3A8UX

Crystal structure of omega-amino acid:pyruvate aminotransferase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
441
structure length
441
Chain Sequence
b'ASLASQLKLDAHWMPYTANRNFLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFQYGHPLSFQLAEKITDLTPGNLNHVFFTDSGSECALTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQPMQDVDHLPHTLLASNAYSRGMPKEGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKGAKNVIDIRNFGLAGAIQIAPRDGDAIVRPFEAGMALWKAGFYVRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLNKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Omega-amino acid--pyruvate aminotransferase
publication title Crystal Structure of omega-Amino Acid:Pyruvate Aminotransferase
rcsb
molecule tags Transferase
total genus 146
structure length 441
sequence length 441
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3a8uX02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3a8uX01
4W5KA 3AATA 4WYDA 2HUIA 3VK2A 1AKCA 4W8IA 4AOAA 4A6UA 3FCRA 4WXFA 3WCOA 2JJFA 1AKAA 1GC0A 3ATHA 4UQVA 4K2BA 1WYUA 3RUYA 4F5KA 2YRIA 4MQPA 3DZZA 1ASNA 3QN6A 1BJOB 2VMXA 1ARTA 2C0RA 2Z20A 1AAWA 3BV0A 2JJHA 2R5CA 3AOWA 1C4KA 1D2FA 1YOOA 3FKDA 2W7FA 4GSAA 1M0PA 2BIAA 5EAAA 1GD9A 2R5EA 2VGUA 2E7UA 1CQ6A 4CBRA 1AIAA 1OHWA 1TPLA 2DGKA 1AMAA 3CAIA 4N0BA 4A0RA 3RQ1A 3TFTA 1LKCA 2XH1A 5IWQA 3FQAA 1WKHA 4AO9A 3LY1A 3MADA 4W91A 2AY2A 2VGZA 1AHEA 3G7QA 5K8BA 1ARGA 4ISYA 4K2IA 4UOYA 1SVVA 1AMSA 1ELUA 5JAYA 2D63A 1CZEA 1AHYA 1GC4A 5BJ4A 2DOUA 5D95A 4BA4A 1KL1A 3KGWA 3I4JA 2WK9A 1AX4A 3ASAA 2BI5A 3DXWA 1CS1A 2E7JA 2BIEA 3PJ0A 4Q31A 3FFRA 4DGTA 1KL2A 3NU7A 4RJ0A 1DTYA 3K28A 4ZWVA 1J04A 1ORDA 4OMAA 2HUFA 5E3KA 4MKJA 1MDXA 4WYEA 3LVJA 4WBTA 1G7XA 3MAFB 3E2YA 3JZLA 2R2NA 3ECDA 2YHKA 3HQTA 5G2QA 3AEJA 5G09A 3FD0A 2FNUA 1VEFA 3BWOA 2TPLA 3GSBA 4CBSA 3I16A 1B9HA 4P3MA 1ASEA 2HOXA 2D7ZA 1AIBA 1PMOA 1ARHA 2ZP7A 4F5MA 1M4NA 1C7NA 2VLFA 4OT8A 2V1PA 1BQDA 1ASAA 3A2BA 2VMNA 4KXKA 3IF2A 4ZLVA 2C7TA 1S06A 2VMWA 1BW0A 2W7IA 1BJWA 2VGTA 4PFFA 4R5FA 3DRDA 4IXOA 4E77A 2YCPA 1TASA 2W7MA 2AY7A 2W7DA 3BWNA 4PIWA 1RVYA 4TN4A 3MEBA 1ZODA 3T32A 3WY7A 2W8UA 3PAAA 2GMUA 2YKXA 3RCHA 3NYTA 3JTXA 1CQ7A 1C7OA 2VMQA 5EAVA 3MKJA 3EI9A 2ZJGA 1AJSB 3RBFA 4P7YA 1BJNA 4ADDA 4MGRA 1EJIA 1LW4A 1FG3A 4LW2A 3LV2A 3RBLA 2VMUA 3E2ZA 1DFOA 1X0MA 2JJGA 4ATPA 3HMUA 2CJGA 2E54A 1QITA 2JG2A 2YCTA 1LC7A 4JF0A 4A00A 1YJSA 4LNJA 4WD2A 2OGEA 1X2AA 3WGBA 4FFCA 1DJEA 3ZZKA 2ZSMA 2ZY2A 3QM2A 2D64A 4BHDA 1XI9A 3ZRRA 1V2EA 4ZSYA 3HBXA 4L0OA 2OKKA 1Z3ZA 4A0HA 2CJHA 1CJ0A 3L44A 1E5EA 2Z1YA 4XJMA 1GEXA 1ASCA 5LH9A 2W8TA 1PMMA 3MC6A 1TOIA 4CVQA 2EPJA 1LS3A 2CY8A 2ZC0A 1AMQA 1KKJA 4WYCA 4ZASA 3AENB 4OC9A 4EB7A 4RITA 5EQCA 3WKRA 3W1HA 4M2MA 4R8DA 4UHMA 3FDBA 1N8PA 2AY9A 2BHXA 1J32A 3FFHA 1C0NA 5EIGA 5FT4A 1QGNA 3PIUA 3HL2A 3H7FA 1MDOA 4AZJA 1LC5A 2BI1A 3H14A 4KYOA 4DBCA 1TOEA 2VMYA 2D5YA 3AELA 3AEOA 4ZDPA 2CSTA 5I92A 2HOZA 4A0FA 2VGVA 2YKVA 2DKJA 1AY4A 4GE4A 4Q6RA 5TF5A 3A9ZA 2FM1A 1OATA 3K40A 2W8VA 4OYTA 3AV7A 1YJZA 4RM1A 1D7UA 2V0YA 1U08A 5DJ1A 4IY7A 1O61A 3JWBA 2AY4A 3MAUA 3EIAA 2W7HA 2WKAA 1AAMA 2VMTA 2CH2A 1WSTA 4I8AA 5EFSA 4ATQA 1BJOA 3EI5A 1GC2A 1E5FA 3QBOA 1OHYA 1B5PA 1SPAA 3ACZA 4OCAA 4IYOB 4J8LA 4XJPA 2BI2A 5HHYA 4ZSWA 1QJ3A 4DQ6A 3BS8A 4QGRA 4O6ZA 2PO3A 3VK4A 1RV3A 2PB2A 5F9SA 2D66A 1ASGA 1B9IA 5M4BA 4UHNA 1EQBA 2AY3A 4JEWA 1ASFA 5EUEA 1V72A 4M2KA 3USFA 4ADBA 3B46A 4JE5D 3AEJC 4ZM4A 3DYDA 3AOVA 3EUCA 3Q8NA 4JEZA 4WLJA 4EU1A 1D7RA 2VLHA 4U1TA 1IAYA 3VAXA 1CL2A 4MKKA 3AEPA 1MAQA 2W7GA 1KMJA 1SFFA 2VMOA 5BJ3A 3B8XA 3BCBA 2OKJA 2Q7WA 4XK1A 3NTJA 1BJ4A 1IAXA 1AHGA 3DU4A 4E3RA 2C44A 3A9YA 4ITGA 5FT6A 3VP6A 1I43A 3UAKA 4CXQA 1MGVA 2CJDA 2VMZA 3LVKA 4GDYA 2VYCA 4F4EA 2AY5A 2QLRA 4M2JA 3BWNC 4Q76A 1W3UA 1WKGA 4RAEA 1IUGA 4HVKA 3QGUA 3BCAA 4XJOA 5M49A 3PA9A 1I29A 3HDOA 4JEXA 3EZ1A 3GETA 2X3LA 3EIBA 1DJUA 1ASMA 5LHAA 4Q75A 4LW4A 3WCNA 4NOGA 2ZY3A 9AATA 3LG0A 3MAFA 3OP7A 3GR9A 3DR7A 1GCKA 2VMVA 3WX9A 1G7WA 4EB5A 3TCMA 3MBBA 1C7GA 1PFFA 2VGWA 3A8UX 3P1TA 4PFNA 1QZ9A 1VJOA 1O69A 1G4XA 1P3WA 2VGSA 1ZC9A 3FVSA 3BCXA 1OXOA 4ADEA 1VP4A 2EZ2A 2W7EA 2FQ6A 4Y0HA 1CQ8A 1WYVB 4J5UA 3ELEA 1ASLA 1YNUA 2W8JA 4XAUA 4ZDLA 3N5MA 1V2DA 4WB0B 4WXGA 5G0AA 2ZSLA 1DJ9A 3LVMA 2BWPA 2GQNA 2BKWA 3TATA 4RJYA 1B5OA 1B8GA 3MC6C 2QA3A 3FQ7A 4MQQA 4ITXA 4R5ZA 3L8AA 1S07A 1LW5A 1WYTB 3M5UA 4OBVA 4WXBA 1FC4A 1QJ5A 2AEVA 4JE5A 4XEWA 2X5DA 4F5IA 1AY5A 2YCNA 1AICA 2OATA 2VIBA 3EI6A 1UU1A 3W1IA 1YIZA 1S0AA 1D7SA 2D65A 2JISA 4F5HA 1GDEA 1ARIA 1TARA 2HOYA 1LC8A 1AJSA 1IVRA 3NU8A 5F8VA 2ZYJA 1FG7A 1DKAA 5M4DA 2NMPA 4GEBA 3NYUA 3B1EA 3PD6B 2Z61A 3R4TA 3A9XA 2Z67A 4OTLA 2X8UA 4Y0DA 1MAPA 4B9BA 1QIRA 3G8MA 3AEMA 1V2FA 3II0A 3PDBB 2AY1A 2X5FA 4JEYA 2QB3A 3HVYA 2R0TA 3PDXA 4XQ2A 1JS6A 1H0CA 4H51A 2YKYA 1ZOBA 1O62A 2WK7A 3KE3A 3PPLA 4RIZA 2O1BA 1M0OA 2XBNA 2Z9XA 3W1JA 2G6WA 3DC1A 1BQAA 4JEVA 1W7MA 1GC3A 1UU0A 2BYLA 1BKGA 1H1CA 1RVUA 1AHXA 3OKSA 1KMKA 5E4ZA 4RKCA 1PG8A 1OHVA 3BN1A 4XJLA 1X29A 2BI9A 3F0HA 3AENA 1UKJA 3E2FA 3IHJA 2CH1A 4MSOA 2EH6A 4GE9A 4UHOA 1AMRA 4WYAA 2DGMA 1WYUB 4ZDOA 4AH3A 2WK8A 3NUIA 4PVFA 2VI9A 1C9CA 4F5FA 2FNIA 2R5CB 3LWSA 2ORDA 1W23A 3EZSA 3HT4A 1GBNA 4ZAHA 2C81A 3FDDA 3EI7A 2HP1A 3FZ7A 1OXPA 5EUNA 2O0RA 1MDZA 1BT4A 2W7KA 5AX8A 2FYFA 2GB3A 4AO4A 2YRRA 3K7YA 3UWCA 2Z9VA 3E77A 1IX7A 2CFBA 1XEYA 4TMRA 3N75A 1M32A 2ZUKA 1RV4A 3KKIA 4F5GA 4W1WA 2VI8A 1JG8A 4F5LA 1GEYA 3GZDA 2HORA 4EMYA 1IJIA 4Y0IA 3F9TA 3GBXA 4K2MA 4E1OA 2BIGA 3FSLA 2D61A 1SF2A 1EG5A 1MLYA 2Z1ZA 1D7VA 4ADCA 4ZM3A 4IYOA 8AATA 2DR1A 3DODA 3BC8A 1KKPA 5G2PA 1JF9A 4HF8A 2JGTA 2BWNA 1AHFA 1M6SA 2BWOA 1G4VA 3CQ6A 4ZWMA 4LC3A 3FZ6A 1GEWA 1O4SA 3EI8A 4IW7A 3QPGA 4RKDA 3ISLA 2O7CA 3I5TA 3ELPA 4IXZA 5C6UA 3QHXA 3FQ8A 1YJYA 1TATA 2DGLA 3B1CA 2OGAA 3N0LA 4A72A 2CB1A 1QISA 1ARSA 3E6GA 1CL1A 3P6KA 2W7LA 2AATA 4AZKA 4A0GA 5HDMA 1M0NA 3WLXA 1TOJA 4BMKA 3FTBA 2HZPA 1N2TA 5DJ9A 2Z9WA 2CINA 2AY6A 1W7LA 