3A8XA

Crystal structure of pkciota kinase domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
343
structure length
334
Chain Sequence
MDPLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLPDDDDIVRKIDQSEFEGFEYINPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the PKC-iota kinase domain in its ATP-bound and apo forms reveal defined structures of residues 533-551 in the C-terminal tail and their roles in ATP binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C iota type
total genus 102
structure length 334
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a8xA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a8xA01
2PY3A 3E8DA 4MQ2A 3V01A 3ZYAA 2BDWA 1YDTE 2E9OA 5EM5A 3SGCA 3KKVA 4QTEA 1MP8A 3GCVA 2R4BA 2JGZA 4EUUA 3RGFA 5J1WA 3VF9A 5LWNA 2Y7JA 3OP5A 4H1MA 3R28A 4FVPA 4TNBA 4E4XA 5I3RA 2XRWA 3UIBA 3HV7A 4O0UA 3UVQA 1OIYA 2WTVA 3KGAA 4R7HA 3V8TA 3R9HA 3NW7A 5JFSA 3FHRA 3EZVA 3EN6A 3F3VA 4FZ7A 4M8TA 4TW9A 5AAFA 3BWFA 1L3RE 3RNYA 3WF9A 4F9WA 4DTAA 2XM8A 3FAAA 3G33A 5AV3A 3Q52A 2I0HA 4CKIA 3WARA 2J7TA 3MVHA 4JBQA 3FKLA 2OF2A 3GU8A 3FI4A 4G1WA 4JS8A 4E73A 4ZAUA 1Q4LA 5CF4A 5L3AA 3KREA 4P2KA 4LM5A 4RVLA 4BZNA 3L1SA 4C3FA 4FV7A 4GJ3A 4J99A 4QMSA 5AV1A 5TOZA 2R3QA 4QMPA 1JAMA 1SYKA 3GQLA 2RFSA 2ZAZA 4WUAA 1TKIA 3CPBA 3EFWA 3NVKI 2UUEA 3FZTA 5BMSA 3QF9A 3AC5A 4E1ZA 3CY2A 3RAWA 3QTSA 5BVNA 2G1TA 2E2BA 1KE7A 4XG3A 4D2WA 4Q9SA 1BUHA 4BBMA 2PE1A 1BI7A 4FT0A 4DEAA 2IVSA 2ZOQA 3FBVA 2WPAA 1W82A 3QCQA 4EK6A 5C26A 4I23A 3BQRA 5A6NA 3C4ZA 3I7CA 2VUWA 3FL4A 3JUHA 4M67A 4WBOA 4WA9A 3MV5A 3F3UA 4G9RA 2XK8A 3TZ8A 4A7CA 4L43A 5AAEA 4N6YA 4U3ZA 4GKIA 1HCLA 1H1QA 4XEYA 2WTKC 4FTAA 4CMOA 3G90X 3UO4A 4GUBA 4EHGA 3HECA 4IVCA 2B9HA 4O7WA 3D7TB 3THBA 3P0MA 3TTJA 2JIVA 3NNVA 3V8WA 2ZDUA 2PHKA 1KV2A 1Q5KA 4F09A 4TYJA 4H3BA 4NEUA 4EONA 3UOLA 4AFJA 1XH8A 4XP2A 3HAVA 4WRGA 2PTKA 4J96A 4O82A 1M7NA 4DEEA 4V0GA 3G9NA 3PZHA 1FMOE 