3A8HB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8hB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8hB02
3X24B 2ZPBB 2PUOB 2WSEE 3VYGA 4ZGEB 4OB3B 2WSCE 2ZPHB 1UGSB 4L6V5 2DXCB 3LW5E 1UGPB 2AHJB 2PVOB 2ZPFB 1V29B 3A8HB 2ZZDA 2DD4A 2PVDB 4FM4B 3X20B 4Y28E 3VYGB 2CZ1B 2DXBA 1GXIE 2ZPGB 4OB2B 3QYHB 3A8MB 2PUKB 5L8RE 2DD5A 2CZ6B 2O01E 2ZZDB 2WSFE 2DD4B 2D0QB 3X25B 1QP3A 2ZPIB 3A8LB 3HHTB 2CZ7B 2DXBB 1DJ7B 3QXEB 3WVEB 2DD5B 3A8OB 4ZGJB 2DPPB 3A8GB 2PVGB 4OB1B 3QZ5B 2CYZB 4RKUE 4KT0E 4OB0B 2PU9B 4XK8E 2ZPEB 1IREB 3WVDB 3QYGB 1QP2A 3VYHB 1PSEA 2QDYB 1AHJB 1PSFA 3X28B 3QZ9B 2DXCA 2ZCFB 4ZGDB 3X26B 1JB0E 2CZ0B 1UGRB 1UGQB
chains in the Genus database with same CATH superfamily
2LTOA 4F6UB 4N0AC 1ZUKA 3CBMA 3JSCA 2ZPBB 3VS6A 1ZSZC 3CXCP 3GBQA 2EQMA 4ZN3A 2EQKA 1YHQT 4ZGEB 1W2BA 1JXMA 4BCNB 2K2MA 1MMGA 4ESRA 1WPYA 3EG1A 3G7ZA 2EJFA 4M77B 2EVRA 3M0PA 2RH2A 1JJ2S 2X35A 1PKTA 1K8AC 1HK9A 2XD0A 1URCB 2CP3A 1LOJA 3BDUA 4F7NB 2COWA 2FB7A 2PVDB 1WHLA 1N9SA 3A1PA 1RI0A 2EQUA 2GFAA 4FM4B 2AZSA 4BY6C 2OAWA 2VVKA 3AHUA 1XJWB 4M7DG 4C92A 1NM7A 1ZUUA 1E7PA 2LQNA 2MOXA 4ELJA 2EYWA 1D09B 1KC8C 1VQKT 4EOSB 3EGDA 3THKA 2DL7A 4IUVA 1SSFA 1H4LD 1BCMA 4M77C 4FW1A 2CT3A 4BI8B 1G3YA 2ZPIB 5IXBA 5GMKh 3OS0A 3OYJA 1ZBJA 1Q82C 2HL5C 3SD4A 3G71T 2G9XB 1UJYA 3PGGA 2NUTB 4QSHA 5A0LA 1VQOT 4E7JA 3CCJA 1KD1R 2HL3A 2O31A 2DPPB 1VYTA 1ZBXA 4LE9A 2L3SA 3H0IA 5D7UA 5KH6A 5ICPB 5GAMj 3OYGA 2KNBB 2FO0A 1UDLA 2X4XA 3UF4A 2L0AA 4C8QF 4BCFB 4RODA 4RTTA 2EAYA 2O9SA 3MEVA 1H24B 5CYIB 2BS3A 3JCMW 2PU9B 2NUPB 2YWWA 1QP2A 2HCKA 2L3RA 3MCAB 1SPKA 2FRYA 2LP5A 4HNTA 4EIKA 5CR2A 4LUDA 1VUBA 1AHJB 3H0HA 3OY9A 3JCMd 2QEXT 1C1AA 4M75A 3DKMA 3CMAQ 4JLIA 1M2OA 1ZA2B 2QI2A 1UNHD 4IIOA 3S3MA 4OP0A 5IHKA 1NEBA 2ED1A 1KQSS 5KYXB 2ROTA 2DO3A 4M7AB 4KRCB 2PUOB 2K9GA 1BI0A 4RTYA 3FRNA 2HSPA 2KXDA 4BCND 5CQXA 2ZPHB 2XK0A 1K1ZA 3MI9B 2DYIA 5KYUA 4M77D 2KQWA 1QKXA 4F7LB 2LT1A 5CAIA 2ZPFB 1GCQA 4JJBA 3N5BB 5IXFA 3CCJQ 3NPFA 1M5Q1 2BTTA 3KXTA 4AKGA 3HO8A 2XICA 4Y28E 1YJNT 1GH6B 3ZFJA 2WMBB 1C6VX 1WYXA 2BUDA 4OMLA 1H8KA 4M7AC 3TSZA 2CGHA 4EOLB 3TREA 2HBWA 2P84A 4RCCA 4X9CA 4EMGA 4WCIA 3CCVA 5I2SA 4BCHB 4X9DA 3OYAA 1YI2A 3CC4A 5CCAA 1BIBA 4N4IA 3HHTB 1RAFB 1G2BA 2ABLA 2A37A 4B9XA 4JRKA 3VS5A 2JTMA 2JVVA 4PJJA 5D6WA 1BBZA 4J9DA 4EC8B 3CCMA 1FWZA 1YJWA 5FRMA 1ABOA 4KRTA 1ARKA 3EOCB 4JPBW 4B9WA 2CYZB 2CUBA 4M7DA 2W0ZA 3QDFA 1R0BG 3CCRA 2E64A 4JJDA 1LPLA 1YCSB 1NJIU 4OB0B 2WJ9A 4JX6A 1JEGA 3E2UA 1Q7YU 2QYZA 1OI9B 1D0YA 3VYHB 3PIOA 2LX9A 2QDYB 3CEYA 1PSFA 3QZ9B 2JXBA 3REBB 1TXQA 4J9BA 4HNVA 2DFUA 5CKDA 5AT1B 3NTHA 2CZ0B 4BBRM 1VQNA 4M7AD 1QMZB 4BE1A 3VKIA 3OW2A 5LJ5f 1YI2Q 3BW1A 5CEIB 2KYBA 2RD1A 2RK2A 4JJNK 1Y96A 5J26A 2QDJA 3EIDB 1N27A 2D6FA 3GIBA 1AWJA 4HCZA 1HXDA 4II1A 3VRYA 2LX7A 1KXUA 2OJ2A 4DOVA 5GANg 3MKDA 3CCMQ 3X20B 4CFUB 1VQ9T 2JTEA 5GJWB 1MGQA 3RESA 4FT2A 3UWNA 1QVFP 2FZKB 4M77E 1AISB 1KHCA 2WACA 5FLXE 3CCRQ 3QWXX 4CC3A 1VQMQ 3UDCA 3OMCA 5HNBB 5L8RE 1OULA 2NUZA 2AZVA 5GMKe 2R5MA 2XI9A 3X25B 1ZA1B 2OTJT 2DLPA 1QP3A 2GGRA 3HFOA 2ROLA 1KHIA 4XTUA 4XTWA 2LQKA 2X3XD 3OS5A 4J6XA 3CPWA 4Y72B 4F7UB 2J7IA 1SEMA 3BFMA 1R77A 4PKCC 1ABQA 3JB9F 1VQNQ 3LGLA 2DD5B 3V8JA 4OGEA 1VQLT 4JDSA 3A8GB 1M3BA 4LDVA 5GAOl 1KJWA 2VGNA 3VKHA 4AFUC 4C0GA 4C92F 1P5EB 1WGSA 4GLKA 1FKMA 4FYXB 2B9RA 1K0XA 3SEMA 1K73R 3PVQA 2KDSA 2EKOA 2F5TX 1YIJQ 3QSUA 1VQ4A 2QG9B 3CCSQ 4MIMA 4BB7A 2LCSA 4A4KA 1M1KC 1U1SA 1JB0E 2QGGA 2VV5A 2O4XB 2RJFA 2RB6A 1K8AU 2I0NA 4BCGB 1JOWA 1AT1B 3OBWA 5HK3A 3GPLA 3SHWA 2WIPB 3G4SA 2C0TA 5EFQB 1JRIA 1FXXA 1W98B 5GAOn 5GANj 8AT1B 1CKAA 2BZ8A 4M7AE 1GFDA 3UA6A 1KC8U 4ELYC 2M1HA 4CFUD 1AD6A 5KYYB 2P4TA 2CP2A 2K7AA 5EG2A 2DMEA 4OB2B 2PK2A 3M56A 3OYCA 3PTAA 1VIFA 4L5GA 1JU5C 3GTMS 1YBYA 3MHXA 2AKKA 2PUKB 1Q82U 3HSBA 2RQUA 2AK5A 2MCNA 4EMKB 2RI2A 5LMKB 3VUZA 4PJOD 2Y90A 1BI1A 2VGMA 1NLOC 3M4YA 1VQ4Q 3ER0A 2B8AA 4FSXA 3NTIA 2DZ9A 4JUVA 1TUCA 2QQSA 4KH0B 4MZPA 2DVEA 1CKBA 1VA7A 2LJ1A 2YUOA 5EJCA 2CKKA 2RHUA 4JS5A 2DJQA 5GAMf 2DE0X 2DTHA 5DLOA 3HL8A 4PLLA 3M9QA 4PJNA 1MMNA 3L2WA 2VKNA 5C6SA 3QIIA 3G4SQ 3VKGA 3C0CA 4XAXB 4RCBA 1D3BB 1WA7A 3CCJT 2BPMB 3PIPA 4EMKC 2A08A 3QUIA 4F6WB 3QKJA 3QYGB 1OU8A 3V7CA 2C0OA 2HKNA 4XU2A 4C5HA 2VB6A 3M5AA 3EG2A 1U8RA 5GAN4 3AT1B 2ED0A 4UN0A 3HFNA 1WXTA 4RTXA 3CC7A 4PLIA 4J9HA 4IURA 1I07A 2CP0A 3S6WA 3M59A 3EG9A 2X3WD 5IH2A 2KMGA 3DLMA 4MFEA 3TCJA 3TQ7P 1JJ2A 4FL6A 1WZOA 3RIRA 3MP6A 1UGPB 1M9SA 1G3NC 4J9CA 1UFFA 3H41A 1T3SA 4M7DF 1D0ZA 1PRMC 4EMHA 4NL3A 3EGXB 2ZZDA 1H25B 2DTIA 2RJEA 5FWBA 5I5ZB 1S1NA 5IN1A 4MDXA 2A36A 2DF6A 1PHTA 1XOVA 1Y57A 4J6YA 1M8MA 2DXBA 4C0FA 2ZPGB 4J9GA 3GF5A 1F1BB 1GUXA 1GBRA 3QWYA 1S72A 3A8MB 3TW7A 4XQ3A 2X4YA 3QG1A 4EOOB 2EYQA 3DB3A 4CC2A 4M77G 4AFSC 1P92A 2YUPA 1M90R 2CT4A 3CC7Q 3FLGA 1NE8A 3CCLA 3F5XB 3O5ZA 4HNUA 3TN8B 3MY1B 3EFSA 2XG8D 3UA7A 3CCVT 4LUEA 4JRQA 5CKFA 2R5AA 4PJOE 1YI2T 3CC4T 2CREA 1WJRA 3JCMg 4AKHA 1WJSA 4M75G 3TW6A 1TOVA 2HD0A 5GMKm 2LJ0A 1QLYA 3T9NA 4E7SA 2KROA 1SG5A 4XK8E 4PFOA 1IREB 1KQ1A 1UNGD 5KYWB 3G6EA 3UATA 4HCCA 3CCMT 1YJWT 4IUTA 1MV3A 4QQDA 5CK9A 5J39A 1KQSA 2COYA 4C5EA 1QWFA 1PCXA 2P0KA 5I2MA 3CCRT 1AWOA 4CC4B 1VQMT 2LVMA 2LZ6B 2PHGA 3NTKA 4LD9K 2M0OA 4E7IA 4BE2A 1VIEA 5GAN8 1NLPC 1JSUB 2VC8A 2WSCE 2Y4XA 3PMIA 3I55A 2C5XB 4DBQA 3CXCS 4OMMA 1M4ZA 1TS9A 1JO8A 3CCLQ 1WHHA 4LOCA 1EX4A 1QCFA 1T3LA 1VQNT 9ATCB 3E9GA 4EOQB 3FDRA 1GFCA 3BHVB 3FC3A 5GAN6 1NPPA 1K9MC 3OMGA 1N8RC 3FJ5A 2CP6A 1QVGS 1KFZA 1WDXA 2K57A 4M7AG 4BDZA 3KUFA 3G6EQ 2WIHB 1RLQC 2H3EB 4N0AA 1V76A 3DDPB 1ZSZA 1ACMB 5C0MA 3BG9A 2COZA 2DA9A 1QVGP 3MY5B 2KRNA 5D6XA 1NYFA 3CMAA 4OR5B 1WQ7A 3BHTB 2QQ8A 5LJ3h 4Y91A 2CSQA 2A3LA 3CPFA 4J7FA 2X1NB 2V8JA 1X6OA 2ZGWA 3I55Q 3RNJA 1SF9A 3JCMX 2XHCA 4E2FB 4YOOA 4B6MA 2DVJA 4D8DA 2FEIA 3NFCA 3NDQA 4XTVA 1QKWA 4N4HA 3J80E 4J9IA 5EC7A 2V1QA 1M1KU 1X2KA 4HA8A 4GBQA 2JZ2A 1IB8A 2ZCFB 2O88A 4M77A 2E4HA 2L8DA 1D3UB 1W6XA 2HQHA 2C5NB 1N9RA 1G3TA 1YN8A 2GTOA 2HQXA 2VUBA 1UGQB 2C0IA 2EPDA 5LL6S 1FMWA 2C5OB 4AG2C 1SHFA 1EFNA 4M78F 2LDMA 4IKFA 1X69A 3DOGB 4LDXA 1BI3A 2F69A 4DBRA 3BLRB 4F16A 4NL2A 3TNIB 1VQ4T 3M54A 2LW4A 2LT4A 4ZN1A 5GANf 2ZAEA 5CVIA 2IIMA 3HB9A 2QGFB 4A4FA 3NGPA 2OI3A 1Y07A 5IDPB 1OV3A 3G4ST 1U1TA 1TU0B 1E6GA 3BLQB 1QCOA 2GQVA 1RABB 3MEWA 2NUTA 2KBTA 2XDDA 2E1HA 5CKHA 2QASA 2EGAA 1VYUA 4ROEA 2E12A 4R55A 2DD4B 1IGUA 1OI1A 4LD6A 1HSQA 4ELLA 2K4YA 3LH0A 3V7RA 4BCQB 4WF2A 2JTFA 3CQTA 2BS2A 4LDWA 4WTOB 3EG0A 2V8KA 4CFMB 1D1CA 1VQ5A 2NUPA 1CSKA 3A8OB 3JCMe 1UEBA 3JV3A 4CI0C 3MEAA 5HBJB 2F2CA 3ZL7C 4Y92A 5GMKj 2QA4A 2SEMA 2FPDA 2JUFA 3FIFA 1BB9A 2E5QA 2XDBA 1NJIR 1B3QA 5KYXA 2GNCA 1Q7YR 1OQKA 2JM9A 5KE2A 4GY5A 4M7AA 2LNVA 2YDLA 5HBHB 2EKHA 1O9KB 1MNEA 4QVDA 3DJBA 2DL3A 2UZLB 2E5KA 4KBMB 2IPOB 1GY3B 5FROA 4F7UG 1OIUB 1VYVA 3OSSC 2QQRA 2PZ1A 4JRPA 5GAOr 4XTXA 1SHGA 2RA2A 4J83A 1UGRB 1Q81C 2JMCA 4FCYA 3VU3C 3JCMP 1VQMA 3RBBB 5LJ3d 5DM7R 4K11A 1ZP2A 3L2ZA 4HKEA 2DXCB 4EOPB 