TCJA 5GAMd 3JAME 2QFZA 3QYBA 3WVDB 2ZZDB 3RKYA 1VQPA 3BW1A 3VYGA 1B34B 2O01E 4XTVA 5HY6A 4A4EA 4B9XA 2EKOA 3L2WA 2D6FA 4IUPA 2DXTA 3A8MB 1KHIA 3F70A 3QDRB 3BDUA 2RHXA 2CKKA 1YJWA 3QUIA 1QLBA 4C92D 1QVGS 4ELYC 5HK3A 3JB9G 1BI0A 3Q1JA 3MCAB 3M57A 1QVFS 2EJ9A 3X26B 4M75E 5GMKj 2QF7A 2RHIA 4LOCA 1M1KU 3CBOA 4HNUA 4J83A 2DXCB 2O4XA 3CCJT 3QYGB 3HP9A 3HL8A 4J6WA 2CZ7B 5GANf 2YLBA 4KULA 4ZTFA 3JRZA 3JCMP 2LQKA 3OW2S 3S6WA 4M7DF 4PJOA 2RI2A 3GF5A 3PMTA 5A0LA 2JTMA 4LDWA 3TU4K 1H641 2PU9B 2QDYB 2DD5B 5LL6S 5GMKh 4Q5WA 3X24B 3L2VA 3NTIA 2WSEE 4HT8A 3JB9D 4Z6YA 2RJFA 2CZ1B 2R5MA 2L89A 3E9GA 3G71T 3X28B 1W2BS 3SB2A 2FHDA 2PVOB 3HPWA 2F5KA 2GCXA 2GFUA 3NTHA 5D6YA 5J26A 4DOVA 5GAN8 1K8AC 1VQ7A 3JCMX 2MAMA 4EMGA 3HFNA 4M77C 5KCHA 3HB9A 3BG9A 3L2UA 3A8LB 2JNGA 5CKDA 3CCLA 2EYQA 2ZCFB 1G5VA 1K73U 3CCSA 4FT4A 3OB9A 2A7YA 2LNVA 2RI3A 3GLXA 4BDZA 4HCZA 3CCRA 3OQ5A 2YLCA 4JUVA 2OTLT 3CCMA 5LJ5d 1JJ2S 1D3BA 5IAYA 1ZHIA 2BKDN 5CKFA 2K2VA 4BD3A 4M77E 1ZQ1A 4PJOF 3S3NA 2X4WA 4XK8E 2KAFA 5FLXE 2VGMA 3VV0A 2FL7A 2LTOA 3KXTA 2ZPBB 2KMGA 3VUZA 3VKIA 2MI6A 2K5FA 3H8ZA 4XTWA 3ME9A 5LJ3e 4ELJA 4PKCC 1XTDA 3QZ5B 4M75A 3GIBA 2DAQA 1FKMA 3PIPA 4OGEA 2KY9A 1UGPB 1X6OA 3MP6A 4AKGA 2XDDA 2EQKA 2PUOB 4C0DB 3QWLA 3CPWA 3VYGB 3CMAA 4BBSM 3OY9A 2R57A 4E47A 4OB3B 3NTKA 4AI6A 5CAIA 1I81A 1YJNT 4QQGA 3JCMW 3I56T 2QQSA 2G3RA 2EFIA 4M78A 5LJ5g 3PGGA 4M7AG 3ER0A 5D6XA 4J6YA 1VQKT 4C8QC 2AHJB 4WF2A 3JCMe 2ZPEB 1OI1A 3LGFA 3S3MA 5HK0A 1XQHA 2DO3A 4C0GA 3VUBA 5DM7R 4ZTJA 1VQMT 4C0DC 3QO3A 1Q81C 1VQLA 1N6AA 3CCVT 5C6SA 3QJ6A 2OTJA 1WPYA 3UPUA 4N4HA 1VQ6A 4M6VA 4BB7A 5GAOn 1YITT 3CD6T 4XU3A 3JB9H 4PJOB 1PSEA 2LT4A 1Q82C 2JUFA 3HO8A 3EFRA 2X35A 4CRIA 3CCQT 4FU6A 4C0FA 4DQ2A 3X20B 4C8QE 2D0QB 4HNTA 2BIVA 4F7UA 3E19A 3G4SA 4M75F 2LDMA 4LDUA 2HQXA 2P4TA 2QA4T 2FYKA 5J39A 1EIFA 4C92A 4DA4A 1UGSB 3M9QA 3CCUA 2RK2A 1VQ8T 4BY6C 4EPCA 5A2QE 1VQ9A 1W4SA 2RJCA 5I2SA 4QQ6A 3SWNA 5LJ5f 1E7PA 2IVWA 4M78F 5GANe 4PJOE 1NPRA 4HT9A 2EWNA 1KQSS 3CXCS 3DB3A 1AHJB 1VQ5T 2XIDA 2Y90A 4NS5A 3QYEA 3S3OA 5C0MA 4O6JA 3M54A 5I21A 4M77G 1WJRA 4ZN3A 4OVAA 3M55A 3KBGA 3OSVA 1NZ9A 3META 5GAN6 3JCMb 1M90C 3QXEB 5FU6B 2QQ8A 2XK0A 3MP1A 1UEBA 2E64A 3CPFA 3EFSA 3N5BB 3URGA 3RMQA 4N0AA 2LRQA 3M5AA 5GAN4 4E7HA 3OYCA 3BG5A 3PFSA 1I8FA 3SDZA 1YHQT 4DOWA 2EJFA 4F7UF 4JRQA 3OYKA 1MGQA 4HL4A 1M1FA 1XNIA 2CGHA 4MFDA 2EQMA 5IN1A 1LNXA 4JX5A 2VXEA 3MEAA 3R6OA 4QVZA 1NJIC 5FU6C 4MZPA 4HA8A 2LT1A 2BS3A 2RHYA 4C92F 3UDCA 3O8VA 2M9UA 2PQWA 4M77D 1TH7A 4R55A 1Y96B 4A53A 2H3JA 3OS0A 4M7AE 2FB7A 4M78B 3HZJA 3HRTA 3V7RA 2KVQG 2XI9A 4ME7A 4RCBA 5LJ3j 4XU2A 3V7CA 2V8JA 2RB6A 3CCET 3OBWA 4N4GA 5CK9A 1BYMA 3VKGA 1M4ZA 3QBYA 2OTLA 1Y71A 4L59A 3WXMB 5GAMg 4AKIA 3FDRA 3QZ9B 2QQAA 1KG1A 2DIGA 2E12A 2RHZA 4FL6A 4RKUE 1M1KC 1N9SA 2KK4A 1YBYA 3QJYA 5DY9A 2E41A 4C8QG 3OYMA 1S72A 3ZFJA 2L8DA 4A4HA 3OYJA 5LJ3h 5KH6A 3JB9F 3RMSA 3M4YA 4F7UB 5GAOm 3FJPA 3QG1A 3H4CA 3L42A 3FC3A 3P8DA 1YI2A 2G77A 3M53A 3CC4A 1JBMA 5KCOA 3JCMQ 3FRNA 2DK3A 2M0OA 4C92B 4CI0C 4A4KA 4B9WA 4E7KA 2EQUA 3MEVA 4PLIA 3OYNA 3FEOA 3BFMA 1ZBXA 3SWNB 2DJZA 2V8KA 3E1SA 3J7AF 2K3YA 3LLRA 3OS5A 3JCMh 4C8QD 1BI3A 2DTHA 2HD0A 2XU8A 4BBRM 3FB9A 3CD6A 4M7DB 4MIMA 1Q7YU 3M59A 5GAMf 3TW6A 1YJWT 1Q86U 1K73C 3OYHA 4EMKA 5FRMA 4IUUA 4BI4A 5LJ3d 4ZGEB 2DIQA 3RUXA 2QEXA 3KUFA 1G3WA 3QPHA 4QSHA 3SWNC 5FRNA 4MDXA 2ZPGB 2LQ8A 2VV5A 5CR2A 1KHCA 2XDPA 3BG3A 2QXFA 1M9SA 4XTXA 5GANj 4M7DC 3UT1A 3LWHA 1QVGA 4JRPA 3V7SA 2E65A 1YJ9T 5J3BA 2R5AA 4QQDA 3CMEA 1QVFA 2BUDA 2X4XA 2QA4A 1BKBA 4NC6A 1JB0E 2RD1A 4XU0A 3HHTB 5LJ5e 4KUIA 3JCMd 3J80E 1VQ8A 3C4SA 2VXFA 3DLMA 4J8OA 4JLGA 2EIFA 3GOXA 1K9MU 3OW2A 1I4K1 4Z02A 3G6EA 2DEQA 4E7JA 1OYXA 2O4XB 4OB2B 5LJ3g 3CCST 4KBMB 2XD0A 2EJGA 4IUQA 3RIRA 2E70A 2M1HA 1G3YA 5GAOr 2DXBA 3CCLT 4FM4B 4BI8B 2XHCA 1IZ6A 2VUBA 2PVGB 3RKXA 4FSXA 4X9DA 1LJOA 3PTAA 2QQBA 1W2BA 4HCBA 4XAXB 4C5GA 3CCRT 1YIJT 4M7AD 1SSFA 5IT9E 2LCLA 3RKWA 4M7AF 4X9CA 3CC2T 1N9RA 4BDYA 5GAOp 3DLLA 4PJOC 2K5LA 1HK9A 1U1TA 3LWIA 1G3TA 2K5IA 4IKFA 4M77A 1XOVA 4MFEA 2EAYA 3CC7T 3QYHB 3OYDA 3A8GB 2HAXA 1QW1A 2RJEA 1JJ2A 1O9SA 1BIAA 4JX4A 3HRSA 4BE2A 1VQNT 1KC8U 2B8AA 5CKHA 2RJDA 4BI3A 3CCJA 1M8VA 2DTIA 5LJ3f 5CIUA 4C0ZA 1NPPA 4EDUA 2E6NA 1VIEA 1D3BB 2JZ2A 2WSFE 4MMKA 5DLQE 2Y4YA 4JJNK 4ZGJB 1DJ7B 3LGLA 3CMAT 3TW7A 2K3XA 3ZEHA 5A0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC A;  3QZ9 B;  4Y28 E;  4RKU E;  1UGR B;  4XK8 E;  2ZPB B;  4OB0 B;  2DD4 B;  2DD5 A;  3QZ5 B;  1PSF A;  2DPP B;  4L6V 5;  1UGP B;  1UGQ B;  2PUO B;  3VYG B;  4OB1 B;  2CZ6 B;  4OB3 B;  2ZPH B;  2AHJ B;  4ZGD B;  2ZPE B;  5L8R E;  1QP3 A;  1GXI E;  2PVD B;  2DXB B;  3VYH B;  4ZGE B;  3WVE B;  2WSC E;  1PSE A;  2ZPG B;  3A8H B;  3X20 B;  2PUK B;  1QP2 A;  2D0Q B;  3A8O B;  2DD4 A;  3LW5 E;  2ZPF B;  1JB0 E;  3HHT B;  3WVD B;  2ZZD B;  1UGS B;  3VYG A;  2O01 E;  2CZ0 B;  3A8M B;  3X25 B;  2ZPI B;  4OB2 B;  3X26 B;  1AHJ B;  2DXC B;  2DXB A;  3QYG B;  4FM4 B;  2CZ7 B;  2PVG B;  3QXE B;  1IRE B;  2PU9 B;  2QDY B;  2DD5 B;  3X24 B;  2WSE E;  2CZ1 B;  3X28 B;  3QYH B;  2PVO B;  3A8G B;  2ZZD A;  4KT0 E;  1V29 B;  2CYZ B;  3A8L B;  2ZCF B;  2WSF E;  4ZGJ B;  1DJ7 B; 