3CTHA 4MNEB 2HY81 3E64A 3NIEA 3LVPA 3TIZA 1WBVA 2PSQA 3A7IA 4GUEA 5EDQA 4D0WA 1Q24A 3CPCA 3U6IA 3GCQA 4GIIA 1VJYA 4RZVA 5EM7A 4F9AA 2X1NA 3TNWA 3CP9A 1UVRA 2AC5A 3LFBA 3VVHA 4DLIA 3Q60A 5CEPA 4NKAA 3LMIA 2Q0NA 2ZM3A 3RI1A 1DAYA 1GZKA 1S9IA 4FUYA 3D5WA 5HCYA 1MUOA 2XMYA 3KXXA 4HZRA 3NAXA 4IFCA 4JDKA 1E1VA 3I81A 3FQSA 5AADA 4MXCA 3QALE 2QR7A 5KHXA 3ET7A 5E9EA 4UX9A 2QOKA 2NP8A 4LL5A 4BYIA 3I6UA 2R5TA 4UWCA 3TACA 1XBCA 4PUZA 4FBXA 4XG7A 2XZSA 4KIQA 2HXQA 1URWA 4EWHA 3Q96A 4Y73A 5CEOA 1OGUA 4QP2A 4O27B 4F7SA 3CEKA 4KNBA 3T9TA 3HV3A 3KRWA 5DGZA 1RJBA 5I5ZA 4W4YA 2JD5A 5JFXA 4CMUA 2YWVA 3P08A 3GU6A 3QD0A 3ANRA 2YISA 4X6RA 2PYWA 2VO3A 4HGEA 4XS2A 4FV9A 3QRUA 4D4SA 4B99A 3PY1A 3R1NA 5E8YA 3ZLYA 1OBDA 4AZEA 2IVTA 4RGJA 4AF3A 2GHMA 4FG9A 1CTPE 4AA4A 3S3IA 5CY3A 5AIRA 2BROA 4EHEA 2PL0A 3EYHA 2I0EA 1OI9A 2YAKA 4JIAA 3U87A 2BALA 4U40A 4QPMA 4DFXE 1GAGA 1RDQE 4G5JA 3NS9A 5EOBA 3D0EA 2ZV9A 3PIZA 4MX9A 3L8SA 3PY0A 3RAKA 2FA2A 3E7OA 4RWJA 3UZPA 2X7FA 3RK9A 3JY0A 3TZ7A 4OUCA 3CD8A 2C3IB 4LMNA 3NIZA 3GGFA 3BIZA 3LE6A 2O3PA 5DR6A 2FVDA 2VRXA 5CWZA 5EI8A 2OXDA 4QQCA 2OICA 4NKSA 4PL4A 4RC3A 4FSWA 4YTHA 5KZIA 2ONLA 5CVGA 1J3HA 4PQNA 2C6EA 2DUVA 1YQJA 2ERKA 4F7NA 5K5XA 3LFEA 3G51A 3MB6A 3SC1A 3DXPA 1XQZA 1UWHA 1WFCA 4X2NA 3PA5A 2W9ZB 2VWYA 4TTHB 5CSPA 1WBPA 5IU2A 2YM6A 4DCEA 5TR6A 2OFVA 3CLYA 4Q5EA 3QQHA 2R0UA 3IG7A 3QYWA 3R1YA 4FL2A 4YLLA 4BDIA 4G6LA 2FSTX 3LAUA 3E87A 2FSOX 1DS5A 2QKRA 3MH0A 3O71A 2BFYA 1Q8ZA 2W1CA 1F5QA 1Y6BA 2ZV2A 3DLSA 3H9FA 3QCSA 5M51A 5C8KA 1URCA 3LPBA 4U43A 4CLIA 4O96A 1QPEA 3TM0A 1E1XA 3PG3A 4TN6A 5FXSA 4RJ5A 2ETMA 5JQ5A 4YJSA 4BCPA 1SZMA 3KVWA 5C9CA 4AE9A 2WMRA 2W1GA 2VWVA 5D7VA 4BDGA 2I1MA 3H9OA 4NIFA 1FVTA 3VBYA 4BCNA 4C4IA 3UNJA 2H96A 3S0OA 3ZOSA 3FI8A 4L9IA 4CZTA 3UMXA 3LXKA 4AN2A 3NUAA 2Z7RA 3V3VA 4EC8A 2Z60A 3UZRA 5E1SA 3ATSA 4BCHA 5CASA 3F5UA 5KMMA 5A4QA 1XJDA 2C5NA 4TWCA 5E8TA 5HX6A 4M3QA 3Q4UA 3U4UA 