1I81A 4IUUA 2IW9B 2QTXA 3CC7T 1LVKA 1BU1A 2HQEA 1OX8A 1VQ5Q 3A8HB 2NLUA 4AT1B 2PTKA 4DBHA 4J8OA 2KRMA 3EJ1B 4FU6A 4KGVB 5HK0A 1YWOA 3SWNB 1X01A 2QA4Q 1YFNA 3RERA 4MZTA 5CKBA 5A0DA 1QVFS 2ECZA 2H8HA 4PJLA 1JBMA 4XTZA 3CC2Q 2D0QB 4EOKB 1Q86C 3L2RA 3M0UA 1PC0A 4BCQD 2P0QA 3A8LB 1OPKA 4IIMA 2CZ7B 4HT8A 5LJ3e 4OMOA 3META 3RKXA 1YIJA 2L5QA 1S72T 4ATOA 3CCSA 1RAIB 1PNJA 4CRLB 1N5ZA 1MMDA 3VS2A 3SWNC 2PVGB 3TNHB 1FMVA 5CIUA 2FPEA 4MZMA 1B34B 2C5VB 1BI2A 2RM4A 3M55A 2W9ZA 1SKUB 2YXYA 4E7HA 2K3XA 3QO3A 3MPUB 4PJOB 3RKYA 3CCLT 3CBPA 5GMKl 2EWNA 1OL2B 2YUNA 3CCEA 1JSTB 1VOMA 2JS0A 4BE0A 2M51A 2X51A 1G83A 3H4CA 4BUGA 3D7SB 2RJCA 1WXBA 1ZSGA 2E3HA 2WMAB 1K76A 4ZGDB 4J5YA 4M4ZA 4MFDA 1I5OB 2EFIA 3OSVA 3O8VA 1H92A 1KK7A 2IW6B 3G6ET 1K8AR 2GF7A 2RQTA 1OKWB 2M02A 2DILA 5GAN5 4HCKA 1G8XA 2FRWA 4OB3B 4OMQA 4PJOC 1UGSB 2Y4YA 2FG0A 2JOYA 2P4RA 3C4SA 4PK4A 3QHSA 2D1XA 4C5IA 3K7AM 3RDVA 3KHIA 1V29B 3LYIA 4CC7A 3JRZA 1KC8R 1K9MU 1N8RU 4KGZB 2GBQA 1EZZB 4QQ6A 3VYGB 3H8ZA 2EYZA 3I55T 1WFWA 2E6NA 2K5FA 1UHCA 4M77F 2IVXA 4F7UA 1PKSA 1Q82R 2G77A 2RHIA 4PFZA 3BHUB 2DD5A 3OYHA 1FMKA 5KE3A 5FWCA 3CCEQ 4F14A 2DTOA 3BDLA 1X2QA 1WQWA 2DX1A 3R6NA 5I21A 1N6AA 1OOTA 4C8QB 1VQPA 1ZLMA 3FB9A 5FGKB 5DLQE 3OYDA 3WVEB 3PVLA 4M78B 3QJ6A 3QHWB 3OS1A 4M75F 3EH1A 4TVRA 1VYWB 4LN2A 5A2QE 1PRLC 1YJ9A 3JCMf 1R8OB 1TD6A 2KI7A 4QKUA 3CD6A 1BKBA 8ATCB 4N4GA 3VS3A 5KCHA 2DNUA 2W99A 2RQWA 3QJYA 3MJXA 4OGCA 3OYBA 3QZ5B 2A7YA 3OYEA 2CUDA 1KD1C 5GAOq 1X43A 4KT0E 2J6KA 1TH7A 3CMAT 3EFOB 2O4XA 4ZNXA 1H1RB 1T0HA 4C8QC 1ZQ1A 5IDNB 3I5RA 2JS2A 2K6DA 3WXMB 5LJ5h 1AVZC 3DTOA 4M78C 1PD0A 3M57A 3JCMJ 2MAMA 4Z8AA 4Z89A 3C95A 4J6WA 2QEXQ 3CXCA 3VS7A 2DRMA 5KYYA 1TG0A 1W4SA 3OW2P 5FW9A 3DL1A 4IUPA 1VQPQ 2L3QA 4HXJA 5D6YA 2EYYA 2V22B 2RO0A 1UUEA 5HQ0B 6AT1B 2DBMA 1YJ9Q 4M7AF 3CD6Q 4QVZA 4EMKA 1QVGA 3OB9A 2MWOA 2QXFA 1Z9ZA 3DDQB 4BCPB 4CFXB 4JZ4A 4BCIB 4AFQC 2BZYA 2A28A 3VRZA 2DETA 2M16A 1MNDA 2E41A 2UZDB 2OX7A 1WI7A 2RQVA 1WHJA 1TWBA 2EYXA 3HRUA 4BD3A 1M1FA 4R0KA 3V7SA 3HBLA 3PE0A 1WJQA 1KQ2A 4C8QD 4F7JB 1GBQA 1M8VA 1Y0MA 3GP8A 3S3NA 5IHYA 1X27A 2AT1B 1AZGB 4CFWB 3EHRA 1D3BA 4M78D 5CQYA 3TU4K 1QVPA 3CPWP 4ANJA 2GQIA 4BBSM 4FSSA 2QQAA 2M9UA 4PL6A 5IHNA 2WFYB 4GLMA 3OYNA 1AEYA 3FEOA 4JRIA 5AYFA 1M3AA 2J6OA 1OYXA 2R57A 2F5KA 1IHVA 1IGQA 1OZ2A 3B57A 2KSSA 1VQ5T 3JB9H 3L1AA 1VQ6A 4UC4A 1G3SA 2ZPEB 1ZUYA 1K4US 2D8HA 3CCUQ 3KFVA 1Q81U 1AZEA 2DAQA 4YOZA 3EG3A 1M1GA 4AMCA 2QA4T 7AT1B 2HNIA 3M53A 5KYNA 4OMNA 5DQWA 1M27C 1I8FA 1PWTA 2VWFA 2EBPA 4BCJB 5ACBA 1Z9QA 3EGXA 4FYYB 2ESWA 2GCXA 3I56A 3VV0A 1ZX6A 2VXEA 4DEYA 1JQQA 2FPFA 3I9QA 2W10A 1M30A 3M58A 2JW4A 4KH1B 1BIAA 1F5QB 2LQ8A 1TUGB 3OBYA 1XNIA 4EOIB 2DIQA 3OYIA 4E7LA 2WEVB 2V8IA 3TVTA 2EGEA 1GL5A 1HD3A 1IO6A 1TTHB 1Y7XA 2KY9A 5LJ5d 1Q86U 1WHKA 2B86A 3QYHB 4J7IA 4DA4A 4QQGA 2WPAB 1IHWA 4E47A 2RPNA 1VQ6Q 2CZ6B 2LCCA 4KULA 1I1JA 2YRVA 4C0DB 2RHXA 2X9HA 5GAMg 1TUDA 1VQ7A 5GAMh 1UTIA 3OA6A 3UPUA 2EJGA 3HZJA 2CH4A 2DBKA 2BS4A 4Q5WA 3BG5A 4C92B 1KG1A 3TEEA 3CMEA 1KIKA 2LMJA 2YRDA 2HKQB 3ME9A 1NG2A 4BDYA 1RAGB 5KYWA 3I56Q 3EGDB 2DXUA 3LX7A 1NYGA 4NOYA 4HL4A 3R6OA 1AD5A 4LXCA 1VOLA 4C8QE 2HAXA 2DMOA 1MHNA 2E6ZA 3SFMA 3P8DA 1R0CB 4C0DC 1YIJT 1VQLQ 3RGFB 4M78E 2DK3A 3O0GD 1M1KR 4F7UF 4G6LB 5LJ5e 3CCST 3PFSA 4II5B 4RTVA 1Y71A 5HBEB 2RHZA 3Q1JA 4D6WA 4C92C 5DQVA 2KEAA 5J3BA 1OL1B 1H3ZA 5LJ3g 3PO3S 2L3PA 1I4K1 3I35A 1YITA 1C9BA 1SSHA 1K73C 3J7AF 3ULRB 2EIFA 2XIDA 3CCET 4BACA 1VQ7Q 4A63B 4AI6A 1NPRA 1JJ2P 5L2WB 4L6V5 4AFZC 2PNIA 2C6TB 3LW5E 4M75B 1U06A 3L2VA 4LNPA 3CMEQ 2PVOB 4BY7X 1AOJA 2BIVA 5LQFB 2G3RA 2LNHB 3CBOA 1AWXA 4E7KA 3U23A 4PFPA 1KSWA 4HVUA 1T0JA 1M2VB 1C0MA 2UZBB 1UE9A 5IF1B 2QF7A 2G6FX 4HT9A 2CH4W 1QVFA 1G3WA 1VQ8A 2K3BA 2CDTA 4RUGA 5KYUB 5I22A 1WNLA 4Z88A 2KXCA 3JCMQ 1MV0B 1RAEB 3JB9D 5HCKA 3RMQA 1I5LA 2O01E 4OMFB 2MI6A 3LLRA 4RTUA 2WSFE 1I0CA 4M75C 3MIAB 2NWMA 1BCOA 2VYTA 4R56A 4C92D 3LGFA 4EPCA 3PMTA 4F17A 2RI3A 1WHGA 2DKGA 3H6ZA 1YITQ 5IT9E 2K3YA 1OIYB 4ZGJB 1KD1U 4ME7A 5FU6B 2YRCA 5GJVB 1SRMA 1QLBA 3OYFA 4PNOA 3RUXA 1RLPC 1HYOA 1UB4A 2L2PA 3QPHA 2AIRB 1FVVB 1GCQC 1VQPT 3RR6A 2RK1A 1NZ9A 4O5VA 2KRSA 2MIOA 4BXXX 5HY6A 1M2VA 1UGVA 2JMAA 1RADB 3IQLA 4XU1A 5HVYB 1FX7A 2X4JA 1YJ9T 4DOWA 2DL8A 5LJ3j 3CD6T 4RG2A 4FW2A 2I40B 5GAMd 1GRIA 1TSFA 1VQ8Q 4EDUA 1KQSP 3M0RA 4Z02A 4X1VA 4M7DB 5FU6C 1WIEA 2HEQA 5KCOA 3ZBDA 2DL5A 2L89A 3RKWA 2HSEB 4KUDK 4E7ZA 1BK2A 4C5GA 3CC2A 3GNFB 4PJOG 3S3OA 4M75D 4HLQA 2BKDN 2HMAA 2NYSA 2F2XA 2RNAA 1W1FA 1W2BS 2RMOA 4EC9B 2QQ9A 1OX9A 2DD4A 1OPLA 1OEBA 2D9TA 1V1CA 2Z0WA 2CSIA 3JCMc 4M7DC 1RL2A 3RMSA 3MP1A 4MMLA 2YLCA 1W2BP 1Y96B 5GAMe 3C94A 3VS0A 4KGXB 2QAZA 1UECA 2E3IA 3E19A 2OTLA 2W2HA 2DERA 2LCLA 5CO7A 3A5ZB 3CCUT 4BY1X 1LNXA 1H1QB 4ZTJA 1FYNA 3NMZC 1Q95G 3MEUA 1G5VA 3QYBA 1YCYA 2F1LA 3VJPA 4JZ3A 2MPXC 1NEGA 2HZYA 2RJDA 1X75C 4J9FA 1UJ0A 3CCQA 1HJDA 4JX4A 1O9KA 2DYBA 1JXOA 5BNJB 1M90C 4FIBA 3OYKA 2RF0A 4A4EA 4C92E 2PQWA 2XMFA 3SDZA 2SRCA 2AKLA 2FYKA 4A54A 2FZCB 2E10A 3GOXA 4RMOA 3CCVQ 2C06A 4EOJB 4V2SA 3LQ5B 4F04B 3CC4Q 3BY7A 3HTRA 2KT8A 1PSEA 5I11A 4C8QG 2QDLA 2JN0A 1YHQA 3OQ5A 2BE9B 2EGCA 2DXCA 4HVVA 1N4MA 4TTHA 4M78G 3X26B 1IZ6A 4M7DD 1RAHB 5GANh 2HBPA 2UUEB 1YJWQ 1VQ6T 1FINB 2K5IA 3TSWA 4DEXA 3X24B 5A0GA 2PJQA 2OTLQ 4F6SB 2JJ9A 3EGUA 4FYWB 2WSEE 2DEQA 2XDPA 1BYMA 4EORB 3SWNA 4IMYB 2LC4A 2EW3A 5IAYA 4A4GA 4BCMB 2E70A 2RHYA 1B7TA 1K9MR 5GMKi 1N8RR 2CP7A 2RQRA 1VQKA 3BE3A 4C0ZA 3I56T 2BKZB 3G33B 2DZCA 3CCQQ 4YTLA 3HRTA 2R58A 3EHQA 2CZ1B 1GXIE 4M75E 3M03A 3QWLA 3G71A 1RUWA 2JGZB 3EAEA 1VQOA 4JS4A 1YNZA 4NSTB 4RG8A 2KR6A 2XU8A 1YHQQ 1B34A 2CS7A 1WXUA 4OMPA 2PMIB 2VXFA 4PJOA 3MP8A 1PD1A 1GCPA 3P8BB 1QW1A 1UG1A 5GAOp 1WLPB 3A98A 1VQ7T 2I2LA 2EQJA 2YSQA 4BI3A 1XTDA 5FU7B 4BI4A 4OF1A 2QEXA 5CKEA 3H9NA 1RACB 1H1PB 4CFNB 3V8KA 3EFRA 2MWPA 1RAAB 3LWHA 2MF2A 3CMET 1AWWA 4YOSA 4LDUA 1XQHA 3L42A 1VQKQ 2KMTA 3E9FA 3BLHB 2ATCB 3P8HA 4MDWA 4RTZA 2K2VA 1D0XA 1OKVB 1OU9A 3QYEA 1K73U 1LJOA 4XU0A 2KR3A 1NBEB 1MUZA 1W70A 1D1AA 2IVWA 3M0QA 1QCNA 1SRLA 3G71Q 1U3OA 4VUBA 1VQOQ 5FU7C 4ROCA 3PNWC 4RTWA 3SB2A 1EIFA 2O2OA 2RI5A 2QTVA 5GAN7 3NHNA 2CCIB 3VYGA 1YJNA 2LRQA 1RI9A 4BCMD 4M7DE 5LJ5g 4A4HA 2AHJB 4NS5A 3OW2S 1YITT 4D8KA 4I3ZB 2CCHB 3EG9B 3PT9A 2FL7A 2V1RA 4F70B 2FVUA 3UT1A 3INZA 2FZGB 3BG3A 4BCOB 1E7OA 1PM3A 1E9HB 4C8QA 1VINA 3HPWA 2DIGA 3JCMb 2QGSA 1PKDB 2W9FA 2DEUA 1OGUB 3H0FA 2DJZA 1ENWA 2KE9A 4M78A 2KK4A 2KAFA 3L2QA 3JB9J 4LDYA 3M0SA 5GANd 3GLXA 1H1SB 1UNLD 2ZZDB 3HKSA 3E1SA 1K9AA 1BU2A 4BCKB 3OYMA 4O6JA 1VQ8T 2DXBB 1XO2A 3KBGA 4A53A 3CCUA 2I53A 4HVWA 1DJ7B 4QW2A 1GUXB 2OAUA 3C12A 4YC3B 3EFOA 2DXTA 2O9VA 3FJPA 1QMCA 2K5LA 4FYVB 2MMPA 4DQ2A 1H28B 2QQBA 3CPWS 2J05A 1YJNQ 4XTYA 2H3JA 4X34A 4IUQA 3JB9G 2F2WA 2EQIA 2GFUA 4E6RA 5GAN2 1WX6A 2YLBA 4AG1C 3ASKA 2C4GB 2ENMA 5DY9A 2DL4A 3M0TA 5LJ3f 2JT4A 3LH5A 3JB9I 1LCKA 1Q81R 1ZHIA 1OZ3A 3POMA 4KRDB 4C92G 2KVQG 5ECAA 5GANe 3GNGA 4QT7A 1WHMA 1NJIC 4CXAB 4EONB 1Q7YC 4HCBA 2X4WA 4OVAA 5L23A 2EUFA 3F70A 2F2VA 2IG0A 2PK9B 3VS1A 2JNGA 1H3HA 4DBFA 3OS2A 1UHFA 3HRSA 1U5SA 1O9SA 2A0FB 2BE7D 3ZEHA 3VS4A 3V8LA 1VQ9A 2WXVB 5LJ5j 1B07A 3VUBA 1IRXA 2K79A 2LQWA 4CFVB 4Z6YA 2P0PA 2CJMB 2J6FA 4CRIA 2MK5A 3OYLA 4J9EA 2OTJA 2IW8B 2VASA 3REAB 1Q86R 3CC2T 2JM8A 2DM1A 4ORZA 2YHTA 2V26A 1H26B 1X6GA 1A0NB 4JJCA 1J3TA 1X6BA 2MYSA 2YT6A 1VQLA 4EOMB 5HKCA 2HDAA 3JCMh 4AKIA 4ZTFA 2LJ3A 3HP9A 2KT1A 3QBYA 4XU3A 1JKWA 4F7UE 1MMAA 4FT4A 1PG5B 2J06A 3QXEB 4P5NA 1YP5A 5M9OA 1H641 1M90U 4F7SB 3JAME 2RN8A 3QHRB 4FX3B 2OTLT 2CP5A 2WHBB 5GAN3 4OGRB 2FHDA 5IHIA 2QK0A 3DB4A 5GAOm 3J81E 3EH2A 5FRNA 2UZEB 1VQ9Q 2YUQA 2BZXA 2M0YA 3M4GA 1S72Q 4OB1B 1ZSZB 2DRKA 4KUIA 4QVCA 4RKUE 4NC6A 2QFZA 1YWPA 2D8JA 2XKOC 2IN3A 3LWIA 2D0NA 1TFBA 2KGTA 2E65A 3WVDB 2KYMA 2R7GA 2EJ9A 1O75A 1QQJA 3CCQT 3URGA 4M6VA 2OTJQ 1IXDA 3DLLA 3MO8A 3X28B 3OYYA 1H27B 1M3CA 4L59A 4ELZC 1K0SA 1QWEA 3G1JA 4BY6B 4PJMA 1E6HA 3QDRB 3JCMV 4PJOF 4JX5A 3TNWB 4JLGA 2GTJA 1D1BA 3I5SA 2W96A 3L2UA 4MMKA