#chains in the Genus database with same CATH topology
 2JOY A;  1KD1 U;  2COW A;  4J5Y A;  2OAU A;  3A98 A;  1LVK A;  5GMK i;  3V8L A;  3OYA A;  3QHW B;  5HKC A;  4O5V A;  1QQJ A;  2D9T A;  2ECZ A;  4LDX A;  1R0C B;  3R6N A;  1RL2 A;  3QHS A;  3THK A;  1WNL A;  4LE9 A;  1UGQ B;  4E7L A;  2WEV B;  5EG2 A;  2LNH B;  4M7D G;  2I40 B;  3CCE Q;  3EGD B;  4FW2 A;  3PIO A;  2XIC A;  3OYL A;  3G7Z A;  2C06 A;  1VQO Q;  1UUE A;  3OMG A;  1SSH A;  4C5I A;  3CCU T;  3OYF A;  1WIE A;  4F17 A;  2DXB B;  3VJP A;  9ATC B;  4BCI B;  2F69 A;  3WVE B;  5CQX A;  4GY5 A;  1WHG A;  1ZUY A;  1NLP C;  4CFV B;  1H1S B;  3C0C A;  3GPL A;  2O2O A;  1AD5 A;  1GCQ C;  3C94 A;  3VRZ A;  4M7D D;  4PL6 A;  3JB9 I;  3I55 T;  1ZP2 A;  2RH2 A;  2GF7 A;  1Z9Q A;  4M77 B;  3I56 A;  4F70 B;  5EFQ B;  3GNF B;  1O75 A;  4UC4 A;  4DBR A;  2ED0 A;  1VQP T;  2HMA A;  2P0P A;  2PZ1 A;  4PJO G;  4OP0 A;  3CCS A;  1TUD A;  1NE8 A;  4E7S A;  5GAO l;  1TS9 A;  3GNG A;  3VS2 A;  5KYX A;  1D1C A;  1RAF B;  3E9F A;  2I2L A;  3NHN A;  4GLK A;  2DNU A;  4IUT A;  3C12 A;  1QWF A;  3ZBD A;  4HVV A;  4RTX A;  2RK1 A;  4C92 E;  3CC2 A;  4J7F A;  4PJO D;  1BI2 A;  3V8J A;  4OR5 B;  4EOP B;  3QKJ A;  2JVV A;  5GMK l;  4M7D E;  2VWF A;  3BHV B;  3CBM A;  1VQ5 A;  4I3Z B;  2X51 A;  2RHU A;  1YI2 T;  4RTZ A;  3JCM c;  3L2Q A;  4C5H A;  4AFS C;  1OZ3 A;  3O0G D;  1K9M C;  1Z9Z A;  1QVG P;  4M75 G;  1GBR A;  4II5 B;  5ICP B;  2XG8 D;  2F5T X;  2X1N B;  3CCM T;  4HCC A;  4ORZ A;  4KUD K;  4J7I A;  1TSF A;  4AKH A;  2KMT A;  1SEM A;  2PNI A;  4OF1 A;  2X4Y A;  4BUG A;  2PMI B;  4OB0 B;  4M78 G;  5FU7 B;  2JJ9 A;  3M58 A;  2VVK A;  3HFO A;  1M2O A;  2LQN A;  4M75 D;  2MWO A;  4OGR B;  3CMA Q;  4LDV A;  1JKW A;  1PCX A;  4HNV A;  1ARK A;  4EOJ B;  1X75 C;  3OMC A;  2XMF A;  4ELL A;  1M5Q 1;  2MYS A;  3OYB A;  4F7U G;  2PVD B;  4M78 D;  4E7I A;  4CC7 A;  1RI0 A;  4X1V A;  3LX7 A;  3HBL A;  4K11 A;  1X2Q A;  5BNJ B;  3SFM A;  5KE3 A;  2AKK A;  2B86 A;  4E7Z A;  1QP2 A;  4F6U B;  1N8R C;  1IXD A;  3DB4 A;  1IGQ A;  2VGN A;  2YHT A;  4F7N B;  4CFW B;  2YUO A;  1MNE A;  1TUG B;  2DFU A;  5HY6 A;  2EKO A;  3CCU Q;  2DXT A;  3QDR B;  2CKK A;  1QLB A;  3JB9 G;  2NUP B;  4AFZ C;  1QVF S;  4Z89 A;  4M75 E;  1NYF A;  2KBT A;  3CBO A;  4HNU A;  4PFO A;  4J83 A;  4CFM B;  4ZTF A;  4IIO A;  4OMP A;  1AWO A;  2EGE A;  3S6W A;  3GF5 A;  5A0L A;  2JTM A;  1RUW A;  1AOJ A;  2YRC A;  3X24 B;  3NTI A;  1UHF A;  3JB9 D;  3NGP A;  4EOQ B;  3G71 T;  3X28 B;  1D0Z A;  4F7J B;  3NTH A;  3I35 A;  3HFN A;  4M77 C;  5AT1 B;  5KCH A;  3CCL A;  2EYQ A;  2ZCF B;  2HSP A;  4DBF A;  3OB9 A;  3GLX A;  5FWC A;  3REB B;  4HCZ A;  3OQ5 A;  1KQS P;  1W98 B;  1ZHI A;  2BKD N;  1ZQ1 A;  3S3N A;  2X4W A;  4XK8 E;  3KXT A;  2VGM A;  1WHK A;  2WIH B;  1OV3 A;  3VKI A;  2MI6 A;  1YI2 Q;  5HQ0 B;  1UGP B;  1X6O A;  1KK7 A;  2EQK A;  2G9X B;  3VYG B;  4E47 A;  1C6V X;  5CAI A;  2EYW A;  1ZSZ B;  2EFI A;  3PGG A;  4M7A G;  3ER0 A;  4WF2 A;  1OI1 A;  3LGF A;  2CUD A;  3U23 A;  5HK0 A;  1VQM T;  4C0G A;  1Q81 C;  1BU1 A;  4ZTJ A;  3EG9 A;  3QO3 A;  4C0D C;  2CSQ A;  3QJ6 A;  2OTJ A;  2VKN A;  3UPU A;  1VQ6 A;  4PJO B;  3JB9 H;  1OI9 B;  2X35 A;  2KE9 A;  1J3T A;  4C8Q E;  3TNI B;  2F2C A;  2BIV A;  4Y92 A;  4CFN B;  3PO3 S;  3G4S A;  1OPL A;  2HQX A;  5J39 A;  1EIF A;  2DIL A;  3TSW A;  4EPC A;  1MND A;  5LJ5 f;  3QWX X;  2IVW A;  4J9I A;  2EGC A;  2RN8 A;  1GUX A;  2C0O A;  3CXC S;  3DB3 A;  2V22 B;  1GBQ A;  4RTV A;  2CRE A;  2QTV A;  4DBQ A;  4OMO A;  2DYI A;  1NZ9 A;  1ENW A;  3MPU B;  3QXE B;  2IW6 B;  4JJB A;  3URG A;  3PFS A;  1I8F A;  1YHQ T;  3OYK A;  5IN1 A;  1K76 A;  1LNX A;  3MEA A;  5FU6 C;  1H1Q B;  4MZP A;  4HA8 A;  2K7A A;  4M7A E;  1EX4 A;  4M78 B;  3HRT A;  4EOO B;  2E4H A;  1C1A A;  2CUB A;  5LJ3 j;  1YFN A;  2V8J A;  3TN8 B;  3OBW A;  4N4G A;  1NBE B;  1RAA B;  1M4Z A;  5KYY A;  1M2V A;  1KG1 A;  4RKU E;  1FYN A;  2MOX A;  4QKU A;  1S72 A;  3QJY A;  2E41 A;  2PK2 A;  3G71 Q;  3A1P A;  2LZ6 B;  3RMS A;  4F7U B;  5GAO m;  3QG1 A;  3L42 A;  2G77 A;  5IDN B;  3CC4 A;  1JBM A;  2ENM A;  3FRN A;  1PKT A;  2ATC B;  2A37 