2VTPA 4E26A 1YDRE 1RW8A 2PMOX 5C1QB 3PSBA 3KEXA 5DR2A 3F69A 4MXXA 3MH1A 3QTZA 4FEWA 4M13A 4H39A 5ACBC 2BIKB 5E8WA 4O7RA 4HYUA 5IDPA 2B52A 3AQVA 3FL5A 4FKLA 1OPLA 1U46A 5CAPA 3QTWA 4FTRA 4B6LA 3VUIA 3QQFA 3HGKA 4JBOA 2QODA 2XEZA 2XBAA 3UIXA 3ZH8A 3QKKA 2X8DA 3SX9A 4AA0A 4CXAA 4HGLA 4FE2A 4Y95A 4BBEA 5CU0A 1NW1A 5M06A 3ITZA 3G2FA 3OWKA 4BDAA 4X7QA 4FKWA 4GK2A 3VUGA 2YHVA 3FMNA 3CS9A 5IA4A 4O7TA 4E4LA 5AAGA 3R21A 5BYLA 4K11A 4LRMA 4JRVA 5LXMA 3DXQA 4JQEA 5B2KA 3VBTA 4UY9A 4O22A 3VRYA 2C30A 5JT2A 5DT3A 2VWWA 4ZJIA 3RPOA 3VBXA 2EB2A 3KXNA 4NJDA 2PMLX 4CV8A 2P2IA 2XIXA 5CLPA 2PK9A 5I9YA 4ZIMA 1P4OA 1OZ1A 3QRTA 4AN3A 4EEVA 3AC2A 3GOPA 4IVDA 4FKSA 3GC0A 4YJTA 5CXZA 4A9SA 2BR1A 5AFVA 1YI6A 5L6OA 4PMMA 2W9FB 4EH6A 2WNTA 5CZHA 3ZLXA 2UW8A 3JPVA 3R00A 3CKWA 5EG3A 3TV4A 3WZUA 3L9MA 3MW1A 4WSYA 2DYLA 4LUDA 3RMFA 3ZUTA 5EQEA 1JSVA 2CGXA 4OTRA 4AQCA 1GY3A 2F2UA 2YDKA 3DKCA 5IH4A 5JSMA 4JQ8A 4EHVA 4L45A 4BDCA 4C62A 3TT0A 2YCRA 2OH4A 4FKVA 3DCVA 4J95A 4AWIA 4MHAA 3UZTA 2O63A 2XA4A 3MBLA 2KTYA 4FV8A 4P5ZA 3T8OA 2J4ZA 2YCFA 4O0TA 5I9UA 3RHXA 3VS7A 4YJQA 3ZUVA 3UC3A 2B0QA 1OIQA 5HE2A 3F3TA 1VYZA 1R39A 4FYNA 3TUDA 2ITNA 4DE4A 3S2PA 1UNGA 3OCGA 2C6MA 5HG8A 3W1FA 4FT5A 5DFPA 2IPXA 3PDTA 4DGGA 3TTIA 4ZLOA 5L6PA 3UQFA 5IQEA 3VS0A 4E4MA 3ZS5A 4QTCA 4QMXA 4U44A 4JI9A 3OWLA 4IAYA 4KKGA 5CF8A 3O96A 4IDVA 4TY1A 5J79A 2PVHA 4PNKA 3DGKA 2XP2A 2C68A 4I6FA 4QMVA 4EK4A 1GNGA 5EYDA 3MFRA 4BGGA 2ZMDA 3SRVB 4O7LA 4AW5A 3ZSGA 2R3RA 3O23A 4U45A 2JKOA 3R71A 5F4NA 4EH9A 1OUKA 3R02A 4NTSA 3TL8A 2W5BA 4O7SA 1Q41A 4QMQA 2UW6A 2IW8A 3PWYA 3KMWA 1AQ1A 3AGLA 2CLQA 3KRRA 2QURA 5AP2A 4CFXA 3ZZEA 3R7UA 3VNTA 4JXFA 1KV1A 3IOPA 4FL3A 3FLQA 3K2LA 4ZP5A 2XBJA 3FZPA 3NYNA 4JAJA 3CGFA 4FV6A 4QMZA 4JG6A 3TV7A 2W1ZA 1DM2A 2FSLX 2PVMA 3F61A 4HCVA 4W9XA 4D2PA 3ZXTA 4ANLA 4A9UA 1I44A 3SXFA 4EOPA 3AC3A 3BEGA 3BPRA 4IQ6A 5EW8A 3K5UA 4A9YA 5FGKA 1W8CA 1H24A 4TYIA 2GSFA 3OD6X 3PSDA 