4FL0A 4BA5A 4MQRA 5M46A 4R2NA 3JWAA 2D7YA 2YKUA 3NNKA 1DGEA 3F6TA 2W7JA 1IBJA 4TV7A 5HXXA 2OQXA 1TOGA 2CANA 2HP2A 3DR4A 3FZ8A 4WP0A 1IX6A 3QI6A 4JF1A 4A6TA 4LNLA 4BQ0A 1SZUA 2FN6A 1YAAA 3RI6A 1I41A 1Z7DA 4WLHA 4OBUA 7AATA 2EGYA 4N0WA 2VMPA 3BB8A 1Y4IA 3AEMC 1CZCA 5EUDA 3TQXA 3RCHB 2F8JA 3ZRPA 1AY8A 1SZSA 4CXRA 3FVXA 4F5JA 4B98A 2AEUA 1X28A 1AJRA 1ELQA 4RLGA 2E7IA 3PGYA 5FT8A 3GJUA 2ZY5A 2AY8A 3E2ZB 1B4XA 1WYVA 5J8QA 3E9KA 3NRAA 1I48A 2VMSA 1ECXA 3CQ5A 4WB0A 5G4IA 3HLMA 3ASBA 1T3IA 3JW9A 1AKBA 4KAMA 2BYJA 2GSAA 1M7YA 3ZRQA 3NYSA 2VMRA 1N31A 1S09A 3FVUA 1SZKA 4U2HA 3NUBA 1WYTA 3B1DA 1BS0A 1YIYA 4GE7A 2RFVA 2Z9UA 3G0TA 4W1VA 4MY5A 2EO5A 3GZCA 3NDNA 1MLZA 2QBTA 4IX8A 2HUUA 3LVLB 2BI3A 4GRXA 2VIAA 3GWPA 1LK9A 3WGCA 5FT5A 3ZZJA 2CTZA 4WYFA 2QB2A 2JJEA 3R9AA 3PD6A 3VOMA 4A6RA 3KGXA 3DXVA 2PB0A 4W1XA 5DX5A 1M0QA 3CBFA 5G4JA 3UE8A 1IX8A 3PDBA 4LNMA 1JS3A 5EIGB 2QMAA 3WKSA 2YOBA 1DGDA 1W7NA 3VK3A 5DB5A 1ASDA 4WYGA 3GZDC 1TOKA 3JU7A 3FRKA 3COGA 3WZFA 2EZ1A 5E5IA 4EFFA 2ZY4A 2DKBA 5D5SA 1S08A 3NX3A 1ASBA 3TFUA 2GMSA 1UU2A 3D6KA 2W8WA 4IXSA 4E3QA 3CQ4A
chains in the Genus database with same CATH superfamily
4W5KA 3AATA 4WYDA 2HUIA 3VK2A 1AKCA 4W8IA 4AOAA 4A6UA 3FCRA 4WXFA 3WCOA 2JJFA 1AKAA 1GC0A 3ATHA 4UQVA 4K2BA 1WYUA 3RUYA 4F5KA 2YRIA 4MQPA 3DZZA 1ASNA 3QN6A 1BJOB 2VMXA 1ARTA 2C0RA 2Z20A 1AAWA 3BV0A 2JJHA 2R5CA 3AOWA 1C4KA 1D2FA 1YOOA 3FKDA 2W7FA 4GSAA 1M0PA 2BIAA 5EAAA 1GD9A 2R5EA 2VGUA 2E7UA 1CQ6A 4CBRA 1AIAA 1OHWA 1TPLA 2DGKA 1AMAA 3CAIA 4N0BA 4A0RA 3RQ1A 3TFTA 1LKCA 2XH1A 5IWQA 3FQAA 1WKHA 4AO9A 3LY1A 3MADA 4W91A 2AY2A 2VGZA 1AHEA 3G7QA 5K8BA 1ARGA 4ISYA 4K2IA 4UOYA 3N7NA 1SVVA 1AMSA 1ELUA 5JAYA 2D63A 1CZEA 1AHYA 2QSRA 1GC4A 5BJ4A 2DOUA 5D95A 4BA4A 1KL1A 3KGWA 3I4JA 2WK9A 1AX4A 3ASAA 2BI5A 3DXWA 1CS1A 2E7JA 2BIEA 3PJ0A 4Q31A 3FFRA 4DGTA 1KL2A 3NU7A 4RJ0A 1DTYA 3K28A 4ZWVA 1J04A 1ORDA 4OMAA 2HUFA 5E3KA 4MKJA 1MDXA 4WYEA 3LVJA 4WBTA 1G7XA 3MAFB 3E2YA 3JZLA 2R2NA 3ECDA 2YHKA 3HQTA 5G2QA 3AEJA 5G09A 3FD0A 2FNUA 1VEFA 3BWOA 2TPLA 3GSBA 4CBSA 3I16A 1B9HA 4P3MA 1ASEA 2HOXA 2D7ZA 1AIBA 1PMOA 1ARHA 2ZP7A 4F5MA 1M4NA 1C7NA 2VLFA 4OT8A 2V1PA 1BQDA 1ASAA 3A2BA 2VMNA 4KXKA 3IF2A 4ZLVA 2C7TA 1S06A 2VMWA 1BW0A 2W7IA 1BJWA 2VGTA 4PFFA 4R5FA 3DRDA 4IXOA 4E77A 2YCPA 1TASA 2W7MA 2AY7A 2W7DA 3BWNA 4PIWA 1RVYA 4TN4A 3MEBA 1ZODA 3T32A 3WY7A 2W8UA 3PAAA 2GMUA 2YKXA 3RCHA 3NYTA 3JTXA 1CQ7A 1C7OA 2VMQA 5EAVA 3MKJA 3EI9A 2ZJGA 1AJSB 3RBFA 4P7YA 1BJNA 4ADDA 4MGRA 1EJIA 1LW4A 1FG3A 4LW2A 3LV2A 3RBLA 2VMUA 3E2ZA 1DFOA 1X0MA 2JJGA 4ATPA 3HMUA 2CJGA 2E54A 1QITA 2JG2A 2YCTA 1LC7A 4JF0A 4A00A 1YJSA 4LNJA 4WD2A 2OGEA 1X2AA 3WGBA 4FFCA 1DJEA 3ZZKA 2ZSMA 2ZY2A 3QM2A 2D64A 4BHDA 1XI9A 3ZRRA 1V2EA 4ZSYA 3HBXA 4L0OA 2OKKA 1Z3ZA 4A0HA 2CJHA 1CJ0A 3L44A 1E5EA 2Z1YA 4XJMA 1GEXA 1ASCA 5LH9A 2W8TA 1PMMA 3MC6A 1TOIA 4CVQA 2EPJA 1LS3A 2CY8A 2ZC0A 1AMQA 1KKJA 4WYCA 4ZASA 3AENB 4OC9A 4EB7A 4RITA 5EQCA 3WKRA 3W1HA 4M2MA 4R8DA 4UHMA 3FDBA 1N8PA 2AY9A 2BHXA 1J32A 3FFHA 1C0NA 5EIGA 5FT4A 1QGNA 3PIUA 3HL2A 3H7FA 1MDOA 4AZJA 1LC5A 2BI1A 3H14A 4KYOA 4DBCA 1TOEA 2VMYA 2D5YA 3AELA 3AEOA 4ZDPA 2CSTA 5I92A 2HOZA 4A0FA 2VGVA 2YKVA 2DKJA 1AY4A 4GE4A 4Q6RA 5TF5A 3A9ZA 2FM1A 1OATA 3K40A 2W8VA 4OYTA 3AV7A 1YJZA 4RM1A 1D7UA 2V0YA 1U08A 5DJ1A 4IY7A 1O61A 3JWBA 2AY4A 3MAUA 3EIAA 2W7HA 2WKAA 1AAMA 2VMTA 2CH2A 1WSTA 4I8AA 5EFSA 4ATQA 1BJOA 3EI5A 1GC2A 1E5FA 3QBOA 1OHYA 1B5PA 1SPAA 3ACZA 4OCAA 4IYOB 4J8LA 4XJPA 2BI2A 5HHYA 5KTBA 4ZSWA 1QJ3A 4DQ6A 3BS8A 4QGRA 4O6ZA 2PO3A 3VK4A 1RV3A 2PB2A 5F9SA 3H9XA 2D66A 1ASGA 1B9IA 5M4BA 4UHNA 1EQBA 2AY3A 4JEWA 1ASFA 5EUEA 1V72A 4M2KA 3USFA 4ADBA 3B46A 4JE5D 3AEJC 4ZM4A 3DYDA 3AOVA 3EUCA 3Q8NA 4JEZA 4WLJA 4EU1A 1D7RA 2VLHA 4U1TA 1IAYA 3VAXA 1CL2A 4MKKA 3AEPA 1MAQA 2W7GA 1KMJA 1SFFA 2VMOA 5BJ3A 3B8XA 3BCBA 2OKJA 2Q7WA 4XK1A 3NTJA 1BJ4A 1IAXA 1AHGA 3DU4A 4E3RA 2C44A 3A9YA 2KFPA 4ITGA 5FT6A 3VP6A 1I43A 3UAKA 4CXQA 1MGVA 2CJDA 2VMZA 3LVKA 4GDYA 2VYCA 4F4EA 2AY5A 2QLRA 4M2JA 3BWNC 4Q76A 1W3UA 1WKGA 4RAEA 1IUGA 4HVKA 3QGUA 3BCAA 4XJOA 5M49A 3PA9A 1I29A 3HDOA 4JEXA 3EZ1A 3GETA 2X3LA 2FKIA 3EIBA 1DJUA 1ASMA 5LHAA 4Q75A 4LW4A 3WCNA 4NOGA 2ZY3A 9AATA 3LG0A 3MAFA 3OP7A 3GR9A 3DR7A 1GCKA 2VMVA 3WX9A 1G7WA 4EB5A 3TCMA 3MBBA 1C7GA 1PFFA 2VGWA 3A8UX 3P1TA 4PFNA 1QZ9A 1VJOA 1O69A 1G4XA 1P3WA 2VGSA 1ZC9A 3FVSA 3BCXA 1OXOA 4ADEA 1VP4A 2EZ2A 2W7EA 2FQ6A 4Y0HA 1CQ8A 1WYVB 4J5UA 3ELEA 1ASLA 1YNUA 2W8JA 4XAUA 4ZDLA 3N5MA 1V2DA 4WB0B 4WXGA 5G0AA 2ZSLA 1DJ9A 3LVMA 2BWPA 2GQNA 2BKWA 3TATA 4RJYA 1B5OA 1B8GA 3MC6C 2QA3A 3FQ7A 4MQQA 4ITXA 4R5ZA 3L8AA 1S07A 1LW5A 1WYTB 3M5UA 4OBVA 4WXBA 1FC4A 1QJ5A 2AEVA 4JE5A 4XEWA 2X5DA 4F5IA 1AY5A 2YCNA 1AICA 2OATA 2VIBA 3EI6A 1UU1A 3W1IA 1YIZA 1S0AA 1D7SA 2D65A 2JISA 4F5HA 1GDEA 1ARIA 1TARA 2HOYA 1LC8A 1AJSA 1IVRA 3NU8A 5F8VA 2ZYJA 1FG7A 1DKAA 5M4DA 2NMPA 4GEBA 3NYUA 4K05A 3B1EA 3PD6B 2Z61A 3R4TA 3A9XA 2Z67A 4OTLA 2X8UA 4Y0DA 1MAPA 4B9BA 1QIRA 3G8MA 3AEMA 1V2FA 3II0A 3PDBB 2WB6A 3N4RA 2AY1A 2X5FA 4JEYA 2QB3A 3HVYA 2R0TA 3PDXA 4XQ2A 1JS6A 1H0CA 4H51A 2YKYA 1ZOBA 1O62A 2WK7A 3KE3A 3PPLA 4H63Q 4RIZA 2O1BA 1M0OA 2XBNA 2Z9XA 3W1JA 2G6WA 3DC1A 1BQAA 4JEVA 1W7MA 1GC3A 1UU0A 2BYLA 1BKGA 1H1CA 1RVUA 1AHXA 3OKSA 1KMKA 5E4ZA 4RKCA 1PG8A 1OHVA 3BN1A 4XJLA 1X29A 2BI9A 3F0HA 3AENA 1UKJA 3E2FA 3IHJA 2CH1A 4MSOA 2EH6A 4GE9A 4UHOA 1AMRA 4WYAA 2DGMA 1WYUB 4ZDOA 4AH3A 2WK8A 3NUIA 4PVFA 2VI9A 1C9CA 4F5FA 2FNIA 2R5CB 3LWSA 2ORDA 1W23A 3EZSA 3HT4A 1GBNA 4ZAHA 2C81A 3FDDA 3EI7A 2HP1A 3FZ7A 1OXPA 5EUNA 2O0RA 1MDZA 1BT4A 2W7KA 5AX8A 2FYFA 2GB3A 4AO4A 2YRRA 3K7YA 3UWCA 2Z9VA 2G7JA 3E77A 1IX7A 2CFBA 1XEYA 4TMRA 3N75A 1M32A 2ZUKA 1RV4A 3KKIA 4F5GA 4W1WA 2VI8A 1JG8A 4F5LA 1GEYA 3GZDA 2HORA 4EMYA 1IJIA 4Y0IA 3F9TA 3GBXA 4K2MA 4E1OA 2BIGA 3FSLA 2D61A 1SF2A 1EG5A 1MLYA 2Z1ZA 1D7VA 4ADCA 4ZM3A 4IYOA 8AATA 2DR1A 3DODA 3BC8A 1KKPA 5G2PA 1JF9A 4HF8A 2JGTA 2BWNA 1AHFA 1M6SA 2BWOA 1G4VA 3CQ6A 4ZWMA 4LC3A 