3A8HB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8hB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8hB02
4Y28E 4RKUE 2CZ6B 2DD5B 3WVDB 3A8MB 1UGQB 1GXIE 1UGRB 3X26B 2WSEE 1DJ7B 2ZPBB 2PVDB 2DXCA 4OB1B 3X25B 3VYGB 4ZGDB 4L6V5 2ZPEB 4OB3B 2PUOB 3QYGB 1AHJB 2PVGB 2DPPB 2DXCB 2CYZB 3A8LB 1UGSB 1PSFA 2ZPFB 2ZZDA 3QZ5B 1UGPB 2WSFE 2ZCFB 3VYHB 2AHJB 3QYHB 2QDYB 3A8HB 4XK8E 2CZ7B 4ZGJB 1JB0E 3X28B 4OB0B 3A8GB 2PU9B 2PVOB 2ZZDB 3WVEB 4OB2B 2DD4B 2CZ1B 2DD5A 1PSEA 4FM4B 3X20B 3VYGA 3A8OB 2O01E 4KT0E 1V29B 1QP3A 2PUKB 2WSCE 2ZPGB 1QP2A 2ZPHB 2DXBA 4ZGEB 3LW5E 1IREB 2DD4A 2DXBB 5L8RE 2D0QB 3QXEB 2CZ0B 2ZPIB 3HHTB 3QZ9B 3X24B
chains in the Genus database with same CATH superfamily
2JXBA 2RD1A 1NYFA 4NS5A 1NPPA 3CBMA 3QPHA 3A8MB 3ER0A 2YWWA 3V7SA 2KMGA 1Q82C 1UGRB 5IHIA 3BDUA 3EHQA 3EH1A 5FLXE 2EQMA 4LNPA 3MP8A 3JCMf 2D1XA 1VQ7Q 2QG9B 7AT1B 1OOTA 2J7IA 2QDJA 1E7OA 3O5ZA 1RABB 2KT1A 1JSTB 4C92B 3CCLT 3OYLA 3LGFA 3CMEQ 1UECA 1UE9A 3OBYA 3CCRA 1UB4A 4J6XA 1H3ZA 2HCKA 4AKHA 4NSTB 1WXTA 3S3OA 4ROEA 1Y0MA 5GMKm 4LUEA 3FJPA 3QZ5B 4XQ3A 4FIBA 4JRIA 1YIJT 3H4CA 2KSSA 1N27A 4PLIA 3OW2S 3OYNA 1D1AA 2ED1A 5CIUA 4JUVA 5LL6S 2XDBA 4WTOB 1VQ4A 3VS2A 3EG2A 4J9IA 3CCLQ 3EG0A 2KEAA 1W98B 4WCIA 1AWOA 5ICPB 3EFSA 1M8VA 3A5ZB 3M0RA 3NTIA 4CFWB 4IURA 5GJWB 2DM1A 3ZL7C 3VU3C 4OMNA 1BYMA 2JN0A 1Q95G 5IN1A 4J9BA 1OX8A 1K73C 4J6YA 1ZHIA 1TUGB 4FX3B 3RGFB 2YRVA 4QVZA 3UF4A 2I2LA 4ELJA 4M77A 2CJMB 4ORZA 1Z9QA 2DD4A 1ZA2B 1PKSA 3QJ6A 3CCQA 4G6LB 1H92A 2MOXA 5L23A 2NWMA 5GMKe 2RI3A 3EG9A 3EG9B 4TVRA 4DA4A 2MYSA 3META 1YCSB 4ZTJA 2WEVB 2XDDA 1FYNA 4EC8B 2HSPA 2DF6A 4QVDA 1UGQB 2AIRB 5I21A 1I0CA 4F14A 3X26B 2LW4A 5GAMh 1VQ8T 4OMFB 1TUDA 5GANe 4MZMA 5IDNB 2HZYA 2DXCA 1G2BA 2Y90A 3K7AM 2P4TA 2COWA 3CC2T 2JNGA 1UJYA 3EGDA 4C8QB 2KRNA 2L3PA 3E1SA 1Q86U 4AI6A 1OEBA 3OYAA 2K3XA 5GMKi 2V8IA 1LOJA 4F6UB 2EIFA 4C92G 1ACMB 2ZZDA 3LH5A 2NUTB 2WSFE 4DBQA 1WJQA 2XD0A 4XAXB 2O4XA 1XTDA 5HKCA 1FMWA 1VQNA 2JT4A 4WF2A 1YJWQ 4DOWA 1QCFA 4BB7A 4PJOF 2QF7A 2DVJA 3GTMS 2EW3A 4HVWA 4A4EA 2DA9A 3A98A 4PJNA 2CKKA 1YJNT 2PVOB 1AWJA 5IXFA 2FL7A 3M03A 5GANg 4M75G 2XK0A 1TSFA 2KVQG 4DBRA 2FYKA 4BCQD 1N4MA 3SWNC 4LE9A 3QDRB 2WSCE 1UHFA 1C6VX 3Q1JA 3FRNA 1U1TA 3CC2A 3BW1A 2F2WA 2LNHB 3QXEB 2RK1A 3G7ZA 2QGSA 5GAMf 1Q81C 2UZLB 1UJ0A 1LVKA 1M5Q1 1LJOA 4OMOA 3JCMb 1XOVA 2YUPA 4BCOB 3QZ9B 2K57A 4FT2A 3HZJA 4E2FB 5M9OA 2PHGA 2V1RA 5CAIA 1ZBXA 1NJIU 2BS4A 1GFDA 5I5ZB 4C5IA 1QMZB 4C0ZA 3JRZA 1ABQA 2FZKB 2BE9B 1VQLT 4M7DG 4PJOE 4BCNB 1ZSZB 1WHHA 3S3NA 2PQWA 3JCMe 5EG2A 1X6OA 2F2VA 3CPFA 4Y92A 3V8JA 3UATA 2IIMA 3O8VA 4FW2A 2DX1A 3CCVQ 2RMOA 4ESRA 2ZAEA 2O9SA 1VQOA 3MEWA 1IXDA 4F17A 1EZZB 1G3NC 5KYNA 5LJ5j 2A7YA 1VQKQ 1VQ4Q 1K9MU 1H4LD 3CPWP 1YJNA 1K73U 2RJEA 3MEUA 3OS1A 2K9GA 2H3EB 1PNJA 4M75B 1G3YA 3M57A 3LLRA 2F1LA 2QXFA 4F7JB 4J9FA 4TTHA 4OGCA 3V7CA 3P8DA 3BHUB 4BCND 4CFVB 4J83A 2YUNA 4XK8E 1FKMA 3M9QA 1PHTA 2AKKA 4MFDA 1TFBA 1BI2A 3KUFA 4A54A 3PFSA 1YITT 3H9NA 2KR6A 2IW8B 3NTHA 2EYZA 4M7AE 1QMCA 2XIDA 5C6SA 4XU2A 4NL2A 2JS0A 2A0FB 2YUQA 4XTYA 2LJ3A 1OZ3A 4J7FA 2A36A 4LUDA 4QQGA 1O9KA 1M2OA 2AK5A 5HBEB 1RACB 4HNTA 3HSBA 3OYHA 2M9UA 2JOYA 4HA8A 3I56A 4M75D 2HMAA 2LT1A 3DB3A 4J8OA 4EOQB 1X01A 4PJOB 1M2VA 1W2BS 4C8QD 1PD1A 2R7GA 2DERA 3F5XB 3EFOB 4JJBA 4LD9K 4JJCA 1FX7A 8AT1B 1M90C 1Q86C 4BBRM 2B9RA 2K7AA 4KGXB 4MZPA 2XU8A 2K5IA 3HP9A 1VQKA 2LTOA 4GY5A 2F5TX 3JB9F 3VS4A 2KGTA 2M1HA 2WMBB 5CKEA 1KQSP 1GXIE 1IB8A 2VUBA 2BIVA 4L59A 1VINA 2EGEA 1P92A 1K9AA 2CP2A 4A4KA 3G6EA 3J81E 2E12A 4C8QF 1TH7A 4M7AA 2CP5A 5KYYA 4PNOA 2X3XD 3R6NA 2FZCB 1PKTA 2A28A 2H8HA 2RO0A 5HK0A 1KD1C 1Y7XA 1YJ9T 2VXFA 3D7SB 1VQ8Q 2EWNA 4L5GA 1D0YA 2PMIB 3J80E 1YN8A 2CGHA 3CCJQ 3HFNA 2W2HA 4QT7A 2GTJA 2EJGA 1A0NB 1I1JA 1WHJA 1X43A 4HT9A 3MKDA 1QKXA 1VQ9A 5IXBA 4OR5B 1AD5A 2SEMA 3JCMd 4LDXA 1H1PB 5EJCA 1ZSZC 5GAOl 1B34A 1ZBJA 2W9ZA 4KRTA 2L89A 1VQ8A 4M7DE 1K4US 4OF1A 3C12A 3QWLA 1H641 5LJ3j 4F7UG 5LJ3h 4XTVA 3JCMW 1RAEB 3JCMP 3X28B 2CSIA 4BCJB 2PK2A 2JS2A 1QVFS 2YSQA 2RQWA 4HVUA 1H8KA 2L3RA 2UZDB 1JXOA 4EOJB 3VYGA 2BS2A 5J39A 3WXMB 3I35A 1QP3A 2KDSA 3AHUA 4OMPA 1I81A 3VKGA 3G71A 3OBWA 4ZGEB 1Y71A 1PD0A 4F7LB 3LW5E 5GAOn 3DL1A 4KRDB 2D0QB 2A3LA 3VUZA 4C8QG 2I53A 3OYEA 2CS7A 1JXMA 1OKVB 1RI0A 1T0HA 3P8HA 1YBYA 3G4ST 2NLUA 4X34A 4C0DB 1D1BA 2L0AA 1OIUB 2QQ8A 1HD3A 2C0IA 1YIJA 2RHZA 4C92F 2SRCA 2KMTA 3LWHA 3GLXA 5D6YA 5ACBA 2JTMA 1GCQA 3HFOA 2CT4A 1SPKA 2YHTA 5CKFA 1WYXA 1VQOT 3RERA 1RLPC 3RNJA 3MIAB 4M78G 2C06A 2O31A 2VV5A 3OYFA 5CYIB 2EYXA 2GBQA 2RJCA 2P0QA 2CP7A 1QVGA 3GOXA 3C95A 5GJVB 3JB9I 3PIPA 1H26B 3H0FA 3PT9A 1H27B 4RTUA 1Y96A 3ASKA 4EOSB 3JCMQ 4JS4A 2EYQA 3VKIA 4EOIB 5FWBA 2HQXA 4C0DC 2DL3A 4LD6A 4EPCA 4OMLA 3CCMA 4QKUA 4C92A 4PJJA 4AFSC 5GAN7 3CCMQ 2M51A 3DKMA 2LC4A 3OYDA 2LZ6B 2DVEA 1RAFB 5FU6B 3BLHB 2NUPB 2LX7A 5KYYB 3CC7Q 3NFCA 4HNUA 4EMKB 4FSXA 1OYXA 2G6FX 5D6XA 2C5VB 1TXQA 1TUCA 1M1KC 3NMZC 4UC4A 2KXDA 1F5QB 2ZPGB 4MIMA 2DL5A 1KD1U 1S1NA 1JJ2S 1LNXA 2DILA 2OAUA 2DXBB 4UN0A 2KRMA 3UA7A 2K6DA 2HDAA 2ZPIB 2VKNA 3HL8A 2QYZA 4XTZA 1U06A 2RQUA 3EH2A 1B3QA 3R6OA 2W0ZA 4RKUE 3PIOA 4CC3A 3KXTA 1NLOC 5HVYB 2DEQA 3I9QA 2DAQA 3BY7A 4RTTA 1AZEA 4M7AG 2HEQA 2QI2A 1AWXA 4QQ6A 4LDYA 2JM9A 3JCMg 3CPWA 5C0MA 2DBKA 2DYBA 2ROLA 3UA6A 8ATCB 2C0TA 4CC7A 1HXDA 3VS3A 2EJFA 1OZ2A 4F6WB 4Z8AA 4OMMA 1VQMQ 4QW2A 1AEYA 3CCQT 1FINB 1U5SA 2L2PA 4PJLA 3TREA 2ZPEB 2LJ1A 2LNVA 2D6FA 3MY5B 3G4SQ 3FEOA 1S72T 5BNJB 1PRLC 3A8LB 2ZPFB 1VQOQ 1UUEA 2HNIA 1WZOA 3GF5A 2DK3A 4X9DA 2K79A 4ZGJB 1WHGA 2L5QA 5CO7A 4PJOG 2UUEB 2EGAA 4MDXA 2CUBA 1KC8R 1K8AU 2QQAA 2WIHB 1IRXA 3CCEQ 3NHNA 4JLGA 2QGGA 4JRPA 4EOMB 2RHXA 5DLOA 4E7SA 3KFVA 1SRLA 2PUKB 3EAEA 1N5ZA 4Q5WA 1K1ZA 2VB6A 2DXBA 5EFQB 2IVWA 4DOVA 3QHWB 4RTXA 4F7NB 4QSHA 5LJ5g 2QTVA 3OS5A 3T9NA 4D8KA 1KSWA 4ELLA 1RAAB 1N9RA 3EFOA 6AT1B 3QUIA 4BY6C 1R8OB 4AFUC 3M56A 3I55A 4Y28E 2CZ6B 3FLGA 2FB7A 2IPOB 1J3TA 5IHNA 2QAZA 1YITQ 1XNIA 3QHSA 4VUBA 4EOLB 2LRQA 1W6XA 4MZTA 3QO3A 3SFMA 1AVZC 1UTIA 2GFAA 5DQVA 5I11A 1YJ9Q 4M7DF 4GLMA 2DYIA 1ZX6A 2HD0A 2F69A 5GAOm 5FRMA 1X69A 2KBTA 4PL6A 1YJWA 3VYGB 1G5VA 1SHGA 4L6V5 5HBHB 4LDWA 1NJIR 2EFIA 4KGVB 4RMOA 1QLBA 3BFMA 3MEVA 1JJ2P 5FRNA 4FYYB 1KIKA 3REAB 3NDQA 2I0NA 4J9GA 5LJ5e 3CCJA 1MMGA 2V1QA 2WACA 2WXVB 2CYZB 2DKGA 2V8KA 1T3SA 2YXYA 4HLQA 5FROA 2CT3A 5IHYA 2UZEB 2GGRA 5GANf 3CCUQ 4YTLA 3RKYA 1KQ2A 1NYGA 1RI9A 4FYVB 1H24B 1X27A 4EMKA 4BE0A 1GL5A 2ESWA 2DJQA 3EHRA 2DJZA 4EOKB 5GANj 4CFMB 2MK5A 5I2SA 1BI1A 4A63B 2XHCA 3HRTA 3PMTA 4F7UF 3QJYA 1VQMT 4EDUA 3TQ7P 3QDFA 3WVEB 9ATCB 2LCLA 1WHLA 4LN2A 2DD4B 3M55A 2GFUA 4II1A 4PKCC 2QEXA 4FM4B 3CMET 2EKOA 2C5XB 3RUXA 5J3BA 5CQXA 4KT0E 4IUPA 1QWFA 3TN8B 2QDLA 4JLIA 4JJNK 4N0AA 4C8QC 2E3IA 2RHIA 5GANd 2W9FA 3RR6A 2XKOC 3PVLA 2GCXA 3TNHB 3TU4K 1NZ9A 2JW4A 3QSUA 1TS9A 2FEIA 1G3SA 2GNCA 2RI5A 3DOGB 3QG1A 4F7UA 1VOMA 1V1CA 4EMKC 3RKWA 1M1GA 3G71Q 1U8RA 1BI0A 4Z02A 2RF0A 4BCHB 2YLCA 3L1AA 3OYBA 