chains in the Genus database with same CATH topology
2LTOA 4MFEA 2GF7A 2L89A 4N0AC 3RKWA 3CBMA 3JSCA 2ZPBB 3TCJA 4KUDK 5GAN5 1JJ2A 2EQMA 4FL6A 4ZN3A 2EQKA 1YHQT 4ZGEB 3RIRA 4C5GA 4OB3B 1W2BA 4PJOC 3CC2A 3GNFB 1UGSB 4PJOG 2Y4YA 3S3OA 4M75D 1WPYA 3G7ZA 3MP6A 1UGPB 4HLQA 2BKDN 1M9SA 2EJFA 2JOYA 4M77B 3C4SA 4C5IA 3QHSA 3J81E 2RH2A 1JJ2S 2X35A 4M7DF 1W2BS 3KHIA 1V29B 1K8AC 1HK9A 3LYIA 4EMHA 5GAOm 4NL3A 2XD0A 1LOJA 3JRZA 2QQ9A 2DTIA 2RJEA 2ZZDA 3BDUA 2DD4A 2FB7A 2PVDB 1K9MU 1N8RU 1N9SA 1RI0A 2D9TA 2EQUA 2GFAA 4FM4B 5IN1A 4BY6C 4MDXA 4QQ6A 3VYGB 1XOVA 3JCMc 3H8ZA 3AHUA 4M7DC 4J6YA 1RL2A 2DXBA 3I55T 4M7DG 4C0FA 4C92A 2ZPGB 3GF5A 2E6NA 3RMSA 2K5FA 1E7PA 3MP1A 4ELJA 4M77F 4MMLA 2YLCA 1Y96B 3A8MB 5GAMe 4F7UA 1S72A 3TW7A 2G77A 2RHIA 3C94A 1KC8C 3E19A 1VQKT 4XQ3A 2DD5A 3OYHA 5KE3A 4IUVA 2OTLA 1SSFA 2X4YA 2DTOA 3BDLA 3QG1A 1WQWA 2EYQA 2LCLA 3DB3A 5CO7A 3A5ZB 4M77C 3CCUT 1LNXA 1G3YA 4M77G 4BI8B 2ZPIB 5I21A 5GMKh 1N6AA 1P92A 4C8QB 3OS0A 3OYJA 4ZTJA 1VQPA 1Q82C 3MEUA 3FB9A 3SD4A 3G71T 3PGGA 1G5VA 3FLGA 1NE8A 3CCLA 5DLQE 3OYDA 3QYBA 4QSHA 3WVEB 1YCYA 4M78B 3QJ6A 3VJPA 5A0LA 3CCJA 4E7JA 1VQOT 3OS1A 4HNUA 4M75F 2RJDA 4TVRA 1X75C 3EFSA 2XG8D 5A2QE 1YJ9A 3CCQA 3JCMf 1R8OB 4JX4A 2DPPB 3CCVT 3CD6A 1BKBA 1ZBXA 4JRQA 5CKFA 2R5AA 5KH6A 4N4GA 5GAMj 4PJOE 5KCHA 1YI2T 1M90C 3CC4T 4FIBA 3QJYA 3OYKA 3OYGA 4A4EA 1WJRA 3JCMg 4C92E 2PQWA 4OGCA 4AKHA 2X4XA 3OYBA 1WJSA 4C8QF 3QZ5B 4M75G 2A7YA 3SDZA 3TW6A 3OYEA 2EAYA 2HD0A 1KD1C 5GAOq 5GMKm 2FYKA 4KT0E 4A54A 1TH7A 2E10A 3MEVA 4RMOA 3T9NA 3GOXA 2C06A 3CMAT 2BS3A 3JCMW 2PU9B 4XK8E 3G6EA 1IREB 1KQ1A 2O4XA 4V2SA 3BY7A 4C8QC 4HCCA 1QP2A 1ZQ1A 2L3RA 3MCAB 5CR2A 3CCMT 1PSEA 4HNTA 4C8QG 4IUTA 2JN0A 1VUBA 1AHJB 3OY9A 1YJWT 4QQDA 5CK9A 5J39A 1YHQA 3JCMd 3WXMB 5LJ5h 2QEXT 3OQ5A 1KQSA 4C5EA 2DXCA 4M78C 4M75A 3DKMA 4M78G 2P0KA 4JLIA 3X26B 1IZ6A 5I2MA 4M7DD 3M57A 3CCRT 2QI2A 3S3MA 3JCMJ 5GANh 4OP0A 1VQMT 2HBPA 1KQSS 2LVMA 1VQ6T 2MAMA 2K5IA 3NTKA 4LD9K 5A0GA 3X24B 2DO3A 3C95A 4J6WA 4M7AB 2M0OA 3CXCA 2PUOB 2WSEE 1BI0A 4E7IA 3FRNA 2DEQA 4BE2A 1W4SA 1VIEA 5GAN8 2VC8A 2WSCE 2XDPA 2Y4XA 3PMIA 2ZPHB 2XK0A 3DL1A 5CQXA 1BYMA 4IUPA 3I55A 3SWNA 2LC4A 5IAYA 4A4GA 5D6YA 4M77D 2KQWA 3CXCS 2E70A 2RHYA 2RO0A 2LT1A 5CAIA 1M4ZA 2ZPFB 5GMKi 3N5BB 4LOCA 1VQKA 1VQNT 1M5Q1 4C0ZA 3I56T 1VQ5T 3KXTA 2DZCA 3E9GA 4AKGA 3HO8A 4M7AF 2XICA 4QVZA 4EMKA 3FDRA 3OB9A 4YTLA 3HRTA 4Y28E 2R58A 1QVGA 3FC3A 1YJNT 2MWOA 2CZ1B 2QXFA 3ZFJA 5GAN6 1GXIE 4M75E 1NPPA 2BUDA 3QWLA 1K9MC 3OMGA 3G71A 1N8RC 4M7AC 4KULA 1QVGS 2CGHA 2K57A 4M7AG 3EAEA 4BDZA 3KUFA 1VQOA 4JS4A 3TREA 2M16A 2E41A 4RCCA 4X9CA 4EMGA 4RG8A 2KR6A 3CCVA 5I2SA 3HRUA 4BD3A 1M1FA 4X9DA 2XU8A 3V7SA 3OYAA 3L2UA 3HBLA 4N0AA 1B34A 2CS7A 1YI2A 1WJQA 5CCAA 1BIBA 4N4IA 3CC4A 1KQ2A 3HHTB 4C8QD 1M8VA 3GP8A 2VXFA 3S3NA 5C0MA 3BG9A 3MP8A 4PJOA 3P8BB 4B9XA 4JRKA 1D3BA 4M78D 1QW1A 5CQYA 1QVPA 3TU4K 5D6XA 2JTMA 3CMAA 1WQ7A 2JVVA 5GAOp 5D6WA 4BBSM 2QQAA 2QQ8A 5GMKe 5LJ3h 2M9UA 4PL6A 4Y91A 1VQ7T 2I2LA 3CCMA 2EQJA 4BI3A 1FWZA 1YJWA 1XTDA 5FU7B 4BI4A 5FRMA 2A3LA 3OYNA 4OF1A 3CPFA 3FEOA 4J7FA 2QEXA 4JRIA 5CKEA 2V8JA 5AYFA 1X6OA 2ZGWA 3V8KA 3EFRA 2MWPA 1OYXA 2R57A 2F5KA 3LWHA 4B9WA 3JCMX 2CYZB 2MF2A 2XHCA 3CMET 4M7DA 3CCRA 1OZ2A 2E64A 2KSSA 3NFCA 4LDUA 4XTVA 3J80E 1XQHA 2WJ9A 4OB0B 3L1AA 4JX6A 3L42A 4N4HA 4UC4A 1G3SA 2ZPEB 2KMTA 1VQ6A 3E9FA 1Q7YU 1M1KU 3P8HA 4MDWA 2K2VA 3QYEA 3VYHB 3PIOA 1K73U 2LX9A 2QDYB 3CEYA 1LJOA 4HA8A 1Q81U 1PSFA 4XU0A 2JZ2A 2DAQA 3QZ9B 1M1GA 2ZCFB 2IVWA 2QA4T 4M77A 2HNIA 2L8DA 3M53A 1I8FA 4VUBA 1N9RA 4HNVA 5CKDA 1G3TA 3NTHA 2CZ0B 5FU7C 2HQXA 2VUBA 4BBRM 3PNWC 1UGQB 1VQNA 2GCXA 5LL6S 3I56A 4M7AD 3SB2A 1EIFA 2RI5A 3VV0A 4BE1A 2VXEA 3VKIA 3OW2A 4M78F 2LDMA 5GAN7 5LJ5f 3VYGA 4IKFA 1YJNA 4LDXA 1BI3A 2F69A 2LRQA 3BW1A 4NL2A 1VQ4T 3M54A 2RD1A 2RK2A 4JJNK 4M7DE 2LT4A 5LJ5g 4A4HA 2AHJB 1Y96A 4NS5A 4ZN1A 5GANf 5J26A 3OW2S 2QDJA 3M58A 1YITT 1N27A 2D6FA 5CVIA 3GIBA 4HCZA 1HXDA 4II1A 3HB9A 1BIAA 2LQ8A 3PT9A 2FL7A 1XNIA 3OBYA 4DOVA 2DIQA 5GANg 3JB9H 3OYIA 2FVUA 3UT1A 4A4FA 4E7LA 2V8IA 3INZA 3X20B 3BG3A 1Y07A 1VQ9T 1MGQA 4C8QA 3RESA 4FT2A 1Y7XA 3UWNA 2KY9A 3HPWA 5LJ5d 2DIGA 4M77E 3JCMb 3G4ST 1Q86U 1U1TA 1KHCA 3QYHB 4J7IA 2WACA 2GQVA 5FLXE 4DA4A 3MEWA 4QQGA 2DJZA 2XDDA 2E1HA 4M78A 5CKHA 2KK4A 2KAFA 4E47A 3L2QA 3JB9J 4LDYA 3UDCA 3OMCA 5L8RE 5GANd 3GLXA 2CZ6B 2LCCA 2ZZDB 2R5MA 2E12A 2YRVA 2DD4B 3E1SA 2XI9A 3HKSA 2RHXA 3X25B 4C0DB 4R55A 5GAMg 1VQ7A 5GAMh 1OI1A 2OTJT 3OA6A 4LD6A 3UPUA 2EJGA 3HZJA 1QP3A 3OYMA 3LH0A 2K4YA 3V7RA 4O6JA 1VQ8T 4Q5WA 2BS4A 4WF2A 2DXBB 3KBGA 2JTFA 3BG5A 4C92B 1KG1A 4A53A 3HFOA 3CCUA 1KHIA 4XTUA 4XTWA 2BS2A 4LDWA 3TEEA 1DJ7B 4QW2A 2LQKA 3CMEA 2V8KA 3OS5A 4J6XA 3CPWA 2OAUA 3C12A 4F7UB 3ME9A 3BFMA 4PKCC 4BDYA 1VQ5A 3JB9F 2DXTA 3FJPA 3LGLA 2DD5B 3A8OB 4OGEA 3V8JA 2K5LA 1UEBA 2DXUA 3JCMe 1VQLT 2MMPA 3LX7A 4JDSA 4DQ2A 3A8GB 4CI0C 3MEAA 2QQBA 4NOYA 3CPWS 4LDVA 4HL4A 5GAOl 3R6OA 2VGNA 4XTYA 2H3JA 4C8QE 4X34A 3VKHA 4IUQA 2HAXA 2E6ZA 1MHNA 4C0GA 5GMKj 2QA4A 3SFMA 3JB9G 4C92F 3G6ET 2JUFA 3P8DA 3FIFA 1WGSA 2GFUA 5GAN2 2E5QA 4GLKA 4C0DC 1YIJT 2XDBA 2YLBA 2DK3A 4M78E 1FKMA 3ASKA 4F7UF 5DY9A 5KE2A 5LJ5e 3CCST 3PFSA 4GY5A 5LJ3f 4M7AA 1Y71A 2LNVA 2RHZA 3JB9I 3Q1JA 4D6WA 5KCOA 2KDSA 1ZHIA 4C92C 1OZ3A 5J3BA 2EKOA 4QVDA 4C92G 2F5TX 2KVQG 5LJ3g 5GANe 1H3ZA 3QSUA 3GNGA 4KBMB 1VQ4A 5FROA 1NJIC 4F7UG 4MIMA 4BB7A 3OSSC 2QQRA 5GAOr 4JRPA 4A4KA 1Q7YC 1M1KC 2X4WA 4OVAA 4HCBA 1NJIU 1U1SA 1JB0E 4XTXA 1I4K1 1YITA 2RA2A 4J83A 1K73C 3J7AF 1UGRB 2EIFA 3F70A 1Q81C 2IG0A 2VV5A 2JNGA 2O4XB 2RJFA 2XIDA 3VU3C 4BACA 3OS2A 3JCMP 2RB6A 3CCET 1VQMA 3HRSA 1K8AU 5LJ3d 1O9SA 3ZEHA 5DM7R 4AI6A 1NPRA 3V8LA 3OBWA 1VQ9A 3L2ZA 4L6V5 5LJ5j 4HKEA 5HK3A 2DXCB 3GPLA 3LW5E 3VUBA 4M75B 3G4SA 1I81A 3L2VA 4IUUA 2QTXA 3CC7T 1JRIA 2PVOB 2HQEA 2BIVA 1FXXA 5GAOn 4Z6YA 2G3RA 2P0PA 3CBOA 5GANj 4E7KA 3A8HB 2NLUA 4M7AE 4CRIA 3OYLA 1KC8U 2OTJA 4ELYC 2M1HA 2QF7A 