3FZ6A 1GEWA 1O4SA 3EI8A 4IW7A 3QPGA 4RKDA 3ISLA 2O7CA 3I5TA 3ELPA 4IXZA 5C6UA 3QHXA 3FQ8A 1YJYA 1TATA 2DGLA 3B1CA 2OGAA 3N0LA 4A72A 2CB1A 1QISA 1ARSA 3E6GA 1CL1A 3P6KA 2W7LA 2AATA 4AZKA 4A0GA 5HDMA 1M0NA 3WLXA 1TOJA 4BMKA 3FTBA 1KAFA 2HZPA 1N2TA 5DJ9A 2Z9WA 2CINA 2AY6A 1W7LA 4FL0A 4BA5A 4MQRA 5M46A 4R2NA 3JWAA 2D7YA 2YKUA 3NNKA 1DGEA 3F6TA 2W7JA 1IBJA 4TV7A 5HXXA 2OQXA 1TOGA 2CANA 2HP2A 3DR4A 3FZ8A 4WP0A 1IX6A 3QI6A 4JF1A 4A6TA 4LNLA 4BQ0A 1SZUA 2FN6A 1YAAA 3RI6A 1I41A 1Z7DA 4WLHA 4OBUA 7AATA 2EGYA 4N0WA 2VMPA 3BB8A 1Y4IA 3AEMC 1CZCA 5EUDA 3TQXA 3RCHB 2F8JA 3ZRPA 1AY8A 1SZSA 4CXRA 3FVXA 4F5JA 4B98A 2AEUA 1X28A 1AJRA 1ELQA 4RLGA 2E7IA 3PGYA 5FT8A 3GJUA 2ZY5A 2AY8A 3N4SA 3E2ZB 1B4XA 1WYVA 5J8QA 3E9KA 3NRAA 1I48A 2VMSA 1ECXA 3CQ5A 4WB0A 5G4IA 3HLMA 3ASBA 1T3IA 3JW9A 1AKBA 4KAMA 2BYJA 2GSAA 1M7YA 3ZRQA 3NYSA 2A1VA 2VMRA 1N31A 1S09A 3FVUA 1SZKA 4U2HA 3NUBA 1WYTA 3B1DA 1BS0A 1YIYA 4GE7A 2RFVA 2Z9UA 3G0TA 4W1VA 4MY5A 2EO5A 3GZCA 3NDNA 1MLZA 2QBTA 4IX8A 2HUUA 3LVLB 2BI3A 4GRXA 2VIAA 3GWPA 1LK9A 3WGCA 5FT5A 3ZZJA 2CTZA 4WYFA 2QB2A 2JJEA 3R9AA 3PD6A 3VOMA 4A6RA 2EYQA 3KGXA 3DXVA 2PB0A 4W1XA 5DX5A 1M0QA 3CBFA 5G4JA 3UE8A 1IX8A 3PDBA 4LNMA 1JS3A 5EIGB 2QMAA 3WKSA 2YOBA 3N4XA 1DGDA 1W7NA 3VK3A 5DB5A 1ASDA 4WYGA 3GZDC 1TOKA 3JU7A 3FRKA 3COGA 3WZFA 2EZ1A 5E5IA 4EFFA 2ZY4A 2DKBA 5D5SA 1S08A 3NX3A 1ASBA 3TFUA 2GMSA 1UU2A 3D6KA 2W8WA 4IXSA 4E3QA 3CQ4A
chains in the Genus database with same CATH topology
4W5KA 3AATA 4WYDA 2HUIA 3VK2A 1AKCA 4W8IA 4AOAA 4A6UA 3FCRA 4WXFA 3WCOA 2JJFA 1AKAA 1GC0A 3ATHA 4UQVA 4K2BA 1WYUA 3RUYA 4F5KA 2YRIA 4MQPA 3DZZA 1ASNA 3QN6A 1BJOB 2VMXA 1ARTA 2C0RA 2Z20A 1AAWA 3BV0A 2JJHA 2R5CA 3AOWA 1C4KA 1D2FA 1YOOA 3FKDA 2W7FA 4GSAA 1M0PA 2BIAA 5EAAA 1GD9A 2R5EA 2VGUA 2E7UA 1CQ6A 4CBRA 1AIAA 1OHWA 1TPLA 2DGKA 1AMAA 3CAIA 4N0BA 4A0RA 3RQ1A 3TFTA 1LKCA 2XH1A 5IWQA 3FQAA 1WKHA 4AO9A 3LY1A 3MADA 4W91A 2AY2A 2VGZA 1AHEA 3G7QA 5K8BA 1ARGA 4ISYA 4K2IA 4UOYA 3N7NA 1SVVA 1AMSA 1ELUA 5JAYA 2D63A 1CZEA 1AHYA 2QSRA 1GC4A 5BJ4A 2DOUA 5D95A 4BA4A 1KL1A 3KGWA 3I4JA 2WK9A 1AX4A 3ASAA 2BI5A 3DXWA 1CS1A 2E7JA 2BIEA 3PJ0A 4Q31A 3FFRA 4DGTA 1KL2A 3NU7A 4RJ0A 1DTYA 3K28A 4ZWVA 1J04A 1ORDA 4OMAA 2HUFA 5E3KA 4MKJA 1MDXA 4WYEA 3LVJA 4WBTA 1G7XA 3MAFB 3E2YA 3JZLA 2R2NA 3ECDA 2YHKA 3HQTA 5G2QA 3AEJA 5G09A 3FD0A 2FNUA 1VEFA 3BWOA 2TPLA 3GSBA 4CBSA 3I16A 1B9HA 4P3MA 1ASEA 2HOXA 2D7ZA 1AIBA 1PMOA 1ARHA 2ZP7A 4F5MA 1M4NA 1C7NA 2VLFA 4OT8A 2V1PA 1BQDA 1ASAA 3A2BA 2VMNA 4KXKA 3IF2A 4ZLVA 2C7TA 1S06A 2VMWA 1BW0A 2W7IA 1BJWA 2VGTA 4PFFA 4R5FA 3DRDA 4IXOA 4E77A 2YCPA 1TASA 2W7MA 2AY7A 2W7DA 3BWNA 4PIWA 1RVYA 4TN4A 3MEBA 1ZODA 3T32A 3WY7A 2W8UA 3PAAA 2GMUA 2YKXA 3RCHA 3NYTA 3JTXA 1CQ7A 1C7OA 2VMQA 5EAVA 3MKJA 3EI9A 2ZJGA 1AJSB 3RBFA 4P7YA 1BJNA 4ADDA 4MGRA 1EJIA 1LW4A 1FG3A 4LW2A 3LV2A 3RBLA 2VMUA 3E2ZA 1DFOA 1X0MA 2JJGA 4ATPA 3HMUA 2CJGA 2E54A 1QITA 2JG2A 2YCTA 1LC7A 4JF0A 4A00A 1YJSA 4LNJA 4WD2A 2OGEA 1X2AA 3WGBA 4FFCA 1DJEA 3ZZKA 2ZSMA 2ZY2A 3QM2A 2D64A 4BHDA 1XI9A 3ZRRA 1V2EA 4ZSYA 3HBXA 4L0OA 2OKKA 1Z3ZA 4A0HA 2CJHA 1CJ0A 3L44A 1E5EA 2Z1YA 4XJMA 1GEXA 1ASCA 5LH9A 2W8TA 1PMMA 3MC6A 1TOIA 4CVQA 2EPJA 1LS3A 2CY8A 2ZC0A 1AMQA 1KKJA 4WYCA 4ZASA 3AENB 4OC9A 4EB7A 4RITA 5EQCA 3WKRA 3W1HA 4M2MA 4R8DA 4UHMA 3FDBA 1N8PA 2AY9A 2BHXA 1J32A 3FFHA 1C0NA 5EIGA 5FT4A 1QGNA 3PIUA 3HL2A 3H7FA 1MDOA 4AZJA 1LC5A 2BI1A 3H14A 4KYOA 4DBCA 1TOEA 2VMYA 2D5YA 3AELA 3AEOA 4ZDPA 2CSTA 5I92A 2HOZA 4A0FA 2VGVA 2YKVA 2DKJA 1AY4A 4GE4A 4Q6RA 5TF5A 3A9ZA 2FM1A 1OATA 3K40A 2W8VA 4OYTA 3AV7A 1YJZA 4RM1A 1D7UA 2V0YA 1U08A 5DJ1A 4IY7A 1O61A 3JWBA 2AY4A 3MAUA 3EIAA 2W7HA 2WKAA 1AAMA 2VMTA 2CH2A 1WSTA 4I8AA 5EFSA 4ATQA 1BJOA 3EI5A 1GC2A 1E5FA 3QBOA 1OHYA 1B5PA 1SPAA 3ACZA 4OCAA 4IYOB 4J8LA 4XJPA 2BI2A 5HHYA 5KTBA 4ZSWA 1QJ3A 4DQ6A 3BS8A 4QGRA 4O6ZA 2PO3A 3VK4A 1RV3A 2PB2A 5F9SA 3H9XA 2D66A 1ASGA 1B9IA 5M4BA 4UHNA 1EQBA 2AY3A 4JEWA 1ASFA 5EUEA 1V72A 4M2KA 3USFA 4ADBA 3B46A 4JE5D 3AEJC 4ZM4A 3DYDA 3AOVA 3EUCA 3Q8NA 4JEZA 4WLJA 4EU1A 1D7RA 2VLHA 4U1TA 1IAYA 3VAXA 1CL2A 4MKKA 3AEPA 1MAQA 2W7GA 1KMJA 1SFFA 2VMOA 5BJ3A 3B8XA 3BCBA 2OKJA 2Q7WA 4XK1A 3NTJA 1BJ4A 1IAXA 1AHGA 3DU4A 4E3RA 2C44A 3A9YA 2KFPA 4ITGA 5FT6A 3VP6A 1I43A 3UAKA 4CXQA 1MGVA 2CJDA 2VMZA 3LVKA 4GDYA 2VYCA 4F4EA 2AY5A 2QLRA 4M2JA 3BWNC 4Q76A 1W3UA 1WKGA 4RAEA 1IUGA 4HVKA 3QGUA 3BCAA 4XJOA 5M49A 3PA9A 1I29A 3HDOA 4JEXA 3EZ1A 3GETA 2X3LA 2FKIA 3EIBA 1DJUA 1ASMA 5LHAA 4Q75A 4LW4A 3WCNA 4NOGA 2ZY3A 9AATA 3LG0A 3MAFA 3OP7A 3GR9A 3DR7A 1GCKA 2VMVA 3WX9A 1G7WA 4EB5A 3TCMA 3MBBA 1C7GA 1PFFA 2VGWA 3A8UX 3P1TA 4PFNA 1QZ9A 1VJOA 1O69A 1G4XA 1P3WA 2VGSA 1ZC9A 3FVSA 3BCXA 1OXOA 4ADEA 1VP4A 2EZ2A 2W7EA 2FQ6A 4Y0HA 1CQ8A 1WYVB 4J5UA 3ELEA 1ASLA 1YNUA 2W8JA 4XAUA 4ZDLA 3N5MA 1V2DA 4WB0B 4WXGA 5G0AA 2ZSLA 1DJ9A 3LVMA 2BWPA 2GQNA 2BKWA 3TATA 4RJYA 1B5OA 1B8GA 3MC6C 2QA3A 3FQ7A 4MQQA 4ITXA 4R5ZA 3L8AA 1S07A 1LW5A 1WYTB 3M5UA 4OBVA 4WXBA 1FC4A 1QJ5A 2AEVA 4JE5A 4XEWA 2X5DA 4F5IA 1AY5A 2YCNA 1AICA 2OATA 2VIBA 3EI6A 1UU1A 3W1IA 1YIZA 1S0AA 1D7SA 2D65A 2JISA 4F5HA 1GDEA 1ARIA 1TARA 2HOYA 1LC8A 1AJSA 1IVRA 3NU8A 5F8VA 2ZYJA 1FG7A 1DKAA 5M4DA 2NMPA 4GEBA 3NYUA 4K05A 3B1EA 3PD6B 2Z61A 3R4TA 3A9XA 2Z67A 4OTLA 2X8UA 4Y0DA 1MAPA 4B9BA 1QIRA 3G8MA 3AEMA 1V2FA 3II0A 3PDBB 2WB6A 3N4RA 2AY1A 2X5FA 4JEYA 2QB3A 3HVYA 2R0TA 3PDXA 4XQ2A 1JS6A 1H0CA 4H51A 2YKYA 1ZOBA 1O62A 2WK7A 3KE3A 3PPLA 4H63Q 4RIZA 2O1BA 1M0OA 2XBNA 2Z9XA 3W1JA 2G6WA 3DC1A 1BQAA 4JEVA 1W7MA 1GC3A 1UU0A 2BYLA 1BKGA 1H1CA 1RVUA 1AHXA 3OKSA 1KMKA 5E4ZA 4RKCA 1PG8A 1OHVA 3BN1A 4XJLA 1X29A 2BI9A 3F0HA 3AENA 1UKJA 3E2FA 3IHJA 2CH1A 4MSOA 2EH6A 4GE9A 4UHOA 1AMRA 4WYAA 2DGMA 1WYUB 4ZDOA 4AH3A 2WK8A 3NUIA 4PVFA 2VI9A 1C9CA 4F5FA 2FNIA 2R5CB 3LWSA 2ORDA 1W23A 3EZSA 3HT4A 1GBNA 4ZAHA 2C81A 3FDDA 3EI7A 2HP1A 3FZ7A 1OXPA 5EUNA 2O0RA 1MDZA 1BT4A 2W7KA 5AX8A 2FYFA 2GB3A 4AO4A 2YRRA 3K7YA 3UWCA 2Z9VA 2G7JA 3E77A 1IX7A 2CFBA 