A;  4B9W A;  1H8K A;  1ZBX A;  3SWN B;  3J7A F;  1U3O A;  2PHG A;  1TFB A;  4J9G A;  3LLR A;  2DL7 A;  1O9K A;  2MCN A;  1K4U S;  2HD0 A;  1SG5 A;  1YN8 A;  4OMN A;  4FYW B;  1RAD B;  3G33 B;  2J7I A;  5GAM f;  1YJW T;  1K73 C;  2VAS A;  3EID B;  1Y57 A;  1G3W A;  1HD3 A;  4MDX A;  3KFV A;  1CSK A;  4M7D C;  2BPM B;  1YJ9 Q;  4JRP A;  4QQD A;  3CME A;  1QVF A;  2BUD A;  2UUE B;  1JB0 E;  2ROT A;  5LJ5 e;  3HHT B;  1VQ8 A;  2JGZ B;  2VXF A;  3GOX A;  1K9M U;  4AFQ C;  3EGD A;  2WHB B;  1VQM Q;  1OYX A;  4OB2 B;  2EJG A;  1WFW A;  3RIR A;  2E70 A;  1TXQ A;  1ZSZ C;  2DXB A;  2VUB A;  3RKX A;  2PVG B;  1W1F A;  4KH0 B;  2FZG B;  4C5G A;  4UN0 A;  2DM1 A;  3CCR T;  1SSF A;  3VS1 A;  3RKW A;  1Y0M A;  5IT9 E;  3VRY A;  1N9R A;  2F2X A;  5GAO p;  4PJO C;  5GJW B;  1RLQ C;  3VS4 A;  3UF4 A;  4M77 A;  1URC B;  2LJ1 A;  3CC7 T;  2EQI A;  2HAX A;  1QW1 A;  2RJE A;  4JX4 A;  4BE2 A;  4KGZ B;  1B3Q A;  1VQN T;  1QKW A;  5CKH A;  4BI3 A;  2DTI A;  4C0Z A;  2C5X B;  4F14 A;  1BCO A;  4EDU A;  2Y4Y A;  4ZGJ B;  1N8R R;  3K7A M;  3MY1 B;  2R58 A;  2L2P A;  2VC8 A;  2YRD A;  4EOL B;  1YHQ Q;  1N8R U;  3UWN A;  2QQR A;  2HQE A;  1VQ4 Q;  2MMP A;  3H41 A;  2C0I A;  2EQJ A;  4EMK C;  2DPP B;  1JXM A;  2LVM A;  4JDS A;  3MEU A;  4M77 F;  1OL1 B;  1S1N A;  2NLU A;  3H9N A;  4N4I A;  1UTI A;  4M75 C;  4OB1 B;  1IRX A;  5GAM e;  1YCS B;  1VQO T;  3OYY A;  1JQQ A;  2R7G A;  2CP0 A;  1GRI A;  4CC2 A;  5HBH B;  2RM4 A;  3TNH B;  1VQ9 T;  4HLQ A;  3RES A;  4M78 C;  3CPW S;  4J6X A;  4JS5 A;  2JM8 A;  3VU3 C;  1WLP B;  4P5N A;  2QYZ A;  2HQH A;  4V2S A;  1OUL A;  2K57 A;  2P84 A;  2JS0 A;  1PNJ A;  3LW5 E;  3CXC A;  2WJ9 A;  2KRM A;  4WTO B;  1KIK A;  3OS1 A;  1QKX A;  3JCM J;  1WA7 A;  2CZ0 B;  3EH1 A;  1QVP A;  1YJW Q;  5CKE A;  2KXC A;  1JRI A;  1UNL D;  5IDP B;  2CP2 A;  3T9N A;  3CD6 A;  3KHI A;  3CCQ A;  1MHN A;  1VUB A;  2Y4X A;  1Q7Y C;  2D8J A;  3OS2 A;  1VOL A;  3H6Z A;  5FWB A;  4ZNX A;  1YIJ A;  4XTZ A;  1IRE B;  3OSS C;  2K3B A;  2W0Z A;  2L0A A;  2QGG A;  2DZ9 A;  5GMK e;  3NFC A;  5CQY A;  4BCN D;  1Q81 R;  5KYW B;  2J6F A;  1WI7 A;  2HNI A;  1WYX A;  5GAN h;  2GFA A;  3I5S A;  4NOY A;  1VQ7 Q;  4KT0 E;  3TQ7 P;  2E5Q A;  2BZX A;  2EVR A;  4JX6 A;  2CYZ B;  1Y07 A;  4XTY A;  2KRN A;  4QW2 A;  1Q81 U;  4Z8A A;  1WQW A;  2NUP A;  1ZA1 B;  1Y96 A;  2VB6 A;  2PTK A;  2X4J A;  3CCR Q;  4NST B;  3IQL A;  4A63 B;  3QSU A;  1GL5 A;  3EGX B;  3EG2 A;  2QTX A;  5CO7 A;  3HKS A;  4FX3 B;  2DZC A;  3PNW C;  3C95 A;  3RER A;  3OW2 P;  4A4F A;  2M16 A;  1AZG B;  2DD4 B;  2QEX T;  3LYI A;  5GAO q;  1UNH D;  1KJW A;  1WX6 A;  2FZK B;  4EIK A;  4BCQ D;  4IUV A;  4R0K A;  1H27 B;  1C9B A;  2DVE A;  2JM9 A;  2AK5 A;  4B6M A;  4MZM A;  5L8R E;  3MI9 B;  3L2R A;  1QP3 A;  3GP8 A;  3G6E T;  4HVW A;  2DBM A;  2KQW A;  2C4G B;  5GJV B;  1PKS A;  4XU1 A;  4YTL A;  1FMV A;  4ZN1 A;  2LW4 A;  1VQL Q;  2L5Q A;  3JCM f;  4M7D A;  2DMO A;  8ATC B;  4C92 G;  1KSW A;  1Y7X A;  2JTF A;  1UDL A;  3I55 A;  2PUK B;  3OYI A;  1PRM C;  1BI1 A;  1YP5 A;  4YOZ A;  1AWX A;  4M7A C;  3TCJ A;  1WHH A;  2DL8 A;  5GAM d;  3JAM E;  1IHW A;  3QYB A;  2M02 A;  3WVD B;  1PC0 A;  2ZZD B;  3RKY A;  1VQP A;  3VYG A;  1B34 B;  4XTV A;  5L23 A;  1HSQ A;  2JMA A;  4B9X A;  2IN3 A;  1VQ9 Q;  3A8M B;  3PVL A;  2RHX A;  2LJ0 A;  4HCK A;  1ZSZ A;  4C92 D;  5HK3 A;  1BI0 A;  3Q1J A;  3MCA B;  3M57 A;  2RHI A;  3NPF A;  2J6K A;  1D3U B;  1W70 A;  2DXC B;  3EH2 A;  3QYG B;  5GAN f;  2AZS A;  3JRZ A;  5LQF B;  1H24 B;  4M7D F;  4PJO A;  4M4Z A;  3TU4 K;  1H64 1;  2PU9 B;  5LL6 S;  1AWW A;  1IGU A;  2W96 A;  4Q5W A;  3BHT B;  1JSU B;  2DL4 A;  4Z6Y A;  3EG1 A;  1WZO A;  1RAG B;  4EOS B;  1K73 R;  1W2B S;  2FHD A;  2PVO B;  4FSS A;  2GCX A;  5GAN 8;  5D6Y A;  2X3W D;  3L2U A;  3HB9 A;  3BG9 A;  5CKD A;  1G5V A;  2ESW A;  1K73 U;  1OIU B;  4BDZ A;  4EOR B;  4JUV A;  2OTL Q;  1G2B A;  3CCM A;  1JJ2 S;  4GBQ A;  1X6G A;  1OU9 A;  5CKF A;  2J6O A;  1RAI B;  4BD3 A;  4PJO F;  2KAF A;  3VV0 A;  4Y72 B;  3VUZ A;  2KEA A;  3H8Z A;  4XTW A;  3ME9 A;  4M75 A;  1UG1 A;  3GIB A;  2HL5 C;  4KRT A;  2LMJ A;  2KY9 A;  1OKW B;  4AKG A;  1N4M A;  2DF6 A;  4C0D B;  3QWL A;  3CPW A;  1XO2 A;  3NTK A;  4QQG A;  3JCM W;  3I56 T;  1NEG A;  2QQS A;  4JZ3 A;  4M78 A;  5LJ5 g;  1TWB A;  1JST B;  4J6Y A;  2J05 A;  2AHJ B;  3JCM e;  1JXO A;  2ZPE B;  3O5Z A;  1H28 B;  1XQH A;  5DM7 R;  1SF9 A;  4BCF B;  2ZAE A;  1WPY A;  5HBE B;  4BB7 A;  5GAO n;  2QEX Q;  4XU3 A;  1PSE A;  2LCS A;  2JUF A;  3HO8 A;  1PD0 A;  2QAS A;  4FU6 A;  4C0F A;  5DQV A;  4BCN B;  1OEB A;  2YUQ A;  2KYB A;  4HNT A;  4F7U