1VQ6T 3LH0A 3UPUA 3EOCB 5AT1B 2JJ9A 3JCMX 1KQ1A 3X25B 2RHYA 3ULRB 3VRYA 3VUBA 5CQYA 2MCNA 3E2UA 2D8HA 2M02A 4NL3A 2FG0A 1YJNQ 4F7UB 2O4XB 4PK4A 1TTHB 1UNLD 3A1PA 1XQHA 3LX7A 1WNLA 2QGFB 2CCHB 4N0AC 5FU7B 5GMKh 3PO3S 1M4ZA 2RN8A 1K8AR 4PFZA 5FU6C 1U3OA 4NOYA 1RAHB 1OIYB 3BLQB 3CD6T 4E7ZA 4J6WA 4BDYA 2DXUA 4HXJA 3CCRQ 1K9MC 1Q7YR 4HNVA 4M78C 4AG2C 5DM7R 1MNDA 1VYTA 3FB9A 3MP1A 3KHIA 4JRQA 3L2RA 2DBMA 2XDPA 2DO3A 3PE0A 5LJ5f 2C6TB 4OB2B 2D0NA 2CZ1B 1AOJA 1Q82U 1PSEA 4PFPA 3X20B 2OTLT 2NUZA 1YI2Q 1V29B 2IN3A 1KHCA 2DL7A 4OMQA 2E6NA 1VYUA 4J5YA 1N8RR 4C5HA 3VS1A 4R55A 4YOOA 1WHMA 4JJDA 2Z0WA 1MNEA 5L8RE 2E10A 4R56A 4A53A 2K2VA 2EYWA 1D3BA 3L42A 1M27C 3OS2A 1I07A 3PMIA 2RNAA 4QQDA 1E6HA 5CEIB 3X24B 4E7LA 1GY3B 2K5FA 1SEMA 2C4GB 2MI6A 3GIBA 1Q82R 4ANJA 1VQLA 2WSEE 3CCUA 2M16A 4M78D 1BCMA 1DJ7B 3THKA 1VIFA 4F16A 2COZA 3I5SA 4E7HA 3CEYA 3QIIA 4BY1X 2RQVA 2LP5A 3OMCA 2X4WA 2OTJQ 1OGUB 4F70B 5CR2A 4KH0B 2DMEA 3M4GA 1D09B 2LX9A 4BE2A 4EIKA 3OMGA 1D1CA 2MAMA 1X6GA 1O75A 4HKEA 5GAN5 4BY7X 1VQ7T 3EGUA 1NPRA 1SG5A 1VQ5A 4PJOA 1HYOA 2OJ2A 1H1SB 2YRCA 3G33B 3SB2A 1CKBA 1C0MA 3DJBA 1KQSS 3PTAA 1M1KU 4JX5A 3OYKA 1NEGA 2JMAA 1SSFA 3SD4A 3CCUT 2X4JA 3GP8A 4ROCA 3M0UA 4EMGA 2AZSA 4M77E 1GFCA 2RHUA 2G3RA 1D3UB 3TSZA 1ZA1B 2OTJT 3OB9A 1GUXA 2KT8A 3HRSA 1BIBA 1QVPA 2O01E 1K73R 2VASA 1VYVA 2F2CA 3VS6A 1FVVB 2WIPB 4HCBA 2DL8A 2DXTA 3VRZA 1H1QB 3CQTA 4ELYC 5LJ5d 4J7IA 3VJPA 3H0IA 4M7AD 1JRIA 2HSEB 4M75A 4PJOC 3EJ1B 3E19A 2D8JA 4J9DA 2L3QA 3CCRT 1VQ7A 4DBHA 1WPYA 4KRCB 5IHKA 2YLBA 2EYYA 4E7KA 3I55Q 2P0KA 1M2VB 4Y72B 3RMQA 1M9SA 3DLMA 4ZN1A 3M4YA 4EONB 2E1HA 1GBQA 3SHWA 5CKHA 4LDUA 1RUWA 4DBFA 1TWBA 4KUIA 1KK7A 1YHQQ 5GMKl 1QW1A 1ABOA 4ZGDB 2J6OA 2LQ8A 1B34B 2DTIA 4LXCA 2PNIA 2P84A 1JOWA 1SF9A 1WQ7A 5FWCA 4M7AB 2DZCA 4PJMA 2EUFA 1AHJB 2PVGB 2BE7D 2DPPB 3RDVA 3CCVT 1YJ9A 4J9EA 1AWWA 4X1VA 5GAMg 2JZ2A 1D3BB 3M0PA 4XTWA 4M75E 1QWEA 1Q7YU 2JVVA 2OTJA 1PC0A 4RTZA 1RLQC 3RKXA 2EPDA 3M0TA 1Q81U 2Y4YA 2CUDA 4CC2A 1Y07A 4FCYA 1VQ4T 4J9HA 2KR3A 1FMKA 3LQ5B 4OGEA 1QVFA 3CBOA 1WGSA 4RTWA 5GAN8 2OI3A 2EQJA 1OI9B 1VQKT 1M8MA 5I2MA 3C0CA 2QA4Q 2BKDN 3H6ZA 1QLYA 3CMAT 2WHBB 2K5LA 4E6RA 1NBEB 1ZLMA 1B7TA 3MP6A 1GCQC 4JDSA 1JEGA 5IH2A 4K11A 5KYXB 4EORB 4BD3A 1UDLA 1VYWB 1WJSA 1YI2T 1Q81R 3CPWS 1QVGP 3TVTA 3HTRA 3H41A 2R58A 2COYA 2V8JA 3M54A 3JB9J 3QKJA 5GAN3 4XTUA 2KYBA 1I5LA 3DB4A 3E9GA 1UG1A 2HKNA 2ZGWA 3CCSA 1M1FA 4C5EA 3M53A 2L3SA 1BU1A 1NE8A 1OI1A 3EFRA 3JCMc 5CVIA 4KULA 2G9XB 1YFNA 4AFQC 1BCOA 1MMNA 4F6SB 4LOCA 2JTFA 3QHRB 2VXEA 4E7JA 4ME7A 3OYCA 3M0SA 2CP3A 3MEAA 4IUUA 3OS0A 2RJDA 3FIFA 4Y91A 4BACA 4MDWA 1VQPQ 2LJ0A 3CC4Q 1OL2B 5FGKB 3TNIB 1T3LA 5KYUB 5A0LA 1GRIA 4A4HA 5LQFB 1IGQA 3VV0A 1VUBA 3NGPA 4BY6B 1YP5A 3ME9A 4RCCA 2IW6B 4E47A 4M7DD 2XMFA 1BI3A 1M30A 2YDLA 1YJWT 1R0BG 1UGPB 3CCQQ 3LYIA 3CXCS 4M77G 3BLRB 2OX7A 1NLPC 3EIDB 4M6VA 4OGRB 4F7UE 1M3CA 4C92D 2DIQA 4EMHA 5EC7A 1AT1B 1BBZA 4CFNB 4YOZA 4XU0A 1G3WA 3E9FA 4JX4A 3MJXA 2R5MA 2XG8D 1OL1B 2QK0A 5HNBB 1YITA 4BBSM 3I5RA 1URCB 4EC9B 4M7DB 4FL6A 4B9WA 1W2BP 2M0OA 4KUDK 2DFUA 2LVMA 1KJWA 1OPKA 2DL4A 3J7AF 2MIOA 3OYYA 3M58A 2O9VA 4CRLB 3RBBB 2HBPA 3POMA 4GBQA 5KE3A 2LQNA 3MO8A 4P5NA 3FDRA 3F70A 2J6FA 1VQ9Q 1RL2A 4N4HA 5D7UA 3V8KA 1M90R 3S6WA 1ZUKA 1M3AA 2D9TA 2E6ZA 1YHQA 4IUTA 1Q86R 2EAYA 4E7IA 2EBPA 2QA4T 2ENMA 1LPLA 2EQUA 2NUTA 3O0GD 3CMAQ 1VQ6A 2DD5B 4F7SB 3EGXB 4RTYA 2L8DA 5DY9A 2JTEA 1PKDB 2EKHA 1VQPA 1UHCA 1GCPA 1QKWA 1UFFA 3M0QA 5J26A 3CC7A 3CC7T 1IZ6A 2RM4A 3OYIA 1S72Q 4II5B 2NUPA 4M7DC 4IIOA 2LCCA 2LDMA 1KD1R 4M77C 3TNWB 2RJFA 2YT6A 1OX9A 4OVAA 2DETA 2VGNA 4Z88A 1YWPA 2BZXA 4LDVA 2KQWA 3CCSQ 4JRKA 4RG8A 4GLKA 3L2UA 1MHNA 2DMOA 4AT1B 3SEMA 1YCYA 2W99A 3HKSA 2CDTA 2FPDA 1MMAA 3V7RA 1VQ9T 4M78E 3BHTB 2HL3A 1OULA 5KCHA 1JU5C 2ZCFB 2CSQA 3OY9A 1EFNA 4HCKA 3QYEA 3QYHB 3CC4A 3A8HB 4FSSA 4C0GA 1YHQT 1VOLA 5LJ5h 4MMLA 1WXBA 4DEYA 3M59A 3CD6A 4FYXB 1W2BA 4B6MA 5CKBA 3P8BB 2FPFA 5L2WB 3L2ZA 2RI2A 4M7DA 4C0FA 1E6GA 3A8OB 4BCIB 4ELZC 5I22A 1QVFP 2KROA 1R0CB 4C8QE 4BCQB 4BCPB 2E64A 1GBRA 1HSQA 1QP2A 1HK9A 2JGZB 2ZPHB 2P4RA 2PTKA 1X2QA 2MMPA 2K3YA 1H3HA 1ZP2A 3OQ5A 2KAFA 2FHDA 3GNGA 3QWXX 1M3BA 1MUZA 1K0XA 4YOSA 3BDLA 2ATCB 2CH4W 4M78A 5FU7C 1WQWA 1HJDA 2BZYA 1FMVA 3PNWC 2FVUA 3CCMT 1YNZA 1RADB 3I56T 1B07A 1W70A 2J06A 3GNFB 2QEXT 5DLQE 1X6BA 2DEUA 3TEEA 2BTTA 2X3WD 4JZ3A 5KCOA 2DE0X 5KH6A 3SWNA 3H8ZA 3DLLA 5GAMd 2EGCA 2OTLQ 3QYBA 4BXXX 4IMYB 1IHWA 4OB1B 4FU6A 4EOOB 1E7PA 2E70A 2A08A 1KXUA 1R77A 3TSWA 4YC3B 2K4YA 3ZFJA 3JCMh 5CK9A 1OV3A 4C8QA 2X4YA 1BIAA 2PUOB 4PFOA 3QYGB 4V2SA 4AFZC 2J6KA 1ZUUA 5A0DA 1JJ2A 2PZ1A 4M78F 2VVKA 4BI4A 4C5GA 2WJ9A 2E4HA 2QEXQ 1GUXB 3N5BB 3TCJA 3CCST 4AKIA 2LCSA 2AHJB 2E3HA 5AYFA 4RCBA 2QDYB 1U1SA 1GH6B 2GF7A 4KGZB 3JB9D 2HL5C 4F04B 3NTKA 3G4SA 3A8GB 3OW2P 5FW9A 1MV3A 2V26A 1F1BB 1G8XA 2DZ9A 1X2KA 5ECAA 2RB6A 3HB9A 1H25B 3AT1B 2JUFA 2BUDA 3CMAA 1VQ6Q 3OA6A 2HQHA 1UGVA 1M1KR 1M90U 1QCOA 2RH2A 3JAME 2E65A 3REBB 1EIFA 1W1FA 3G71T 2AKLA 4JZ4A 2B86A 4BCMB 2E5KA 3MHXA 3RESA 4M78B 2FRWA 2MWPA 1WXUA 4CFXB 1NG2A 3EGDB 3BG5A 3LWIA 2KRSA 2C5NB 3PVQA 2EVRA 2JM8A 1WDXA 3WVDB 1YIJQ 1BB9A 1K0SA 2DRMA 1PG5B 3OW2A 3KBGA 3ZBDA 5CKDA 1PRMC 4BE1A 5DQWA 2Y4XA 3VS5A 4BI3A 2DTHA 2HAXA 2X1NB 3BHVB 1T0JA 3IQLA 2PVDB 1LCKA 1VA7A 3RMSA 2AZVA 5LJ3d 2QASA 4QVCA 2FO0A 3HO8A 1P5EB 1PWTA 3I56Q 2W96A 4RUGA 5CCAA 4JS5A 4BCMD 1I8FA 1BK2A 2VWFA 1OPLA 2BPMB 3MY1B 2VYTA 3RIRA 2K3BA 2R57A 4FYWB 3QBYA 5IDPB 3URGA 4AG1C 3L2VA 1UGSB 2C0OA 2MF2A 1VQNQ 2GTOA 2RK2A 1UEBA 3G6ET 1MMDA 2O2OA 5GAN6 5GAN2 2KE9A 2CH4A 3HPWA 2CZ7B 2MPXC 2X51A 3M5AA 1KC8U 1OKWB 1ZSGA 2DTOA 1WX6A 1SRMA 4BCGB 2X4XA 1XJWB 5IAYA 2FPEA 5GANh 1TG0A 3CCEA 3JV3A 3JB9G 4M77F 4FT4A 4B9XA 1VQLQ 4HT8A 1KC8C 4IIMA 2FRYA 1KG1A 2JMCA 4D6WA 1KQSA 3CCVA 2QTXA 3VS7A 1SHFA 1QCNA 3QWYA 3L2QA 2EQIA 3JCMJ 1D0ZA 2IVXA 5HK3A 2G77A 2BS3A 4CFUD 3V8LA 5KYWB 1QVGS 5IT9E 1QQJA 5KYXA 3INZA 2HKQB 4R0KA 1W4SA 3CCLA 4M77D 2W10A 4IUVA 1VQ5Q 1MV0B 5A0GA 2RA2A 4BUGA 4BCFB 3CBPA 1H1RB 2F5KA 1KFZA 1EX4A 3I55T 4MFEA 1VQMA 2OAWA 3LGLA 3JSCA 2BKZB 3EGXA 4XU1A 5HQ0B 2J05A 1I5OB 2QQ9A 4CFUB 2ECZA 2K2MA 2FZGB 2ZPBB 1TU0B 1BKBA 4PLLA 2QFZA 1YWOA 4DQ2A 1WIEA 1NJIC 4O6JA 5KYUA 4C92E 2B8AA 1N6AA 1WJRA 1Y96B 4HVVA 3ZEHA 2IW9B 3CCJT 1NM7A 2X9HA 3MCAB 4M77B 4JX6A 2CCIB 2V22B 4M75C 1JKWA 3FC3A 1O9KB 2MWOA 3UWNA 3UT1A 1K76A 3OYGA 2KXCA 2QQBA 1VQ5T 5HCKA 3DDPB 1VQNT 3VYHB 3EG1A 4M75F 4N4IA 1FWZA 4ZTFA 3B57A 1OU8A 3OSVA 4FW1A 1ZQ1A 3PGGA 4MMKA 4BDZA 2GQIA 2YRDA 2F2XA 3SWNB 2CP0A 2IG0A 1O9SA 3HBLA 1C9BA 1SKUB 1Z9ZA 2VC8A 4KH1B 4BI8B 3CC4T 3TW7A 1ENWA 3VKHA 3TW6A 3HRUA 2YUOA 1VIEA 2DNUA 2DD5A 1AISB 3C94A 4HL4A 1PM3A 1Y57A 3NPFA 4KBMB 1AZGB 2OTLA 2EQKA 4XTXA 3BG3A 2KI7A 3CD6Q 1YI2A 4M7AC 4PJOD 4RODA 3U23A 2KNBB 5KE2A 3SDZA 2CREA 3G6EQ 1IREB 2LQWA 5GAMe 4HCZA 1WHKA 3HHTB 1C1AA 2EJ9A 2NYSA 5D6WA 5LJ3e 2WPAB 2LT4A 1WI7A 1TD6A 2RQTA 1IHVA 1IO6A 2BZ8A 1UNHD 4NC6A 2O88A 1OU9A 4IUQA 3CCET 5GAMj 4M4ZA 4EOPB 1MGQA 2P0PA 4CXAB 1ZSZA 4OP0A 4JPBW 2PJQA 1G3TA 2LQKA 1JO8A 4CRIA 5HBJB 5HY6A 4C92C 4HCCA 3GPLA 4ATOA 2KY9A 1WA7A 3OSSC 3DDQB 1ZUYA 1NEBA 4ZN3A 3DTOA 1RAGB 4CI0C 2WFYB 5A2QE 2QA4A 2H3JA 3BG9A 1S72A 2R5AA 1XO2A 3G1JA 2DLPA 4X9CA 5GAOp 3CC2Q 4OB3B 3OYMA 2ED0A 4O5VA 5GAOr 1JBMA 1WLPB 2C5OB 3OYJA 2DXCB 2QQSA 2KK4A 2KYMA 2QQRA 3H0HA 1H28B 2HQEA 1PSFA 1X75C 2A37A 1VQPT 2WMAB 1JQQA 4ZNXA 4I3ZB 4J9CA 1KHIA 1K8AC 4N4GA 3CMEA 2I40B 1V76A 1WFWA 1CSKA 2X35A 2XI9A 5IF1B 5LJ3g 1ARKA 2PK9B 4AKGA 2RQRA 3L2WA 1RAIB 1JB0E 1AD6A 1PCXA 4DEXA 2DIGA 1K9MR 1Q7YC 1FXXA 2E5QA 2UZBB 1CKAA 4OB0B 2AT1B 2PU9B 4RTVA 4BCKB 4A4FA 2RPNA 2ZZDB 5KYWA 3EG3A 3UDCA 1OQKA 3GBQA 2GQVA 4D8DA 5LJ3f 2ROTA 1N8RU 1I4K1 5GMKj 1IGUA 4AMCA 5GAN4 4CC4B 2HBWA 3C4SA 4XU3A 3JCMV 2DRKA 3MI9B 5LMKB 1SSHA 3VS0A 5GAOq 1N8RC 1G83A 4IKFA 2M0YA 1N9SA 4Z89A 3MPUB 1UNGD 2XICA 4A4GA 1JSUB 2CZ0B 4Z6YA 2E41A 3JB9H 1E9HB 1BU2A 2LMJA 4RG2A 1D0XA 1TOVA 2CP6A 2VGMA 2ABLA 3BE3A 3CXCP 3CXCA 4M7AF 3FJ5A 3S3MA