1XEYA 4TMRA 3N75A 1M32A 2ZUKA 1RV4A 3KKIA 4F5GA 4W1WA 2VI8A 1JG8A 4F5LA 1GEYA 3GZDA 2HORA 4EMYA 1IJIA 4Y0IA 3F9TA 3GBXA 4K2MA 4E1OA 2BIGA 3FSLA 2D61A 1SF2A 1EG5A 1MLYA 2Z1ZA 1D7VA 4ADCA 4ZM3A 4IYOA 8AATA 2DR1A 3DODA 3BC8A 1KKPA 5G2PA 1JF9A 4HF8A 2JGTA 2BWNA 1AHFA 1M6SA 2BWOA 1G4VA 3CQ6A 4ZWMA 4LC3A 3FZ6A 1GEWA 1O4SA 3EI8A 4IW7A 3QPGA 4RKDA 3ISLA 2O7CA 3I5TA 3ELPA 4IXZA 5C6UA 3QHXA 3FQ8A 1YJYA 1TATA 2DGLA 3B1CA 2OGAA 3N0LA 4A72A 2CB1A 1QISA 1ARSA 3E6GA 1CL1A 3P6KA 2W7LA 2AATA 4AZKA 4A0GA 5HDMA 1M0NA 3WLXA 1TOJA 4BMKA 3FTBA 2HZPA 1N2TA 5DJ9A 2Z9WA 2CINA 2AY6A 1W7LA 4FL0A 4BA5A 4MQRA 5M46A 4R2NA 3JWAA 2D7YA 2YKUA 3NNKA 1DGEA 3F6TA 2W7JA 1IBJA 4TV7A 5HXXA 2OQXA 1TOGA 2CANA 2HP2A 3DR4A 3FZ8A 4WP0A 1IX6A 3QI6A 4JF1A 4A6TA 4LNLA 4BQ0A 1SZUA 2FN6A 1YAAA 3RI6A 1I41A 1Z7DA 4WLHA 4OBUA 7AATA 2EGYA 4N0WA 2VMPA 3BB8A 1Y4IA 3AEMC 1CZCA 5EUDA 3TQXA 3RCHB 2F8JA 3ZRPA 1AY8A 1SZSA 4CXRA 3FVXA 4F5JA 4B98A 2AEUA 1X28A 1AJRA 1ELQA 4RLGA 2E7IA 3PGYA 5FT8A 3GJUA 2ZY5A 2AY8A 3N4SA 3E2ZB 1B4XA 1WYVA 5J8QA 3E9KA 3NRAA 1I48A 2VMSA 1ECXA 3CQ5A 4WB0A 5G4IA 3HLMA 3ASBA 1T3IA 3JW9A 1AKBA 4KAMA 2BYJA 2GSAA 1M7YA 3ZRQA 3NYSA 2A1VA 2VMRA 1N31A 1S09A 3FVUA 1SZKA 4U2HA 3NUBA 1WYTA 3B1DA 1BS0A 1YIYA 4GE7A 2RFVA 2Z9UA 3G0TA 4W1VA 4MY5A 2EO5A 3GZCA 3NDNA 1MLZA 2QBTA 4IX8A 2HUUA 3LVLB 2BI3A 4GRXA 2VIAA 3GWPA 1LK9A 3WGCA 5FT5A 3ZZJA 2CTZA 4WYFA 2QB2A 2JJEA 3R9AA 3PD6A 3VOMA 4A6RA 2EYQA 3KGXA 3DXVA 2PB0A 4W1XA 5DX5A 1M0QA 3CBFA 5G4JA 3UE8A 1IX8A 3PDBA 4LNMA 1JS3A 5EIGB 2QMAA 3WKSA 2YOBA 3N4XA 1DGDA 1W7NA 3VK3A 5DB5A 1ASDA 4WYGA 3GZDC 1TOKA 3JU7A 3FRKA 3COGA 3WZFA 2EZ1A 5E5IA 4EFFA 2ZY4A 2DKBA 5D5SA 1S08A 3NX3A 1ASBA 3TFUA 2GMSA 1UU2A 3D6KA 2W8WA 4IXSA 4E3QA 3CQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5K A;  3AAT A;  4WYD A;  2HUI A;  3VK2 A;  1AKC A;  4W8I A;  4AOA A;  4A6U A;  3FCR A;  4WXF A;  3WCO A;  2JJF A;  1AKA A;  1GC0 A;  3ATH A;  4UQV A;  4K2B A;  1WYU A;  3RUY A;  4F5K A;  2YRI A;  4MQP A;  3DZZ A;  1ASN A;  3QN6 A;  1BJO B;  2VMX A;  1ART A;  2C0R A;  2Z20 A;  1AAW A;  3BV0 A;  2JJH A;  2R5C A;  3AOW A;  1C4K A;  1D2F A;  1YOO A;  3FKD A;  2W7F A;  4GSA A;  1M0P A;  2BIA A;  5EAA A;  1GD9 A;  2R5E A;  2VGU A;  2E7U A;  1CQ6 A;  4CBR A;  1AIA A;  1OHW A;  1TPL A;  2DGK A;  1AMA A;  3CAI A;  4N0B A;  4A0R A;  3RQ1 A;  3TFT A;  1LKC A;  2XH1 A;  5IWQ A;  3FQA A;  1WKH A;  4AO9 A;  3LY1 A;  3MAD A;  4W91 A;  2AY2 A;  2VGZ A;  1AHE A;  3G7Q A;  5K8B A;  1ARG A;  4ISY A;  4K2I A;  4UOY A;  1SVV A;  1AMS A;  1ELU A;  5JAY A;  2D63 A;  1CZE A;  1AHY A;  1GC4 A;  5BJ4 A;  2DOU A;  5D95 A;  4BA4 A;  1KL1 A;  3KGW A;  3I4J A;  2WK9 A;  1AX4 A;  3ASA A;  2BI5 A;  3DXW A;  1CS1 A;  2E7J A;  2BIE A;  3PJ0 A;  4Q31 A;  3FFR A;  4DGT A;  1KL2 A;  3NU7 A;  4RJ0 A;  1DTY A;  3K28 A;  4ZWV A;  1J04 A;  1ORD A;  4OMA A;  2HUF A;  5E3K A;  4MKJ A;  1MDX A;  4WYE A;  3LVJ A;  4WBT A;  1G7X A;  3MAF B;  3E2Y A;  3JZL A;  2R2N A;  3ECD A;  2YHK A;  3HQT A;  5G2Q A;  3AEJ A;  5G09 A;  3FD0 A;  2FNU A;  1VEF A;  3BWO A;  2TPL A;  3GSB A;  4CBS A;  3I16 A;  1B9H A;  4P3M A;  1ASE A;  2HOX A;  2D7Z A;  1AIB A;  1PMO A;  1ARH A;  2ZP7 A;  4F5M A;  1M4N A;  1C7N A;  2VLF A;  4OT8 A;  2V1P A;  1BQD A;  1ASA A;  3A2B A;  2VMN A;  4KXK A;  3IF2 A;  4ZLV A;  2C7T A;  1S06 A;  2VMW A;  1BW0 A;  2W7I A;  1BJW A;  2VGT A;  4PFF A;  4R5F A;  3DRD A;  4IXO A;  4E77 A;  2YCP A;  1TAS A;  2W7M A;  2AY7 A;  2W7D A;  3BWN A;  4PIW A;  1RVY A;  4TN4 A;  3MEB A;  1ZOD A;  3T32 A;  3WY7 A;  2W8U A;  3PAA A;  2GMU A;  2YKX A;  3RCH A;  3NYT A;  3JTX A;  1CQ7 A;  1C7O A;  2VMQ A;  5EAV A;  3MKJ A;  3EI9 A;  2ZJG A;  1AJS B;  3RBF A;  4P7Y A;  1BJN A;  4ADD A;  4MGR A;  1EJI A;  1LW4 A;  1FG3 A;  4LW2 A;  3LV2 A;  3RBL A;  2VMU A;  3E2Z A;  1DFO A;  1X0M A;  2JJG A;  4ATP A;  3HMU A;  2CJG A;  2E54 A;  1QIT A;  2JG2 A;  2YCT A;  1LC7 A;  4JF0 A;  4A00 A;  1YJS A;  4LNJ A;  4WD2 A;  2OGE A;  1X2A A;  3WGB A;  4FFC A;  1DJE A;  3ZZK A;  2ZSM A;  2ZY2 A;  3QM2 A;  2D64 A;  4BHD A;  1XI9 A;  3ZRR A;  1V2E A;  4ZSY A;  3HBX A;  4L0O A;  2OKK A;  1Z3Z A;  4A0H A;  2CJH A;  1CJ0 A;  3L44 A;  1E5E A;  2Z1Y A;  4XJM A;  1GEX A;  1ASC A;  5LH9 A;  2W8T A;  1PMM A;  3MC6 A;  1TOI A;  4CVQ A;  2EPJ A;  1LS3 A;  2CY8 A;  2ZC0 A;  1AMQ A;  1KKJ A;  4WYC A;  4ZAS A;  3AEN B;  4OC9 A;  4EB7 A;  4RIT A;  5EQC A;  3WKR A;  3W1H A;  4M2M A;  4R8D A;  4UHM A;  3FDB A;  1N8P A;  2AY9 A;  2BHX A;  1J32 A;  3FFH A;  1C0N A;  5EIG A;  5FT4 A;  1QGN A;  3PIU A;  3HL2 A;  3H7F A;  1MDO A;  4AZJ A;  1LC5 A;  2BI1 A;  3H14 A;  4KYO A;  4DBC A;  1TOE A;  2VMY A;  2D5Y A;  3AEL A;  3AEO A;  4ZDP A;  2CST A;  5I92 A;  2HOZ A;  4A0F A;  2VGV A;  2YKV A;  2DKJ A;  1AY4 A;  4GE4 A;  4Q6R A;  5TF5 A;  3A9Z A;  2FM1 A;  1OAT A;  3K40 A;  2W8V A;  4OYT A;  3AV7 A;  1YJZ A;  4RM1 A;  1D7U A;  2V0Y A;  1U08 A;  5DJ1 A;  4IY7 A;  1O61 A;  3JWB A;  2AY4 A;  3MAU A;  3EIA A;  2W7H A;  2WKA A;  1AAM A;  2VMT A;  2CH2 A;  1WST A;  4I8A A;  5EFS A;  4ATQ A;  1BJO A;  3EI5 A;  1GC2 A;  1E5F A;  3QBO A;  1OHY A;  1B5P A;  1SPA A;  3ACZ A;  4OCA A;  4IYO B;  4J8L A;  4XJP A;  2BI2 A;  5HHY A;  4ZSW A;  1QJ3 A;  4DQ6 A;  3BS8 A;  4QGR A;  4O6Z A;  2PO3 A;  3VK4 A;  1RV3 A;  2PB2 A;  5F9S A;  2D66 A;  1ASG A;  1B9I A;  5M4B A;  4UHN A;  1EQB A;  2AY3 A;  4JEW A;  1ASF A;  5EUE A;  1V72 A;  4M2K A;  3USF A;  4ADB A;  3B46 A;  4JE5 D;  3AEJ C;  4ZM4 A;  3DYD A;  3AOV A;  3EUC A;  3Q8N A;  4JEZ A;  4WLJ A;  4EU1 A;  1D7R A;  2VLH A;  4U1T A;  1IAY A;  3VAX A;  1CL2 A;  4MKK A;  3AEP A;  1MAQ A;  2W7G A;  1KMJ A;  1SFF A;  2VMO A;  5BJ3 A;  3B8X A;  3BCB A;  2OKJ A;  2Q7W A;  4XK1 A;  3NTJ A;  1BJ4 A;  1IAX A;  1AHG A;  3DU4 A;  4E3R A;  2C44 A;  3A9Y A;  4ITG A;  5FT6 A;  3VP6 A;  1I43 A;  3UAK A;  4CXQ A;  1MGV A;  2CJD A;  2VMZ A;  3LVK A;  4GDY