A;  2K2M A;  3E19 A;  4M75 F;  2LDM A;  2YXY A;  2WIP B;  2HL3 A;  2QA4 Q;  1JEG A;  2KXD A;  3M9Q A;  1RAC B;  2RK2 A;  1UE9 A;  2RJC A;  3G6E Q;  5I2S A;  2CSI A;  2M51 A;  4HXJ A;  2LJ3 A;  4QQ6 A;  3SWN A;  4M78 F;  5GAN e;  2JW4 A;  4HT9 A;  1VYU A;  1VQ5 T;  2KNB B;  4O6J A;  2SEM A;  1X69 A;  4ZN3 A;  3M55 A;  4ANJ A;  4BCO B;  2UZE B;  3MET A;  3JCM b;  2IW9 B;  1H3H A;  1M90 C;  5FU6 B;  2QQ8 A;  2XK0 A;  3MP1 A;  3M5A A;  4BCQ B;  3OYC A;  4BCP B;  4DOW A;  4F7U F;  4JRQ A;  4HL4 A;  1XNI A;  2CGH A;  3TSZ A;  4MFD A;  1NJI C;  1UJY A;  2LT1 A;  1D0X A;  3UDC A;  3O8V A;  4R55 A;  2PQW A;  4D8K A;  1Y96 B;  3H0H A;  2H3J A;  3VS5 A;  2BE9 B;  2CJM B;  1QCO A;  1BYM A;  3VKG A;  3QBY A;  2YDL A;  4L59 A;  3WXM B;  5GAM g;  1GFC A;  2QQA A;  3VS6 A;  1M1K C;  1PM3 A;  1N9S A;  2KK4 A;  5DY9 A;  4C8Q G;  2C0T A;  3ZL7 C;  2L8D A;  5LJ3 h;  3JB9 F;  3M4Y A;  2W9F A;  1MMN A;  3H4C A;  3FC3 A;  3M53 A;  1PHT A;  2CH4 W;  4C92 B;  4A4K A;  2HEQ A;  2W9Z A;  4PLI A;  1RAB B;  1Q7Y R;  1AVZ C;  2FPD A;  4PFZ A;  3BLR B;  3E1S A;  2V8K A;  2K3Y A;  1PKD B;  4C8Q D;  2YWW A;  1BI3 A;  4BBR M;  3FB9 A;  4M7D B;  1Q7Y U;  2KRS A;  5FRM A;  4BI4 A;  4ZGE B;  2DIQ A;  2HCK A;  3I9Q A;  4YOO A;  3GTM S;  4QSH A;  3QPH A;  2O88 A;  2ZPG B;  2VV5 A;  4PJJ A;  4XTX A;  1M9S A;  3LWH A;  1YJ9 T;  2E65 A;  2R5A A;  3NDQ A;  2X4X A;  4AT1 B;  1BKB A;  3I56 Q;  2RD1 A;  4XU0 A;  4KUI A;  3JCM d;  3J80 E;  4J8O A;  3EOC B;  4WCI A;  3CCS Q;  4KBM B;  1GCQ A;  3UAT A;  1AEY A;  1Q82 R;  1X6B A;  5GAO r;  3M0R A;  3CCL T;  2CCH B;  4FSX A;  2L3Q A;  2JTE A;  4X9D A;  1GFD A;  3PTA A;  1BB9 A;  1W2B A;  4HCB A;  1B7T A;  2KGT A;  4M7A D;  4PJN A;  1KFZ A;  1ZLM A;  3I5R A;  4M7A F;  3CC2 Q;  2LX7 A;  1M30 A;  3DLL A;  2K5L A;  1HK9 A;  1HJD A;  4E2F B;  3DTO A;  4BXX X;  1NM7 A;  1MMD A;  4MFE A;  2EAY A;  4AMC A;  1JJ2 A;  1BBZ A;  1VQ5 Q;  3CCJ A;  2E5K A;  1M8V A;  5LJ3 f;  1N5Z A;  1PWT A;  1VIE A;  2E6N A;  4MMK A;  5IHY A;  1DJ7 B;  3TW7 A;  2JMC A;  3DDP B;  1QCN A;  2DRM A;  2K3X A;  1OX9 A;  4EMK B;  5GAN 7;  5FRO A;  4Y28 E;  4EMH A;  1YWO A;  2YRV A;  3FJ5 A;  1NG2 A;  4M75 B;  3MO8 A;  2RNA A;  1X01 A;  2RO0 A;  4RTU A;  1VQ4 T;  3BLH B;  1OX8 A;  4F16 A;  1VQ6 T;  1SRM A;  2K6D A;  1PSF A;  4PNO A;  3L2Z A;  2DL3 A;  3GBQ A;  4II1 A;  5KYW A;  2LC4 A;  2E10 A;  1G3N C;  2K4Y A;  2H8H A;  2OI3 A;  4PLL A;  4XQ3 A;  3LH0 A;  3G4S T;  1H3Z A;  2AKL A;  3INZ A;  1BK2 A;  2LP5 A;  3M56 A;  1TUC A;  2X3X D;  6AT1 B;  1ABO A;  1WJS A;  5A0D A;  4TVR A;  2BS4 A;  3M0T A;  4BAC A;  3MEW A;  4RTY A;  1QWE A;  5LJ5 j;  1M27 C;  5CVI A;  2P0Q A;  2O31 A;  1EFN A;  2ZGW A;  3EGX A;  3JB9 J;  2QK0 A;  5KYN A;  3LQ5 B;  4JLI A;  2CS7 A;  4D6W A;  2DD4 A;  4PK4 A;  2QQ9 A;  3CQT A;  3M0S A;  1YJN A;  4AFU C;  1VQK A;  2KDS A;  1UHC A;  5EJC A;  2CP6 A;  1P92 A;  1WJQ A;  4A4G A;  5GMK m;  3DKM A;  3CCV A;  4C92 C;  4BCH B;  4FW1 A;  2F2W A;  1P5E B;  1BIB A;  4IUR A;  5GAN 5;  1YIT A;  1WXB A;  4OGC A;  4BCG B;  4Z88 A;  1KQ1 A;  2AT1 B;  2JN0 A;  3EG0 A;  3JSC A;  4XTU A;  3P8H A;  1U8R A;  2E6Z A;  1X2K A;  3MHX A;  3HRU A;  3TRE A;  3TNW B;  4YC3 B;  4LD6 A;  3A5Z B;  2F2V A;  3J81 E;  2DX1 A;  2XDB A;  1S72 T;  2EBP A;  3CC7 A;  2GQV A;  2BZ8 A;  4L5G A;  2ZZD A;  4C8Q B;  1VQN A;  1B34 A;  1VQ7 T;  1V29 B;  2LCC A;  3PMI A;  3CC4 T;  4KRC B;  5ACB A;  3FIF A;  5I22 A;  3CCL Q;  4BY7 X;  2RI5 A;  3ASK A;  4MDW A;  1VIF A;  5M9O A;  4A54 A;  2DXC A;  1QVF P;  3CBP A;  3JCM g;  2ED1 A;  2RQV A;  3E2U A;  2MK5 A;  2RF0 A;  4LNP A;  3PT9 A;  2LX9 A;  1OQK A;  1OU8 A;  2DTO A;  5GAM j;  1MMG A;  2CH4 A;  1HYO A;  3DL1 A;  1N27 A;  2B9R A;  2BS2 A;  4FYY B;  1I0C A;  3VS0 A;  1X27 A;  1JU5 C;  4EOM B;  1WHL A;  2FPE A;  2MF2 A;  3VS7 A;  5DLO A;  4NL3 A;  3CCE A;  5CYI B;  2CP3 A;  2D0N A;  4AG2 C;  3CME T;  1M90 R;  2V8I A;  1VQO A;  5I5Z B;  2EYX A;  1ZX6 A;  1IO6 A;  4JRI A;  4BE0 A;  4ZGD B;  3SD4 A;  1WXT A;  1M90 U;  5I2M A;  1YWP A;  1V1C A;  3VYH B;  2ROL A;  2YSQ A;  4EON B;  4NL2 A;  4M7A B;  5GAN g;  1VQL T;  3M4G A;  4RUG A;  1NJI R;  2OTJ Q;  2CCI B;  2WSC E;  3OYG A;  1VQ6 Q;  2FVU A;  3A8H B;  1FIN B;  1FXX A;  1X43 A;  4BE1 A;  4R56 A;  4LD9 K;  4CC4 B;  1NJI U;  4LXC A;  2RA2 A;  2CDT A;  1LPL A;  3G4S Q;  3OBY A;  4PJL A;  2X9H A;  4KRD B;  1JOW A;  2O01 E;  1UJ0 A;  4A4E A;  1M1K R;  2D6F A;  3L2W A;  1UFF A;  1KHI A;  3F70 A;  1SRL A;  2FRY A;  1QVG S;  4ELY C;  3HTR A;  4LUD A;  2EJ9 A;  5GMK j;  1U06 A;  2BTT A;  2CP5 A;  1M1K U;  5IXB A;  3CCJ Q;  1E9H B;  4J6W A;  4QT7 A;  2YLB A;  4KUL