chains in the Genus database with same CATH topology
2RD1A 3P8HA 1YBYA 2K5FA 3G4ST 2NLUA 4NS5A 1NPPA 4X34A 4C0DB 3CBMA 3QPHA 3PNWC 2FVUA 3A8MB 3CCMT 3I56T 3ER0A 2MI6A 3V7SA 3GIBA 2KMGA 3GNFB 1Q82C 1UGRB 2QQ8A 2QEXT 5DLQE 1VQLA 3TEEA 2WSEE 3CCUA 2M16A 3BDUA 5KCOA 5KH6A 4M78D 5FLXE 1DJ7B 1YIJA 2EQMA 3SWNA 2RHZA 1VIFA 3H8ZA 4C92F 3DLLA 2KMTA 5GAMd 3MP8A 3LWHA 4E7HA 3CEYA 3QIIA 3GLXA 3QYBA 5D6YA 3JCMf 2JTMA 3OMCA 2X4WA 4OB1B 3HFOA 4FU6A 5CR2A 1E7PA 2QDJA 2E70A 2YHTA 3M4GA 5CKFA 1VQOT 3RERA 4C92B 2LX9A 2K4YA 3ZFJA 3CCLT 4BE2A 3OMGA 4M78G 3LGFA 3JCMh 3OYLA 2MAMA 5CK9A 2C06A 2VV5A 4C8QA 1O75A 3OYFA 2X4YA 1BIAA 2PUOB 4HKEA 5GAN5 2RJCA 3OBYA 3QYGB 1VQ7T 2P0QA 4V2SA 3CCRA 1NPRA 1UB4A 4J6XA 5A0DA 1VQ5A 1H3ZA 1QVGA 4PJOA 1JJ2A 3GOXA 4AKHA 4M78F 3C95A 3JB9I 3S3OA 3PIPA 4BI4A 4C5GA 5GMKm 2WJ9A 3FJPA 3QZ5B 4XQ3A 3SB2A 4FIBA 3N5BB 3PT9A 3TCJA 3CCST 4AKIA 4JRIA 1YIJT 3H4CA 1Y96A 3ASKA 2KSSA 2AHJB 1N27A 5AYFA 1KQSS 4RCBA 3JCMQ 2QDYB 1U1SA 3PTAA 4JS4A 4PLIA 3OW2S 2EYQA 2GF7A 3VKIA 3OYNA 1M1KU 4JX5A 4C0DC 2HQXA 4LD6A 4EPCA 3OYKA 1SSFA 5CIUA 4JUVA 4C92A 3SD4A 5LL6S 5GAN7 3CCUT 3CCMA 2X4JA 3GP8A 3DKMA 1VQ4A 2XDBA 3NTKA 3G4SA 3A8GB 4EMGA 2LC4A 3OYDA 4M77E 2DVEA 2RHUA 2G3RA 5FU6B 3NFCA 2DZ9A 3EFSA 4HNUA 4EMKB 1M8VA 3A5ZB 3NTIA 4FSXA 4IURA 2OTJT 2RB6A 1OYXA 3HB9A 3OB9A 3VU3C 1BYMA 3HRSA 2JN0A 2JUFA 1BIBA 1QVPA 2BUDA 2O01E 5D6XA 5IN1A 3OA6A 3CMAA 1K73C 4J6YA 1ZHIA 1M1KC 1M90U 2RH2A 4UC4A 2YRVA 2E65A 3JAME 4HCBA 4QVZA 2DXTA 1EIFA 2ZPGB 4MIMA 2I2LA 1KD1U 4ELYC 5LJ5d 4J7IA 4ELJA 3G71T 4M77A 3VJPA 1JJ2S 1LNXA 3MHXA 3RESA 2OAUA 2DD4A 2DXBB 3QJ6A 3CCQA 4M78B 5GMKe 2RI3A 4M7AD 1JRIA 4PJOC 2MWPA 4M75A 2ZPIB 3E19A 4TVRA 3HL8A 4DA4A 3BG5A 4XTZA 3CCRT 1VQ7A 3META 3LWIA 4ZTJA 1WPYA 2YLBA 4E7KA 3R6OA 2P0KA 2XDDA 4RKUE 3PIOA 3WVDB 4QVDA 3RMQA 3KXTA 3OW2A 1UGQB 1M9SA 3DLMA 2DEQA 3KBGA 4ZN1A 2DAQA 3BY7A 3M4YA 5I21A 3ZBDA 4M7AG 2QI2A 3X26B 4QQ6A 4LDYA 5CKDA 4C5EA 5GAMh 4OMFB 1VQ8T 2E1HA 3JCMg 3CPWA 4BE1A 5GANe 5C0MA 5CKHA 2Y4XA 4MZMA 4BI3A 2DTHA 4LDUA 2HAXA 2PVDB 4KUIA 2DXCA 3RMSA 2Y90A 5LJ3d 1QW1A 2P4TA 5GMKl 4QVCA 3HO8A 3CC2T 4ZGDB 1HXDA 2EJFA 2JNGA 5CCAA 4JS5A 1OZ2A 4C8QB 2LQ8A 1B34B 2DTIA 4QW2A 1I8FA 3E1SA 3CCQT 3TREA 2ZPEB 1Q86U 2LNVA 1WQ7A 2D6FA 4AI6A 4M7AB 2DZCA 2VYTA 1AHJB 2K3XA 2PVGB 3OYAA 5GMKi 2DPPB 3RIRA 2V8IA 1LOJA 3FEOA 3CCVT 1YJ9A 2R57A 3URGA 3QBYA 3L2VA 1S72T 2EIFA 3A8LB 5GAMg 1UGSB 2JZ2A 1D3BB 4C92G 2ZPFB 2MF2A 4XTWA 2ZZDA 4M75E 1Q7YU 2JVVA 2WSFE 2RK2A 2HNIA 1UEBA 2OTJA 1WJQA 2XD0A 4XAXB 2O4XA 3G6ET 5GAN6 1XTDA 5GAN2 5HKCA 3GF5A 2DK3A 3HPWA 4WF2A 4X9DA 2CZ7B 3RKXA 3M5AA 1Q81U 1KC8U 4DOWA 2Y4YA 4ZGJB 4BB7A 4PJOF 2QF7A 2DTOA 2L5QA 5CO7A 1Y07A 1VQ4T 4A4EA 2X4XA 2CKKA 5IAYA 1YJNT 4BY6C 4PJOG 2PVOB 5GANh 4OGEA 1QVFA 3CBOA 1WGSA 3CCEA 3JB9G 2FL7A 4M77F 4MDXA 5GAN8 4FT4A 4B9XA 5GANg 4M75G 1KC8C 2EQJA 4HT8A 1VQKT 5I2MA 2XK0A 2BKDN 2QQAA 1K8AU 1KG1A 4D6WA 3H6ZA 1KQSA 3CCVA 2KVQG 2QTXA 3CMAT 5GAN3 2FYKA 4JLGA 3L2QA 3JCMJ 3SWNC 4JRPA 2RHXA 5DLOA 2K5LA 5HK3A 3QDRB 2G77A 2PUKB 2BS3A 3EAEA 2WSCE 3V8LA 4Q5WA 3MP6A 2DXBA 4JDSA 1QVGS 2IVWA 3Q1JA 5IT9E 3FRNA 1U1TA 4DOVA 3CC2A 3BW1A 3INZA 4BD3A 3QXEB 2RK1A 4QSHA 3G7ZA 1W4SA 1WJSA 3CCLA 1YI2T 5GAMf 5LJ5g 1Q81C 3OS5A 3CPWS 3T9NA 4M77D 1M5Q1 1N9RA 4IUVA 3QUIA 1LJOA 2R58A 5A0GA 3M54A 2V8JA 3JCMb 2RA2A 3JB9J 3QKJA 1XOVA 4BUGA 3QZ9B 4FT2A 2K57A 3CBPA 1R8OB 3HZJA 4XTUA 2F5KA 3M56A 3DB4A 4Y28E 3E9GA 5M9OA 3I55A 1I5LA 3I55T 5CAIA 1ZBXA 2ZGWA 2CZ6B 3CCSA 3FLGA 4MFEA 2FB7A 2BS4A 1M1FA 1NJIU 1VQMA 4C5IA 1XNIA 3JSCA 3LGLA 3M53A 3QHSA 4VUBA 4C0ZA 1NE8A 3EFRA 1OI1A 3JRZA 2LRQA 3JCMc 4MZTA 4XU1A 3QO3A 3SFMA 5CVIA 4KULA 1VQLT 4M7DG 4PJOE 2GFAA 2QQ9A 3S3NA 2PQWA 4M7DF 4LOCA 2JTFA 3JCMe 2VXEA 5EG2A 1X6OA 4E7JA 2ZPBB 4ME7A 2HD0A 3OYCA 2F69A 4M7DB 5GAOm 3CPFA 4IUUA 3V8JA 3MEAA 5FRMA 3OS0A 2RJDA 1BKBA 3FIFA 4PL6A 4Y91A 3VYGB 3O8VA 4BACA 1YJWA 4PLLA 4MDWA 1G5VA 2QFZA 4DQ2A 1VQOA 4L6V5 4LDWA 3MEWA 4O6JA 2EFIA 1NJIC 4RMOA 4C92E 2B8AA 5A0LA 1QLBA 3BFMA 3MEVA 5FRNA 1N6AA 1WJRA 1Y96B 4A4HA 5LJ5j 2A7YA 3ZEHA 1K9MU 3CCJT 3MCAB 5LJ5e 4M77B 4JX6A 3VV0A 3CCJA 1VUBA 2WACA 4M75C 1YJNA 2CYZB 2DKGA 2RJEA 2V8KA 4BY6B 3FC3A 3MEUA 2MWOA 3UWNA 4HLQA 3ME9A 4RCCA 5FROA 3UT1A 3OS1A 4E47A 4M75B 4M7DD 5GANf 3OYGA 2QQBA 1BI3A 1G3YA 1VQ5T 3M57A 3LLRA 4YTLA 3RKYA 1YJWT 1KQ2A 1UGPB 1VQNT 2QXFA 3VYHB 4N4IA 4M75F 3LYIA 4OGCA 3CXCS 3V7CA 1FWZA 4ZTFA 3OSVA 4M77G 3P8DA 4EMKA 4BE0A 2DJZA 4J83A 4XK8E 1FKMA 3M9QA 1ZQ1A 4M6VA 3PGGA 4MMKA 4BDZA 5GANj 4MFDA 1BI2A 4F7UE 5I2SA 1BI1A 3KUFA 4A54A 3PFSA 1YITT 3SWNB 4C92D 2KR6A 2XHCA 2IG0A 2DIQA 3HRTA 3NTHA 3PMTA 4F7UF 4EMHA 4M7AE 3QJYA 1O9SA 2XIDA 3HBLA 5C6SA 4XU2A 4NL2A 1VQMT 4XU0A 2VC8A 4EDUA 1G3WA 3E9FA 4BI8B 3CC4T 4JX4A 3TW7A 3WVEB 4XTYA 1OZ3A 2LCLA 3VKHA 3TW6A 4J7FA 3HRUA 2R5MA 2DD4B 3M55A 3HSBA 1VIEA 2XG8D 4QQGA 4HL4A 2DD5A 2GFUA 3C94A 4FM4B 4HNTA 4BBSM 4II1A 4PKCC 2EKOA 2QEXA 3CMET 3OYHA 2M9UA 4KBMB 2JOYA 4HA8A 3I56A 3RUXA 2OTLA 4M75D 4FL6A 5CQXA 2EQKA 4KT0E 4XTXA 3BG3A 2M0OA 5J3BA 4B9WA 2LT1A 4IUPA 1YI2A 2LVMA 4KUDK 4M7AC 4PJOD 3J7AF 3DB3A 3OYYA 3M58A 4J8OA 4PJOB 1X01A 2HBPA 4JLIA 5KE2A 5KE3A 3SDZA 4N0AA 3MO8A 4JJNK 1W2BS 4P5NA 4C8QD 4C8QC 3FDRA 3F70A 1IREB 5GAMe 4LD9K 2RHIA 5GANd 4HCZA 1RL2A 4N4HA 2XKOC 1FX7A 3V8KA 3S6WA 1M90C 2GCXA 3HHTB 2D9TA 2E6ZA 1YHQA 4IUTA 1Q86C 2EAYA 3TU4K 2EJ9A 4BBRM 5D6WA 5LJ3e 1YITA 1NZ9A 4E7IA 2LT4A 2QA4T 3QSUA 4MZPA 2XU8A 2K5IA 3HP9A 1VQKA 1G3SA 2EQUA 2LTOA 4GY5A 1VQ6A 2RI5A 2DD5B 2F5TX 4NC6A 3QG1A 3JB9F 2M1HA 4IUQA 4F7UA 2L8DA 5CKEA 5DY9A 5GAMj 3CCET 4EMKC 3RKWA 1GXIE 1MGQA 2BIVA 2P0PA 2VUBA 1M1GA 4L59A 1VQPA 1P92A 4OP0A 5J26A 3CC7A 3CC7T 1G3TA 2LQKA 4CRIA 5HY6A 4A4KA 3G6EA 3J81E 1U8RA 1BI0A 2E12A 4Z02A 4C92C 4C8QF 4HCCA 1IZ6A 1TH7A 2RM4A 3GPLA 4ATOA 2KY9A 4M7AA 3OYIA 2YLCA 3L1AA 3OSSC 3OYBA 4PNOA 1VQ6T 3LH0A 4M7DC 3UPUA 4ZN3A 4CI0C 5HK0A 2RO0A 2LCCA 2LDMA 1KD1C 4M77C 1KQ1A 3JCMX 1Y7XA 