2P4TA 4HT9A 5EG2A 4J8OA 3CC2T 1G3WA 1QVFA 1VQ8A 4OB2B 4FU6A 5HK0A 3SWNB 1X01A 2YHTA 3M56A 1WNLA 3OYCA 3RERA 3JCMQ 3PTAA 1VIFA 4L5GA 4MZTA 5CKBA 3JB9D 5A0DA 1YBYA 1QVFS 3MHXA 3RMQA 2PUKB 1Q82U 3HSBA 1I5LA 2O01E 4OMFB 2MI6A 3LLRA 2WSFE 1JBMA 4XTZA 1VQLA 2D0QB 5HKCA 3JCMh 4AKIA 4M75C 4ZTFA 1Q86C 3L2RA 4EMKB 2RI2A 3HP9A 3QBYA 4XU3A 2P0QA 3VUZA 3A8LB 4PJOD 2Y90A 2VYTA 4F7UE 4R56A 2CZ7B 1BI1A 2VGMA 3LGFA 4C92D 3M4YA 4HT8A 3ER0A 2B8AA 4FSXA 5LJ3e 4EPCA 3NTIA 3PMTA 4FT4A 2RI3A 2DZ9A 4JUVA 4P5NA 3QXEB 5M9OA 1M90U 3META 1H641 2DKGA 2L5QA 3RKXA 1YIJA 2QQSA 1S72T 3H6ZA 4ATOA 5IT9E 4MZPA 2DVEA 3JAME 2K3YA 3CCSA 5EJCA 2CKKA 2RHUA 4JS5A 2OTLT 4ZGJB 1KD1U 4ME7A 5GAMf 5GAN3 2DTHA 5FU6B 2FHDA 5DLOA 3DB4A 3HL8A 3SWNC 1QLBA 2PVGB 3M9QA 4PLLA 4PNOA 5CIUA 3RUXA 1UB4A 3QPHA 3OYFA 5FRNA 3M4GA 3L2WA 4MZMA 1B34B 1BI2A 2RM4A 5C6SA 3M55A 4OB1B 1VQPT 3QIIA 4E7HA 2RK1A 3VKGA 4KUIA 1NZ9A 2K3XA 3QO3A 4O5VA 4QVCA 5HY6A 3RKYA 4XAXB 4PJOB 4RCBA 4RKUE 3CCLT 4XU1A 4NC6A 2QFZA 1D3BB 2XKOC 3CBPA 1FX7A 5GMKl 3LWIA 3CCJT 3PIPA 2EWNA 4EMKC 3QUIA 2E65A 3WVDB 2X4JA 2EJ9A 1YJ9T 1O75A 3QKJA 3QYGB 4DOWA 3CCEA 3V7CA 3CCQT 3URGA 5LJ3j 4BE0A 3CD6T 4M6VA 4RG2A 4XU2A 4C5HA 3H4CA 3DLLA 3M5AA 3MO8A 1U8RA 4BUGA 5GAMd 5GAN4 3X28B 2RJCA 3OYYA 4L59A 4ELZC 4EDUA 3HFNA 4ZGDB 4J5YA 4Z02A 4BY6B 4MFDA 3CC7A 2EFIA 3QDRB 4PLIA 4IURA 4M7DB 3JCMV 3OSVA 5FU6C 4JX5A 4PJOF 3O8VA 4JLGA 3S6WA 3M59A 2KMGA 3DLMA 4MMKA 3ZBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X24 B;  2ZPB B;  2PUO B;  2WSE E;  3VYG A;  4ZGE B;  4OB3 B;  2WSC E;  2ZPH B;  1UGS B;  4L6V 5;  2DXC B;  3LW5 E;  1UGP B;  2AHJ B;  2PVO B;  2ZPF B;  1V29 B;  3A8H B;  2ZZD A;  2DD4 A;  2PVD B;  4FM4 B;  3X20 B;  4Y28 E;  3VYG B;  2CZ1 B;  2DXB A;  1GXI E;  2ZPG B;  4OB2 B;  3QYH B;  3A8M B;  2PUK B;  5L8R E;  2DD5 A;  2CZ6 B;  2O01 E;  2ZZD B;  2WSF E;  2DD4 B;  2D0Q B;  3X25 B;  1QP3 A;  2ZPI B;  3A8L B;  3HHT B;  2CZ7 B;  2DXB B;  1DJ7 B;  3QXE B;  3WVE B;  2DD5 B;  3A8O B;  4ZGJ B;  2DPP B;  3A8G B;  2PVG B;  4OB1 B;  3QZ5 B;  2CYZ B;  4RKU E;  4KT0 E;  4OB0 B;  2PU9 B;  4XK8 E;  2ZPE B;  1IRE B;  3WVD B;  3QYG B;  1QP2 A;  3VYH B;  1PSE A;  2QDY B;  1AHJ B;  1PSF A;  3X28 B;  3QZ9 B;  2DXC A;  2ZCF B;  4ZGD B;  3X26 B;  1JB0 E;  2CZ0 B;  1UGR B;  1UGQ B; 
#chains in the Genus database with same CATH topology
 2LTO A;  4F6U B;  4N0A C;  1ZUK A;  3CBM A;  3JSC A;  2ZPB B;  3VS6 A;  1ZSZ C;  3CXC P;  3GBQ A;  2EQM A;  4ZN3 A;  2EQK A;  1YHQ T;  4ZGE B;  1W2B A;  1JXM A;  4BCN B;  2K2M A;  1MMG A;  4ESR A;  1WPY A;  3EG1 A;  3G7Z A;  2EJF A;  4M77 B;  2EVR A;  3M0P A;  2RH2 A;  1JJ2 S;  2X35 A;  1PKT A;  1K8A C;  1HK9 A;  2XD0 A;  1URC B;  2CP3 A;  1LOJ A;  3BDU A;  4F7N B;  2COW A;  2FB7 A;  2PVD B;  1WHL A;  1N9S A;  3A1P A;  1RI0 A;  2EQU A;  2GFA A;  4FM4 B;  2AZS A;  4BY6 C;  2OAW A;  2VVK A;  3AHU A;  1XJW B;  4M7D G;  4C92 A;  1NM7 A;  1ZUU A;  1E7P A;  2LQN A;  2MOX A;  4ELJ A;  2EYW A;  1D09 B;  1KC8 C;  1VQK T;  4EOS B;  3EGD A;  3THK A;  2DL7 A;  4IUV A;  1SSF A;  1H4L D;  1BCM A;  4M77 C;  4FW1 A;  2CT3 A;  4BI8 B;  1G3Y A;  2ZPI B;  5IXB A;  5GMK h;  3OS0 A;  3OYJ A;  1ZBJ A;  1Q82 C;  2HL5 C;  3SD4 A;  3G71 T;  2G9X B;  1UJY A;  3PGG A;  2NUT B;  4QSH A;  5A0L A;  1VQO T;  4E7J A;  3CCJ A;  1KD1 R;  2HL3 A;  2O31 A;  2DPP B;  1VYT A;  1ZBX A;  4LE9 A;  2L3S A;  3H0I A;  5D7U A;  5KH6 A;  5ICP B;  5GAM j;  3OYG A;  2KNB B;  2FO0 A;  1UDL A;  2X4X A;  3UF4 A;  2L0A A;  4C8Q F;  4BCF B;  4ROD A;  4RTT A;  2EAY A;  2O9S A;  3MEV A;  1H24 B;  5CYI B;  2BS3 A;  3JCM W;  2PU9 B;  2NUP B;  2YWW A;  1QP2 A;  2HCK A;  2L3R A;  3MCA B;  1SPK A;  2FRY A;  2LP5 A;  4HNT A;  4EIK A;  5CR2 A;  4LUD A;  1VUB A;  1AHJ B;  3H0H A;  3OY9 A;  3JCM d;  2QEX T;  1C1A A;  4M75 A;  3DKM A;  3CMA Q;  4JLI A;  1M2O A;  1ZA2 B;  2QI2 A;  1UNH D;  4IIO A;  3S3M A;  4OP0 A;  5IHK A;  1NEB A;  2ED1 A;  1KQS S;  5KYX B;  2ROT A;  2DO3 A;  4M7A B;  4KRC B;  2PUO B;  2K9G A;  1BI0 A;  4RTY A;  3FRN A;  2HSP A;  2KXD A;  4BCN D;  5CQX A;  2ZPH B;  2XK0 A;  1K1Z A;  3MI9 B;  2DYI A;  5KYU A;  4M77 D;  2KQW A;  1QKX A;  4F7L B;  2LT1 A;  5CAI A;  2ZPF B;  1GCQ A;  4JJB A;  3N5B B;  5IXF A;  3CCJ Q;  3NPF A;  1M5Q 1;  2BTT A;  3KXT A;  4AKG A;  3HO8 A;  2XIC A;  4Y28 E;  1YJN T;  1GH6 B;  3ZFJ A;  2WMB B;  1C6V X;  1WYX A;  2BUD A;  4OML A;  1H8K A;  4M7A C;  3TSZ A;  2CGH A;  4EOL B;  3TRE A;  2HBW A;  2P84 A;  4RCC A;  4X9C A;  4EMG A;  4WCI A;  3CCV A;  5I2S A;  4BCH B;  4X9D A;  3OYA A;  1YI2 A;  3CC4 A;  5CCA A;  1BIB A;  4N4I A;  3HHT B;  1RAF B;  1G2B A;  2ABL A;  2A37 A;  4B9X A;  4JRK A;  3VS5 A;  2JTM A;  2JVV A;  4PJJ A;  5D6W A;  1BBZ A;  4J9D A;  4EC8 B;  3CCM A;  1FWZ A;  1YJW A;  5FRM A;  1ABO A;  4KRT A;  1ARK A;  3EOC B;  4JPB W;  4B9W A;  2CYZ B;  2CUB A;  4M7D A;  2W0Z A;  3QDF A;  1R0B G;  3CCR A;  2E64 A;  4JJD A;  1LPL A;  1YCS B;  1NJI U;  4OB0 B;  2WJ9 A;  4JX6 A;  1JEG A;  3E2U A;  1Q7Y U;  2QYZ A;  1OI9 B;  1D0Y A;  3VYH B;  3PIO A;  2LX9 A;  2QDY B;  3CEY A;  1PSF A;  3QZ9 B;  2JXB A;  3REB B;  1TXQ A;  4J9B A;  4HNV A;  2DFU A;  5CKD A;  5AT1 B;  3NTH A;  2CZ0 B;  4BBR M;  1VQN A;  4M7A D;  1QMZ B;  4BE1 A;  3VKI A;  3OW2 A;  5LJ5 f;  1YI2 Q;  3BW1 A;  5CEI B;  2KYB A;  2RD1 A;  2RK2 A;  4JJN K;  1Y96 A;  5J26 A;  2QDJ A;  3EID B;  1N27 A;  2D6F A;  3GIB A;  1AWJ A;  4HCZ A;  1HXD A;  4II1 A;  3VRY A;  2LX7 A;  1KXU A;  2OJ2 A;  4DOV A;  5GAN g;  3MKD A;  3CCM Q;  3X20 B;  4CFU B;  1VQ9 T;  2JTE A;  5GJW B;  1MGQ A;  3RES A;  4FT2 A;  3UWN A;  1QVF P;  2FZK B;  4M77 E;  1AIS B;  1KHC A;  2WAC A;  5FLX E;  3CCR Q;  3QWX X;  4CC3 A;  1VQM Q;  3UDC A;  3OMC A;  5HNB B;  5L8R E;  1OUL A;  2NUZ A;  2AZV A;  5GMK e;  2R5M A;  2XI9 A;  3X25 B;  1ZA1 B;  2OTJ T;  2DLP A;  1QP3 A;  2GGR A;  3HFO A;  2ROL A;  1KHI A;  4XTU A;  4XTW A;  2LQK A;  2X3X D;  3OS5 A;  4J6X A;  3CPW A;  4Y72 B;  4F7U B;  2J7I A;  1SEM A;  3BFM A;  1R77 A;  4PKC C;  1ABQ A;  3JB9 F;  1VQN Q;  3LGL A;  2DD5 B;  3V8J A;  4OGE A;  1VQL T;  4JDS A;  3A8G B;  1M3B A;  4LDV A;  5GAO l;  1KJW A;  2VGN A;  3VKH A;  4AFU C;  4C0G A;  4C92 F;  1P5E B;  1WGS A;  4GLK A;  1FKM A;  4FYX B;  2B9R A;  1K0X A;  3SEM A;  1K73 R;  3PVQ A;  2KDS A;  2EKO A;  2F5T X;  1YIJ Q;  3QSU A;  1VQ4 A;  2QG9 B;  3CCS Q;  4MIM A;  4BB7 A;  2LCS A;  4A4K A;  1M1K C;  1U1S A;  1JB0 E;  2QGG A;  2VV5 A;  2O4X B;  2RJF A;  2RB6 A;  1K8A U;  2I0N A;  4BCG B;  1JOW A;  1AT1 B;  3OBW A;  5HK3 A;  3GPL A;  3SHW A;  2WIP B;  3G4S A;  2C0T A;  5EFQ B;  1JRI A;  1FXX A;  1W98 B;  5GAO n;  5GAN j;  8AT1 B;  1CKA A;  2BZ8 A;  4M7A E;  1GFD A;  3UA6 A;  1KC8 U;  4ELY C;  2M1H A;  4CFU D;  1AD6 A;  5KYY B;  2P4T A;  2CP2 A;  2K7A A;  5EG2 A;  2DME A;  4OB2 B;  2PK2 A;  3M56 A;  3OYC A;  3PTA A;  1VIF A;  4L5G A;  1JU5 C;  3GTM S;  1YBY A;  3MHX A;  2AKK