A;  1AZE A;  1WHM A;  2LQK A;  1OOT A;  2KYM A;  3M0Q A;  4CFX B;  3PMT A;  1XJW B;  4LDW A;  1VOM A;  2DD5 B;  3UA6 A;  1WXU A;  1H4L D;  2KT8 A;  3L2V A;  2DBK A;  3TVT A;  2RJF A;  4E6R A;  3E9G A;  3SB2 A;  3HPW A;  2F5K A;  2GFU A;  3PE0 A;  4DOV A;  1K8A C;  1BCM A;  2FPF A;  4JJC A;  3JCM X;  2MAM A;  2JNG A;  3PVQ A;  1D1B A;  5L2W B;  2LNV A;  2DA9 A;  2RI3 A;  2YLC A;  2OTL T;  5IF1 B;  2BZY A;  2Z0W A;  5LJ5 d;  3CXC P;  1D3B A;  3BE3 A;  2K2V A;  3EHR A;  1NLO C;  4M77 E;  2UZL B;  1S72 Q;  5FLX E;  2DL5 A;  1PD1 A;  2KT1 A;  2KMG A;  2K5F A;  2QGF B;  4ELJ A;  1OPK A;  1OGU B;  4PKC C;  3QZ5 B;  2YT6 A;  3AT1 B;  2DJQ A;  2DAQ A;  3PIP A;  4OGE A;  2XDD A;  3CC4 Q;  2RQW A;  1KXU A;  4ROC A;  1EZZ B;  3CMA A;  3OY9 A;  4F6W B;  1I81 A;  1WHJ A;  2COY A;  4C8Q C;  2G6F X;  3S3M A;  2W2H A;  2DO3 A;  3VUB A;  1N6A A;  2A08 A;  5C6S A;  4EOK B;  1AT1 B;  3CD6 T;  1V76 A;  2LT4 A;  1Q82 C;  2OX7 A;  4OMM A;  3CCQ T;  2A36 A;  1ABQ A;  2HSE B;  3X20 B;  2D0Q B;  2JXB A;  4BCM D;  3CME Q;  2O9V A;  4LDU A;  4CRL B;  2QA4 T;  1RAE B;  2FYK A;  1LCK A;  4C92 A;  1M8M A;  1UGS B;  1VQ8 Q;  2JS2 A;  3CCU A;  3MIA B;  5HVY B;  5A2Q E;  1NPR A;  2EWN A;  1KQS S;  4IIM A;  2MPX C;  2J06 A;  2XID A;  2Y90 A;  3QYE A;  5C0M A;  5I21 A;  4J9H A;  1WJR A;  2EKH A;  1FVV B;  2W10 A;  3KBG A;  3OSV A;  4ROD A;  2FEI A;  5GAN 6;  3SHW A;  3NMZ C;  4FYX B;  2BKZ B;  2ABL A;  5FW9 A;  3EFS A;  5GAN 4;  4E7H A;  3RGF B;  3SDZ A;  1M1F A;  1SPK A;  2EQM A;  4QVZ A;  2VXE A;  2RHY A;  2BS3 A;  4C92 F;  1JO8 A;  4EOI B;  2M9U A;  3OS0 A;  2WPA B;  2FB7 A;  2NYS A;  3HZJ A;  4G6L B;  3MJX A;  2E3I A;  2GNC A;  4AKI A;  1G8X A;  3QZ9 B;  2CT3 A;  1MUZ A;  2RHZ A;  4FL6 A;  3EJ1 B;  4RTW A;  1YBY A;  1GCP A;  3M0U A;  3OYJ A;  2OAW A;  1CKB A;  2QDL A;  3FJP A;  7AT1 B;  4CFU D;  1YI2 A;  3H0F A;  2M0O A;  4E7K A;  2IIM A;  4J9C A;  3OYN A;  3BFM A;  3EHQ A;  2DET A;  2DJZ A;  3DOG B;  2MIO A;  4BY1 X;  2F1L A;  3OS5 A;  3H0I A;  1SHF A;  1UEC A;  1VA7 A;  4EMK A;  4IUU A;  2WFY B;  3KUF A;  2BE7 D;  5FRN A;  1OKV B;  1KHC A;  2FRW A;  2XDP A;  2QXF A;  5GAN j;  3DDQ B;  3B57 A;  3UT1 A;  1TG0 A;  1QVG A;  5ECA A;  3V7S A;  3EFO B;  3DLM A;  4JLG A;  1I4K 1;  2DEQ A;  3RBB B;  3CCS T;  5LJ3 g;  1MV0 B;  4GLM A;  8AT1 B;  4KH1 B;  4IUQ A;  3REA B;  3RDV A;  3CD6 Q;  2L3S A;  2C6T B;  3CCQ Q;  4FM4 B;  4BI8 B;  4PJM A;  2OJ2 A;  1G83 A;  4XAX B;  2CT4 A;  3CPW P;  1YIJ Q;  2LCL A;  2DYB A;  5FGK B;  1TU0 B;  4X9C A;  1NEB A;  2I53 A;  3CC2 T;  2RMO A;  2EYZ A;  4DEX A;  1RLP C;  1G3T A;  2DME A;  4IKF A;  2DER A;  2RQU A;  1A0N B;  3QYH B;  2A28 A;  1O9S A;  1BIA A;  3HRS A;  2C5V B;  1PRL C;  5CIU A;  5D7U A;  4PJO E;  4JJN K;  1D3B B;  2JZ2 A;  3LGL A;  1FMK A;  1T3L A;  2MWP A;  2HKQ B;  4C5E A;  2EYY A;  3L1A A;  4RCC A;  3CEY A;  1SHG A;  1UGR B;  2KSS A;  2HBP A;  4BCM B;  3G71 A;  2AZV A;  3ULR B;  4JJD A;  4QVD A;  1ZUK A;  1FX7 A;  1TD6 A;  1RAH B;  5KYU B;  3AHU A;  3QII A;  3QWY A;  4LUE A;  2IG0 A;  2DKG A;  4YOS A;  4C8Q A;  4EC8 B;  1ZA2 B;  3BDL A;  5GAN 2;  4MML A;  2QAZ A;  5D6W A;  1VYW B;  2ZPH B;  2I0N A;  1B07 A;  2DE0 X;  3MP8 A;  1GXI E;  3JV3 A;  4MZT A;  3VKH A;  2A3L A;  4ELZ C;  2EW3 A;  1R0B G;  1GY3 B;  2P4R A;  1K8A R;  4JRK A;  3P8B B;  3LH5 A;  1M1G A;  1M3C A;  3I55 Q;  2P0K A;  4F7L B;  2WXV B;  1YJ9 A;  1G3S A;  3A8O B;  2C5O B;  2V1Q A;  3MKD A;  5IHN A;  1K8A U;  1FWZ A;  1KQS A;  4M78 E;  1I5O B;  1H1R B;  5LJ5 h;  2ZPF B;  3BLQ B;  3EAE A;  5DQW A;  1VQP Q;  4C8Q F;  1R8O B;  5IH2 A;  3X25 B;  3TEE A;  1VQM A;  1HXD A;  1WGS A;  2ZPI B;  3JCM V;  4QVC A;  4BCK B;  4EC9 B;  5AYF A;  1MMA A;  3V8K A;  2XKO C;  1QLY A;  1TTH B;  2KR6 A;  4F7U E;  5GAN 3;  4M7A A;  3VS3 A;  1C0M A;  1KQ2 A;  1PG5 B;  2WAC A;  1E6H A;  1Q86 C;  1WQ7 A;  4CFU B;  4Y91 A;  3RNJ A;  1OZ2 A;  5CEI B;  2RQR A;  3M0P A;  4N0A C;  2V26 A;  2NWM A;  4OML A;  2GBQ A;  2KR3 A;  1UB4 A;  2NUT A;  1M3B A;  4JS4 A;  2QI2 A;  3BY7 A;  1VIN A;  1Q82 U;  5IHK A;  2FO0 A;  3OA6 A;  4HKE A;  1Q95 G;  3CCM Q;  1YHQ A;  4RG8 A;  2E1H A;  1M3A A;  4PFP A;  1YCY A;  1VQ4 A;  4VUB A;  2DXU A;  5GAN d;  2DD5 A;  3HSB A;  5CCA A;  4BY6 B;  4L6V 5;  1LOJ A;  2VYT A;  4RMO A;  2CZ6 B;  1UGV A;  1K0X A;  4FT2 A;  2SRC A;  1OIY B;  3FLG A;  5GAM h;  1W2B P;  5FU7 C;  2QDJ A;  5KYX B;  1KC8 C;  5CKB A;  4OMF B;  4LDY A;  1VYV A;  4X34 A;  4JPB W;  4FCY A;  4RG2 A;  3D7S B;  4ROE A;  4FIB A;  2O9S A;  2L3R A;  4J9F A;  3OYE A;  2OTJ T;  4ATO A;  4KGX B;  5KE2 A;  1KD1 C;  2D8H A;  1JJ2 P;  1U1S A;  2LQW A;  2GTO A;  