4FTNA 5J5TA 2XJ1A 3R30A 4G3GA 2HIWA 1PMEA 5LMKA 4BCGA 1UWJA 4Z55A 4JAIA 3ALOA 5JMSA 4EQMA 4ANBA 4IFGA 2UZTA 2WD1A 4DG3E 5E91A 4YC8A 4EOKA 3RPSA 2W1DA 4JIKA 4IZAA 3FMMA 5C01A 2Z7QA 4GEOA 5CAQA 3MIAA 4J52A 3FMKA 4K1BA 4I1ZA 4PMTA 4USDA 4Z9LA 3ZBFA 2I0VA 3BQCA 2P3GX 1M52A 4II5A 4RC4A 3MDYA 5AP1A 4UB7A 2XH5A 3HMNA 3E63A 3EIDA 4FKGA 2DQ7X 3OUNB 2QOOA 3QHWA 4YSMA 3SKCA 3EFKA 4BBFA 1BKXA 2OJJA 3WYXA 4NZWB 4OTHA 3A60A 3RPRA 3FMLA 3ZFXA 3L9NA 4G3EA 3PUPA 4ACGA 2OG8A 4DYMA 3BLQA 4EORA 3EYGA 1RE8A 2WEIA 3VN9A 4EK3A 3QTIA 3ETAA 3O8PA 4L42A 4RVTA 4O91A 2X7OA 3BEAA 2OZAB 4BZOA 3MPTA 1QPDA 4I92A 4GT4A 4HNFA 3DS6A 3GU7A 1VZOA 2V5QA 3KULB 3MA6A 1OL2A 5DBXA 5LARA 4E8AA 5M56A 3VBVA 4BCFA 2Z2WA 1SMHA 2B7AA 2OIDA 3V5TA 1NY3A 1UNHA 5IQIA 3AT3A 4O6LA 1NT2A 1H00A 1SM2A 4QD6A 4FGRA 2XKEA 4YJPA 1DAWA 2B9JA 4AZVA 4ID7A 3WF8A 1ZWSA 3FLZA 3QXPA 3ODZX 2FYSA 2WMUA 4MCVA 2XNMA 4MD8E 4DGMA 3FHIA 2A0CX 2J51A 1XBAA 1O6LA 2BUJA 2PWLA 4RIWA 4UWYA 4KKEA 4V05A 3D7TA 4OTFA 4R5YA 4GYIA 2QOIA 5BVFA 1BYGA 3TUCA 4GFMA 5DI1A 2BRMA 3NCGA 5EDRA 4IM0A 4QMLA 3ALNA 2QOBA 5HNGA 3O51A 5LCJA 2JDTA 3DBEA 3P86A 3ZXZA 2H34A 3DKOA 2Z8CA 4FMQA 4V0GB 3IKAA 2BZIB 2OIQA 4YO6A 4AFEA 4E4NA 3F9NA 2AUHA 2H9VA 4RX8A 5A4TA 3FKOA 1P4FA 2Q83A 1P14A 3F2RA 3CXWA 3G15A 4QP3A 1UNLA 1QL6A 4RRVA 3BGZA 2QU6A 5AP6A 2BAKA 4BRXA 3VS2A 4HJOA 2GCDA 1XO2B 5HG7A 4AZTA 4QTDA 5AM7A 4BHZA 4OBPA 4U41A 3GFEA 3WILA 3GVUA 1P5EA 3NUSA 4J53A 4WT6A 3COMA 4E20A 5HEZA 3PY3A 5FBNC 3D2KA 4O81A 2Y6MA 3FDNA 2W4JA 2BTRA 3LCOA 4JJRA 2A2AA 2BILB 2WAJA 4ACHA 5JRSA 3NX8A 5EK7A 5IEVA 2YM5A 4UXLA 4HVHA 4FV5A 4PDOA 3QU0A 2WELA 2ZM1A 5EW9A 5AV2A 4Y5QA 3V6RA 4DTKA 2J5FA 1PXJA 3GC9A 3WF6A 3FLWA 3MWUA 5CALA 3PXRA 4N4SA 5AMNA 3RP9A 2WU6A 4UMQA 4E6QA 1VEBA 2C0IA 1IRKA 4O6EA 4FIEA 3HKOA 3WIGA 4YSJA 4JRNA 4IZ5A 3EQIA 3WIKA 5LVNA 3BHVA 4J8NA 3IW6A 2PUNA 3IW8A 3PTGA 3UG1A 2OJ9A 2VWIA 3C4EA 1WBWA 5IG1A 3PYYA 4FK6A 5CU3A 3CQWA 