5A2QE 2H3JA 3BG9A 3X25B 2RHYA 2QA4A 2RJFA 1YJ9T 4OVAA 1S72A 3VUBA 2VGNA 2VXFA 2R5AA 5CQYA 2EWNA 4L5GA 4NL3A 4LDVA 4X9CA 5GAOp 1VQNA 2KQWA 4JRKA 3JB9D 4RG8A 4GLKA 4F7UB 1MHNA 3L2UA 4OB3B 2O4XB 3J80E 2CGHA 3OYMA 1YCYA 3HKSA 3HFNA 4O5VA 5GAOr 1XQHA 2EJGA 3LX7A 1JBMA 3OYJA 2DXCB 1WNLA 2KK4A 2QQSA 3V7RA 4N0AC 1VQ9T 4HT9A 2QQRA 5FU7B 1VQ9A 2HQEA 1PSFA 1X75C 4M78E 3JCMd 5GMKh 1VQPT 4LDXA 5EJCA 1M4ZA 5KCHA 1KHIA 1B34A 5GAOl 1K8AC 5FU6C 4N4GA 3CMEA 4NOYA 2ZCFB 3OY9A 2L89A 1VQ8A 4M7DE 4OF1A 2X35A 3C12A 3CD6T 3QWLA 3QYHB 3QYEA 1H641 2XI9A 5LJ3g 3CC4A 3A8HB 4AKGA 5LJ3j 3L2WA 1K73U 4J6WA 4BDYA 4C0GA 1YHQT 2DXUA 4F7UG 1JB0E 4XTVA 5LJ3h 5LJ5h 2DIGA 4MMLA 1K9MC 3JCMW 1FXXA 4HNVA 2E5QA 4M78C 5DM7R 1Q7YC 3M59A 3JCMP 3X28B 3CD6A 4OB0B 2PU9B 4A4FA 3FB9A 3MP1A 1W2BA 3KHIA 2ZZDB 5CKBA 3UDCA 4JRQA 3P8BB 3L2RA 1QVFS 2GQVA 5LJ3f 2XDPA 2DO3A 1I4K1 5GMKj 5LJ5f 4OB2B 1N8RU 3L2ZA 2CZ1B 5GAN4 1Q82U 1PSEA 2L3RA 2RI2A 3X20B 4C0FA 4M7DA 3VYGA 3A8OB 4ELZC 3C4SA 4XU3A 2OTLT 2BS2A 3JCMV 5J39A 4C8QE 1V29B 1KHCA 3WXMB 1QP3A 2E6NA 2E64A 5GAOq 2KDSA 4J5YA 1N8RC 4C5HA 1QP2A 1HK9A 4IKFA 2ZPHB 3AHUA 1I81A 3VKGA 4R55A 3G71A 1N9SA 4ZGEB 2MMPA 2K3YA 1Y71A 3OBWA 3OQ5A 2KAFA 3LW5E 2XICA 2FHDA 3DL1A 5L8RE 4A4GA 3GNGA 5GAOn 2E10A 2D0QB 2CZ0B 4Z6YA 2A3LA 2E41A 3VUZA 4A53A 4R56A 2K2VA 3JB9H 1D3BA 3L42A 4RG2A 3BDLA 4C8QG 3OS2A 3PMIA 3OYEA 2VGMA 4QQDA 4M78A 5FU7C 2CS7A 3CXCA 1WQWA 4M7AF 1RI0A 3S3MA 3X24B 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 E;  4RKU E;  2CZ6 B;  2DD5 B;  3WVD B;  3A8M B;  1UGQ B;  1GXI E;  1UGR B;  3X26 B;  2WSE E;  1DJ7 B;  2ZPB B;  2PVD B;  2DXC A;  4OB1 B;  3X25 B;  3VYG B;  4ZGD B;  4L6V 5;  2ZPE B;  4OB3 B;  2PUO B;  3QYG B;  1AHJ B;  2PVG B;  2DPP B;  2DXC B;  2CYZ B;  3A8L B;  1UGS B;  1PSF A;  2ZPF B;  2ZZD A;  3QZ5 B;  1UGP B;  2WSF E;  2ZCF B;  3VYH B;  2AHJ B;  3QYH B;  2QDY B;  3A8H B;  4XK8 E;  2CZ7 B;  4ZGJ B;  1JB0 E;  3X28 B;  4OB0 B;  3A8G B;  2PU9 B;  2PVO B;  2ZZD B;  3WVE B;  4OB2 B;  2DD4 B;  2CZ1 B;  2DD5 A;  1PSE A;  4FM4 B;  3X20 B;  3VYG A;  3A8O B;  2O01 E;  4KT0 E;  1V29 B;  1QP3 A;  2PUK B;  2WSC E;  2ZPG B;  1QP2 A;  2ZPH B;  2DXB A;  4ZGE B;  3LW5 E;  1IRE B;  2DD4 A;  2DXB B;  5L8R E;  2D0Q B;  3QXE B;  2CZ0 B;  2ZPI B;  3HHT B;  3QZ9 B;  3X24 B; 
#chains in the Genus database with same CATH topology
 2JXB A;  2RD1 A;  1NYF A;  4NS5 A;  1NPP A;  3CBM A;  3QPH A;  3A8M B;  3ER0 A;  2YWW A;  3V7S A;  2KMG A;  1Q82 C;  1UGR B;  5IHI A;  3BDU A;  3EHQ A;  3EH1 A;  5FLX E;  2EQM A;  4LNP A;  3MP8 A;  3JCM f;  2D1X A;  1VQ7 Q;  2QG9 B;  7AT1 B;  1OOT A;  2J7I A;  2QDJ A;  1E7O A;  3O5Z A;  1RAB B;  2KT1 A;  1JST B;  4C92 B;  3CCL T;  3OYL A;  3LGF A;  3CME Q;  1UEC A;  1UE9 A;  3OBY A;  3CCR A;  1UB4 A;  4J6X A;  1H3Z A;  2HCK A;  4AKH A;  4NST B;  1WXT A;  3S3O A;  4ROE A;  1Y0M A;  5GMK m;  4LUE A;  3FJP A;  3QZ5 B;  4XQ3 A;  4FIB A;  4JRI A;  1YIJ T;  3H4C A;  2KSS A;  1N27 A;  4PLI A;  3OW2 S;  3OYN A;  1D1A A;  2ED1 A;  5CIU A;  4JUV A;  5LL6 S;  2XDB A;  4WTO B;  1VQ4 A;  3VS2 A;  3EG2 A;  4J9I A;  3CCL Q;  3EG0 A;  2KEA A;  1W98 B;  4WCI A;  1AWO A;  5ICP B;  3EFS A;  1M8V A;  3A5Z B;  3M0R A;  3NTI A;  4CFW B;  4IUR A;  5GJW B;  2DM1 A;  3ZL7 C;  3VU3 C;  4OMN A;  1BYM A;  2JN0 A;  1Q95 G;  5IN1 A;  4J9B A;  1OX8 A;  1K73 C;  4J6Y A;  1ZHI A;  1TUG B;  4FX3 B;  3RGF B;  2YRV A;  4QVZ A;  3UF4 A;  2I2L A;  4ELJ A;  4M77 A;  2CJM B;  4ORZ A;  1Z9Q A;  2DD4 A;  1ZA2 B;  1PKS A;  3QJ6 A;  3CCQ A;  4G6L B;  1H92 A;  2MOX A;  5L23 A;  2NWM A;  5GMK e;  2RI3 A;  3EG9 A;  3EG9 B;  4TVR A;  4DA4 A;  2MYS A;  3MET A;  1YCS B;  4ZTJ A;  2WEV B;  2XDD A;  1FYN A;  4EC8 B;  2HSP A;  2DF6 A;  4QVD A;  1UGQ B;  2AIR B;  5I21 A;  1I0C A;  4F14 A;  3X26 B;  2LW4 A;  5GAM h;  1VQ8 T;  4OMF B;  1TUD A;  5GAN e;  4MZM A;  5IDN B;  2HZY A;  2DXC A;  1G2B A;  2Y90 A;  3K7A M;  2P4T A;  2COW A;  3CC2 T;  2JNG A;  1UJY A;  3EGD A;  4C8Q B;  2KRN A;  2L3P A;  3E1S A;  1Q86 U;  4AI6 A;  1OEB A;  3OYA A;  2K3X A;  5GMK i;  2V8I A;  1LOJ A;  4F6U B;  2EIF A;  4C92 G;  1ACM B;  2ZZD A;  3LH5 A;  2NUT B;  2WSF E;  4DBQ A;  1WJQ A;  2XD0 A;  4XAX B;  2O4X A;  1XTD A;  5HKC A;  1FMW A;  1VQN A;  2JT4 A;  4WF2 A;  1YJW Q;  4DOW A;  1QCF A;  4BB7 A;  4PJO F;  2QF7 A;  2DVJ A;  3GTM S;  2EW3 A;  4HVW A;  4A4E A;  2DA9 A;  3A98 A;  4PJN A;  2CKK A;  1YJN T;  2PVO B;  1AWJ A;  5IXF A;  2FL7 A;  3M03 A;  5GAN g;  4M75 G;  2XK0 A;  1TSF A;  2KVQ G;  4DBR A;  2FYK A;  4BCQ D;  1N4M A;  3SWN C;  4LE9 A;  3QDR B;  2WSC E;  1UHF A;  1C6V X;  3Q1J A;  3FRN A;  1U1T A;  3CC2 A;  3BW1 A;  2F2W A;  2LNH B;  3QXE B;  2RK1 A;  3G7Z A;  2QGS A;  5GAM f;  1Q81 C;  2UZL B;  1UJ0 A;  1LVK A;  1M5Q 1;  1LJO A;  4OMO A;  3JCM b;  1XOV A;  2YUP A;  4BCO B;  3QZ9 B;  2K57 A;  4FT2 A;  3HZJ A;  4E2F B;  5M9O A;  2PHG A;  2V1R A;  5CAI A;  1ZBX A;  1NJI U;  2BS4 A;  1GFD A;  5I5Z B;  4C5I A;  1QMZ B;  4C0Z A;  3JRZ A;  1ABQ A;  2FZK B;  2BE9 B;  1VQL T;  4M7D G;  4PJO E;  4BCN B;  1ZSZ B;  1WHH A;  3S3N A;  2PQW A;  3JCM e;  5EG2 A;  1X6O A;  2F2V A;  3CPF A;  4Y92 A;  3V8J A;  3UAT A;  2IIM A;  3O8V A;  4FW2 A;  2DX1 A;  3CCV Q;  2RMO A;  4ESR A;  2ZAE A;  2O9S A;  1VQO A;  3MEW A;  1IXD A;  4F17 A;  1EZZ B;  1G3N C;  5KYN A;  5LJ5 j;  2A7Y A;  1VQK Q;  1VQ4 Q;  1K9M U;  1H4L D;  3CPW P;  1YJN A;  1K73 U;  2RJE A;  3MEU A;  3OS1 A;  2K9G A;  2H3E B;  1PNJ A;  4M75 B;  1G3Y A;  3M57 A;  3LLR A;  2F1L A;  2QXF A;  4F7J B;  4J9F A;  4TTH A;  4OGC A;  3V7C A;  3P8D A;  3BHU B;  4BCN D;  4CFV B;  4J83 A;  2YUN A;  4XK8 E;  1FKM A;  3M9Q A;  1PHT A;  2AKK A;  4MFD A;  1TFB A;  1BI2 A;  3KUF A;  4A54 A;  3PFS A;  1YIT T;  3H9N A;  2KR6 A;  2IW8 B;  3NTH A;  2EYZ A;  4M7A E;  1QMC A;  2XID A;  5C6S A;  4XU2 A;  4NL2 A;  2JS0 A;  2A0F B;  2YUQ A;  4XTY A;  2LJ3 A;  1OZ3 A;  4J7F A;  2A36 A;  4LUD A;  4QQG A;  1O9K A;  1M2O A;  2AK5 A;  5HBE B;  1RAC B;  4HNT A;  3HSB A;  3OYH A;  2M9U A;  2JOY A;  4HA8 A;  3I56 A;  4M75 D;  2HMA A;  2LT1 A;  3DB3 A;  4J8O A;  4EOQ B;  1X01 A;  4PJO B;  1M2V A;  1W2B S;  4C8Q D;  1PD1 A;  2R7G A;  2DER A;  3F5X B;  3EFO B;  4JJB A;  4LD9 K;  4JJC A;  1FX7 A;  8AT1 B;  1M90 C;  1Q86 C;  4BBR M;  2B9R A;  2K7A A;  4KGX B;  4MZP A;  2XU8 A;  2K5I A;  3HP9 A;  1VQK A;  2LTO A;  4GY5 A;  2F5T X;  3JB9 F;  3VS4 A;  2KGT A;  2M1H A;  2WMB B;  5CKE A;  1KQS P;  1GXI E;  1IB8 A;  2VUB A;  2BIV A;  4L59 A;  1VIN A;  2EGE A;  1P92 A;  1K9A A;  2CP2 A;  4A4K A;  3G6E A;  3J81 E;  2E12 A;  4C8Q F;  1TH7 A;  4M7A A;  2CP5 A;  5KYY A;  4PNO A;  2X3X D;  3R6N A;  2FZC B;  1PKT A;  2A28 A;  2H8H A;  2RO0 A;  5HK0 A;  1KD1 C;  1Y7X A;  1YJ9 T;  2VXF A;  3D7S B;  1VQ8 Q;  2EWN A;  4L5G A;  1D0Y A;  2PMI B;  3J80 E;  1YN8 A;  2CGH A;  3CCJ Q;  3HFN A;  2W2H A;  4QT7 A;  2GTJ A;  2EJG A;  1A0N B;  1I1J A;  1WHJ A;  1X43 