A;  2VYC A;  4F4E A;  2AY5 A;  2QLR A;  4M2J A;  3BWN C;  4Q76 A;  1W3U A;  1WKG A;  4RAE A;  1IUG A;  4HVK A;  3QGU A;  3BCA A;  4XJO A;  5M49 A;  3PA9 A;  1I29 A;  3HDO A;  4JEX A;  3EZ1 A;  3GET A;  2X3L A;  3EIB A;  1DJU A;  1ASM A;  5LHA A;  4Q75 A;  4LW4 A;  3WCN A;  4NOG A;  2ZY3 A;  9AAT A;  3LG0 A;  3MAF A;  3OP7 A;  3GR9 A;  3DR7 A;  1GCK A;  2VMV A;  3WX9 A;  1G7W A;  4EB5 A;  3TCM A;  3MBB A;  1C7G A;  1PFF A;  2VGW A;  3A8U X;  3P1T A;  4PFN A;  1QZ9 A;  1VJO A;  1O69 A;  1G4X A;  1P3W A;  2VGS A;  1ZC9 A;  3FVS A;  3BCX A;  1OXO A;  4ADE A;  1VP4 A;  2EZ2 A;  2W7E A;  2FQ6 A;  4Y0H A;  1CQ8 A;  1WYV B;  4J5U A;  3ELE A;  1ASL A;  1YNU A;  2W8J A;  4XAU A;  4ZDL A;  3N5M A;  1V2D A;  4WB0 B;  4WXG A;  5G0A A;  2ZSL A;  1DJ9 A;  3LVM A;  2BWP A;  2GQN A;  2BKW A;  3TAT A;  4RJY A;  1B5O A;  1B8G A;  3MC6 C;  2QA3 A;  3FQ7 A;  4MQQ A;  4ITX A;  4R5Z A;  3L8A A;  1S07 A;  1LW5 A;  1WYT B;  3M5U A;  4OBV A;  4WXB A;  1FC4 A;  1QJ5 A;  2AEV A;  4JE5 A;  4XEW A;  2X5D A;  4F5I A;  1AY5 A;  2YCN A;  1AIC A;  2OAT A;  2VIB A;  3EI6 A;  1UU1 A;  3W1I A;  1YIZ A;  1S0A A;  1D7S A;  2D65 A;  2JIS A;  4F5H A;  1GDE A;  1ARI A;  1TAR A;  2HOY A;  1LC8 A;  1AJS A;  1IVR A;  3NU8 A;  5F8V A;  2ZYJ A;  1FG7 A;  1DKA A;  5M4D A;  2NMP A;  4GEB A;  3NYU A;  3B1E A;  3PD6 B;  2Z61 A;  3R4T A;  3A9X A;  2Z67 A;  4OTL A;  2X8U A;  4Y0D A;  1MAP A;  4B9B A;  1QIR A;  3G8M A;  3AEM A;  1V2F A;  3II0 A;  3PDB B;  2AY1 A;  2X5F A;  4JEY A;  2QB3 A;  3HVY A;  2R0T A;  3PDX A;  4XQ2 A;  1JS6 A;  1H0C A;  4H51 A;  2YKY A;  1ZOB A;  1O62 A;  2WK7 A;  3KE3 A;  3PPL A;  4RIZ A;  2O1B A;  1M0O A;  2XBN A;  2Z9X A;  3W1J A;  2G6W A;  3DC1 A;  1BQA A;  4JEV A;  1W7M A;  1GC3 A;  1UU0 A;  2BYL A;  1BKG A;  1H1C A;  1RVU A;  1AHX A;  3OKS A;  1KMK A;  5E4Z A;  4RKC A;  1PG8 A;  1OHV A;  3BN1 A;  4XJL A;  1X29 A;  2BI9 A;  3F0H A;  3AEN A;  1UKJ A;  3E2F A;  3IHJ A;  2CH1 A;  4MSO A;  2EH6 A;  4GE9 A;  4UHO A;  1AMR A;  4WYA A;  2DGM A;  1WYU B;  4ZDO A;  4AH3 A;  2WK8 A;  3NUI A;  4PVF A;  2VI9 A;  1C9C A;  4F5F A;  2FNI A;  2R5C B;  3LWS A;  2ORD A;  1W23 A;  3EZS A;  3HT4 A;  1GBN A;  4ZAH A;  2C81 A;  3FDD A;  3EI7 A;  2HP1 A;  3FZ7 A;  1OXP A;  5EUN A;  2O0R A;  1MDZ A;  1BT4 A;  2W7K A;  5AX8 A;  2FYF A;  2GB3 A;  4AO4 A;  2YRR A;  3K7Y A;  3UWC A;  2Z9V A;  3E77 A;  1IX7 A;  2CFB A;  1XEY A;  4TMR A;  3N75 A;  1M32 A;  2ZUK A;  1RV4 A;  3KKI A;  4F5G A;  4W1W A;  2VI8 A;  1JG8 A;  4F5L A;  1GEY A;  3GZD A;  2HOR A;  4EMY A;  1IJI A;  4Y0I A;  3F9T A;  3GBX A;  4K2M A;  4E1O A;  2BIG A;  3FSL A;  2D61 A;  1SF2 A;  1EG5 A;  1MLY A;  2Z1Z A;  1D7V A;  4ADC A;  4ZM3 A;  4IYO A;  8AAT A;  2DR1 A;  3DOD A;  3BC8 A;  1KKP A;  5G2P A;  1JF9 A;  4HF8 A;  2JGT A;  2BWN A;  1AHF A;  1M6S A;  2BWO A;  1G4V A;  3CQ6 A;  4ZWM A;  4LC3 A;  3FZ6 A;  1GEW A;  1O4S A;  3EI8 A;  4IW7 A;  3QPG A;  4RKD A;  3ISL A;  2O7C A;  3I5T A;  3ELP A;  4IXZ A;  5C6U A;  3QHX A;  3FQ8 A;  1YJY A;  1TAT A;  2DGL A;  3B1C A;  2OGA A;  3N0L A;  4A72 A;  2CB1 A;  1QIS A;  1ARS A;  3E6G A;  1CL1 A;  3P6K A;  2W7L A;  2AAT A;  4AZK A;  4A0G A;  5HDM A;  1M0N A;  3WLX A;  1TOJ A;  4BMK A;  3FTB A;  2HZP A;  1N2T A;  5DJ9 A;  2Z9W A;  2CIN A;  2AY6 A;  1W7L A;  4FL0 A;  4BA5 A;  4MQR A;  5M46 A;  4R2N A;  3JWA A;  2D7Y A;  2YKU A;  3NNK A;  1DGE A;  3F6T A;  2W7J A;  1IBJ A;  4TV7 A;  5HXX A;  2OQX A;  1TOG A;  2CAN A;  2HP2 A;  3DR4 A;  3FZ8 A;  4WP0 A;  1IX6 A;  3QI6 A;  4JF1 A;  4A6T A;  4LNL A;  4BQ0 A;  1SZU A;  2FN6 A;  1YAA A;  3RI6 A;  1I41 A;  1Z7D A;  4WLH A;  4OBU A;  7AAT A;  2EGY A;  4N0W A;  2VMP A;  3BB8 A;  1Y4I A;  3AEM C;  1CZC A;  5EUD A;  3TQX A;  3RCH B;  2F8J A;  3ZRP A;  1AY8 A;  1SZS A;  4CXR A;  3FVX A;  4F5J A;  4B98 A;  2AEU A;  1X28 A;  1AJR A;  1ELQ A;  4RLG A;  2E7I A;  3PGY A;  5FT8 A;  3GJU A;  2ZY5 A;  2AY8 A;  3E2Z B;  1B4X A;  1WYV A;  5J8Q A;  3E9K A;  3NRA A;  1I48 A;  2VMS A;  1ECX A;  3CQ5 A;  4WB0 A;  5G4I A;  3HLM A;  3ASB A;  1T3I A;  3JW9 A;  1AKB A;  4KAM A;  2BYJ A;  2GSA A;  1M7Y A;  3ZRQ A;  3NYS A;  2VMR A;  1N31 A;  1S09 A;  3FVU A;  1SZK A;  4U2H A;  3NUB A;  1WYT A;  3B1D A;  1BS0 A;  1YIY A;  4GE7 A;  2RFV A;  2Z9U A;  3G0T A;  4W1V A;  4MY5 A;  2EO5 A;  3GZC A;  3NDN A;  1MLZ A;  2QBT A;  4IX8 A;  2HUU A;  3LVL B;  2BI3 A;  4GRX A;  2VIA A;  3GWP A;  1LK9 A;  3WGC A;  5FT5 A;  3ZZJ A;  2CTZ A;  4WYF A;  2QB2 A;  2JJE A;  3R9A A;  3PD6 A;  3VOM A;  4A6R A;  3KGX A;  3DXV A;  2PB0 A;  4W1X A;  5DX5 A;  1M0Q A;  3CBF A;  5G4J A;  3UE8 A;  1IX8 A;  3PDB A;  4LNM A;  1JS3 A;  5EIG B;  2QMA A;  3WKS A;  2YOB A;  1DGD A;  1W7N A;  3VK3 A;  5DB5 A;  1ASD A;  4WYG A;  3GZD C;  1TOK A;  3JU7 A;  3FRK A;  3COG A;  3WZF A;  2EZ1 A;  5E5I A;  4EFF A;  2ZY4 A;  2DKB A;  5D5S A;  1S08 A;  3NX3 A;  1ASB A;  3TFU A;  2GMS A;  1UU2 A;  3D6K A;  2W8W A;  4IXS A;  4E3Q A;  3CQ4 A; 
#chains in the Genus database with same CATH topology