A;  2PUK B;  1Q82 U;  3HSB A;  2RQU A;  2AK5 A;  2MCN A;  4EMK B;  2RI2 A;  5LMK B;  3VUZ A;  4PJO D;  2Y90 A;  1BI1 A;  2VGM A;  1NLO C;  3M4Y A;  1VQ4 Q;  3ER0 A;  2B8A A;  4FSX A;  3NTI A;  2DZ9 A;  4JUV A;  1TUC A;  2QQS A;  4KH0 B;  4MZP A;  2DVE A;  1CKB A;  1VA7 A;  2LJ1 A;  2YUO A;  5EJC A;  2CKK A;  2RHU A;  4JS5 A;  2DJQ A;  5GAM f;  2DE0 X;  2DTH A;  5DLO A;  3HL8 A;  4PLL A;  3M9Q A;  4PJN A;  1MMN A;  3L2W A;  2VKN A;  5C6S A;  3QII A;  3G4S Q;  3VKG A;  3C0C A;  4XAX B;  4RCB A;  1D3B B;  1WA7 A;  3CCJ T;  2BPM B;  3PIP A;  4EMK C;  2A08 A;  3QUI A;  4F6W B;  3QKJ A;  3QYG B;  1OU8 A;  3V7C A;  2C0O A;  2HKN A;  4XU2 A;  4C5H A;  2VB6 A;  3M5A A;  3EG2 A;  1U8R A;  5GAN 4;  3AT1 B;  2ED0 A;  4UN0 A;  3HFN A;  1WXT A;  4RTX A;  3CC7 A;  4PLI A;  4J9H A;  4IUR A;  1I07 A;  2CP0 A;  3S6W A;  3M59 A;  3EG9 A;  2X3W D;  5IH2 A;  2KMG A;  3DLM A;  4MFE A;  3TCJ A;  3TQ7 P;  1JJ2 A;  4FL6 A;  1WZO A;  3RIR A;  3MP6 A;  1UGP B;  1M9S A;  1G3N C;  4J9C A;  1UFF A;  3H41 A;  1T3S A;  4M7D F;  1D0Z A;  1PRM C;  4EMH A;  4NL3 A;  3EGX B;  2ZZD A;  1H25 B;  2DTI A;  2RJE A;  5FWB A;  5I5Z B;  1S1N A;  5IN1 A;  4MDX A;  2A36 A;  2DF6 A;  1PHT A;  1XOV A;  1Y57 A;  4J6Y A;  1M8M A;  2DXB A;  4C0F A;  2ZPG B;  4J9G A;  3GF5 A;  1F1B B;  1GUX A;  1GBR A;  3QWY A;  1S72 A;  3A8M B;  3TW7 A;  4XQ3 A;  2X4Y A;  3QG1 A;  4EOO B;  2EYQ A;  3DB3 A;  4CC2 A;  4M77 G;  4AFS C;  1P92 A;  2YUP A;  1M90 R;  2CT4 A;  3CC7 Q;  3FLG A;  1NE8 A;  3CCL A;  3F5X B;  3O5Z A;  4HNU A;  3TN8 B;  3MY1 B;  3EFS A;  2XG8 D;  3UA7 A;  3CCV T;  4LUE A;  4JRQ A;  5CKF A;  2R5A A;  4PJO E;  1YI2 T;  3CC4 T;  2CRE A;  1WJR A;  3JCM g;  4AKH A;  1WJS A;  4M75 G;  3TW6 A;  1TOV A;  2HD0 A;  5GMK m;  2LJ0 A;  1QLY A;  3T9N A;  4E7S A;  2KRO A;  1SG5 A;  4XK8 E;  4PFO A;  1IRE B;  1KQ1 A;  1UNG D;  5KYW B;  3G6E A;  3UAT A;  4HCC A;  3CCM T;  1YJW T;  4IUT A;  1MV3 A;  4QQD A;  5CK9 A;  5J39 A;  1KQS A;  2COY A;  4C5E A;  1QWF A;  1PCX A;  2P0K A;  5I2M A;  3CCR T;  1AWO A;  4CC4 B;  1VQM T;  2LVM A;  2LZ6 B;  2PHG A;  3NTK A;  4LD9 K;  2M0O A;  4E7I A;  4BE2 A;  1VIE A;  5GAN 8;  1NLP C;  1JSU B;  2VC8 A;  2WSC E;  2Y4X A;  3PMI A;  3I55 A;  2C5X B;  4DBQ A;  3CXC S;  4OMM A;  1M4Z A;  1TS9 A;  1JO8 A;  3CCL Q;  1WHH A;  4LOC A;  1EX4 A;  1QCF A;  1T3L A;  1VQN T;  9ATC B;  3E9G A;  4EOQ B;  3FDR A;  1GFC A;  3BHV B;  3FC3 A;  5GAN 6;  1NPP A;  1K9M C;  3OMG A;  1N8R C;  3FJ5 A;  2CP6 A;  1QVG S;  1KFZ A;  1WDX A;  2K57 A;  4M7A G;  4BDZ A;  3KUF A;  3G6E Q;  2WIH B;  1RLQ C;  2H3E B;  4N0A A;  1V76 A;  3DDP B;  1ZSZ A;  1ACM B;  5C0M A;  3BG9 A;  2COZ A;  2DA9 A;  1QVG P;  3MY5 B;  2KRN A;  5D6X A;  1NYF A;  3CMA A;  4OR5 B;  1WQ7 A;  3BHT B;  2QQ8 A;  5LJ3 h;  4Y91 A;  2CSQ A;  2A3L A;  3CPF A;  4J7F A;  2X1N B;  2V8J A;  1X6O A;  2ZGW A;  3I55 Q;  3RNJ A;  1SF9 A;  3JCM X;  2XHC A;  4E2F B;  4YOO A;  4B6M A;  2DVJ A;  4D8D A;  2FEI A;  3NFC A;  3NDQ A;  4XTV A;  1QKW A;  4N4H A;  3J80 E;  4J9I A;  5EC7 A;  2V1Q A;  1M1K U;  1X2K A;  4HA8 A;  4GBQ A;  2JZ2 A;  1IB8 A;  2ZCF B;  2O88 A;  4M77 A;  2E4H A;  2L8D A;  1D3U B;  1W6X A;  2HQH A;  2C5N B;  1N9R A;  1G3T A;  1YN8 A;  2GTO A;  2HQX A;  2VUB A;  1UGQ B;  2C0I A;  2EPD A;  5LL6 S;  1FMW A;  2C5O B;  4AG2 C;  1SHF A;  1EFN A;  4M78 F;  2LDM A;  4IKF A;  1X69 A;  3DOG B;  4LDX A;  1BI3 A;  2F69 A;  4DBR A;  3BLR B;  4F16 A;  4NL2 A;  3TNI B;  1VQ4 T;  3M54 A;  2LW4 A;  2LT4 A;  4ZN1 A;  5GAN f;  2ZAE A;  5CVI A;  2IIM A;  3HB9 A;  2QGF B;  4A4F A;  3NGP A;  2OI3 A;  1Y07 A;  5IDP B;  1OV3 A;  3G4S T;  1U1T A;  1TU0 B;  1E6G A;  3BLQ B;  1QCO A;  2GQV A;  1RAB B;  3MEW A;  2NUT A;  2KBT A;  2XDD A;  2E1H A;  5CKH A;  2QAS A;  2EGA A;  1VYU A;  4ROE A;  2E12 A;  4R55 A;  2DD4 B;  1IGU A;  1OI1 A;  4LD6 A;  1HSQ A;  4ELL A;  2K4Y A;  3LH0 A;  3V7R A;  4BCQ B;  4WF2 A;  2JTF A;  3CQT A;  2BS2 A;  4LDW A;  4WTO B;  3EG0 A;  2V8K A;  4CFM B;  1D1C A;  1VQ5 A;  2NUP A;  1CSK A;  3A8O B;  3JCM e;  1UEB A;  3JV3 A;  4CI0 C;  3MEA A;  5HBJ B;  2F2C A;  3ZL7 C;  4Y92 A;  5GMK j;  2QA4 A;  2SEM A;  2FPD A;  2JUF A;  3FIF A;  1BB9 A;  2E5Q A;  2XDB A;  1NJI R;  1B3Q A;  5KYX A;  2GNC A;  1Q7Y R;  1OQK A;  2JM9 A;  5KE2 A;  4GY5 A;  4M7A A;  2LNV A;  2YDL A;  5HBH B;  2EKH A;  1O9K B;  1MNE A;  4QVD A;  3DJB A;  2DL3 A;  2UZL B;  2E5K A;  4KBM B;  2IPO B;  1GY3 B;  5FRO A;  4F7U G;  1OIU B;  1VYV A;  3OSS C;  2QQR A;  2PZ1 A;  4JRP A;  5GAO r;  4XTX A;  1SHG A;  2RA2 A;  4J83 A;  1UGR B;  1Q81 C;  2JMC A;  4FCY A;  3VU3 C;  3JCM P;  1VQM A;  3RBB B;  5LJ3 d;  5DM7 R;  4K11 A;  1ZP2 A;  3L2Z A;  4HKE A;  2DXC B;  4EOP B;  1I81 A;  4IUU A;  2IW9 B;  2QTX A;  3CC7 T;  1LVK A;  1BU1 A;  2HQE A;  1OX8 A;  1VQ5 Q;  3A8H B;  2NLU A;  4AT1 B;  2PTK A;  4DBH A;  4J8O A;  2KRM A;  3EJ1 B;  4FU6 A;  4KGV B;  5HK0 A;  1YWO A;  3SWN B;  1X01 A;  2QA4 Q;  1YFN A;  3RER A;  4MZT A;  5CKB A;  5A0D A;  1QVF S;  2ECZ A;  2H8H A;  4PJL A;  1JBM A;  4XTZ A;  3CC2 Q;  2D0Q B;  4EOK B;  1Q86 C;  3L2R A;  3M0U A;  1PC0 A;  4BCQ D;  2P0Q A;  3A8L B;  1OPK A;  4IIM A;  2CZ7 B;  4HT8 A;  5LJ3 e;  4OMO A;  3MET A;  3RKX A;  1YIJ A;  2L5Q A;  1S72 T;  4ATO A;  3CCS A;  1RAI B;  1PNJ A;  4CRL B;  1N5Z A;  1MMD A;  3VS2 A;  3SWN C;  2PVG B;  3TNH B;  1FMV A;  5CIU A;  2FPE A;  4MZM A;  1B34 B;  2C5V B;  1BI2 A;  2RM4 A;  3M55 A;  2W9Z A;  1SKU B;  2YXY A;  4E7H A;  2K3X A;  3QO3 A;  3MPU B;  4PJO B;  3RKY A;  3CCL T;  3CBP A;  5GMK l;  2EWN A;  1OL2 B;  2YUN A;  3CCE A;  1JST B;  1VOM A;  2JS0 A;  4BE0 A;  2M51 A;  2X51 A;  1G83 A;  3H4C A;  4BUG A;  3D7S B;  2RJC A;  1WXB A;  1ZSG A;  2E3H A;  2WMA B;  1K76 A;  4ZGD B;  4J5Y A;  4M4Z A;  4MFD A;  1I5O B;  2EFI A;  3OSV A;  3O8V A;  1H92 A;  1KK7 A;  2IW6 B;  3G6E T;  1K8A R;  2GF7 A;  2RQT A;  1OKW B;  2M02 A;  2DIL A;  5GAN 5;  4HCK A;  1G8X A;  2FRW A;  4OB3 B;  4OMQ A;  4PJO C;  1UGS B;  2Y4Y A;  2FG0 A;  2JOY A;  2P4R A;  3C4S A;  4PK4 A;  3QHS A;  2D1X A;  4C5I A;  3K7A M;  3RDV A;  3KHI A;  1V29 B;  3LYI A;  4CC7 A;  3JRZ A;  1KC8 R;  1K9M U;  1N8R U;  4KGZ B;  2GBQ A;  1EZZ B;  4QQ6 A;  3VYG B;  3H8Z A;  2EYZ A;  3I55 T;  1WFW A;  2E6N A;  2K5F A;  1UHC A;  4M77 F;  2IVX A;  4F7U A;  1PKS A;  1Q82 R;  2G77 A;  2RHI A;  4PFZ A;  3BHU B;  2DD5 A;  3OYH A;  1FMK A;  5KE3 A;  5FWC A;  3CCE Q;  4F14 A;  2DTO A;  3BDL A;  1X2Q A;  1WQW A;  2DX1 A;  3R6N A;  5I21 A;  1N6A A;  1OOT A;  4C8Q B;  1VQP A;  1ZLM A;  3FB9 A;  5FGK B;  5DLQ E;  3OYD A;  3WVE B;  3PVL A;  4M78 B;  3QJ6 A;  3QHW B;  3OS1 A;  4M75 F;  3EH1 A;  4TVR A;  1VYW B;  4LN2 A;  5A2Q E;  1PRL C;  1YJ9 A;  3JCM f;  1R8O B;  1TD6 A;  2KI7 A;  4QKU A;  3CD6 A;  1BKB A;  8ATC B;  4N4G A;  3VS3 A;  5KCH A;  2DNU A;  2W99 A;  2RQW A;  3QJY A;  3MJX A;  4OGC A;  3OYB A;  3QZ5 B;  2A7Y A;  3OYE