A;  4HT9 A;  3MKD A;  1QKX A;  1VQ9 A;  5IXB A;  4OR5 B;  1AD5 A;  2SEM A;  3JCM d;  4LDX A;  1H1P B;  5EJC A;  1ZSZ C;  5GAO l;  1B34 A;  1ZBJ A;  2W9Z A;  4KRT A;  2L89 A;  1VQ8 A;  4M7D E;  1K4U S;  4OF1 A;  3C12 A;  3QWL A;  1H64 1;  5LJ3 j;  4F7U G;  5LJ3 h;  4XTV A;  3JCM W;  1RAE B;  3JCM P;  3X28 B;  2CSI A;  4BCJ B;  2PK2 A;  2JS2 A;  1QVF S;  2YSQ A;  2RQW A;  4HVU A;  1H8K A;  2L3R A;  2UZD B;  1JXO A;  4EOJ B;  3VYG A;  2BS2 A;  5J39 A;  3WXM B;  3I35 A;  1QP3 A;  2KDS A;  3AHU A;  4OMP A;  1I81 A;  3VKG A;  3G71 A;  3OBW A;  4ZGE B;  1Y71 A;  1PD0 A;  4F7L B;  3LW5 E;  5GAO n;  3DL1 A;  4KRD B;  2D0Q B;  2A3L A;  3VUZ A;  4C8Q G;  2I53 A;  3OYE A;  2CS7 A;  1JXM A;  1OKV B;  1RI0 A;  1T0H A;  3P8H A;  1YBY A;  3G4S T;  2NLU A;  4X34 A;  4C0D B;  1D1B A;  2L0A A;  1OIU B;  2QQ8 A;  1HD3 A;  2C0I A;  1YIJ A;  2RHZ A;  4C92 F;  2SRC A;  2KMT A;  3LWH A;  3GLX A;  5D6Y A;  5ACB A;  2JTM A;  1GCQ A;  3HFO A;  2CT4 A;  1SPK A;  2YHT A;  5CKF A;  1WYX A;  1VQO T;  3RER A;  1RLP C;  3RNJ A;  3MIA B;  4M78 G;  2C06 A;  2O31 A;  2VV5 A;  3OYF A;  5CYI B;  2EYX A;  2GBQ A;  2RJC A;  2P0Q A;  2CP7 A;  1QVG A;  3GOX A;  3C95 A;  5GJV B;  3JB9 I;  3PIP A;  1H26 B;  3H0F A;  3PT9 A;  1H27 B;  4RTU A;  1Y96 A;  3ASK A;  4EOS B;  3JCM Q;  4JS4 A;  2EYQ A;  3VKI A;  4EOI B;  5FWB A;  2HQX A;  4C0D C;  2DL3 A;  4LD6 A;  4EPC A;  4OML A;  3CCM A;  4QKU A;  4C92 A;  4PJJ A;  4AFS C;  5GAN 7;  3CCM Q;  2M51 A;  3DKM A;  2LC4 A;  3OYD A;  2LZ6 B;  2DVE A;  1RAF B;  5FU6 B;  3BLH B;  2NUP B;  2LX7 A;  5KYY B;  3CC7 Q;  3NFC A;  4HNU A;  4EMK B;  4FSX A;  1OYX A;  2G6F X;  5D6X A;  2C5V B;  1TXQ A;  1TUC A;  1M1K C;  3NMZ C;  4UC4 A;  2KXD A;  1F5Q B;  2ZPG B;  4MIM A;  2DL5 A;  1KD1 U;  1S1N A;  1JJ2 S;  1LNX A;  2DIL A;  2OAU A;  2DXB B;  4UN0 A;  2KRM A;  3UA7 A;  2K6D A;  2HDA A;  2ZPI B;  2VKN A;  3HL8 A;  2QYZ A;  4XTZ A;  1U06 A;  2RQU A;  3EH2 A;  1B3Q A;  3R6O A;  2W0Z A;  4RKU E;  3PIO A;  4CC3 A;  3KXT A;  1NLO C;  5HVY B;  2DEQ A;  3I9Q A;  2DAQ A;  3BY7 A;  4RTT A;  1AZE A;  4M7A G;  2HEQ A;  2QI2 A;  1AWX A;  4QQ6 A;  4LDY A;  2JM9 A;  3JCM g;  3CPW A;  5C0M A;  2DBK A;  2DYB A;  2ROL A;  3UA6 A;  8ATC B;  2C0T A;  4CC7 A;  1HXD A;  3VS3 A;  2EJF A;  1OZ2 A;  4F6W B;  4Z8A A;  4OMM A;  1VQM Q;  4QW2 A;  1AEY A;  3CCQ T;  1FIN B;  1U5S A;  2L2P A;  4PJL A;  3TRE A;  2ZPE B;  2LJ1 A;  2LNV A;  2D6F A;  3MY5 B;  3G4S Q;  3FEO A;  1S72 T;  5BNJ B;  1PRL C;  3A8L B;  2ZPF B;  1VQO Q;  1UUE A;  2HNI A;  1WZO A;  3GF5 A;  2DK3 A;  4X9D A;  2K79 A;  4ZGJ B;  1WHG A;  2L5Q A;  5CO7 A;  4PJO G;  2UUE B;  2EGA A;  4MDX A;  2CUB A;  1KC8 R;  1K8A U;  2QQA A;  2WIH B;  1IRX A;  3CCE Q;  3NHN A;  4JLG A;  2QGG A;  4JRP A;  4EOM B;  2RHX A;  5DLO A;  4E7S A;  3KFV A;  1SRL A;  2PUK B;  3EAE A;  1N5Z A;  4Q5W A;  1K1Z A;  2VB6 A;  2DXB A;  5EFQ B;  2IVW A;  4DOV A;  3QHW B;  4RTX A;  4F7N B;  4QSH A;  5LJ5 g;  2QTV A;  3OS5 A;  3T9N A;  4D8K A;  1KSW A;  4ELL A;  1RAA B;  1N9R A;  3EFO A;  6AT1 B;  3QUI A;  4BY6 C;  1R8O B;  4AFU C;  3M56 A;  3I55 A;  4Y28 E;  2CZ6 B;  3FLG A;  2FB7 A;  2IPO B;  1J3T A;  5IHN A;  2QAZ A;  1YIT Q;  1XNI A;  3QHS A;  4VUB A;  4EOL B;  2LRQ A;  1W6X A;  4MZT A;  3QO3 A;  3SFM A;  1AVZ C;  1UTI A;  2GFA A;  5DQV A;  5I11 A;  1YJ9 Q;  4M7D F;  4GLM A;  2DYI A;  1ZX6 A;  2HD0 A;  2F69 A;  5GAO m;  5FRM A;  1X69 A;  2KBT A;  4PL6 A;  1YJW A;  3VYG B;  1G5V A;  1SHG A;  4L6V 5;  5HBH B;  4LDW A;  1NJI R;  2EFI A;  4KGV B;  4RMO A;  1QLB A;  3BFM A;  3MEV A;  1JJ2 P;  5FRN A;  4FYY B;  1KIK A;  3REA B;  3NDQ A;  2I0N A;  4J9G A;  5LJ5 e;  3CCJ A;  1MMG A;  2V1Q A;  2WAC A;  2WXV B;  2CYZ B;  2DKG A;  2V8K A;  1T3S A;  2YXY A;  4HLQ A;  5FRO A;  2CT3 A;  5IHY A;  2UZE B;  2GGR A;  5GAN f;  3CCU Q;  4YTL A;  3RKY A;  1KQ2 A;  1NYG A;  1RI9 A;  4FYV B;  1H24 B;  1X27 A;  4EMK A;  4BE0 A;  1GL5 A;  2ESW A;  2DJQ A;  3EHR A;  2DJZ A;  4EOK B;  5GAN j;  4CFM B;  2MK5 A;  5I2S A;  1BI1 A;  4A63 B;  2XHC A;  3HRT A;  3PMT A;  4F7U F;  3QJY A;  1VQM T;  4EDU A;  3TQ7 P;  3QDF A;  3WVE B;  9ATC B;  2LCL A;  1WHL A;  4LN2 A;  2DD4 B;  3M55 A;  2GFU A;  4II1 A;  4PKC C;  2QEX A;  4FM4 B;  3CME T;  2EKO A;  2C5X B;  3RUX A;  5J3B A;  5CQX A;  4KT0 E;  4IUP A;  1QWF A;  3TN8 B;  2QDL A;  4JLI A;  4JJN K;  4N0A A;  4C8Q C;  2E3I A;  2RHI A;  5GAN d;  2W9F A;  3RR6 A;  2XKO C;  3PVL A;  2GCX A;  3TNH B;  3TU4 K;  1NZ9 A;  2JW4 A;  3QSU A;  1TS9 A;  2FEI A;  1G3S A;  2GNC A;  2RI5 A;  3DOG B;  3QG1 A;  4F7U A;  1VOM A;  1V1C A;  4EMK C;  3RKW A;  1M1G A;  3G71 Q;  1U8R A;  1BI0 A;  4Z02 A;  2RF0 A;  4BCH B;  2YLC A;  3L1A A;  3OYB A;  1VQ6 T;  3LH0 A;  3UPU A;  3EOC B;  5AT1 B;  2JJ9 A;  3JCM X;  1KQ1 A;  3X25 B;  2RHY A;  3ULR B;  3VRY A;  3VUB A;  5CQY A;  2MCN A;  3E2U A;  2D8H A;  2M02 A;  4NL3 A;  2FG0 A;  1YJN Q;  4F7U B;  2O4X B;  4PK4 A;  1TTH B;  1UNL D;  3A1P A;  1XQH A;  3LX7 A;  1WNL A;  2QGF B;  2CCH B;  4N0A C;  5FU7 B;  5GMK h;  3PO3 S;  1M4Z A;  2RN8 A;  1K8A R;  4PFZ A;  5FU6 C;  1U3O A;  4NOY A;  1RAH B;  1OIY B;  3BLQ B;  3CD6 T;  4E7Z A;  4J6W A;  4BDY A;  2DXU A;  4HXJ A;  3CCR Q;  1K9M C;  1Q7Y R;  4HNV A;  4M78 C;  4AG2 C;  5DM7 R;  1MND A;  1VYT A;  3FB9 A;  3MP1 A;  3KHI A;  4JRQ A;  3L2R A;  2DBM A;  2XDP A;  2DO3 A;  3PE0 A;  5LJ5 f;  2C6T B;  4OB2 B;  2D0N A;  2CZ1 B;  1AOJ A;  1Q82 U;  1PSE A;  4PFP A;  3X20 B;  2OTL T;  2NUZ A;  1YI2 Q;  1V29 B;  2IN3 A;  1KHC A;  2DL7 A;  4OMQ A;  2E6N A;  1VYU A;  4J5Y A;  1N8R R;  4C5H A;  3VS1 A;  4R55 A;  4YOO A;  1WHM A;  4JJD A;  2Z0W A;  1MNE A;  5L8R E;  2E10 A;  4R56 A;  4A53 A;  2K2V A;  2EYW A;  1D3B A;  3L42 A;  1M27 C;  3OS2 A;  1I07 A;  3PMI A;  2RNA A;  4QQD A;  1E6H A;  5CEI B;  3X24 B;  4E7L A;  1GY3 B;  2K5F A;  1SEM A;  2C4G B;  2MI6 A;  3GIB A;  1Q82 R;  4ANJ A;  1VQL A;  2WSE E;  3CCU A;  2M16 A;  4M78 D;  1BCM A;  1DJ7 B;  3THK A;  1VIF A;  4F16 A;  2COZ A;  3I5S A;  4E7H A;  3CEY A;  3QII A;  4BY1 X;  2RQV A;  2LP5 A;  3OMC A;  2X4W A;  2OTJ Q;  1OGU B;  4F70 B;  5CR2 A;  4KH0 B;  2DME A;  3M4G A;  1D09 B;  2LX9 A;  4BE2 A;  4EIK A;  3OMG A;  1D1C A;  2MAM A;  1X6G A;  1O75 A;  4HKE A;  5GAN 5;  4BY7 X;  1VQ7 T;  3EGU A;  1NPR A;  1SG5 A;  1VQ5 A;  4PJO A;  1HYO A;  2OJ2 A;  1H1S B;  2YRC A;  3G33 B;  3SB2 A;  1CKB A;  1C0M A;  3DJB A;  1KQS S;  3PTA A;  1M1K U;  4JX5 A;  3OYK A;  1NEG A;  2JMA A;  1SSF A;  3SD4 A;  3CCU T;  2X4J A;  3GP8 A;  4ROC A;  3M0U A;  4EMG A;  2AZS A;  4M77 E;  1GFC A;  2RHU A;  2G3R A;  1D3U B;  3TSZ A;  1ZA1 B;  2OTJ T;  3OB9 A;  1GUX A;  2KT8 A;  3HRS A;  1BIB A;  1QVP A;  2O01 E;  1K73 R;  2VAS A;  1VYV A;  2F2C A;  3VS6 A;  1FVV B;  2WIP B;  4HCB A;  2DL8 A;  2DXT A;  3VRZ A;  1H1Q B;  3CQT A;  4ELY C;  5LJ5 d;  4J7I A;  3VJP A;  3H0I A;  4M7A D;  1JRI A;  2HSE B;  