 4W5K A;  3AAT A;  4WYD A;  2HUI A;  3VK2 A;  1AKC A;  4W8I A;  4AOA A;  4A6U A;  3FCR A;  4WXF A;  3WCO A;  2JJF A;  1AKA A;  1GC0 A;  3ATH A;  4UQV A;  4K2B A;  1WYU A;  3RUY A;  4F5K A;  2YRI A;  4MQP A;  3DZZ A;  1ASN A;  3QN6 A;  1BJO B;  2VMX A;  1ART A;  2C0R A;  2Z20 A;  1AAW A;  3BV0 A;  2JJH A;  2R5C A;  3AOW A;  1C4K A;  1D2F A;  1YOO A;  3FKD A;  2W7F A;  4GSA A;  1M0P A;  2BIA A;  5EAA A;  1GD9 A;  2R5E A;  2VGU A;  2E7U A;  1CQ6 A;  4CBR A;  1AIA A;  1OHW A;  1TPL A;  2DGK A;  1AMA A;  3CAI A;  4N0B A;  4A0R A;  3RQ1 A;  3TFT A;  1LKC A;  2XH1 A;  5IWQ A;  3FQA A;  1WKH A;  4AO9 A;  3LY1 A;  3MAD A;  4W91 A;  2AY2 A;  2VGZ A;  1AHE A;  3G7Q A;  5K8B A;  1ARG A;  4ISY A;  4K2I A;  4UOY A;  3N7N A;  1SVV A;  1AMS A;  1ELU A;  5JAY A;  2D63 A;  1CZE A;  1AHY A;  2QSR A;  1GC4 A;  5BJ4 A;  2DOU A;  5D95 A;  4BA4 A;  1KL1 A;  3KGW A;  3I4J A;  2WK9 A;  1AX4 A;  3ASA A;  2BI5 A;  3DXW A;  1CS1 A;  2E7J A;  2BIE A;  3PJ0 A;  4Q31 A;  3FFR A;  4DGT A;  1KL2 A;  3NU7 A;  4RJ0 A;  1DTY A;  3K28 A;  4ZWV A;  1J04 A;  1ORD A;  4OMA A;  2HUF A;  5E3K A;  4MKJ A;  1MDX A;  4WYE A;  3LVJ A;  4WBT A;  1G7X A;  3MAF B;  3E2Y A;  3JZL A;  2R2N A;  3ECD A;  2YHK A;  3HQT A;  5G2Q A;  3AEJ A;  5G09 A;  3FD0 A;  2FNU A;  1VEF A;  3BWO A;  2TPL A;  3GSB A;  4CBS A;  3I16 A;  1B9H A;  4P3M A;  1ASE A;  2HOX A;  2D7Z A;  1AIB A;  1PMO A;  1ARH A;  2ZP7 A;  4F5M A;  1M4N A;  1C7N A;  2VLF A;  4OT8 A;  2V1P A;  1BQD A;  1ASA A;  3A2B A;  2VMN A;  4KXK A;  3IF2 A;  4ZLV A;  2C7T A;  1S06 A;  2VMW A;  1BW0 A;  2W7I A;  1BJW A;  2VGT A;  4PFF A;  4R5F A;  3DRD A;  4IXO A;  4E77 A;  2YCP A;  1TAS A;  2W7M A;  2AY7 A;  2W7D A;  3BWN A;  4PIW A;  1RVY A;  4TN4 A;  3MEB A;  1ZOD A;  3T32 A;  3WY7 A;  2W8U A;  3PAA A;  2GMU A;  2YKX A;  3RCH A;  3NYT A;  3JTX A;  1CQ7 A;  1C7O A;  2VMQ A;  5EAV A;  3MKJ A;  3EI9 A;  2ZJG A;  1AJS B;  3RBF A;  4P7Y A;  1BJN A;  4ADD A;  4MGR A;  1EJI A;  1LW4 A;  1FG3 A;  4LW2 A;  3LV2 A;  3RBL A;  2VMU A;  3E2Z A;  1DFO A;  1X0M A;  2JJG A;  4ATP A;  3HMU A;  2CJG A;  2E54 A;  1QIT A;  2JG2 A;  2YCT A;  1LC7 A;  4JF0 A;  4A00 A;  1YJS A;  4LNJ A;  4WD2 A;  2OGE A;  1X2A A;  3WGB A;  4FFC A;  1DJE A;  3ZZK A;  2ZSM A;  2ZY2 A;  3QM2 A;  2D64 A;  4BHD A;  1XI9 A;  3ZRR A;  1V2E A;  4ZSY A;  3HBX A;  4L0O A;  2OKK A;  1Z3Z A;  4A0H A;  2CJH A;  1CJ0 A;  3L44 A;  1E5E A;  2Z1Y A;  4XJM A;  1GEX A;  1ASC A;  5LH9 A;  2W8T A;  1PMM A;  3MC6 A;  1TOI A;  4CVQ A;  2EPJ A;  1LS3 A;  2CY8 A;  2ZC0 A;  1AMQ A;  1KKJ A;  4WYC A;  4ZAS A;  3AEN B;  4OC9 A;  4EB7 A;  4RIT A;  5EQC A;  3WKR A;  3W1H A;  4M2M A;  4R8D A;  4UHM A;  3FDB A;  1N8P A;  2AY9 A;  2BHX A;  1J32 A;  3FFH A;  1C0N A;  5EIG A;  5FT4 A;  1QGN A;  3PIU A;  3HL2 A;  3H7F A;  1MDO A;  4AZJ A;  1LC5 A;  2BI1 A;  3H14 A;  4KYO A;  4DBC A;  1TOE A;  2VMY A;  2D5Y A;  3AEL A;  3AEO A;  4ZDP A;  2CST A;  5I92 A;  2HOZ A;  4A0F A;  2VGV A;  2YKV A;  2DKJ A;  1AY4 A;  4GE4 A;  4Q6R A;  5TF5 A;  3A9Z A;  2FM1 A;  1OAT A;  3K40 A;  2W8V A;  4OYT A;  3AV7 A;  1YJZ A;  4RM1 A;  1D7U A;  2V0Y A;  1U08 A;  5DJ1 A;  4IY7 A;  1O61 A;  3JWB A;  2AY4 A;  3MAU A;  3EIA A;  2W7H A;  2WKA A;  1AAM A;  2VMT A;  2CH2 A;  1WST A;  4I8A A;  5EFS A;  4ATQ A;  1BJO A;  3EI5 A;  1GC2 A;  1E5F A;  3QBO A;  1OHY A;  1B5P A;  1SPA A;  3ACZ A;  4OCA A;  4IYO B;  4J8L A;  4XJP A;  2BI2 A;  5HHY A;  5KTB A;  4ZSW A;  1QJ3 A;  4DQ6 A;  3BS8 A;  4QGR A;  4O6Z A;  2PO3 A;  3VK4 A;  1RV3 A;  2PB2 A;  5F9S A;  3H9X A;  2D66 A;  1ASG A;  1B9I A;  5M4B A;  4UHN A;  1EQB A;  2AY3 A;  4JEW A;  1ASF A;  5EUE A;  1V72 A;  4M2K A;  3USF A;  4ADB A;  3B46 A;  4JE5 D;  3AEJ C;  4ZM4 A;  3DYD A;  3AOV A;  3EUC A;  3Q8N A;  4JEZ A;  4WLJ A;  4EU1 A;  1D7R A;  2VLH A;  4U1T A;  1IAY A;  3VAX A;  1CL2 A;  4MKK A;  3AEP A;  1MAQ A;  2W7G A;  1KMJ A;  1SFF A;  2VMO A;  5BJ3 A;  3B8X A;  3BCB A;  2OKJ A;  2Q7W A;  4XK1 A;  3NTJ A;  1BJ4 A;  1IAX A;  1AHG A;  3DU4 A;  4E3R A;  2C44 A;  3A9Y A;  2KFP A;  4ITG A;  5FT6 A;  3VP6 A;  1I43 A;  3UAK A;  4CXQ A;  1MGV A;  2CJD A;  2VMZ A;  3LVK A;  4GDY A;  2VYC A;  4F4E A;  2AY5 A;  2QLR A;  4M2J A;  3BWN C;  4Q76 A;  1W3U A;  1WKG A;  4RAE A;  1IUG A;  4HVK A;  3QGU A;  3BCA A;  4XJO A;  5M49 A;  3PA9 A;  1I29 A;  3HDO A;  4JEX A;  3EZ1 A;  3GET A;  2X3L A;  2FKI A;  3EIB A;  1DJU A;  1ASM A;  5LHA A;  4Q75 A;  4LW4 A;  3WCN A;  4NOG A;  2ZY3 A;  9AAT A;  3LG0 A;  3MAF A;  3OP7 A;  3GR9 A;  3DR7 A;  1GCK A;  2VMV A;  3WX9 A;  1G7W A;  4EB5 A;  3TCM A;  3MBB A;  1C7G A;  1PFF A;  2VGW A;  3A8U X;  3P1T A;  4PFN A;  1QZ9 A;  1VJO A;  1O69 A;  1G4X A;  1P3W A;  2VGS A;  1ZC9 A;  3FVS A;  3BCX A;  1OXO A;  4ADE A;  1VP4 A;  2EZ2 A;  2W7E A;  2FQ6 A;  4Y0H A;  1CQ8 A;  1WYV B;  4J5U A;  3ELE A;  1ASL A;  1YNU A;  2W8J A;  4XAU A;  4ZDL A;  3N5M A;  1V2D A;  4WB0 B;  4WXG A;  5G0A A;  2ZSL A;  1DJ9 A;  3LVM A;  2BWP A;  2GQN A;  2BKW A;  3TAT A;  4RJY A;  1B5O A;  1B8G A;  3MC6 C;  2QA3 A;  3FQ7 A;  4MQQ A;  4ITX A;  4R5Z A;  3L8A A;  1S07 A;  1LW5 A;  1WYT B;  3M5U A;  4OBV A;  4WXB A;  1FC4 A;  1QJ5 A;  2AEV A;  4JE5 A;  4XEW A;  2X5D A;  4F5I A;  1AY5 A;  2YCN A;  1AIC A;  2OAT A;  2VIB A;  3EI6 A;  1UU1 A;  3W1I A;  1YIZ A;  1S0A A;  1D7S A;  2D65 A;  2JIS A;  4F5H A;  1GDE A;  1ARI A;  1TAR A;  2HOY A;  1LC8 A;  1AJS A;  1IVR A;  3NU8 A;  5F8V A;  2ZYJ A;  1FG7 A;  1DKA A;  5M4D A;  2NMP A;  4GEB A;  3NYU A;  4K05 A;  3B1E A;  3PD6 B;  2Z61 A;  3R4T A;  3A9X A;  2Z67 A;  4OTL A;  2X8U A;  4Y0D A;  1MAP A;  4B9B A;  1QIR A;  3G8M A;  3AEM A;  1V2F A;  3II0 A;  3PDB B;  2WB6 A;  3N4R A;  2AY1 A;  2X5F A;  4JEY A;  2QB3 A;  3HVY A;  2R0T A;  3PDX A;  4XQ2 A;  1JS6 A;  1H0C A;  4H51 A;  2YKY A;  1ZOB A;  1O62 A;  2WK7 A;  3KE3 A;  3PPL A;  4H63 Q;  4RIZ A;  2O1B A;  1M0O A;  2XBN A;  2Z9X A;  3W1J A;  2G6W A;  3DC1 A;  1BQA A;  4JEV A;  1W7M A;  1GC3 A;  1UU0 A;  2BYL A;  1BKG A;  1H1C A;  1RVU A;  1AHX A;  3OKS A;  1KMK A;  5E4Z A;  4RKC A;  1PG8 A;  1OHV A;  3BN1 A;  4XJL A;  1X29 A;  2BI9 A;  3F0H A;  3AEN A;  1UKJ A;  3E2F A;  3IHJ A;  2CH1 A;  4MSO A;  2EH6 A;  4GE9 A;  4UHO A;  1AMR A;  4WYA A;  2DGM A;  1WYU B;  4ZDO A;  4AH3 A;  2WK8 A;  3NUI A;  4PVF A;  2VI9 A;  1C9C A;  4F5F A;  2FNI A;  2R5C B;  3LWS A;  2ORD A;  1W23 A;  3EZS A;  3HT4 A;  1GBN A;  4ZAH A;  2C81 A;  3FDD A;  3EI7 A;  2HP1 A;  3FZ7 A;  1OXP A;  5EUN A;  2O0R A;  1MDZ A;  1BT4 A;  2W7K A;  5AX8 A;  2FYF A;  2GB3 A;  4AO4 A;  2YRR A;  3K7Y A;  3UWC A;  2Z9V A;  2G7J A;  3E77 A;  1IX7 A;  2CFB A;  1XEY A;  4TMR A;  3N75 A;  1M32 A;  2ZUK A;  1RV4 A;  3KKI A;  4F5G A;  4W1W A;  2VI8 A;  1JG8 A;  4F5L A;  1GEY A;  3GZD A;  2HOR