2KRO A;  1K0S A;  2WMA B;  2QFZ A;  2DVJ A;  1I5L A;  3BW1 A;  4IUP A;  1SKU B;  3BDU A;  1YJW A;  3QUI A;  3DJB A;  3X26 B;  5HCK A;  2QF7 A;  4LOC A;  3QDF A;  2GQI A;  2O4X A;  3CCJ T;  3HP9 A;  3HL8 A;  2CZ7 B;  4BCJ B;  3JCM P;  3OW2 S;  1H26 B;  4J9B A;  2RI2 A;  1ZSG A;  2L3P A;  2UZB B;  2QDY B;  2H3E B;  3RR6 A;  5GMK h;  2WSE E;  1CKA A;  4HT8 A;  1AD6 A;  2CZ1 B;  2R5M A;  2L89 A;  2WMB B;  2DEU A;  4KGV B;  1ACM B;  4FYV B;  1VQ7 A;  5J26 A;  2IPO B;  4EMG A;  3A8L B;  1RI9 A;  2QGS A;  2HDA A;  3M03 A;  4FT4 A;  2A7Y A;  3CCR A;  2A0F B;  5IAY A;  4LN2 A;  2NUZ A;  2FL7 A;  2K79 A;  2LTO A;  2ZPB B;  1QMC A;  4CC3 A;  5LJ3 e;  1H1P B;  1TOV A;  1XTD A;  2YUN A;  2QG9 B;  1FKM A;  3F5X B;  3MP6 A;  4F6S B;  4CXA B;  1GH6 B;  2PUO B;  1K9M R;  2C5N B;  5IHI A;  2HZY A;  4BBS M;  2R57 A;  4OB3 B;  4AI6 A;  2FG0 A;  2CP7 A;  1F1B B;  1YJN T;  1H92 A;  2G3R A;  4OMQ A;  1ZBJ A;  5D6X A;  1VQK T;  2PK9 B;  2HBW A;  1R77 A;  1VQL A;  3CCV T;  2RPN A;  4N4H A;  4M6V A;  1YIT T;  1WDX A;  3EFR A;  4HVU A;  4CRI A;  2UZD B;  1QMZ B;  4DQ2 A;  1D1A A;  5IXF A;  1H25 B;  1K9A A;  1E7O A;  4F04 B;  2DLP A;  2P4T A;  4JZ4 A;  4DA4 A;  1K1Z A;  1VQ8 T;  4BY6 C;  1VQ9 A;  1FMW A;  1W4S A;  2M0Y A;  1IHV A;  1E7P A;  1D0Y A;  5HNB B;  1AHJ B;  2IVX A;  4NS5 A;  1D09 B;  3S3O A;  2GGR A;  2KI7 A;  2K9G A;  4D8D A;  4DEY A;  3M54 A;  4M77 G;  4OVA A;  3EG3 A;  1E6G A;  1UEB A;  2E64 A;  3CPF A;  4TTH A;  3N5B B;  3RMQ A;  4N0A A;  2LRQ A;  3BG5 A;  1BU2 A;  2NUT B;  2EJF A;  3EFO A;  1MGQ A;  4JX5 A;  3R6O A;  1I07 A;  4M77 D;  1TH7 A;  4A53 A;  3BHU B;  3V7R A;  2KVQ G;  2XI9 A;  4ME7 A;  4RCB A;  4XU2 A;  3V7C A;  3UA7 A;  2RB6 A;  3CCE T;  5CK9 A;  1U5S A;  2RQT A;  2JT4 A;  2OTL A;  1Y71 A;  3EG9 B;  3QHR B;  1VYT A;  3FDR A;  2IW8 B;  5EC7 A;  2DIG A;  2E12 A;  1T0H A;  3OYM A;  2YUP A;  3ZFJ A;  4A4H A;  5KH6 A;  1UNG D;  1IB8 A;  1QCF A;  2COZ A;  3P8D A;  1ZUU A;  3G1J A;  5KCO A;  4AG1 C;  3JCM Q;  3SEM A;  2DK3 A;  1T0J A;  1YNZ A;  4CI0 C;  2EQU A;  3MEV A;  3FEO A;  2GTJ A;  1Q86 R;  1GUX B;  3JCM h;  2PJQ A;  2DTH A;  2XU8 A;  4MIM A;  2EGA A;  2D1X A;  3POM A;  3M59 A;  3TW6 A;  1Q86 U;  3OYH A;  5LJ3 d;  3RUX A;  2QEX A;  2DRK A;  1MV3 A;  3SWN C;  4ESR A;  2LQ8 A;  5CR2 A;  2HKN A;  3EGU A;  3BG3 A;  5LMK B;  5J3B A;  1I1J A;  2V1R A;  4J9E A;  5KYU A;  2QA4 A;  1YJN Q;  4NC6 A;  5I11 A;  1VQK Q;  3C4S A;  2EIF A;  2E3H A;  3OW2 A;  4J9D A;  3G6E A;  4Z02 A;  4E7J A;  2O4X B;  1AWJ A;  3CCV Q;  2XD0 A;  4IMY B;  1W6X A;  1YIT Q;  2FZC B;  2M1H A;  5KYY B;  1G3Y A;  1NYG A;  4RTT A;  4F7S B;  1M2V B;  2XHC A;  1IZ6 A;  1LJO A;  2QQB A;  2EUF A;  1F5Q B;  1YIJ T;  2W99 A;  4BDY A;  4DBH A;  1U1T A;  1OL2 B;  3LWI A;  2AIR B;  1KC8 R;  2K5I A;  1XOV A;  3CC7 Q;  3OYD A;  3MY5 B;  1AIS B;  3A8G B;  5HBJ B;  1VQN Q;  1T3S A;  1KC8 U;  2B8A A;  1KD1 R;  2RJD A;  1O9K B;  1NPP A;  2WSF E;  5DLQ E;  3CMA T;  2EPD A;  3ZEH A;  5A0G A; 
#chains in the Genus database with same CATH homology
 2JOY A;  1KD1 U;  4J5Y A;  2R58 A;  4EMK B;  2MWP A;  5GAN 7;  5FRO A;  4C5E A;  2OAU A;  4Y28 E;  3L1A A;  4RCC A;  3CEY A;  2VC8 A;  4EMH A;  1UGR B;  5GMK i;  2KSS A;  2YRV A;  3V8L A;  1N8R U;  2HBP A;  3UWN A;  2QQR A;  3OYA A;  5HKC A;  4M75 B;  4O5V A;  3MO8 A;  2HQE A;  1X01 A;  2RO0 A;  3G71 A;  2D9T A;  2MMP A;  1VQ4 T;  4LDX A;  1VQ6 T;  2EQJ A;  1PSF A;  4EMK C;  2DPP B;  1RL2 A;  2LVM A;  1FX7 A;  4JDS A;  4PNO A;  3L2Z A;  3QHS A;  4QVD A;  3AHU A;  1WNL A;  3MEU A;  3QII A;  4M77 F;  1UGQ B;  4II1 A;  2LC4 A;  2NLU A;  2IG0 A;  2DKG A;  2E10 A;  2K4Y A;  5EG2 A;  4E7L A;  4N4I A;  4M75 C;  4OB1 B;  4C8Q A;  4PLL A;  4XQ3 A;  3LH0 A;  3G4S T;  4M7D G;  3BDL A;  5GAN 2;  3PIO A;  1H3Z A;  4MML A;  3INZ A;  2XIC A;  5D6W A;  3OYL A;  5GAM e;  3G7Z A;  2C06 A;  2ZPH B;  3M56 A;  1VQO T;  3OYY A;  1WJS A;  3OMG A;  4TVR A;  5A0D A;  4C5I A;  2BS4 A;  3MP8 A;  3CCU T;  2RM4 A;  4BAC A;  3MEW A;  4HLQ A;  3RES A;  3OYF A;  1VQ9 T;  1GXI E;  2DXB B;  4MZT A;  4M78 C;  3VKH A;  2A3L A;  3VJP A;  4ELZ C;  3CPW S;  5LJ5 j;  2F69 A;  5CVI A;  3WVE B;  2P0Q A;  4J6X A;  4JS5 A;  5CQX A;  2ZGW A;  4GY5 A;  3VU3 C;  3JB9 J;  4P5N A;  4JRK A;  3P8B B;  4V2S A;  1M1G A;  3GPL A;  3C94 A;  2K57 A;  4M7D D;  4PL6 A;  3JB9 I;  2P0K A;  4JLI A;  3I55 T;  1YJ9 A;  2CS7 A;  2RH2 A;  1G3S A;  2DD4 A;  3A8O B;  4D6W A;  2QQ9 A;  1K8A U;  1FWZ A;  2GF7 A;  3LW5 E;  4M78 E;  3CXC A;  1KQS A;  2WJ9 A;  1YJN A;  4M77 B;  3I56 A;  5LJ5 h;  2ZPF B;  3EAE A;  3OS1 A;  3GNF B;  3JCM J;  1VQK A;  1O75 A;  4UC4 A;  2KDS A;  