4M75 A;  4PJO C;  3EJ1 B;  3E19 A;  2D8J A;  4J9D A;  2L3Q A;  3CCR T;  1VQ7 A;  4DBH A;  1WPY A;  4KRC B;  5IHK A;  2YLB A;  2EYY A;  4E7K A;  3I55 Q;  2P0K A;  1M2V B;  4Y72 B;  3RMQ A;  1M9S A;  3DLM A;  4ZN1 A;  3M4Y A;  4EON B;  2E1H A;  1GBQ A;  3SHW A;  5CKH A;  4LDU A;  1RUW A;  4DBF A;  1TWB A;  4KUI A;  1KK7 A;  1YHQ Q;  5GMK l;  1QW1 A;  1ABO A;  4ZGD B;  2J6O A;  2LQ8 A;  1B34 B;  2DTI A;  4LXC A;  2PNI A;  2P84 A;  1JOW A;  1SF9 A;  1WQ7 A;  5FWC A;  4M7A B;  2DZC A;  4PJM A;  2EUF A;  1AHJ B;  2PVG B;  2BE7 D;  2DPP B;  3RDV A;  3CCV T;  1YJ9 A;  4J9E A;  1AWW A;  4X1V A;  5GAM g;  2JZ2 A;  1D3B B;  3M0P A;  4XTW A;  4M75 E;  1QWE A;  1Q7Y U;  2JVV A;  2OTJ A;  1PC0 A;  4RTZ A;  1RLQ C;  3RKX A;  2EPD A;  3M0T A;  1Q81 U;  2Y4Y A;  2CUD A;  4CC2 A;  1Y07 A;  4FCY A;  1VQ4 T;  4J9H A;  2KR3 A;  1FMK A;  3LQ5 B;  4OGE A;  1QVF A;  3CBO A;  1WGS A;  4RTW A;  5GAN 8;  2OI3 A;  2EQJ A;  1OI9 B;  1VQK T;  1M8M A;  5I2M A;  3C0C A;  2QA4 Q;  2BKD N;  3H6Z A;  1QLY A;  3CMA T;  2WHB B;  2K5L A;  4E6R A;  1NBE B;  1ZLM A;  1B7T A;  3MP6 A;  1GCQ C;  4JDS A;  1JEG A;  5IH2 A;  4K11 A;  5KYX B;  4EOR B;  4BD3 A;  1UDL A;  1VYW B;  1WJS A;  1YI2 T;  1Q81 R;  3CPW S;  1QVG P;  3TVT A;  3HTR A;  3H41 A;  2R58 A;  2COY A;  2V8J A;  3M54 A;  3JB9 J;  3QKJ A;  5GAN 3;  4XTU A;  2KYB A;  1I5L A;  3DB4 A;  3E9G A;  1UG1 A;  2HKN A;  2ZGW A;  3CCS A;  1M1F A;  4C5E A;  3M53 A;  2L3S A;  1BU1 A;  1NE8 A;  1OI1 A;  3EFR A;  3JCM c;  5CVI A;  4KUL A;  2G9X B;  1YFN A;  4AFQ C;  1BCO A;  1MMN A;  4F6S B;  4LOC A;  2JTF A;  3QHR B;  2VXE A;  4E7J A;  4ME7 A;  3OYC A;  3M0S A;  2CP3 A;  3MEA A;  4IUU A;  3OS0 A;  2RJD A;  3FIF A;  4Y91 A;  4BAC A;  4MDW A;  1VQP Q;  2LJ0 A;  3CC4 Q;  1OL2 B;  5FGK B;  3TNI B;  1T3L A;  5KYU B;  5A0L A;  1GRI A;  4A4H A;  5LQF B;  1IGQ A;  3VV0 A;  1VUB A;  3NGP A;  4BY6 B;  1YP5 A;  3ME9 A;  4RCC A;  2IW6 B;  4E47 A;  4M7D D;  2XMF A;  1BI3 A;  1M30 A;  2YDL A;  1YJW T;  1R0B G;  1UGP B;  3CCQ Q;  3LYI A;  3CXC S;  4M77 G;  3BLR B;  2OX7 A;  1NLP C;  3EID B;  4M6V A;  4OGR B;  4F7U E;  1M3C A;  4C92 D;  2DIQ A;  4EMH A;  5EC7 A;  1AT1 B;  1BBZ A;  4CFN B;  4YOZ A;  4XU0 A;  1G3W A;  3E9F A;  4JX4 A;  3MJX A;  2R5M A;  2XG8 D;  1OL1 B;  2QK0 A;  5HNB B;  1YIT A;  4BBS M;  3I5R A;  1URC B;  4EC9 B;  4M7D B;  4FL6 A;  4B9W A;  1W2B P;  2M0O A;  4KUD K;  2DFU A;  2LVM A;  1KJW A;  1OPK A;  2DL4 A;  3J7A F;  2MIO A;  3OYY A;  3M58 A;  2O9V A;  4CRL B;  3RBB B;  2HBP A;  3POM A;  4GBQ A;  5KE3 A;  2LQN A;  3MO8 A;  4P5N A;  3FDR A;  3F70 A;  2J6F A;  1VQ9 Q;  1RL2 A;  4N4H A;  5D7U A;  3V8K A;  1M90 R;  3S6W A;  1ZUK A;  1M3A A;  2D9T A;  2E6Z A;  1YHQ A;  4IUT A;  1Q86 R;  2EAY A;  4E7I A;  2EBP A;  2QA4 T;  2ENM A;  1LPL A;  2EQU A;  2NUT A;  3O0G D;  3CMA Q;  1VQ6 A;  2DD5 B;  4F7S B;  3EGX B;  4RTY A;  2L8D A;  5DY9 A;  2JTE A;  1PKD B;  2EKH A;  1VQP A;  1UHC A;  1GCP A;  1QKW A;  1UFF A;  3M0Q A;  5J26 A;  3CC7 A;  3CC7 T;  1IZ6 A;  2RM4 A;  3OYI A;  1S72 Q;  4II5 B;  2NUP A;  4M7D C;  4IIO A;  2LCC A;  2LDM A;  1KD1 R;  4M77 C;  3TNW B;  2RJF A;  2YT6 A;  1OX9 A;  4OVA A;  2DET A;  2VGN A;  4Z88 A;  1YWP A;  2BZX A;  4LDV A;  2KQW A;  3CCS Q;  4JRK A;  4RG8 A;  4GLK A;  3L2U A;  1MHN A;  2DMO A;  4AT1 B;  3SEM A;  1YCY A;  2W99 A;  3HKS A;  2CDT A;  2FPD A;  1MMA A;  3V7R A;  1VQ9 T;  4M78 E;  3BHT B;  2HL3 A;  1OUL A;  5KCH A;  1JU5 C;  2ZCF B;  2CSQ A;  3OY9 A;  1EFN A;  4HCK A;  3QYE A;  3QYH B;  3CC4 A;  3A8H B;  4FSS A;  4C0G A;  1YHQ T;  1VOL A;  5LJ5 h;  4MML A;  1WXB A;  4DEY A;  3M59 A;  3CD6 A;  4FYX B;  1W2B A;  4B6M A;  5CKB A;  3P8B B;  2FPF A;  5L2W B;  3L2Z A;  2RI2 A;  4M7D A;  4C0F A;  1E6G A;  3A8O B;  4BCI B;  4ELZ C;  5I22 A;  1QVF P;  2KRO A;  1R0C B;  4C8Q E;  4BCQ B;  4BCP B;  2E64 A;  1GBR A;  1HSQ A;  1QP2 A;  1HK9 A;  2JGZ B;  2ZPH B;  2P4R A;  2PTK A;  1X2Q A;  2MMP A;  2K3Y A;  1H3H A;  1ZP2 A;  3OQ5 A;  2KAF A;  2FHD A;  3GNG A;  3QWX X;  1M3B A;  1MUZ A;  1K0X A;  4YOS A;  3BDL A;  2ATC B;  2CH4 W;  4M78 A;  5FU7 C;  1WQW A;  1HJD A;  2BZY A;  1FMV A;  3PNW C;  2FVU A;  3CCM T;  1YNZ A;  1RAD B;  3I56 T;  1B07 A;  1W70 A;  2J06 A;  3GNF B;  2QEX T;  5DLQ E;  1X6B A;  2DEU A;  3TEE A;  2BTT A;  2X3W D;  4JZ3 A;  5KCO A;  2DE0 X;  5KH6 A;  3SWN A;  3H8Z A;  3DLL A;  5GAM d;  2EGC A;  2OTL Q;  3QYB A;  4BXX X;  4IMY B;  1IHW A;  4OB1 B;  4FU6 A;  4EOO B;  1E7P A;  2E70 A;  2A08 A;  1KXU A;  1R77 A;  3TSW A;  4YC3 B;  2K4Y A;  3ZFJ A;  3JCM h;  5CK9 A;  1OV3 A;  4C8Q A;  2X4Y A;  1BIA A;  2PUO B;  4PFO A;  3QYG B;  4V2S A;  4AFZ C;  2J6K A;  1ZUU A;  5A0D A;  1JJ2 A;  2PZ1 A;  4M78 F;  2VVK A;  4BI4 A;  4C5G A;  2WJ9 A;  2E4H A;  2QEX Q;  1GUX B;  3N5B B;  3TCJ A;  3CCS T;  4AKI A;  2LCS A;  2AHJ B;  2E3H A;  5AYF A;  4RCB A;  2QDY B;  1U1S A;  1GH6 B;  2GF7 A;  4KGZ B;  3JB9 D;  2HL5 C;  4F04 B;  3NTK A;  3G4S A;  3A8G B;  3OW2 P;  5FW9 A;  1MV3 A;  2V26 A;  1F1B B;  1G8X A;  2DZ9 A;  1X2K A;  5ECA A;  2RB6 A;  3HB9 A;  1H25 B;  3AT1 B;  2JUF A;  2BUD A;  3CMA A;  1VQ6 Q;  3OA6 A;  2HQH A;  1UGV A;  1M1K R;  1M90 U;  1QCO A;  2RH2 A;  3JAM E;  2E65 A;  3REB B;  1EIF A;  1W1F A;  3G71 T;  2AKL A;  4JZ4 A;  2B86 A;  4BCM B;  2E5K A;  3MHX A;  3RES A;  4M78 B;  2FRW A;  2MWP A;  1WXU A;  4CFX B;  1NG2 A;  3EGD B;  3BG5 A;  3LWI A;  2KRS A;  2C5N B;  3PVQ A;  2EVR A;  2JM8 A;  1WDX A;  3WVD B;  1YIJ Q;  1BB9 A;  1K0S A;  2DRM A;  1PG5 B;  3OW2 A;  3KBG A;  3ZBD A;  5CKD A;  1PRM C;  4BE1 A;  5DQW A;  2Y4X A;  3VS5 A;  4BI3 A;  2DTH A;  2HAX A;  2X1N B;  3BHV B;  1T0J A;  3IQL A;  2PVD B;  1LCK A;  1VA7 A;  3RMS A;  2AZV A;  5LJ3 d;  2QAS A;  4QVC A;  2FO0 A;  3HO8 A;  1P5E B;  1PWT A;  3I56 Q;  2W96 A;  4RUG A;  5CCA A;  4JS5 A;  4BCM D;  1I8F A;  1BK2 A;  2VWF A;  1OPL A;  2BPM B;  3MY1 B;  2VYT A;  3RIR A;  2K3B A;  2R57 A;  4FYW B;  3QBY A;  5IDP B;  3URG A;  4AG1 C;  3L2V A;  1UGS B;  2C0O A;  2MF2 A;  1VQN Q;  2GTO A;  2RK2 A;  1UEB A;  3G6E T;  1MMD A;  2O2O A;  5GAN 6;  5GAN 2;  2KE9 A;  2CH4 A;  3HPW A;  2CZ7 B;  2MPX C;  2X51 A;  3M5A A;  1KC8 U;  1OKW B;  1ZSG A;  2DTO A;  1WX6 A;  1SRM A;  4BCG B;  2X4X A;  1XJW B;  5IAY A;  2FPE A;  5GAN h;  1TG0 A;  3CCE A;  3JV3 A;  3JB9 G;  4M77 F;  4FT4 A;  4B9X A;  1VQL Q;  4HT8 A;  1KC8 C;  4IIM A;  2FRY A;  1KG1 A;  2JMC A;  4D6W A;  1KQS A;  3CCV A;  2QTX A;  3VS7 A;  1SHF A;  1QCN A;  3QWY A;  3L2Q A;  2EQI A;  3JCM J;  1D0Z A;  2IVX A;  5HK3 A;  2G77 A;  2BS3 A;  4CFU D;  3V8L A;  5KYW B;  1QVG S;  5IT9 E;  1QQJ A;  5KYX A;  3INZ A;  2HKQ B;  4R0K A;  1W4S A;  3CCL A;  4M77 D;  2W10 A;  4IUV A;  1VQ5 Q;  1MV0 B;  5A0G A;  2RA2 A;  4BUG A;  4BCF B;  3CBP A;  1H1R B;  2F5K A;  1KFZ A;  1EX4 A;  3I55 T;  4MFE A;  1VQM A;  2OAW A;  3LGL A;  3JSC A;  2BKZ B;  3EGX A;  4XU1 A;  5HQ0 B;  