A;  4EMY A;  1IJI A;  4Y0I A;  3F9T A;  3GBX A;  4K2M A;  4E1O A;  2BIG A;  3FSL A;  2D61 A;  1SF2 A;  1EG5 A;  1MLY A;  2Z1Z A;  1D7V A;  4ADC A;  4ZM3 A;  4IYO A;  8AAT A;  2DR1 A;  3DOD A;  3BC8 A;  1KKP A;  5G2P A;  1JF9 A;  4HF8 A;  2JGT A;  2BWN A;  1AHF A;  1M6S A;  2BWO A;  1G4V A;  3CQ6 A;  4ZWM A;  4LC3 A;  3FZ6 A;  1GEW A;  1O4S A;  3EI8 A;  4IW7 A;  3QPG A;  4RKD A;  3ISL A;  2O7C A;  3I5T A;  3ELP A;  4IXZ A;  5C6U A;  3QHX A;  3FQ8 A;  1YJY A;  1TAT A;  2DGL A;  3B1C A;  2OGA A;  3N0L A;  4A72 A;  2CB1 A;  1QIS A;  1ARS A;  3E6G A;  1CL1 A;  3P6K A;  2W7L A;  2AAT A;  4AZK A;  4A0G A;  5HDM A;  1M0N A;  3WLX A;  1TOJ A;  4BMK A;  3FTB A;  1KAF A;  2HZP A;  1N2T A;  5DJ9 A;  2Z9W A;  2CIN A;  2AY6 A;  1W7L A;  4FL0 A;  4BA5 A;  4MQR A;  5M46 A;  4R2N A;  3JWA A;  2D7Y A;  2YKU A;  3NNK A;  1DGE A;  3F6T A;  2W7J A;  1IBJ A;  4TV7 A;  5HXX A;  2OQX A;  1TOG A;  2CAN A;  2HP2 A;  3DR4 A;  3FZ8 A;  4WP0 A;  1IX6 A;  3QI6 A;  4JF1 A;  4A6T A;  4LNL A;  4BQ0 A;  1SZU A;  2FN6 A;  1YAA A;  3RI6 A;  1I41 A;  1Z7D A;  4WLH A;  4OBU A;  7AAT A;  2EGY A;  4N0W A;  2VMP A;  3BB8 A;  1Y4I A;  3AEM C;  1CZC A;  5EUD A;  3TQX A;  3RCH B;  2F8J A;  3ZRP A;  1AY8 A;  1SZS A;  4CXR A;  3FVX A;  4F5J A;  4B98 A;  2AEU A;  1X28 A;  1AJR A;  1ELQ A;  4RLG A;  2E7I A;  3PGY A;  5FT8 A;  3GJU A;  2ZY5 A;  2AY8 A;  3N4S A;  3E2Z B;  1B4X A;  1WYV A;  5J8Q A;  3E9K A;  3NRA A;  1I48 A;  2VMS A;  1ECX A;  3CQ5 A;  4WB0 A;  5G4I A;  3HLM A;  3ASB A;  1T3I A;  3JW9 A;  1AKB A;  4KAM A;  2BYJ A;  2GSA A;  1M7Y A;  3ZRQ A;  3NYS A;  2A1V A;  2VMR A;  1N31 A;  1S09 A;  3FVU A;  1SZK A;  4U2H A;  3NUB A;  1WYT A;  3B1D A;  1BS0 A;  1YIY A;  4GE7 A;  2RFV A;  2Z9U A;  3G0T A;  4W1V A;  4MY5 A;  2EO5 A;  3GZC A;  3NDN A;  1MLZ A;  2QBT A;  4IX8 A;  2HUU A;  3LVL B;  2BI3 A;  4GRX A;  2VIA A;  3GWP A;  1LK9 A;  3WGC A;  5FT5 A;  3ZZJ A;  2CTZ A;  4WYF A;  2QB2 A;  2JJE A;  3R9A A;  3PD6 A;  3VOM A;  4A6R A;  2EYQ A;  3KGX A;  3DXV A;  2PB0 A;  4W1X A;  5DX5 A;  1M0Q A;  3CBF A;  5G4J A;  3UE8 A;  1IX8 A;  3PDB A;  4LNM A;  1JS3 A;  5EIG B;  2QMA A;  3WKS A;  2YOB A;  3N4X A;  1DGD A;  1W7N A;  3VK3 A;  5DB5 A;  1ASD A;  4WYG A;  3GZD C;  1TOK A;  3JU7 A;  3FRK A;  3COG A;  3WZF A;  2EZ1 A;  5E5I A;  4EFF A;  2ZY4 A;  2DKB A;  5D5S A;  1S08 A;  3NX3 A;  1ASB A;  3TFU A;  2GMS A;  1UU2 A;  3D6K A;  2W8W A;  4IXS A;  4E3Q A;  3CQ4 A; 
#chains in the Genus database with same CATH homology
 4W5K A;  3AAT A;  4WYD A;  2HUI A;  3VK2 A;  1AKC A;  4W8I A;  4AOA A;  4A6U A;  3FCR A;  4WXF A;  3WCO A;  2JJF A;  1AKA A;  1GC0 A;  3ATH A;  4UQV A;  4K2B A;  1WYU A;  3RUY A;  4F5K A;  2YRI A;  4MQP A;  3DZZ A;  1ASN A;  3QN6 A;  1BJO B;  2VMX A;  1ART A;  2C0R A;  2Z20 A;  1AAW A;  3BV0 A;  2JJH A;  2R5C A;  3AOW A;  1C4K A;  1D2F A;  1YOO A;  3FKD A;  2W7F A;  4GSA A;  1M0P A;  2BIA A;  5EAA A;  1GD9 A;  2R5E A;  2VGU A;  2E7U A;  1CQ6 A;  4CBR A;  1AIA A;  1OHW A;  1TPL A;  2DGK A;  1AMA A;  3CAI A;  4N0B A;  4A0R A;  3RQ1 A;  3TFT A;  1LKC A;  2XH1 A;  5IWQ A;  3FQA A;  1WKH A;  4AO9 A;  3LY1 A;  3MAD A;  4W91 A;  2AY2 A;  2VGZ A;  1AHE A;  3G7Q A;  5K8B A;  1ARG A;  4ISY A;  4K2I A;  4UOY A;  3N7N A;  1SVV A;  1AMS A;  1ELU A;  5JAY A;  2D63 A;  1CZE A;  1AHY A;  2QSR A;  1GC4 A;  5BJ4 A;  2DOU A;  5D95 A;  4BA4 A;  1KL1 A;  3KGW A;  3I4J A;  2WK9 A;  1AX4 A;  3ASA A;  2BI5 A;  3DXW A;  1CS1 A;  2E7J A;  2BIE A;  3PJ0 A;  4Q31 A;  3FFR A;  4DGT A;  1KL2 A;  3NU7 A;  4RJ0 A;  1DTY A;  3K28 A;  4ZWV A;  1J04 A;  1ORD A;  4OMA A;  2HUF A;  5E3K A;  4MKJ A;  1MDX A;  4WYE A;  3LVJ A;  4WBT A;  1G7X A;  3MAF B;  3E2Y A;  3JZL A;  2R2N A;  3ECD A;  2YHK A;  3HQT A;  5G2Q A;  3AEJ A;  5G09 A;  3FD0 A;  2FNU A;  1VEF A;  3BWO A;  2TPL A;  3GSB A;  4CBS A;  3I16 A;  1B9H A;  4P3M A;  1ASE A;  2HOX A;  2D7Z A;  1AIB A;  1PMO A;  1ARH A;  2ZP7 A;  4F5M A;  1M4N A;  1C7N A;  2VLF A;  4OT8 A;  2V1P A;  1BQD A;  1ASA A;  3A2B A;  2VMN A;  4KXK A;  3IF2 A;  4ZLV A;  2C7T A;  1S06 A;  2VMW A;  1BW0 A;  2W7I A;  1BJW A;  2VGT A;  4PFF A;  4R5F A;  3DRD A;  4IXO A;  4E77 A;  2YCP A;  1TAS A;  2W7M A;  2AY7 A;  2W7D A;  3BWN A;  4PIW A;  1RVY A;  4TN4 A;  3MEB A;  1ZOD A;  3T32 A;  3WY7 A;  2W8U A;  3PAA A;  2GMU A;  2YKX A;  3RCH A;  3NYT A;  3JTX A;  1CQ7 A;  1C7O A;  2VMQ A;  5EAV A;  3MKJ A;  3EI9 A;  2ZJG A;  1AJS B;  3RBF A;  4P7Y A;  1BJN A;  4ADD A;  4MGR A;  1EJI A;  1LW4 A;  1FG3 A;  4LW2 A;  3LV2 A;  3RBL A;  2VMU A;  3E2Z A;  1DFO A;  1X0M A;  2JJG A;  4ATP A;  3HMU A;  2CJG A;  2E54 A;  1QIT A;  2JG2 A;  2YCT A;  1LC7 A;  4JF0 A;  4A00 A;  1YJS A;  4LNJ A;  4WD2 A;  2OGE A;  1X2A A;  3WGB A;  4FFC A;  1DJE A;  3ZZK A;  2ZSM A;  2ZY2 A;  3QM2 A;  2D64 A;  4BHD A;  1XI9 A;  3ZRR A;  1V2E A;  4ZSY A;  3HBX A;  4L0O A;  2OKK A;  1Z3Z A;  4A0H A;  2CJH A;  1CJ0 A;  3L44 A;  1E5E A;  2Z1Y A;  4XJM A;  1GEX A;  1ASC A;  5LH9 A;  2W8T A;  1PMM A;  3MC6 A;  1TOI A;  4CVQ A;  2EPJ A;  1LS3 A;  2CY8 A;  2ZC0 A;  1AMQ A;  1KKJ A;  4WYC A;  4ZAS A;  3AEN B;  4OC9 A;  4EB7 A;  4RIT A;  5EQC A;  3WKR A;  3W1H A;  4M2M A;  4R8D A;  4UHM A;  3FDB A;  1N8P A;  2AY9 A;  2BHX A;  1J32 A;  3FFH A;  1C0N A;  5EIG A;  5FT4 A;  1QGN A;  3PIU A;  3HL2 A;  3H7F A;  1MDO A;  4AZJ A;  1LC5 A;  2BI1 A;  3H14 A;  4KYO A;  4DBC A;  1TOE A;  2VMY A;  2D5Y A;  3AEL A;  3AEO A;  4ZDP A;  2CST A;  5I92 A;  2HOZ A;  4A0F A;  2VGV A;  2YKV A;  2DKJ A;  1AY4 A;  4GE4 A;  4Q6R A;  5TF5 A;  3A9Z A;  2FM1 A;  1OAT A;  3K40 A;  2W8V A;  4OYT A;  3AV7 A;  1YJZ A;  4RM1 A;  1D7U A;  2V0Y A;  1U08 A;  5DJ1 A;  4IY7 A;  1O61 A;  3JWB A;  2AY4 A;  3MAU A;  3EIA A;  2W7H A;  2WKA A;  1AAM A;  2VMT A;  2CH2 A;  1WST A;  4I8A A;  5EFS A;  4ATQ A;  1BJO A;  3EI5 A;  1GC2 A;  1E5F A;  3QBO A;  1OHY A;  1B5P A;  1SPA A;  