3LCTA 3LMHA 4HCTA 3AD5A 5KMKA 2XCKA 4XYFA 1JKKA 2YAAA 3MVMA 3RBWA 2W4KA 1XKKA 3LQ5A 2YM8A 3EQPA 3QZFA 5DA3A 3QGWA 3DAKA 3DBQA 1CSNA 4GS6A 2J2IB 1L8TA 4M14A 4TYHA 5M57A 3ZM4A 2PZIA 2CPKE 4FV1A 4I4EA 2QI8A 4I22A 3UOHA 5I9ZA 3IDBA 4D9UA 4QTBA 4F0FA 1R0EA 3F3WA 3IW4A 3NEWA 1ZMUA 3DZOA 3K3JA 2R3PA 4LGGA 4C61A 1OKYA 4CD0A 3UOJA 4NTTA 2QQ7A 3D14A 4RFYA 3OOMA 1JVPP 3HZTA 2IW9A 5A4LA 1W7HA 1XHAA 2JAMA 2P55A 2JDVA 3ORLA 3V5QA 2VX0A 4QMNA 3N4TA 3UO5A 4DFBA 3DOGA 4ACCA 4KIOA 4PNIA 3NWWA 4GT5A 2A19B 2GTMA 3TCPA 1SVGA 1OKVA 4J98A 2CCHA 3HYHA 4FR4A 4TYGA 3ZUUA 4KUJA 4I3ZA 3TKIA 1J7IA 3I7BA 3QD2B 5H8EA 3PZEA 4J71A 5DIAA 1K3AA 2VD5A 4JX7A 4K0YA 4M0YA 2Z7LA 4EYJA 5FDPA 3Q9WA 3PVUA 3MH3A 4FNZA 4QYYA 1OB3A 4FC0A 4FSMA 3F66A 1UU7A 4L68A 5J95A 4BYJA 4BI0A 3QL8A 3LM0A 4QO9A 5L8KA 3PXYA 5ETFA 4AT4A 5HG5A 3LFDA 4DEBA 2RSVA 4JR7A 5B7VA 4RWIA 2WIPA 4EQUA 4FKUA 4NIFB 3NDMA 4UXQA 5JEBA 4TPTA 4OTQA 3GQIA 1ZYCA 3F6XA 5FG8A 3FMDA 1YHVA 1TVOA 3R01A 3W2RA 4F65A 1IAJA 3NGAA 4BN1A 1G8SA 3OY3A 4IAKA 1PHKA 5FD2A 4GVJA 4YLKA 3LZBA 4YZNA 2C4GA 3ORKA 1IAHA 2CNUA 4NM3A 2O65A 2HELA 3BHHA 3OEZA 4FX3A 3D4QA 4EUTA 4ZJVA 3TDVA 3RM7A 2E9UA 4EOLA 1GZ8A 1YDSE 1SVEA 1Z5MA 2H8HA 4WG3A 4F1MA 3MS9A 2GS6A 4Q5HA 4IBMA 3HVCA 2OF4A 4RVKA 5DPVA 3Q3BA 3CQUA 1NXKA 2RGPA 4N0SA 2WO6A 2OFUA 5CF5A 2VTQA 3KF7A 1YWVA 4BVUA 2F7EE 3PXQA 4AS0A 2X9EA 5L2SA 4N6ZA 2YN8A 3L8VA 1ZOEA 4YU2A 3D15A 1CM8A 3RWPA 1WBOA 4A4XA 2G2HA 4RG0A 4XG8A 4QMOA 3LOKA 4LMUA 4C3RA 4UALA 4AGCA 4I0RA 2NRYA 2WTWA 2JIUA 2VTHA 3MESA 3BE2A 4KBAA 4X2GA 5AR3A 4BTKA 3H4JA 3MPAA 3OBGA 2XKFA 4YJRA 4DFZE 3QCXA 1CDKA 5HLNA 4WOVA 4XCUA 3ZO2A 2R3LA 3U9NA 2VX3A 4AZWA 3CD3A 4PDSA 2PVJA 2HYYA 4GU9A 4KINA 1XH7A 4I0SA 4IVAA 1DI9A 5FDXA 2Y4PA 2QU5A 3FI3A 4MBLA 5T6KA 4DN5A 3R1QA 4QQTA 3POZA 3GENA 2UV2A 3OROA 2V0DA 5CU6A 3I60A 3U6JA 4DF3A 2ITPA 5DT0A 4C8BA 4E5WA 4J97A 4PPCA 5KHWA 4CGAA 4C4JA 4NFNA 5AWMA 3WF5A 1BL6A 4RIOA 4FNWA 3RM6A 