2J05 A;  1I5O B;  2QQ9 A;  4CFU B;  2ECZ A;  2K2M A;  2FZG B;  2ZPB B;  1TU0 B;  1BKB A;  4PLL A;  2QFZ A;  1YWO A;  4DQ2 A;  1WIE A;  1NJI C;  4O6J A;  5KYU A;  4C92 E;  2B8A A;  1N6A A;  1WJR A;  1Y96 B;  4HVV A;  3ZEH A;  2IW9 B;  3CCJ T;  1NM7 A;  2X9H A;  3MCA B;  4M77 B;  4JX6 A;  2CCI B;  2V22 B;  4M75 C;  1JKW A;  3FC3 A;  1O9K B;  2MWO A;  3UWN A;  3UT1 A;  1K76 A;  3OYG A;  2KXC A;  2QQB A;  1VQ5 T;  5HCK A;  3DDP B;  1VQN T;  3VYH B;  3EG1 A;  4M75 F;  4N4I A;  1FWZ A;  4ZTF A;  3B57 A;  1OU8 A;  3OSV A;  4FW1 A;  1ZQ1 A;  3PGG A;  4MMK A;  4BDZ A;  2GQI A;  2YRD A;  2F2X A;  3SWN B;  2CP0 A;  2IG0 A;  1O9S A;  3HBL A;  1C9B A;  1SKU B;  1Z9Z A;  2VC8 A;  4KH1 B;  4BI8 B;  3CC4 T;  3TW7 A;  1ENW A;  3VKH A;  3TW6 A;  3HRU A;  2YUO A;  1VIE A;  2DNU A;  2DD5 A;  1AIS B;  3C94 A;  4HL4 A;  1PM3 A;  1Y57 A;  3NPF A;  4KBM B;  1AZG B;  2OTL A;  2EQK A;  4XTX A;  3BG3 A;  2KI7 A;  3CD6 Q;  1YI2 A;  4M7A C;  4PJO D;  4ROD A;  3U23 A;  2KNB B;  5KE2 A;  3SDZ A;  2CRE A;  3G6E Q;  1IRE B;  2LQW A;  5GAM e;  4HCZ A;  1WHK A;  3HHT B;  1C1A A;  2EJ9 A;  2NYS A;  5D6W A;  5LJ3 e;  2WPA B;  2LT4 A;  1WI7 A;  1TD6 A;  2RQT A;  1IHV A;  1IO6 A;  2BZ8 A;  1UNH D;  4NC6 A;  2O88 A;  1OU9 A;  4IUQ A;  3CCE T;  5GAM j;  4M4Z A;  4EOP B;  1MGQ A;  2P0P A;  4CXA B;  1ZSZ A;  4OP0 A;  4JPB W;  2PJQ A;  1G3T A;  2LQK A;  1JO8 A;  4CRI A;  5HBJ B;  5HY6 A;  4C92 C;  4HCC A;  3GPL A;  4ATO A;  2KY9 A;  1WA7 A;  3OSS C;  3DDQ B;  1ZUY A;  1NEB A;  4ZN3 A;  3DTO A;  1RAG B;  4CI0 C;  2WFY B;  5A2Q E;  2QA4 A;  2H3J A;  3BG9 A;  1S72 A;  2R5A A;  1XO2 A;  3G1J A;  2DLP A;  4X9C A;  5GAO p;  3CC2 Q;  4OB3 B;  3OYM A;  2ED0 A;  4O5V A;  5GAO r;  1JBM A;  1WLP B;  2C5O B;  3OYJ A;  2DXC B;  2QQS A;  2KK4 A;  2KYM A;  2QQR A;  3H0H A;  1H28 B;  2HQE A;  1PSF A;  1X75 C;  2A37 A;  1VQP T;  2WMA B;  1JQQ A;  4ZNX A;  4I3Z B;  4J9C A;  1KHI A;  1K8A C;  4N4G A;  3CME A;  2I40 B;  1V76 A;  1WFW A;  1CSK A;  2X35 A;  2XI9 A;  5IF1 B;  5LJ3 g;  1ARK A;  2PK9 B;  4AKG A;  2RQR A;  3L2W A;  1RAI B;  1JB0 E;  1AD6 A;  1PCX A;  4DEX A;  2DIG A;  1K9M R;  1Q7Y C;  1FXX A;  2E5Q A;  2UZB B;  1CKA A;  4OB0 B;  2AT1 B;  2PU9 B;  4RTV A;  4BCK B;  4A4F A;  2RPN A;  2ZZD B;  5KYW A;  3EG3 A;  3UDC A;  1OQK A;  3GBQ A;  2GQV A;  4D8D A;  5LJ3 f;  2ROT A;  1N8R U;  1I4K 1;  5GMK j;  1IGU A;  4AMC A;  5GAN 4;  4CC4 B;  2HBW A;  3C4S A;  4XU3 A;  3JCM V;  2DRK A;  3MI9 B;  5LMK B;  1SSH A;  3VS0 A;  5GAO q;  1N8R C;  1G83 A;  4IKF A;  2M0Y A;  1N9S A;  4Z89 A;  3MPU B;  1UNG D;  2XIC A;  4A4G A;  1JSU B;  2CZ0 B;  4Z6Y A;  2E41 A;  3JB9 H;  1E9H B;  1BU2 A;  2LMJ A;  4RG2 A;  1D0X A;  1TOV A;  2CP6 A;  2VGM A;  2ABL A;  3BE3 A;  3CXC P;  3CXC A;  4M7A F;  3FJ5 A;  3S3M A; 
#chains in the Genus database with same CATH homology
 2RD1 A;  3P8H A;  1YBY A;  2K5F A;  3G4S T;  2NLU A;  4NS5 A;  1NPP A;  4X34 A;  4C0D B;  3CBM A;  3QPH A;  3PNW C;  2FVU A;  3A8M B;  3CCM T;  3I56 T;  3ER0 A;  2MI6 A;  3V7S A;  3GIB A;  2KMG A;  3GNF B;  1Q82 C;  1UGR B;  2QQ8 A;  2QEX T;  5DLQ E;  1VQL A;  3TEE A;  2WSE E;  3CCU A;  2M16 A;  3BDU A;  5KCO A;  5KH6 A;  4M78 D;  5FLX E;  1DJ7 B;  1YIJ A;  2EQM A;  3SWN A;  2RHZ A;  1VIF A;  3H8Z A;  4C92 F;  3DLL A;  2KMT A;  5GAM d;  3MP8 A;  3LWH A;  4E7H A;  3CEY A;  3QII A;  3GLX A;  3QYB A;  5D6Y A;  3JCM f;  2JTM A;  3OMC A;  2X4W A;  4OB1 B;  3HFO A;  4FU6 A;  5CR2 A;  1E7P A;  2QDJ A;  2E70 A;  2YHT A;  3M4G A;  5CKF A;  1VQO T;  3RER A;  4C92 B;  2LX9 A;  2K4Y A;  3ZFJ A;  3CCL T;  4BE2 A;  3OMG A;  4M78 G;  3LGF A;  3JCM h;  3OYL A;  2MAM A;  5CK9 A;  2C06 A;  2VV5 A;  4C8Q A;  1O75 A;  3OYF A;  2X4Y A;  1BIA A;  2PUO B;  4HKE A;  5GAN 5;  2RJC A;  3OBY A;  3QYG B;  1VQ7 T;  2P0Q A;  4V2S A;  3CCR A;  1NPR A;  1UB4 A;  4J6X A;  5A0D A;  1VQ5 A;  1H3Z A;  1QVG A;  4PJO A;  1JJ2 A;  3GOX A;  4AKH A;  4M78 F;  3C95 A;  3JB9 I;  3S3O A;  3PIP A;  4BI4 A;  4C5G A;  5GMK m;  2WJ9 A;  3FJP A;  3QZ5 B;  4XQ3 A;  3SB2 A;  4FIB A;  3N5B B;  3PT9 A;  3TCJ A;  3CCS T;  4AKI A;  4JRI A;  1YIJ T;  3H4C A;  1Y96 A;  3ASK A;  2KSS A;  2AHJ B;  1N27 A;  5AYF A;  1KQS S;  4RCB A;  3JCM Q;  2QDY B;  1U1S A;  3PTA A;  4JS4 A;  4PLI A;  3OW2 S;  2EYQ A;  2GF7 A;  3VKI A;  3OYN A;  1M1K U;  4JX5 A;  4C0D C;  2HQX A;  4LD6 A;  4EPC A;  3OYK A;  1SSF A;  5CIU A;  4JUV A;  4C92 A;  3SD4 A;  5LL6 S;  5GAN 7;  3CCU T;  3CCM A;  2X4J A;  3GP8 A;  3DKM A;  1VQ4 A;  2XDB A;  3NTK A;  3G4S A;  3A8G B;  4EMG A;  2LC4 A;  3OYD A;  4M77 E;  2DVE A;  2RHU A;  2G3R A;  5FU6 B;  3NFC A;  2DZ9 A;  3EFS A;  4HNU A;  4EMK B;  1M8V A;  3A5Z B;  3NTI A;  4FSX A;  4IUR A;  2OTJ T;  2RB6 A;  1OYX A;  3HB9 A;  3OB9 A;  3VU3 C;  1BYM A;  3HRS A;  2JN0 A;  2JUF A;  1BIB A;  1QVP A;  2BUD A;  2O01 E;  5D6X A;  5IN1 A;  3OA6 A;  3CMA A;  1K73 C;  4J6Y A;  1ZHI A;  1M1K C;  1M90 U;  2RH2 A;  4UC4 A;  2YRV A;  2E65 A;  3JAM E;  4HCB A;  4QVZ A;  2DXT A;  1EIF A;  2ZPG B;  4MIM A;  2I2L A;  1KD1 U;  4ELY C;  5LJ5 d;  4J7I A;  4ELJ A;  3G71 T;  4M77 A;  3VJP A;  1JJ2 S;  1LNX A;  3MHX A;  3RES A;  2OAU A;  2DD4 A;  2DXB B;  3QJ6 A;  3CCQ A;  4M78 B;  5GMK e;  2RI3 A;  4M7A D;  1JRI A;  4PJO C;  2MWP A;  4M75 A;  2ZPI B;  3E19 A;  4TVR A;  3HL8 A;  4DA4 A;  3BG5 A;  4XTZ A;  3CCR T;  1VQ7 A;  3MET A;  3LWI A;  4ZTJ A;  1WPY A;  2YLB A;  4E7K A;  3R6O A;  2P0K A;  2XDD A;  4RKU E;  3PIO A;  3WVD B;  4QVD A;  3RMQ A;  3KXT A;  3OW2 A;  1UGQ B;  1M9S A;  3DLM A;  2DEQ A;  3KBG A;  4ZN1 A;  2DAQ A;  3BY7 A;  3M4Y A;  5I21 A;  3ZBD A;  4M7A G;  2QI2 A;  3X26 B;  4QQ6 A;  4LDY A;  5CKD A;  4C5E A;  5GAM h;  4OMF B;  1VQ8 T;  2E1H A;  3JCM g;  3CPW A;  4BE1 A;  5GAN e;  5C0M A;  5CKH A;  2Y4X A;  4MZM A;  4BI3 A;  2DTH A;  4LDU A;  2HAX A;  2PVD B;  4KUI A;  2DXC A;  3RMS A;  2Y90 A;  5LJ3 d;  1QW1 A;  2P4T A;  5GMK l;  4QVC A;  3HO8 A;  3CC2 T;  4ZGD B;  1HXD A;  2EJF A;  2JNG A;  5CCA A;  4JS5 A;  1OZ2 A;  4C8Q B;  2LQ8 A;  1B34 B;  2DTI A;  4QW2 A;  1I8F A;  3E1S A;  3CCQ T;  3TRE A;  2ZPE B;  1Q86 U;  2LNV A;  1WQ7 A;  2D6F A;  4AI6 A;  4M7A B;  2DZC A;  2VYT A;  1AHJ B;  2K3X A;  2PVG B;  3OYA A;  5GMK i;  2DPP B;  3RIR A;  2V8I A;  1LOJ A;  3FEO A;  3CCV T;  1YJ9 A;  2R57 A;  3URG A;  3QBY A;  3L2V A;  1S72 T;  2EIF A;  3A8L B;  5GAM g;  1UGS B;  2JZ2 A;  1D3B B;  4C92 G;  2ZPF B;  2MF2 A;  4XTW A;  2ZZD A;  4M75 E;  1Q7Y U;  2JVV A;  2WSF E;  2RK2 A;  2HNI A;  1UEB A;  2OTJ A;  1WJQ A;  2XD0 A;  4XAX B;  2O4X A;  3G6E T;  5GAN 6;  1XTD A;  5GAN 2;  5HKC A;  3GF5 A;  2DK3 A;  3HPW A;  4WF2 A;  4X9D A;  2CZ7 B;  3RKX A;  3M5A A;  1Q81 U;  1KC8 U;  4DOW A;  2Y4Y A;  4ZGJ B;  4BB7 A;  4PJO F;  2QF7 A;  2DTO A;  2L5Q A;  5CO7 A;  1Y07 A;  1VQ4 T;  4A4E A;  2X4X A;  2CKK A;  5IAY A;  1YJN T;  4BY6 C;  4PJO G;  2PVO B;  5GAN h;  4OGE A;  1QVF