1VQP T;  5EJC A;  4C8Q F;  1R8O B;  2CZ0 B;  1P92 A;  2P0P A;  4PJO G;  3X25 B;  4OP0 A;  3TEE A;  1VQM A;  1QVP A;  1HXD A;  1WGS A;  1WJQ A;  4A4G A;  1NE8 A;  3DKM A;  5CKE A;  2ZPI B;  3JCM V;  4C92 C;  4QVC A;  5GMK m;  3CCV A;  1JRI A;  5GAO l;  5AYF A;  1BIB A;  4IUR A;  3GNG A;  3KHI A;  3T9N A;  5GAN 5;  3V8K A;  4OGC A;  1YIT A;  2XKO C;  1I5L A;  3CCQ A;  1MHN A;  1VUB A;  2KR6 A;  1KQ1 A;  2JN0 A;  3JSC A;  2Y4X A;  4XTU A;  3E9F A;  2I2L A;  4F7U E;  5GAN 3;  1KQ2 A;  4M7A A;  2WAC A;  3P8H A;  4GLK A;  1U8R A;  1Q7Y C;  2E6Z A;  3OS2 A;  3H6Z A;  4IUT A;  3MHX A;  1YIJ A;  3HRU A;  3TRE A;  1Q86 C;  1WQ7 A;  3C12 A;  4XTZ A;  1IRE B;  3OSS C;  4LD6 A;  4Y91 A;  2RK1 A;  3A5Z B;  3ZBD A;  4C92 E;  4J7F A;  3CC2 A;  3J81 E;  4PJO D;  1BI2 A;  1OZ2 A;  2DZ9 A;  3V8J A;  3NFC A;  5GMK e;  3QKJ A;  2XDB A;  1S72 T;  2JVV A;  5CQY A;  5GMK l;  4N0A C;  3CC7 A;  2GQV A;  5GAN h;  2HNI A;  3CBM A;  4M7D E;  4L5G A;  2GFA A;  2ZZD A;  1UB4 A;  4NOY A;  4C8Q B;  1VQN A;  1B34 A;  4KT0 E;  1VQ7 T;  2E5Q A;  1VQ5 A;  1V29 B;  4JX6 A;  2CYZ B;  1Y07 A;  2LCC A;  2RHU A;  3PMI A;  3JCM c;  3L2Q A;  1YI2 T;  3CC4 T;  4C5H A;  4XTY A;  3FIF A;  4QW2 A;  1Q81 U;  1OZ3 A;  2QI2 A;  4JS4 A;  2RI5 A;  1WQW A;  3ASK A;  4MDW A;  1VIF A;  1K9M C;  3BY7 A;  5M9O A;  1Y96 A;  1Q82 U;  4A54 A;  4M75 G;  2DXC A;  2X4J A;  2XG8 D;  3OA6 A;  4HKE A;  2F5T X;  3CBP A;  3CCM T;  4HCC A;  3QSU A;  3JCM g;  1YHQ A;  4KUD K;  4J7I A;  4RG8 A;  2E1H A;  2QTX A;  5CO7 A;  3HKS A;  3PT9 A;  2DZC A;  2LX9 A;  3PNW C;  2DTO A;  4AKH A;  2KMT A;  3C95 A;  4OF1 A;  2X4Y A;  1YCY A;  4BUG A;  5GAM j;  4VUB A;  2DXU A;  4A4F A;  1VQ4 A;  3RER A;  4OB0 B;  2M16 A;  4M78 G;  2DD4 B;  2DD5 A;  3DL1 A;  5FU7 B;  1N27 A;  5GAN d;  2QEX T;  3M58 A;  2BS2 A;  3HSB A;  3LYI A;  5GAO q;  5CCA A;  4BY6 B;  4L6V 5;  1LOJ A;  2VYT A;  3HFO A;  4M75 D;  2MF2 A;  2MWO A;  5DLO A;  4RMO A;  4NL3 A;  3CCE A;  4LDV A;  2CZ6 B;  4HNV A;  4FT2 A;  3CME T;  3FLG A;  4IUV A;  5GAM h;  2DVE A;  2V8I A;  1VQO A;  5FU7 C;  1X75 C;  3OMC A;  4JRI A;  1M5Q 1;  4BE0 A;  2QDJ A;  4ZGD B;  3OYB A;  4MZM A;  5L8R E;  3SD4 A;  3L2R A;  4F7U G;  1KC8 C;  1QP3 A;  3GP8 A;  3G6E T;  2PVD B;  4M78 D;  4OMF B;  5CKB A;  4LDY A;  4E7I A;  5I2M A;  1M90 U;  2KQW A;  1RI0 A;  4X34 A;  3VYH B;  4XU1 A;  4NL2 A;  4RG2 A;  4YTL A;  4M7A B;  4ZN1 A;  5GAN g;  2L5Q A;  4FIB A;  3JCM f;  3M4G A;  1VQL T;  2L3R A;  3LX7 A;  3OYE A;  2WSC E;  3OYG A;  4C92 G;  4ATO A;  3HBL A;  4M7D A;  1Y7X A;  2OTJ T;  5KE2 A;  3SFM A;  1KD1 C;  2FVU A;  3A8H B;  2JTF A;  5KE3 A;  1FXX A;  3I55 A;  1U1S A;  2PUK B;  3OYI A;  4BE1 A;  4R56 A;  1QP2 A;  4LD9 K;  1NJI U;  1BI1 A;  1N8R C;  2RA2 A;  3DB4 A;  2VGN A;  3OBY A;  4M7A C;  2YHT A;  3TCJ A;  5GAM d;  3JAM E;  2QFZ A;  3QYB A;  3WVD B;  2ZZD B;  3RKY A;  1VQP A;  3BW1 A;  3VYG A;  1B34 B;  2O01 E;  4XTV A;  5HY6 A;  4A4E A;  4B9X A;  2EKO A;  3L2W A;  2D6F A;  4IUP A;  2DXT A;  3A8M B;  1KHI A;  3F70 A;  3QDR B;  3BDU A;  2RHX A;  2CKK A;  1YJW A;  3QUI A;  1QLB A;  4C92 D;  1QVG S;  4ELY C;  5HK3 A;  3JB9 G;  1BI0 A;  3Q1J A;  3MCA B;  3M57 A;  1QVF S;  2EJ9 A;  3X26 B;  4M75 E;  5GMK j;  2QF7 A;  2RHI A;  4LOC A;  1M1K U;  3CBO A;  4HNU A;  4J83 A;  2DXC B;  2O4X A;  3CCJ T;  3QYG B;  3HP9 A;  3HL8 A;  4J6W A;  2CZ7 B;  5GAN f;  2YLB A;  4KUL A;  4ZTF A;  3JRZ A;  3JCM P;  2LQK A;  3OW2 S;  3S6W A;  4M7D F;  4PJO A;  2RI2 A;  3GF5 A;  3PMT A;  5A0L A;  2JTM A;  4LDW A;  3TU4 K;  1H64 1;  2PU9 B;  2QDY B;  2DD5 B;  5LL6 S;  5GMK h;  4Q5W A;  3X24 B;  3L2V A;  3NTI A;  2WSE E;  4HT8 A;  3JB9 D;  4Z6Y A;  2RJF A;  2CZ1 B;  2R5M A;  2L89 A;  3E9G A;  3G71 T;  3X28 B;  1W2B S;  3SB2 A;  2FHD A;  2PVO B;  3HPW A;  2F5K A;  2GCX A;  2GFU A;  3NTH A;  5D6Y A;  5J26 A;  4DOV A;  5GAN 8;  1K8A C;  1VQ7 A;  3JCM X;  2MAM A;  4EMG A;  3HFN A;  4M77 C;  5KCH A;  3HB9 A;  3BG9 A;  3L2U A;  3A8L B;  2JNG A;  5CKD A;  3CCL A;  2EYQ A;  2ZCF B;  1G5V A;  1K73 U;  3CCS A;  4FT4 A;  3OB9 A;  2A7Y A;  2LNV A;  2RI3 A;  3GLX A;  4BDZ A;  4HCZ A;  3CCR A;  3OQ5 A;  2YLC A;  4JUV A;  2OTL T;  3CCM A;  5LJ5 d;  1JJ2 S;  1D3B A;  5IAY A;  1ZHI A;  2BKD N;  5CKF A;  2K2V A;  4BD3 A;  4M77 E;  1ZQ1 A;  4PJO F;  3S3N A;  2X4W A;  4XK8 E;  2KAF A;  5FLX E;  2VGM A;  3VV0 A;  2FL7 A;  2LTO A;  3KXT A;  2ZPB B;  2KMG A;  3VUZ A;  3VKI A;  2MI6 A;  2K5F A;  3H8Z A;  4XTW A;  3ME9 A;  5LJ3 e;  4ELJ A;  4PKC C;  1XTD A;  3QZ5 B;  4M75 A;  3GIB A;  2DAQ A;  1FKM A;  3PIP A;  4OGE A;  2KY9 A;  1UGP B;  1X6O A;  3MP6 A;  4AKG A;  2XDD A;  2EQK A;  2PUO