A;  2CUD A;  1KD1 C;  5GAO q;  1X43 A;  4KT0 E;  2J6K A;  1TH7 A;  3CMA T;  3EFO B;  2O4X A;  4ZNX A;  1H1R B;  1T0H A;  4C8Q C;  1ZQ1 A;  5IDN B;  3I5R A;  2JS2 A;  2K6D A;  3WXM B;  5LJ5 h;  1AVZ C;  3DTO A;  4M78 C;  1PD0 A;  3M57 A;  3JCM J;  2MAM A;  4Z8A A;  4Z89 A;  3C95 A;  4J6W A;  2QEX Q;  3CXC A;  3VS7 A;  2DRM A;  5KYY A;  1TG0 A;  1W4S A;  3OW2 P;  5FW9 A;  3DL1 A;  4IUP A;  1VQP Q;  2L3Q A;  4HXJ A;  5D6Y A;  2EYY A;  2V22 B;  2RO0 A;  1UUE A;  5HQ0 B;  6AT1 B;  2DBM A;  1YJ9 Q;  4M7A F;  3CD6 Q;  4QVZ A;  4EMK A;  1QVG A;  3OB9 A;  2MWO A;  2QXF A;  1Z9Z A;  3DDQ B;  4BCP B;  4CFX B;  4JZ4 A;  4BCI B;  4AFQ C;  2BZY A;  2A28 A;  3VRZ A;  2DET A;  2M16 A;  1MND A;  2E41 A;  2UZD B;  2OX7 A;  1WI7 A;  2RQV A;  1WHJ A;  1TWB A;  2EYX A;  3HRU A;  4BD3 A;  1M1F A;  4R0K A;  3V7S A;  3HBL A;  3PE0 A;  1WJQ A;  1KQ2 A;  4C8Q D;  4F7J B;  1GBQ A;  1M8V A;  1Y0M A;  3GP8 A;  3S3N A;  5IHY A;  1X27 A;  2AT1 B;  1AZG B;  4CFW B;  3EHR A;  1D3B A;  4M78 D;  5CQY A;  3TU4 K;  1QVP A;  3CPW P;  4ANJ A;  2GQI A;  4BBS M;  4FSS A;  2QQA A;  2M9U A;  4PL6 A;  5IHN A;  2WFY B;  4GLM A;  3OYN A;  1AEY A;  3FEO A;  4JRI A;  5AYF A;  1M3A A;  2J6O A;  1OYX A;  2R57 A;  2F5K A;  1IHV A;  1IGQ A;  1OZ2 A;  3B57 A;  2KSS A;  1VQ5 T;  3JB9 H;  3L1A A;  1VQ6 A;  4UC4 A;  1G3S A;  2ZPE B;  1ZUY A;  1K4U S;  2D8H A;  3CCU Q;  3KFV A;  1Q81 U;  1AZE A;  2DAQ A;  4YOZ A;  3EG3 A;  1M1G A;  4AMC A;  2QA4 T;  7AT1 B;  2HNI A;  3M53 A;  5KYN A;  4OMN A;  5DQW A;  1M27 C;  1I8F A;  1PWT A;  2VWF A;  2EBP A;  4BCJ B;  5ACB A;  1Z9Q A;  3EGX A;  4FYY B;  2ESW A;  2GCX A;  3I56 A;  3VV0 A;  1ZX6 A;  2VXE A;  4DEY A;  1JQQ A;  2FPF A;  3I9Q A;  2W10 A;  1M30 A;  3M58 A;  2JW4 A;  4KH1 B;  1BIA A;  1F5Q B;  2LQ8 A;  1TUG B;  3OBY A;  1XNI A;  4EOI B;  2DIQ A;  3OYI A;  4E7L A;  2WEV B;  2V8I A;  3TVT A;  2EGE A;  1GL5 A;  1HD3 A;  1IO6 A;  1TTH B;  1Y7X A;  2KY9 A;  5LJ5 d;  1Q86 U;  1WHK A;  2B86 A;  3QYH B;  4J7I A;  4DA4 A;  4QQG A;  2WPA B;  1IHW A;  4E47 A;  2RPN A;  1VQ6 Q;  2CZ6 B;  2LCC A;  4KUL A;  1I1J A;  2YRV A;  4C0D B;  2RHX A;  2X9H A;  5GAM g;  1TUD A;  1VQ7 A;  5GAM h;  1UTI A;  3OA6 A;  3UPU A;  2EJG A;  3HZJ A;  2CH4 A;  2DBK A;  2BS4 A;  4Q5W A;  3BG5 A;  4C92 B;  1KG1 A;  3TEE A;  3CME A;  1KIK A;  2LMJ A;  2YRD A;  2HKQ B;  3ME9 A;  1NG2 A;  4BDY A;  1RAG B;  5KYW A;  3I56 Q;  3EGD B;  2DXU A;  3LX7 A;  1NYG A;  4NOY A;  4HL4 A;  3R6O A;  1AD5 A;  4LXC A;  1VOL A;  4C8Q E;  2HAX A;  2DMO A;  1MHN A;  2E6Z A;  3SFM A;  3P8D A;  1R0C B;  4C0D C;  1YIJ T;  1VQL Q;  3RGF B;  4M78 E;  2DK3 A;  3O0G D;  1M1K R;  4F7U F;  4G6L B;  5LJ5 e;  3CCS T;  3PFS A;  4II5 B;  4RTV A;  1Y71 A;  5HBE B;  2RHZ A;  3Q1J A;  4D6W A;  4C92 C;  5DQV A;  2KEA A;  5J3B A;  1OL1 B;  1H3Z A;  5LJ3 g;  3PO3 S;  2L3P A;  1I4K 1;  3I35 A;  1YIT A;  1C9B A;  1SSH A;  1K73 C;  3J7A F;  3ULR B;  2EIF A;  2XID A;  3CCE T;  4BAC A;  1VQ7 Q;  4A63 B;  4AI6 A;  1NPR A;  1JJ2 P;  5L2W B;  4L6V 5;  4AFZ C;  2PNI A;  2C6T B;  3LW5 E;  4M75 B;  1U06 A;  3L2V A;  4LNP A;  3CME Q;  2PVO B;  4BY7 X;  1AOJ A;  2BIV A;  5LQF B;  2G3R A;  2LNH B;  3CBO A;  1AWX A;  4E7K A;  3U23 A;  4PFP A;  1KSW A;  4HVU A;  1T0J A;  1M2V B;  1C0M A;  2UZB B;  1UE9 A;  5IF1 B;  2QF7 A;  2G6F X;  4HT9 A;  2CH4 W;  1QVF A;  1G3W A;  1VQ8 A;  2K3B A;  2CDT A;  4RUG A;  5KYU B;  5I22 A;  1WNL A;  4Z88 A;  2KXC A;  3JCM Q;  1MV0 B;  1RAE B;  3JB9 D;  5HCK A;  3RMQ A;  1I5L A;  2O01 E;  4OMF B;  2MI6 A;  3LLR A;  4RTU A;  2WSF E;  1I0C A;  4M75 C;  3MIA B;  2NWM A;  1BCO A;  2VYT A;  4R56 A;  4C92 D;  3LGF A;  4EPC A;  3PMT A;  4F17 A;  2RI3 A;  1WHG A;  2DKG A;  3H6Z A;  1YIT Q;  5IT9 E;  2K3Y A;  1OIY B;  4ZGJ B;  1KD1 U;  4ME7 A;  5FU6 B;  2YRC A;  5GJV B;  1SRM A;  1QLB A;  3OYF A;  4PNO A;  3RUX A;  1RLP C;  1HYO A;  1UB4 A;  2L2P A;  3QPH A;  2AIR B;  1FVV B;  1GCQ C;  1VQP T;  3RR6 A;  2RK1 A;  1NZ9 A;  4O5V A;  2KRS A;  2MIO A;  4BXX X;  5HY6 A;  1M2V A;  1UGV A;  2JMA A;  1RAD B;  3IQL A;  4XU1 A;  5HVY B;  1FX7 A;  2X4J A;  1YJ9 T;  4DOW A;  2DL8 A;  5LJ3 j;  3CD6 T;  4RG2 A;  4FW2 A;  2I40 B;  5GAM d;  1GRI A;  1TSF A;  1VQ8 Q;  4EDU A;  1KQS P;  3M0R A;  4Z02 A;  4X1V A;  4M7D B;  5FU6 C;  1WIE A;  2HEQ A;  5KCO A;  3ZBD A;  2DL5 A;  2L89 A;  3RKW A;  2HSE B;  4KUD K;  4E7Z A;  1BK2 A;  4C5G A;  3CC2 A;  3GNF B;  4PJO G;  3S3O A;  4M75 D;  4HLQ A;  2BKD N;  2HMA A;  2NYS A;  2F2X A;  2RNA A;  1W1F A;  1W2B S;  2RMO A;  4EC9 B;  2QQ9 A;  1OX9 A;  2DD4 A;  1OPL A;  1OEB A;  2D9T A;  1V1C A;  2Z0W A;  2CSI A;  3JCM c;  4M7D C;  1RL2 A;  3RMS A;  3MP1 A;  4MML A;  2YLC A;  1W2B P;  1Y96 B;  5GAM e;  3C94 A;  3VS0 A;  4KGX B;  2QAZ A;  1UEC A;  2E3I A;  3E19 A;  2OTL A;  2W2H A;  2DER A;  2LCL A;  5CO7 A;  3A5Z B;  3CCU T;  4BY1 X;  1LNX A;  1H1Q B;  4ZTJ A;  1FYN A;  3NMZ C;  1Q95 G;  3MEU A;  1G5V A;  3QYB A;  1YCY A;  2F1L A;  3VJP A;  4JZ3 A;  2MPX C;  1NEG A;  2HZY A;  2RJD A;  1X75 C;  4J9F A;  1UJ0 A;  3CCQ A;  1HJD A;  4JX4 A;  1O9K A;  2DYB A;  1JXO A;  5BNJ B;  1M90 C;  4FIB A;  3OYK A;  2RF0 A;  4A4E A;  4C92 E;  2PQW A;  2XMF A;  3SDZ A;  2SRC A;  2AKL A;  2FYK A;  4A54 A;  2FZC B;  2E10 A;  3GOX A;  4RMO A;  3CCV Q;  2C06 A;  4EOJ B;  4V2S A;  3LQ5 B;  4F04 B;  3CC4 Q;  3BY7 A;  3HTR A;  2KT8 A;  1PSE A;  5I11 A;  4C8Q G;  2QDL A;  2JN0 A;  1YHQ A;  3OQ5 A;  2BE9 B;  2EGC A;  2DXC A;  4HVV A;  1N4M A;  4TTH A;  4M78 G;  3X26 B;  1IZ6 A;  4M7D D;  1RAH B;  5GAN h;  2HBP A;  2UUE B;  1YJW Q;  1VQ6 T;  1FIN B;  2K5I A;  3TSW A;  4DEX A;  3X24 B;  5A0G A;  2PJQ A;  2OTL Q;  4F6S B;  2JJ9 A;  3EGU A;  4FYW B;  2WSE E;  2DEQ A;  2XDP A;  1BYM A;  4EOR B;  3SWN A;  4IMY B;  2LC4 A;  2EW3 A;  5IAY A;  4A4G A;  4BCM B;  2E70 A;  2RHY A;  1B7T A;  1K9M R;  5GMK i;  1N8R R;  2CP7 A;  2RQR A;  1VQK A;  3BE3 A;  4C0Z A;  3I56 T;  2BKZ B;  3G33 B;  2DZC A;  3CCQ Q;  4YTL A;  3HRT A;  2R58 A;  3EHQ A;  2CZ1 B;  1GXI E;  4M75 E;  3M03 A;  3QWL A;  3G71 A;  1RUW A;  2JGZ B;  3EAE A;  1VQO A;  4JS4 A;  1YNZ A;  4NST B;  4RG8 A;  2KR6 A;  2XU8 A;  1YHQ Q;  1B34 A;  2CS7 A;  1WXU A;  4OMP A;  2PMI B;  2VXF A;  4PJO A;  3MP8 A;  1PD1 A;  1GCP A;  3P8B B;  1QW1 A;  1UG1 A;  5GAO p;  1WLP B;  3A98 A;  1VQ7 T;  2I2L A;  2EQJ A;  2YSQ A;  4BI3 A;  1XTD A;  5FU7 B;  4BI4 A;  4OF1 A;  2QEX A;  5CKE A;  3H9N A;  1RAC B;  1H1P B;  4CFN B;  3V8K A;  3EFR A;  2MWP A;  1RAA B;  3LWH A;  2MF2 A;  3CME T;  1AWW A;  4YOS A;  4LDU A;  1XQH A;  3L42 A;  1VQK Q;  2KMT A;  3E9F A;  3BLH B;  2ATC B;  3P8H A;  4MDW A;  4RTZ A;  2K2V A;  1D0X A;  1OKV B;  1OU9 A;  3QYE A;  1K73 U;  1LJO A;  4XU0 A;  2KR3 A;  1NBE B;  1MUZ A;  1W70 A;  1D1A A;  2IVW A;  3M0Q A;  1QCN A;  1SRL A;  3G71 Q;  1U3O A;  4VUB A;  1VQO Q;  5FU7 C;  4ROC A;  3PNW C;  4RTW A;  3SB2 A;  1EIF A;  