A;  3CBO A;  1WGS A;  3CCE A;  3JB9 G;  2FL7 A;  4M77 F;  4MDX A;  5GAN 8;  4FT4 A;  4B9X A;  5GAN g;  4M75 G;  1KC8 C;  2EQJ A;  4HT8 A;  1VQK T;  5I2M A;  2XK0 A;  2BKD N;  2QQA A;  1K8A U;  1KG1 A;  4D6W A;  3H6Z A;  1KQS A;  3CCV A;  2KVQ G;  2QTX A;  3CMA T;  5GAN 3;  2FYK A;  4JLG A;  3L2Q A;  3JCM J;  3SWN C;  4JRP A;  2RHX A;  5DLO A;  2K5L A;  5HK3 A;  3QDR B;  2G77 A;  2PUK B;  2BS3 A;  3EAE A;  2WSC E;  3V8L A;  4Q5W A;  3MP6 A;  2DXB A;  4JDS A;  1QVG S;  2IVW A;  3Q1J A;  5IT9 E;  3FRN A;  1U1T A;  4DOV A;  3CC2 A;  3BW1 A;  3INZ A;  4BD3 A;  3QXE B;  2RK1 A;  4QSH A;  3G7Z A;  1W4S A;  1WJS A;  3CCL A;  1YI2 T;  5GAM f;  5LJ5 g;  1Q81 C;  3OS5 A;  3CPW S;  3T9N A;  4M77 D;  1M5Q 1;  1N9R A;  4IUV A;  3QUI A;  1LJO A;  2R58 A;  5A0G A;  3M54 A;  2V8J A;  3JCM b;  2RA2 A;  3JB9 J;  3QKJ A;  1XOV A;  4BUG A;  3QZ9 B;  4FT2 A;  2K57 A;  3CBP A;  1R8O B;  3HZJ A;  4XTU A;  2F5K A;  3M56 A;  3DB4 A;  4Y28 E;  3E9G A;  5M9O A;  3I55 A;  1I5L A;  3I55 T;  5CAI A;  1ZBX A;  2ZGW A;  2CZ6 B;  3CCS A;  3FLG A;  4MFE A;  2FB7 A;  2BS4 A;  1M1F A;  1NJI U;  1VQM A;  4C5I A;  1XNI A;  3JSC A;  3LGL A;  3M53 A;  3QHS A;  4VUB A;  4C0Z A;  1NE8 A;  3EFR A;  1OI1 A;  3JRZ A;  2LRQ A;  3JCM c;  4MZT A;  4XU1 A;  3QO3 A;  3SFM A;  5CVI A;  4KUL A;  1VQL T;  4M7D G;  4PJO E;  2GFA A;  2QQ9 A;  3S3N A;  2PQW A;  4M7D F;  4LOC A;  2JTF A;  3JCM e;  2VXE A;  5EG2 A;  1X6O A;  4E7J A;  2ZPB B;  4ME7 A;  2HD0 A;  3OYC A;  2F69 A;  4M7D B;  5GAO m;  3CPF A;  4IUU A;  3V8J A;  3MEA A;  5FRM A;  3OS0 A;  2RJD A;  1BKB A;  3FIF A;  4PL6 A;  4Y91 A;  3VYG B;  3O8V A;  4BAC A;  1YJW A;  4PLL A;  4MDW A;  1G5V A;  2QFZ A;  4DQ2 A;  1VQO A;  4L6V 5;  4LDW A;  3MEW A;  4O6J A;  2EFI A;  1NJI C;  4RMO A;  4C92 E;  2B8A A;  5A0L A;  1QLB A;  3BFM A;  3MEV A;  5FRN A;  1N6A A;  1WJR A;  1Y96 B;  4A4H A;  5LJ5 j;  2A7Y A;  3ZEH A;  1K9M U;  3CCJ T;  3MCA B;  5LJ5 e;  4M77 B;  4JX6 A;  3VV0 A;  3CCJ A;  1VUB A;  2WAC A;  4M75 C;  1YJN A;  2CYZ B;  2DKG A;  2RJE A;  2V8K A;  4BY6 B;  3FC3 A;  3MEU A;  2MWO A;  3UWN A;  4HLQ A;  3ME9 A;  4RCC A;  5FRO A;  3UT1 A;  3OS1 A;  4E47 A;  4M75 B;  4M7D D;  5GAN f;  3OYG A;  2QQB A;  1BI3 A;  1G3Y A;  1VQ5 T;  3M57 A;  3LLR A;  4YTL A;  3RKY A;  1YJW T;  1KQ2 A;  1UGP B;  1VQN T;  2QXF A;  3VYH B;  4N4I A;  4M75 F;  3LYI A;  4OGC A;  3CXC S;  3V7C A;  1FWZ A;  4ZTF A;  3OSV A;  4M77 G;  3P8D A;  4EMK A;  4BE0 A;  2DJZ A;  4J83 A;  4XK8 E;  1FKM A;  3M9Q A;  1ZQ1 A;  4M6V A;  3PGG A;  4MMK A;  4BDZ A;  5GAN j;  4MFD A;  1BI2 A;  4F7U E;  5I2S A;  1BI1 A;  3KUF A;  4A54 A;  3PFS A;  1YIT T;  3SWN B;  4C92 D;  2KR6 A;  2XHC A;  2IG0 A;  2DIQ A;  3HRT A;  3NTH A;  3PMT A;  4F7U F;  4EMH A;  4M7A E;  3QJY A;  1O9S A;  2XID A;  3HBL A;  5C6S A;  4XU2 A;  4NL2 A;  1VQM T;  4XU0 A;  2VC8 A;  4EDU A;  1G3W A;  3E9F A;  4BI8 B;  3CC4 T;  4JX4 A;  3TW7 A;  3WVE B;  4XTY A;  1OZ3 A;  2LCL A;  3VKH A;  3TW6 A;  4J7F A;  3HRU A;  2R5M A;  2DD4 B;  3M55 A;  3HSB A;  1VIE A;  2XG8 D;  4QQG A;  4HL4 A;  2DD5 A;  2GFU A;  3C94 A;  4FM4 B;  4HNT A;  4BBS M;  4II1 A;  4PKC C;  2EKO A;  2QEX A;  3CME T;  3OYH A;  2M9U A;  4KBM B;  2JOY A;  4HA8 A;  3I56 A;  3RUX A;  2OTL A;  4M75 D;  4FL6 A;  5CQX A;  2EQK A;  4KT0 E;  4XTX A;  3BG3 A;  2M0O A;  5J3B A;  4B9W A;  2LT1 A;  4IUP A;  1YI2 A;  2LVM A;  4KUD K;  4M7A C;  4PJO D;  3J7A F;  3DB3 A;  3OYY A;  3M58 A;  4J8O A;  4PJO B;  1X01 A;  2HBP A;  4JLI A;  5KE2 A;  5KE3 A;  3SDZ A;  4N0A A;  3MO8 A;  4JJN K;  1W2B S;  4P5N A;  4C8Q D;  4C8Q C;  3FDR A;  3F70 A;  1IRE B;  5GAM e;  4LD9 K;  2RHI A;  5GAN d;  4HCZ A;  1RL2 A;  4N4H A;  2XKO C;  1FX7 A;  3V8K A;  3S6W A;  1M90 C;  2GCX A;  3HHT B;  2D9T A;  2E6Z A;  1YHQ A;  4IUT A;  1Q86 C;  2EAY A;  3TU4 K;  2EJ9 A;  4BBR M;  5D6W A;  5LJ3 e;  1YIT A;  1NZ9 A;  4E7I A;  2LT4 A;  2QA4 T;  3QSU A;  4MZP A;  2XU8 A;  2K5I A;  3HP9 A;  1VQK A;  1G3S A;  2EQU A;  2LTO A;  4GY5 A;  1VQ6 A;  2RI5 A;  2DD5 B;  2F5T X;  4NC6 A;  3QG1 A;  3JB9 F;  2M1H A;  4IUQ A;  4F7U A;  2L8D A;  5CKE A;  5DY9 A;  5GAM j;  3CCE T;  4EMK C;  3RKW A;  1GXI E;  1MGQ A;  2BIV A;  2P0P A;  2VUB A;  1M1G A;  4L59 A;  1VQP A;  1P92 A;  4OP0 A;  5J26 A;  3CC7 A;  3CC7 T;  1G3T A;  2LQK A;  4CRI A;  5HY6 A;  4A4K A;  3G6E A;  3J81 E;  1U8R A;  1BI0 A;  2E12 A;  4Z02 A;  4C92 C;  4C8Q F;  4HCC A;  1IZ6 A;  1TH7 A;  2RM4 A;  3GPL A;  4ATO A;  2KY9 A;  4M7A A;  3OYI A;  2YLC A;  3L1A A;  3OSS C;  3OYB A;  4PNO A;  1VQ6 T;  3LH0 A;  4M7D C;  3UPU A;  4ZN3 A;  4CI0 C;  5HK0 A;  2RO0 A;  2LCC A;  2LDM A;  1KD1 C;  4M77 C;  1KQ1 A;  3JCM X;  1Y7X A;  5A2Q E;  2H3J A;  3BG9 A;  3X25 B;  2RHY A;  2QA4 A;  2RJF A;  1YJ9 T;  4OVA A;  1S72 A;  3VUB A;  2VGN A;  2VXF A;  2R5A A;  5CQY A;  2EWN A;  4L5G A;  4NL3 A;  4LDV A;  4X9C A;  5GAO p;  1VQN A;  2KQW A;  4JRK A;  3JB9 D;  4RG8 A;  4GLK A;  4F7U B;  1MHN A;  3L2U A;  4OB3 B;  2O4X B;  3J80 E;  2CGH A;  3OYM A;  1YCY A;  3HKS A;  3HFN A;  4O5V A;  5GAO r;  1XQH A;  2EJG A;  3LX7 A;  1JBM A;  3OYJ A;  2DXC B;  1WNL A;  2KK4 A;  2QQS A;  3V7R A;  4N0A C;  1VQ9 T;  4HT9 A;  2QQR A;  5FU7 B;  1VQ9 A;  2HQE A;  1PSF A;  1X75 C;  4M78 E;  3JCM d;  5GMK h;  1VQP T;  4LDX A;  5EJC A;  1M4Z A;  5KCH A;  1KHI A;  1B34 A;  5GAO l;  1K8A C;  5FU6 C;  4N4G A;  3CME A;  4NOY A;  2ZCF B;  3OY9 A;  2L89 A;  1VQ8 A;  4M7D E;  4OF1 A;  2X35 A;  3C12 A;  3CD6 T;  3QWL A;  3QYH B;  3QYE A;  1H64 1;  2XI9 A;  5LJ3 g;  3CC4 A;  3A8H B;  4AKG A;  5LJ3 j;  3L2W A;  1K73 U;  4J6W A;  4BDY A;  4C0G A;  1YHQ T;  2DXU A;  4F7U G;  1JB0 E;  4XTV A;  5LJ3 h;  5LJ5 h;  2DIG A;  4MML A;  1K9M C;  3JCM W;  1FXX A;  4HNV A;  2E5Q A;  4M78 C;  5DM7 R;  1Q7Y C;  3M59 A;  3JCM P;  3X28 B;  3CD6 A;  4OB0 B;  2PU9 B;  4A4F A;  3FB9 A;  3MP1 A;  1W2B A;  3KHI A;  2ZZD B;  5CKB A;  3UDC A;  4JRQ A;  3P8B B;  3L2R A;  1QVF S;  2GQV A;  5LJ3 f;  2XDP A;  2DO3 A;  1I4K 1;  5GMK j;  5LJ5 f;  4OB2 B;  1N8R U;  3L2Z A;  2CZ1 B;  5GAN 4;  1Q82 U;  1PSE A;  2L3R A;  2RI2 A;  3X20 B;  4C0F A;  4M7D A;  3VYG A;  3A8O B;  4ELZ C;  3C4S A;  4XU3 A;  2OTL T;  2BS2 A;  3JCM V;  5J39 A;  4C8Q E;  1V29 B;  1KHC A;  3WXM B;  1QP3 A;  2E6N A;  2E64 A;  5GAO q;  2KDS A;  4J5Y A;  1N8R C;  4C5H A;  1QP2 A;  1HK9 A;  4IKF A;  2ZPH B;  3AHU A;  1I81 A;  3VKG A;  4R55 A;  3G71 A;  1N9S A;  4ZGE B;  2MMP A;  2K3Y A;  1Y71 A;  3OBW A;  3OQ5 A;  2KAF A;  3LW5 E;  2XIC A;  2FHD A;  3DL1 A;  5L8R E;  4A4G A;  3GNG A;  5GAO n;  2E10 A;  2D0Q B;  2CZ0 B;  4Z6Y A;  2A3L A;  2E41 A;  3VUZ A;  4A53 A;  4R56 A;  2K2V A;  3JB9 H;  1D3B A;  3L42 A;  4RG2 A;  3BDL A;  4C8Q G;  3OS2 A;  3PMI A;  3OYE A;  2VGM A;  4QQD A;  4M78 A;  5FU7 C;  2CS7 A;  3CXC A;  1WQW A;  4M7A F;  1RI0 A;  3S3M A;  3X24 B;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...