B;  4C0D B;  3QWL A;  3CPW A;  3VYG B;  3CMA A;  4BBS M;  3OY9 A;  2R57 A;  4E47 A;  4OB3 B;  3NTK A;  4AI6 A;  5CAI A;  1I81 A;  1YJN T;  4QQG A;  3JCM W;  3I56 T;  2QQS A;  2G3R A;  2EFI A;  4M78 A;  5LJ5 g;  3PGG A;  4M7A G;  3ER0 A;  5D6X A;  4J6Y A;  1VQK T;  4C8Q C;  2AHJ B;  4WF2 A;  3JCM e;  2ZPE B;  1OI1 A;  3LGF A;  3S3M A;  5HK0 A;  1XQH A;  2DO3 A;  4C0G A;  3VUB A;  5DM7 R;  4ZTJ A;  1VQM T;  4C0D C;  3QO3 A;  1Q81 C;  1VQL A;  1N6A A;  3CCV T;  5C6S A;  3QJ6 A;  2OTJ A;  1WPY A;  3UPU A;  4N4H A;  1VQ6 A;  4M6V A;  4BB7 A;  5GAO n;  1YIT T;  3CD6 T;  4XU3 A;  3JB9 H;  4PJO B;  1PSE A;  2LT4 A;  1Q82 C;  2JUF A;  3HO8 A;  3EFR A;  2X35 A;  4CRI A;  3CCQ T;  4FU6 A;  4C0F A;  4DQ2 A;  3X20 B;  4C8Q E;  2D0Q B;  4HNT A;  2BIV A;  4F7U A;  3E19 A;  3G4S A;  4M75 F;  2LDM A;  4LDU A;  2HQX A;  2P4T A;  2QA4 T;  2FYK A;  5J39 A;  1EIF A;  4C92 A;  4DA4 A;  1UGS B;  3M9Q A;  3CCU A;  2RK2 A;  1VQ8 T;  4BY6 C;  4EPC A;  5A2Q E;  1VQ9 A;  1W4S A;  2RJC A;  5I2S A;  4QQ6 A;  3SWN A;  5LJ5 f;  1E7P A;  2IVW A;  4M78 F;  5GAN e;  4PJO E;  1NPR A;  4HT9 A;  2EWN A;  1KQS S;  3CXC S;  3DB3 A;  1AHJ B;  1VQ5 T;  2XID A;  2Y90 A;  4NS5 A;  3QYE A;  3S3O A;  5C0M A;  4O6J A;  3M54 A;  5I21 A;  4M77 G;  1WJR A;  4ZN3 A;  4OVA A;  3M55 A;  3KBG A;  3OSV A;  1NZ9 A;  3MET A;  5GAN 6;  3JCM b;  1M90 C;  3QXE B;  5FU6 B;  2QQ8 A;  2XK0 A;  3MP1 A;  1UEB A;  2E64 A;  3CPF A;  3EFS A;  3N5B B;  3URG A;  3RMQ A;  4N0A A;  2LRQ A;  3M5A A;  5GAN 4;  4E7H A;  3OYC A;  3BG5 A;  3PFS A;  1I8F A;  3SDZ A;  1YHQ T;  4DOW A;  2EJF A;  4F7U F;  4JRQ A;  3OYK A;  1MGQ A;  4HL4 A;  1M1F A;  1XNI A;  2CGH A;  4MFD A;  2EQM A;  5IN1 A;  1LNX A;  4JX5 A;  2VXE A;  3MEA A;  3R6O A;  4QVZ A;  1NJI C;  5FU6 C;  4MZP A;  4HA8 A;  2LT1 A;  2BS3 A;  2RHY A;  4C92 F;  3UDC A;  3O8V A;  2M9U A;  2PQW A;  4M77 D;  1TH7 A;  4R55 A;  1Y96 B;  4A53 A;  2H3J A;  3OS0 A;  4M7A E;  2FB7 A;  4M78 B;  3HZJ A;  3HRT A;  3V7R A;  2KVQ G;  2XI9 A;  4ME7 A;  4RCB A;  5LJ3 j;  4XU2 A;  3V7C A;  2V8J A;  2RB6 A;  3CCE T;  3OBW A;  4N4G A;  5CK9 A;  1BYM A;  3VKG A;  1M4Z A;  3QBY A;  2OTL A;  1Y71 A;  4L59 A;  3WXM B;  5GAM g;  4AKI A;  3FDR A;  3QZ9 B;  2QQA A;  1KG1 A;  2DIG A;  2E12 A;  2RHZ A;  4FL6 A;  4RKU E;  1M1K C;  1N9S A;  2KK4 A;  1YBY A;  3QJY A;  5DY9 A;  2E41 A;  4C8Q G;  3OYM A;  1S72 A;  3ZFJ A;  2L8D A;  4A4H A;  3OYJ A;  5LJ3 h;  5KH6 A;  3JB9 F;  3RMS A;  3M4Y A;  4F7U B;  5GAO m;  3FJP A;  3QG1 A;  3H4C A;  3L42 A;  3FC3 A;  3P8D A;  1YI2 A;  2G77 A;  3M53 A;  3CC4 A;  1JBM A;  5KCO A;  3JCM Q;  3FRN A;  2DK3 A;  2M0O A;  4C92 B;  4CI0 C;  4A4K A;  4B9W A;  4E7K A;  2EQU A;  3MEV A;  4PLI A;  3OYN A;  3FEO A;  3BFM A;  1ZBX A;  3SWN B;  2DJZ A;  2V8K A;  3E1S A;  3J7A F;  2K3Y A;  3LLR A;  3OS5 A;  3JCM h;  4C8Q D;  1BI3 A;  2DTH A;  2HD0 A;  2XU8 A;  4BBR M;  3FB9 A;  3CD6 A;  4M7D B;  4MIM A;  1Q7Y U;  3M59 A;  5GAM f;  3TW6 A;  1YJW T;  1Q86 U;  1K73 C;  3OYH A;  4EMK A;  5FRM A;  4IUU A;  4BI4 A;  5LJ3 d;  4ZGE B;  2DIQ A;  3RUX A;  2QEX A;  3KUF A;  1G3W A;  3QPH A;  4QSH A;  3SWN C;  5FRN A;  4MDX A;  2ZPG B;  2LQ8 A;  2VV5 A;  5CR2 A;  1KHC A;  2XDP A;  3BG3 A;  2QXF A;  1M9S A;  4XTX A;  5GAN j;  4M7D C;  3UT1 A;  3LWH A;  1QVG A;  4JRP A;  3V7S A;  2E65 A;  1YJ9 T;  5J3B A;  2R5A A;  4QQD A;  3CME A;  1QVF A;  2BUD A;  2X4X A;  2QA4 A;  1BKB A;  4NC6 A;  1JB0 E;  2RD1 A;  4XU0 A;  3HHT B;  5LJ5 e;  4KUI A;  3JCM d;  3J80 E;  1VQ8 A;  3C4S A;  2VXF A;  3DLM A;  4J8O A;  4JLG A;  2EIF A;  3GOX A;  1K9M U;  3OW2 A;  1I4K 1;  4Z02 A;  3G6E A;  2DEQ A;  4E7J A;  1OYX A;  2O4X B;  4OB2 B;  5LJ3 g;  3CCS T;  4KBM B;  2XD0 A;  2EJG A;  4IUQ A;  3RIR A;  2E70 A;  2M1H A;  1G3Y A;  5GAO r;  2DXB A;  3CCL T;  4FM4 B;  4BI8 B;  2XHC A;  1IZ6 A;  2VUB A;  2PVG B;  3RKX A;  4FSX A;  4X9D A;  1LJO A;  3PTA A;  2QQB A;  1W2B A;  4HCB A;  4XAX B;  4C5G A;  3CCR T;  1YIJ T;  4M7A D;  1SSF A;  5IT9 E;  2LCL A;  3RKW A;  4M7A F;  4X9C A;  3CC2 T;  1N9R A;  4BDY A;  5GAO p;  3DLL A;  4PJO C;  2K5L A;  1HK9 A;  1U1T A;  3LWI A;  1G3T A;  2K5I A;  4IKF A;  4M77 A;  1XOV A;  4MFE A;  2EAY A;  3CC7 T;  3QYH B;  3OYD A;  3A8G B;  2HAX A;  1QW1 A;  2RJE A;  1JJ2 A;  1O9S A;  1BIA A;  4JX4 A;  3HRS A;  4BE2 A;  1VQN T;  1KC8 U;  2B8A A;  5CKH A;  2RJD A;  4BI3 A;  3CCJ A;  1M8V A;  2DTI A;  5LJ3 f;  5CIU A;  4C0Z A;  1NPP A;  4EDU A;  2E6N A;  1VIE A;  1D3B B;  2JZ2 A;  2WSF E;  4MMK A;  5DLQ E;  2Y4Y A;  4JJN K;  4ZGJ B;  1DJ7 B;  3LGL A;  3CMA T;  3TW7 A;  2K3X A;  3ZEH A;  5A0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...