2O2O A;  2RI5 A;  2QTV A;  5GAN 7;  3NHN A;  2CCI B;  3VYG A;  1YJN A;  2LRQ A;  1RI9 A;  4BCM D;  4M7D E;  5LJ5 g;  4A4H A;  2AHJ B;  4NS5 A;  3OW2 S;  1YIT T;  4D8K A;  4I3Z B;  2CCH B;  3EG9 B;  3PT9 A;  2FL7 A;  2V1R A;  4F70 B;  2FVU A;  3UT1 A;  3INZ A;  2FZG B;  3BG3 A;  4BCO B;  1E7O A;  1PM3 A;  1E9H B;  4C8Q A;  1VIN A;  3HPW A;  2DIG A;  3JCM b;  2QGS A;  1PKD B;  2W9F A;  2DEU A;  1OGU B;  3H0F A;  2DJZ A;  1ENW A;  2KE9 A;  4M78 A;  2KK4 A;  2KAF A;  3L2Q A;  3JB9 J;  4LDY A;  3M0S A;  5GAN d;  3GLX A;  1H1S B;  1UNL D;  2ZZD B;  3HKS A;  3E1S A;  1K9A A;  1BU2 A;  4BCK B;  3OYM A;  4O6J A;  1VQ8 T;  2DXB B;  1XO2 A;  3KBG A;  4A53 A;  3CCU A;  2I53 A;  4HVW A;  1DJ7 B;  4QW2 A;  1GUX B;  2OAU A;  3C12 A;  4YC3 B;  3EFO A;  2DXT A;  2O9V A;  3FJP A;  1QMC A;  2K5L A;  4FYV B;  2MMP A;  4DQ2 A;  1H28 B;  2QQB A;  3CPW S;  2J05 A;  1YJN Q;  4XTY A;  2H3J A;  4X34 A;  4IUQ A;  3JB9 G;  2F2W A;  2EQI A;  2GFU A;  4E6R A;  5GAN 2;  1WX6 A;  2YLB A;  4AG1 C;  3ASK A;  2C4G B;  2ENM A;  5DY9 A;  2DL4 A;  3M0T A;  5LJ3 f;  2JT4 A;  3LH5 A;  3JB9 I;  1LCK A;  1Q81 R;  1ZHI A;  1OZ3 A;  3POM A;  4KRD B;  4C92 G;  2KVQ G;  5ECA A;  5GAN e;  3GNG A;  4QT7 A;  1WHM A;  1NJI C;  4CXA B;  4EON B;  1Q7Y C;  4HCB A;  2X4W A;  4OVA A;  5L23 A;  2EUF A;  3F70 A;  2F2V A;  2IG0 A;  2PK9 B;  3VS1 A;  2JNG A;  1H3H A;  4DBF A;  3OS2 A;  1UHF A;  3HRS A;  1U5S A;  1O9S A;  2A0F B;  2BE7 D;  3ZEH A;  3VS4 A;  3V8L A;  1VQ9 A;  2WXV B;  5LJ5 j;  1B07 A;  3VUB A;  1IRX A;  2K79 A;  2LQW A;  4CFV B;  4Z6Y A;  2P0P A;  2CJM B;  2J6F A;  4CRI A;  2MK5 A;  3OYL A;  4J9E A;  2OTJ A;  2IW8 B;  2VAS A;  3REA B;  1Q86 R;  3CC2 T;  2JM8 A;  2DM1 A;  4ORZ A;  2YHT A;  2V26 A;  1H26 B;  1X6G A;  1A0N B;  4JJC A;  1J3T A;  1X6B A;  2MYS A;  2YT6 A;  1VQL A;  4EOM B;  5HKC A;  2HDA A;  3JCM h;  4AKI A;  4ZTF A;  2LJ3 A;  3HP9 A;  2KT1 A;  3QBY A;  4XU3 A;  1JKW A;  4F7U E;  1MMA A;  4FT4 A;  1PG5 B;  2J06 A;  3QXE B;  4P5N A;  1YP5 A;  5M9O A;  1H64 1;  1M90 U;  4F7S B;  3JAM E;  2RN8 A;  3QHR B;  4FX3 B;  2OTL T;  2CP5 A;  2WHB B;  5GAN 3;  4OGR B;  2FHD A;  5IHI A;  2QK0 A;  3DB4 A;  5GAO m;  3J81 E;  3EH2 A;  5FRN A;  2UZE B;  1VQ9 Q;  2YUQ A;  2BZX A;  2M0Y A;  3M4G A;  1S72 Q;  4OB1 B;  1ZSZ B;  2DRK A;  4KUI A;  4QVC A;  4RKU E;  4NC6 A;  2QFZ A;  1YWP A;  2D8J A;  2XKO C;  2IN3 A;  3LWI A;  2D0N A;  1TFB A;  2KGT A;  2E65 A;  3WVD B;  2KYM A;  2R7G A;  2EJ9 A;  1O75 A;  1QQJ A;  3CCQ T;  3URG A;  4M6V A;  2OTJ Q;  1IXD A;  3DLL A;  3MO8 A;  3X28 B;  3OYY A;  1H27 B;  1M3C A;  4L59 A;  4ELZ C;  1K0S A;  1QWE A;  3G1J A;  4BY6 B;  4PJM A;  1E6H A;  3QDR B;  3JCM V;  4PJO F;  4JX5 A;  3TNW B;  4JLG A;  2GTJ A;  1D1B A;  3I5S A;  2W96 A;  3L2U A;  4MMK A; 
#chains in the Genus database with same CATH homology
 2LTO A;  4MFE A;  2GF7 A;  2L89 A;  4N0A C;  3RKW A;  3CBM A;  3JSC A;  2ZPB B;  3TCJ A;  4KUD K;  5GAN 5;  1JJ2 A;  2EQM A;  4FL6 A;  4ZN3 A;  2EQK A;  1YHQ T;  4ZGE B;  3RIR A;  4C5G A;  4OB3 B;  1W2B A;  4PJO C;  3CC2 A;  3GNF B;  1UGS B;  4PJO G;  2Y4Y A;  3S3O A;  4M75 D;  1WPY A;  3G7Z A;  3MP6 A;  1UGP B;  4HLQ A;  2BKD N;  1M9S A;  2EJF A;  2JOY A;  4M77 B;  3C4S A;  4C5I A;  3QHS A;  3J81 E;  2RH2 A;  1JJ2 S;  2X35 A;  4M7D F;  1W2B S;  3KHI A;  1V29 B;  1K8A C;  1HK9 A;  3LYI A;  4EMH A;  5GAO m;  4NL3 A;  2XD0 A;  1LOJ A;  3JRZ A;  2QQ9 A;  2DTI A;  2RJE A;  2ZZD A;  3BDU A;  2DD4 A;  2FB7 A;  2PVD B;  1K9M U;  1N8R U;  1N9S A;  1RI0 A;  2D9T A;  2EQU A;  2GFA A;  4FM4 B;  5IN1 A;  4BY6 C;  4MDX A;  4QQ6 A;  3VYG B;  1XOV A;  3JCM c;  3H8Z A;  3AHU A;  4M7D C;  4J6Y A;  1RL2 A;  2DXB A;  3I55 T;  4M7D G;  4C0F A;  4C92 A;  2ZPG B;  3GF5 A;  2E6N A;  3RMS A;  2K5F A;  1E7P A;  3MP1 A;  4ELJ A;  4M77 F;  4MML A;  2YLC A;  1Y96 B;  3A8M B;  5GAM e;  4F7U A;  1S72 A;  3TW7 A;  2G77 A;  2RHI A;  3C94 A;  1KC8 C;  3E19 A;  1VQK T;  4XQ3 A;  2DD5 A;  3OYH A;  5KE3 A;  4IUV A;  2OTL A;  1SSF A;  2X4Y A;  2DTO A;  3BDL A;  3QG1 A;  1WQW A;  2EYQ A;  2LCL A;  3DB3 A;  5CO7 A;  3A5Z B;  4M77 C;  3CCU T;  1LNX A;  1G3Y A;  4M77 G;  4BI8 B;  2ZPI B;  5I21 A;  5GMK h;  1N6A A;  1P92 A;  4C8Q B;  3OS0 A;  3OYJ A;  4ZTJ A;  1VQP A;  1Q82 C;  3MEU A;  3FB9 A;  3SD4 A;  3G71 T;  3PGG A;  1G5V A;  3FLG A;  1NE8 A;  3CCL A;  5DLQ E;  3OYD A;  3QYB A;  4QSH A;  3WVE B;  1YCY A;  4M78 B;  3QJ6 A;  3VJP A;  5A0L A;  3CCJ A;  4E7J A;  1VQO T;  3OS1 A;  4HNU A;  4M75 F;  2RJD A;  4TVR A;  1X75 C;  3EFS A;  2XG8 D;  5A2Q E;  1YJ9 A;  3CCQ A;  3JCM f;  1R8O B;  4JX4 A;  2DPP B;  3CCV T;  3CD6 A;  1BKB A;  1ZBX A;  4JRQ A;  5CKF A;  2R5A A;  5KH6 A;  4N4G A;  5GAM j;  4PJO E;  5KCH A;  1YI2 T;  1M90 C;  3CC4 T;  4FIB A;  3QJY A;  3OYK A;  3OYG A;  4A4E A;  1WJR A;  3JCM g;  4C92 E;  2PQW A;  4OGC A;  4AKH A;  2X4X A;  3OYB A;  1WJS A;  4C8Q F;  3QZ5 B;  4M75 G;  2A7Y A;  3SDZ A;  3TW6 A;  3OYE A;  2EAY A;  2HD0 A;  1KD1 C;  5GAO q;  5GMK m;  2FYK A;  4KT0 E;  4A54 A;  1TH7 A;  2E10 A;  3MEV A;  4RMO A;  3T9N A;  3GOX A;  2C06 A;  3CMA T;  2BS3 A;  3JCM W;  2PU9 B;  4XK8 E;  3G6E A;  1IRE B;  1KQ1 A;  2O4X A;  4V2S A;  3BY7 A;  4C8Q C;  4HCC A;  1QP2 A;  1ZQ1 A;  2L3R A;  3MCA B;  5CR2 A;  3CCM T;  1PSE A;  4HNT A;  4C8Q G;  4IUT A;  2JN0 A;  1VUB A;  1AHJ B;  3OY9 A;  1YJW T;  4QQD A;  5CK9 A;  5J39 A;  1YHQ A;  3JCM d;  3WXM B;  5LJ5 h;  2QEX T;  3OQ5 A;  1KQS A;  4C5E A;  2DXC A;  4M78 C;  4M75 A;  3DKM A;  4M78 G;  2P0K A;  4JLI A;  3X26 B;  1IZ6 A;  5I2M A;  4M7D D;  3M57 A;  3CCR T;  2QI2 A;  3S3M A;  3JCM J;  5GAN h;  4OP0 A;  1VQM T;  2HBP A;  1KQS S;  2LVM A;  1VQ6 T;  2MAM A;  2K5I A;  3NTK A;  4LD9 K;  5A0G A;  3X24 B;  2DO3 A;  3C95 A;  4J6W A;  4M7A B;  2M0O A;  3CXC A;  2PUO B;  2WSE E;  1BI0 A;  4E7I A;  3FRN A;  2DEQ A;  4BE2 A;  1W4S A;  1VIE A;  5GAN 8;  2VC8 A;  2WSC E;  2XDP A;  2Y4X A;  3PMI A;  2ZPH B;  2XK0 A;  3DL1 A;  5CQX A;  1BYM A;  4IUP A;  3I55 A;  3SWN A;  2LC4 A;  5IAY A;  4A4G A;  5D6Y A;  4M77 D;  2KQW A;  3CXC S;  2E70 A;  2RHY A;  2RO0 A;  2LT1 A;  5CAI A;  1M4Z A;  2ZPF B;  5GMK i;  3N5B B;  4LOC A;  1VQK A;  1VQN T;  1M5Q 1;  4C0Z A;  3I56 T;  1VQ5 T;  3KXT A;  2DZC A;  3E9G A;  4AKG A;  3HO8 A;  4M7A F;  2XIC A;  4QVZ A;  4EMK A;  3FDR A;  3OB9 A;  4YTL A;  3HRT A;  4Y28 E;  2R58 A;  1QVG A;  3FC3 A;  1YJN T;  2MWO A;  2CZ1 B;  2QXF A;  3ZFJ A;  5GAN 6;  1GXI E;  4M75 E;  1NPP A;  2BUD A;  3QWL A;  1K9M C;  3OMG A;  3G71 A;  1N8R C;  4M7A C;  4KUL A;  1QVG S;  2CGH A;  2K57 A;  4M7A G;  3EAE A;  4BDZ A;  3KUF A;  1VQO A;  4JS4 A;  3TRE A;  2M16 A;  2E41 A;  4RCC A;  4X9C A;  4EMG A;  4RG8 A;  2KR6 A;  3CCV A;  5I2S A;  3HRU A;  4BD3 A;  1M1F A;  4X9D A;  2XU8 A;  3V7S A;  3OYA A;  3L2U A;  3HBL A;  4N0A A;  1B34 A;  2CS7 A;  1YI2 A;  1WJQ A;  5CCA A;  1BIB A;  4N4I A;  3CC4 