3ACZ A;  4OCA A;  4IYO B;  4J8L A;  4XJP A;  2BI2 A;  5HHY A;  5KTB A;  4ZSW A;  1QJ3 A;  4DQ6 A;  3BS8 A;  4QGR A;  4O6Z A;  2PO3 A;  3VK4 A;  1RV3 A;  2PB2 A;  5F9S A;  3H9X A;  2D66 A;  1ASG A;  1B9I A;  5M4B A;  4UHN A;  1EQB A;  2AY3 A;  4JEW A;  1ASF A;  5EUE A;  1V72 A;  4M2K A;  3USF A;  4ADB A;  3B46 A;  4JE5 D;  3AEJ C;  4ZM4 A;  3DYD A;  3AOV A;  3EUC A;  3Q8N A;  4JEZ A;  4WLJ A;  4EU1 A;  1D7R A;  2VLH A;  4U1T A;  1IAY A;  3VAX A;  1CL2 A;  4MKK A;  3AEP A;  1MAQ A;  2W7G A;  1KMJ A;  1SFF A;  2VMO A;  5BJ3 A;  3B8X A;  3BCB A;  2OKJ A;  2Q7W A;  4XK1 A;  3NTJ A;  1BJ4 A;  1IAX A;  1AHG A;  3DU4 A;  4E3R A;  2C44 A;  3A9Y A;  2KFP A;  4ITG A;  5FT6 A;  3VP6 A;  1I43 A;  3UAK A;  4CXQ A;  1MGV A;  2CJD A;  2VMZ A;  3LVK A;  4GDY A;  2VYC A;  4F4E A;  2AY5 A;  2QLR A;  4M2J A;  3BWN C;  4Q76 A;  1W3U A;  1WKG A;  4RAE A;  1IUG A;  4HVK A;  3QGU A;  3BCA A;  4XJO A;  5M49 A;  3PA9 A;  1I29 A;  3HDO A;  4JEX A;  3EZ1 A;  3GET A;  2X3L A;  2FKI A;  3EIB A;  1DJU A;  1ASM A;  5LHA A;  4Q75 A;  4LW4 A;  3WCN A;  4NOG A;  2ZY3 A;  9AAT A;  3LG0 A;  3MAF A;  3OP7 A;  3GR9 A;  3DR7 A;  1GCK A;  2VMV A;  3WX9 A;  1G7W A;  4EB5 A;  3TCM A;  3MBB A;  1C7G A;  1PFF A;  2VGW A;  3A8U X;  3P1T A;  4PFN A;  1QZ9 A;  1VJO A;  1O69 A;  1G4X A;  1P3W A;  2VGS A;  1ZC9 A;  3FVS A;  3BCX A;  1OXO A;  4ADE A;  1VP4 A;  2EZ2 A;  2W7E A;  2FQ6 A;  4Y0H A;  1CQ8 A;  1WYV B;  4J5U A;  3ELE A;  1ASL A;  1YNU A;  2W8J A;  4XAU A;  4ZDL A;  3N5M A;  1V2D A;  4WB0 B;  4WXG A;  5G0A A;  2ZSL A;  1DJ9 A;  3LVM A;  2BWP A;  2GQN A;  2BKW A;  3TAT A;  4RJY A;  1B5O A;  1B8G A;  3MC6 C;  2QA3 A;  3FQ7 A;  4MQQ A;  4ITX A;  4R5Z A;  3L8A A;  1S07 A;  1LW5 A;  1WYT B;  3M5U A;  4OBV A;  4WXB A;  1FC4 A;  1QJ5 A;  2AEV A;  4JE5 A;  4XEW A;  2X5D A;  4F5I A;  1AY5 A;  2YCN A;  1AIC A;  2OAT A;  2VIB A;  3EI6 A;  1UU1 A;  3W1I A;  1YIZ A;  1S0A A;  1D7S A;  2D65 A;  2JIS A;  4F5H A;  1GDE A;  1ARI A;  1TAR A;  2HOY A;  1LC8 A;  1AJS A;  1IVR A;  3NU8 A;  5F8V A;  2ZYJ A;  1FG7 A;  1DKA A;  5M4D A;  2NMP A;  4GEB A;  3NYU A;  4K05 A;  3B1E A;  3PD6 B;  2Z61 A;  3R4T A;  3A9X A;  2Z67 A;  4OTL A;  2X8U A;  4Y0D A;  1MAP A;  4B9B A;  1QIR A;  3G8M A;  3AEM A;  1V2F A;  3II0 A;  3PDB B;  2WB6 A;  3N4R A;  2AY1 A;  2X5F A;  4JEY A;  2QB3 A;  3HVY A;  2R0T A;  3PDX A;  4XQ2 A;  1JS6 A;  1H0C A;  4H51 A;  2YKY A;  1ZOB A;  1O62 A;  2WK7 A;  3KE3 A;  3PPL A;  4H63 Q;  4RIZ A;  2O1B A;  1M0O A;  2XBN A;  2Z9X A;  3W1J A;  2G6W A;  3DC1 A;  1BQA A;  4JEV A;  1W7M A;  1GC3 A;  1UU0 A;  2BYL A;  1BKG A;  1H1C A;  1RVU A;  1AHX A;  3OKS A;  1KMK A;  5E4Z A;  4RKC A;  1PG8 A;  1OHV A;  3BN1 A;  4XJL A;  1X29 A;  2BI9 A;  3F0H A;  3AEN A;  1UKJ A;  3E2F A;  3IHJ A;  2CH1 A;  4MSO A;  2EH6 A;  4GE9 A;  4UHO A;  1AMR A;  4WYA A;  2DGM A;  1WYU B;  4ZDO A;  4AH3 A;  2WK8 A;  3NUI A;  4PVF A;  2VI9 A;  1C9C A;  4F5F A;  2FNI A;  2R5C B;  3LWS A;  2ORD A;  1W23 A;  3EZS A;  3HT4 A;  1GBN A;  4ZAH A;  2C81 A;  3FDD A;  3EI7 A;  2HP1 A;  3FZ7 A;  1OXP A;  5EUN A;  2O0R A;  1MDZ A;  1BT4 A;  2W7K A;  5AX8 A;  2FYF A;  2GB3 A;  4AO4 A;  2YRR A;  3K7Y A;  3UWC A;  2Z9V A;  2G7J A;  3E77 A;  1IX7 A;  2CFB A;  1XEY A;  4TMR A;  3N75 A;  1M32 A;  2ZUK A;  1RV4 A;  3KKI A;  4F5G A;  4W1W A;  2VI8 A;  1JG8 A;  4F5L A;  1GEY A;  3GZD A;  2HOR A;  4EMY A;  1IJI A;  4Y0I A;  3F9T A;  3GBX A;  4K2M A;  4E1O A;  2BIG A;  3FSL A;  2D61 A;  1SF2 A;  1EG5 A;  1MLY A;  2Z1Z A;  1D7V A;  4ADC A;  4ZM3 A;  4IYO A;  8AAT A;  2DR1 A;  3DOD A;  3BC8 A;  1KKP A;  5G2P A;  1JF9 A;  4HF8 A;  2JGT A;  2BWN A;  1AHF A;  1M6S A;  2BWO A;  1G4V A;  3CQ6 A;  4ZWM A;  4LC3 A;  3FZ6 A;  1GEW A;  1O4S A;  3EI8 A;  4IW7 A;  3QPG A;  4RKD A;  3ISL A;  2O7C A;  3I5T A;  3ELP A;  4IXZ A;  5C6U A;  3QHX A;  3FQ8 A;  1YJY A;  1TAT A;  2DGL A;  3B1C A;  2OGA A;  3N0L A;  4A72 A;  2CB1 A;  1QIS A;  1ARS A;  3E6G A;  1CL1 A;  3P6K A;  2W7L A;  2AAT A;  4AZK A;  4A0G A;  5HDM A;  1M0N A;  3WLX A;  1TOJ A;  4BMK A;  3FTB A;  2HZP A;  1N2T A;  5DJ9 A;  2Z9W A;  2CIN A;  2AY6 A;  1W7L A;  4FL0 A;  4BA5 A;  4MQR A;  5M46 A;  4R2N A;  3JWA A;  2D7Y A;  2YKU A;  3NNK A;  1DGE A;  3F6T A;  2W7J A;  1IBJ A;  4TV7 A;  5HXX A;  2OQX A;  1TOG A;  2CAN A;  2HP2 A;  3DR4 A;  3FZ8 A;  4WP0 A;  1IX6 A;  3QI6 A;  4JF1 A;  4A6T A;  4LNL A;  4BQ0 A;  1SZU A;  2FN6 A;  1YAA A;  3RI6 A;  1I41 A;  1Z7D A;  4WLH A;  4OBU A;  7AAT A;  2EGY A;  4N0W A;  2VMP A;  3BB8 A;  1Y4I A;  3AEM C;  1CZC A;  5EUD A;  3TQX A;  3RCH B;  2F8J A;  3ZRP A;  1AY8 A;  1SZS A;  4CXR A;  3FVX A;  4F5J A;  4B98 A;  2AEU A;  1X28 A;  1AJR A;  1ELQ A;  4RLG A;  2E7I A;  3PGY A;  5FT8 A;  3GJU A;  2ZY5 A;  2AY8 A;  3N4S A;  3E2Z B;  1B4X A;  1WYV A;  5J8Q A;  3E9K A;  3NRA A;  1I48 A;  2VMS A;  1ECX A;  3CQ5 A;  4WB0 A;  5G4I A;  3HLM A;  3ASB A;  1T3I A;  3JW9 A;  1AKB A;  4KAM A;  2BYJ A;  2GSA A;  1M7Y A;  3ZRQ A;  3NYS A;  2A1V A;  2VMR A;  1N31 A;  1S09 A;  3FVU A;  1SZK A;  4U2H A;  3NUB A;  1WYT A;  3B1D A;  1BS0 A;  1YIY A;  4GE7 A;  2RFV A;  2Z9U A;  3G0T A;  4W1V A;  4MY5 A;  2EO5 A;  3GZC A;  3NDN A;  1MLZ A;  2QBT A;  4IX8 A;  2HUU A;  3LVL B;  2BI3 A;  4GRX A;  2VIA A;  3GWP A;  1LK9 A;  3WGC A;  5FT5 A;  3ZZJ A;  2CTZ A;  4WYF A;  2QB2 A;  2JJE A;  3R9A A;  3PD6 A;  3VOM A;  4A6R A;  2EYQ A;  3KGX A;  3DXV A;  2PB0 A;  4W1X A;  5DX5 A;  1M0Q A;  3CBF A;  5G4J A;  3UE8 A;  1IX8 A;  3PDB A;  4LNM A;  1JS3 A;  5EIG B;  2QMA A;  3WKS A;  2YOB A;  3N4X A;  1DGD A;  1W7N A;  3VK3 A;  5DB5 A;  1ASD A;  4WYG A;  3GZD C;  1TOK A;  3JU7 A;  3FRK A;  3COG A;  3WZF A;  2EZ1 A;  5E5I A;  4EFF A;  2ZY4 A;  2DKB A;  5D5S A;  1S08 A;  3NX3 A;  1ASB A;  3TFU A;  2GMS A;  1UU2 A;  3D6K A;  2W8W A;  4IXS A;  4E3Q A;  3CQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...