A;  1KQ2 A;  3HHT B;  4C8Q D;  1M8V A;  3GP8 A;  2VXF A;  3S3N A;  5C0M A;  3BG9 A;  3MP8 A;  4PJO A;  3P8B B;  4B9X A;  4JRK A;  1D3B A;  4M78 D;  1QW1 A;  5CQY A;  1QVP A;  3TU4 K;  5D6X A;  2JTM A;  3CMA A;  1WQ7 A;  2JVV A;  5GAO p;  5D6W A;  4BBS M;  2QQA A;  2QQ8 A;  5GMK e;  5LJ3 h;  2M9U A;  4PL6 A;  4Y91 A;  1VQ7 T;  2I2L A;  3CCM A;  2EQJ A;  4BI3 A;  1FWZ A;  1YJW A;  1XTD A;  5FU7 B;  4BI4 A;  5FRM A;  2A3L A;  3OYN A;  4OF1 A;  3CPF A;  3FEO A;  4J7F A;  2QEX A;  4JRI A;  5CKE A;  2V8J A;  5AYF A;  1X6O A;  2ZGW A;  3V8K A;  3EFR A;  2MWP A;  1OYX A;  2R57 A;  2F5K A;  3LWH A;  4B9W A;  3JCM X;  2CYZ B;  2MF2 A;  2XHC A;  3CME T;  4M7D A;  3CCR A;  1OZ2 A;  2E64 A;  2KSS A;  3NFC A;  4LDU A;  4XTV A;  3J80 E;  1XQH A;  2WJ9 A;  4OB0 B;  3L1A A;  4JX6 A;  3L42 A;  4N4H A;  4UC4 A;  1G3S A;  2ZPE B;  2KMT A;  1VQ6 A;  3E9F A;  1Q7Y U;  1M1K U;  3P8H A;  4MDW A;  2K2V A;  3QYE A;  3VYH B;  3PIO A;  1K73 U;  2LX9 A;  2QDY B;  3CEY A;  1LJO A;  4HA8 A;  1Q81 U;  1PSF A;  4XU0 A;  2JZ2 A;  2DAQ A;  3QZ9 B;  1M1G A;  2ZCF B;  2IVW A;  2QA4 T;  4M77 A;  2HNI A;  2L8D A;  3M53 A;  1I8F A;  4VUB A;  1N9R A;  4HNV A;  5CKD A;  1G3T A;  3NTH A;  2CZ0 B;  5FU7 C;  2HQX A;  2VUB A;  4BBR M;  3PNW C;  1UGQ B;  1VQN A;  2GCX A;  5LL6 S;  3I56 A;  4M7A D;  3SB2 A;  1EIF A;  2RI5 A;  3VV0 A;  4BE1 A;  2VXE A;  3VKI A;  3OW2 A;  4M78 F;  2LDM A;  5GAN 7;  5LJ5 f;  3VYG A;  4IKF A;  1YJN A;  4LDX A;  1BI3 A;  2F69 A;  2LRQ A;  3BW1 A;  4NL2 A;  1VQ4 T;  3M54 A;  2RD1 A;  2RK2 A;  4JJN K;  4M7D E;  2LT4 A;  5LJ5 g;  4A4H A;  2AHJ B;  1Y96 A;  4NS5 A;  4ZN1 A;  5GAN f;  5J26 A;  3OW2 S;  2QDJ A;  3M58 A;  1YIT T;  1N27 A;  2D6F A;  5CVI A;  3GIB A;  4HCZ A;  1HXD A;  4II1 A;  3HB9 A;  1BIA A;  2LQ8 A;  3PT9 A;  2FL7 A;  1XNI A;  3OBY A;  4DOV A;  2DIQ A;  5GAN g;  3JB9 H;  3OYI A;  2FVU A;  3UT1 A;  4A4F A;  4E7L A;  2V8I A;  3INZ A;  3X20 B;  3BG3 A;  1Y07 A;  1VQ9 T;  1MGQ A;  4C8Q A;  3RES A;  4FT2 A;  1Y7X A;  3UWN A;  2KY9 A;  3HPW A;  5LJ5 d;  2DIG A;  4M77 E;  3JCM b;  3G4S T;  1Q86 U;  1U1T A;  1KHC A;  3QYH B;  4J7I A;  2WAC A;  2GQV A;  5FLX E;  4DA4 A;  3MEW A;  4QQG A;  2DJZ A;  2XDD A;  2E1H A;  4M78 A;  5CKH A;  2KK4 A;  2KAF A;  4E47 A;  3L2Q A;  3JB9 J;  4LDY A;  3UDC A;  3OMC A;  5L8R E;  5GAN d;  3GLX A;  2CZ6 B;  2LCC A;  2ZZD B;  2R5M A;  2E12 A;  2YRV A;  2DD4 B;  3E1S A;  2XI9 A;  3HKS A;  2RHX A;  3X25 B;  4C0D B;  4R55 A;  5GAM g;  1VQ7 A;  5GAM h;  1OI1 A;  2OTJ T;  3OA6 A;  4LD6 A;  3UPU A;  2EJG A;  3HZJ A;  1QP3 A;  3OYM A;  3LH0 A;  2K4Y A;  3V7R A;  4O6J A;  1VQ8 T;  4Q5W A;  2BS4 A;  4WF2 A;  2DXB B;  3KBG A;  2JTF A;  3BG5 A;  4C92 B;  1KG1 A;  4A53 A;  3HFO A;  3CCU A;  1KHI A;  4XTU A;  4XTW A;  2BS2 A;  4LDW A;  3TEE A;  1DJ7 B;  4QW2 A;  2LQK A;  3CME A;  2V8K A;  3OS5 A;  4J6X A;  3CPW A;  2OAU A;  3C12 A;  4F7U B;  3ME9 A;  3BFM A;  4PKC C;  4BDY A;  1VQ5 A;  3JB9 F;  2DXT A;  3FJP A;  3LGL A;  2DD5 B;  3A8O B;  4OGE A;  3V8J A;  2K5L A;  1UEB A;  2DXU A;  3JCM e;  1VQL T;  2MMP A;  3LX7 A;  4JDS A;  4DQ2 A;  3A8G B;  4CI0 C;  3MEA A;  2QQB A;  4NOY A;  3CPW S;  4LDV A;  4HL4 A;  5GAO l;  3R6O A;  2VGN A;  4XTY A;  2H3J A;  4C8Q E;  4X34 A;  3VKH A;  4IUQ A;  2HAX A;  2E6Z A;  1MHN A;  4C0G A;  5GMK j;  2QA4 A;  3SFM A;  3JB9 G;  4C92 F;  3G6E T;  2JUF A;  3P8D A;  3FIF A;  1WGS A;  2GFU A;  5GAN 2;  2E5Q A;  4GLK A;  4C0D C;  1YIJ T;  2XDB A;  2YLB A;  2DK3 A;  4M78 E;  1FKM A;  3ASK A;  4F7U F;  5DY9 A;  5KE2 A;  5LJ5 e;  3CCS T;  3PFS A;  4GY5 A;  5LJ3 f;  4M7A A;  1Y71 A;  2LNV A;  2RHZ A;  3JB9 I;  3Q1J A;  4D6W A;  5KCO A;  2KDS A;  1ZHI A;  4C92 C;  1OZ3 A;  5J3B A;  2EKO A;  4QVD A;  4C92 G;  2F5T X;  2KVQ G;  5LJ3 g;  5GAN e;  1H3Z A;  3QSU A;  3GNG A;  4KBM B;  1VQ4 A;  5FRO A;  1NJI C;  4F7U G;  4MIM A;  4BB7 A;  3OSS C;  2QQR A;  5GAO r;  4JRP A;  4A4K A;  1Q7Y C;  1M1K C;  2X4W A;  4OVA A;  4HCB A;  1NJI U;  1U1S A;  1JB0 E;  4XTX A;  1I4K 1;  1YIT A;  2RA2 A;  4J83 A;  1K73 C;  3J7A F;  1UGR B;  2EIF A;  3F70 A;  1Q81 C;  2IG0 A;  2VV5 A;  2JNG A;  2O4X B;  2RJF A;  2XID A;  3VU3 C;  4BAC A;  3OS2 A;  3JCM P;  2RB6 A;  3CCE T;  1VQM A;  3HRS A;  1K8A U;  5LJ3 d;  1O9S A;  3ZEH A;  5DM7 R;  4AI6 A;  1NPR A;  3V8L A;  3OBW A;  1VQ9 A;  3L2Z A;  4L6V 5;  5LJ5 j;  4HKE A;  5HK3 A;  2DXC B;  3GPL A;  3LW5 E;  3VUB A;  4M75 B;  3G4S A;  1I81 A;  3L2V A;  4IUU A;  2QTX A;  3CC7 T;  1JRI A;  2PVO B;  2HQE A;  2BIV A;  1FXX A;  5GAO n;  4Z6Y A;  2G3R A;  2P0P A;  3CBO A;  5GAN j;  4E7K A;  3A8H B;  2NLU A;  4M7A E;  4CRI A;  3OYL A;  1KC8 U;  2OTJ A;  4ELY C;  2M1H A;  2QF7 A;  2P4T A;  4HT9 A;  5EG2 A;  4J8O A;  3CC2 T;  1G3W A;  1QVF A;  1VQ8 A;  4OB2 B;  4FU6 A;  5HK0 A;  3SWN B;  1X01 A;  2YHT A;  3M56 A;  1WNL A;  3OYC A;  3RER A;  3JCM Q;  3PTA A;  1VIF A;  4L5G A;  4MZT A;  5CKB A;  3JB9 D;  5A0D A;  1YBY A;  1QVF S;  3MHX A;  3RMQ A;  2PUK B;  1Q82 U;  3HSB A;  1I5L A;  2O01 E;  4OMF B;  2MI6 A;  3LLR A;  2WSF E;  1JBM A;  4XTZ A;  1VQL A;  2D0Q B;  5HKC A;  3JCM h;  4AKI A;  4M75 C;  4ZTF A;  1Q86 C;  3L2R A;  4EMK B;  2RI2 A;  3HP9 A;  3QBY A;  4XU3 A;  2P0Q A;  3VUZ A;  3A8L B;  4PJO D;  2Y90 A;  2VYT A;  4F7U E;  4R56 A;  2CZ7 B;  1BI1 A;  2VGM A;  3LGF A;  4C92 D;  3M4Y A;  4HT8 A;  3ER0 A;  2B8A A;  4FSX A;  5LJ3 e;  4EPC A;  3NTI A;  3PMT A;  4FT4 A;  2RI3 A;  2DZ9 A;  4JUV A;  4P5N A;  3QXE B;  5M9O A;  1M90 U;  3MET A;  1H64 1;  2DKG A;  2L5Q A;  3RKX A;  1YIJ A;  2QQS A;  1S72 T;  3H6Z A;  4ATO A;  5IT9 E;  4MZP A;  2DVE A;  3JAM E;  2K3Y A;  3CCS A;  5EJC A;  2CKK A;  2RHU A;  4JS5 A;  2OTL T;  4ZGJ B;  1KD1 U;  4ME7 A;  5GAM f;  5GAN 3;  2DTH A;  5FU6 B;  2FHD A;  5DLO A;  3DB4 A;  3HL8 A;  3SWN C;  1QLB A;  2PVG B;  3M9Q A;  4PLL A;  4PNO A;  5CIU A;  3RUX A;  1UB4 A;  3QPH A;  3OYF A;  5FRN A;  3M4G A;  3L2W A;  4MZM A;  1B34 B;  1BI2 A;  2RM4 A;  5C6S A;  3M55 A;  4OB1 B;  1VQP T;  3QII A;  4E7H A;  2RK1 A;  3VKG A;  4KUI A;  1NZ9 A;  2K3X A;  3QO3 A;  4O5V A;  4QVC A;  5HY6 A;  3RKY A;  4XAX B;  4PJO B;  4RCB A;  4RKU E;  3CCL T;  4XU1 A;  4NC6 A;  2QFZ A;  1D3B B;  2XKO C;  3CBP A;  1FX7 A;  5GMK l;  3LWI A;  3CCJ T;  3PIP A;  2EWN A;  4EMK C;  3QUI A;  2E65 A;  3WVD B;  2X4J A;  2EJ9 A;  1YJ9 T;  1O75 A;  3QKJ A;  3QYG B;  4DOW A;  3CCE A;  3V7C A;  3CCQ T;  3URG A;  5LJ3 j;  4BE0 A;  3CD6 T;  4M6V A;  4RG2 A;  4XU2 A;  4C5H A;  3H4C A;  3DLL A;  3M5A A;  3MO8 A;  1U8R A;  4BUG A;  5GAM d;  5GAN 4;  3X28 B;  2RJC A;  3OYY A;  4L59 A;  4ELZ C;  4EDU A;  3HFN A;  4ZGD B;  4J5Y A;  4Z02 A;  4BY6 B;  4MFD A;  3CC7 A;  2EFI A;  3QDR B;  4PLI A;  4IUR A;  4M7D B;  3JCM V;  3OSV A;  5FU6 C;  4JX5 A;  4PJO F;  3O8V A;  4JLG A;  3S6W A;  3M59 A;  2KMG A;  3DLM A;  4MMK A;  3ZBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...