2OJFE 3P9JA 3I79A 4DGLC 4R5SA 2J50A 2IVUA 1GZOA 3NNXA 3NR9A 3Q5IA 2XYUA 2A1AB 3DK6A 5HE3A 4CRLA 4WD5A 5HE1A 5HIEA 1FGIA 1A9UA 4RQKA 3DDPA 4FICA 3BU6A 4FTIA 3S4QA 4USFA 4FKIA 4BGQA 1O9UA 5E8SA 5GZAA 2VTAA 4XH6A 4I20A 1J7UA 1YKRA 2V62A 3NYVA 3Q4ZA 4XP0A 1PXMA 2YM3A 4RJ4A 5IA5A 2PVRA 4D0XA 4QRCA 3ZBXA 2C1BA 3GCUA 3VWAA 5CNNA 3QQLA 3D94A 3BGQA 4ONAA 4UMTA 4B0GA 3F7WA 1Y8YA 2EUFB 3IPHA 2AYPA 1Q8TA 2WQMA 5C27A 2FUMA 2F9GA 5CAVA 3MFSA 1REJA 3QQJA 4X2FA 2BRBA 4EH4A 4LGDA 3DFAA 4YNOA 2JKMA 2XRUA 4F4PA 5EQYA 3TG1A 3R8PA 1Q8WA 3BV3A 3GT8A 1O6YA 3O7LD 3POOA 5HG9A 4D1SA 3G0EA 3IGGA 2XKDA 4EYMA 5L8LA 4CNHA 5LVOA 5IQHA 3BYOA 2OXXA 4OTDA 1M2PA 3L9PA 4EOMA 2WMVA 1AD5A 3E3PA 2BMCA 4UYAA 5EDPA 2V7OA 3DTCA 3LHJA 3DNDA 4MK0A 4AZFA 4BZDA 2ZM4A 3ZRLA 3NW6A 3VJNA 4HVGA 5CAUA 4A07A 2ZV8A 3RAIA 3BYVA 5AUZA 3ZFMA 5ANKA 3M2WA 4IZYA 3FUPA 2EXEA 5K9IA 3I5ZA 4W8DA 4I5MA 4OBOA 4GKHA 3KC3A 1XR1A 5A54A 2BKKA 4YZDA 2XK9A 3Q9XA 4BDBA 3GXLA 2Z02A 3QXOA 2XK6A 3HA8A 4EI4A 4I4FA 4FEXA 3SXSA 4YR8A 4BI2A 5HVKA 2ZB1A 4HNIA 2B53A 3LJ2A 4QMYA 5IUIA 2O64A 2WFYA 3QKLA 4GT3A 4DFNA 2R3FA 3OWJA 3QX2A 4HVSA 3QFVA 2C6KA 1OL7A 2YM4A 5L8JA 3PJ3A 1STCE 3VUDA 4ZLZA 4QYFA 4FNYA 4RIYB 4DFLA 3E5AA 5BYZA 5TKDA 3MJ2A 4BDKA 2GDOA 4UWBA 4K77A 1ZZ2A 4D4VA 4FEQA 4TXCA 3QTQA 3FPMA 2EVAA 3Q5ZA 2RFDA 1B38A 1U54A 4ALUA 4F1TA 5IUGA 3U55A 2ZB0A 1U54B 4XBUA 3WE8A 4GFOA 4TL0A 3HV6A 4EKLA 4D2VA 4L52A 2CN5A 3OS3A 1V1KA 3EQFA 3FV8A 3KN6A 4BL1A 5ACKA 3FZOA 4M15A 4I5PA 3JR1A 3Q6WA 4DH5A 3R8MA 1GOLA 1ZY4A 2C5VA 3PRFA 3SG9A 3VS3A 5AP3A 4FV0A 5I0BA 2Z7SA 4WG4A 2OZAA 2PZYA 3CKXA 2WIHA 4G17A 2W1HA 3MVJA 4EOJA 2VAGA 2WTCA 3MJ1A 4L01A 3R8LA 3R8ZA 2ITWA 1PF8A 1WCCA 3KXHA 3VS4A 4L67A 4L53A 2GTNA 4ZTRA 5EHYA 3KQ7A 3NUPA 4FKTA 5AUVA 5IDNA 3UIUA 2Y4IC 3RCDA 4D5HA 2YCSA 4UZDA 4H36A 2YACA 2VWZA 2GNLA 2GNGA 5HVYA 3I5NA 4EOSA 4U7ZA 3NMUF 5BPYA 3COHA 4CTCA 3AMYA 3AT2A 3P7AA 4ZMFA 2QVSE 3MY1A 4I21A 1W84A 5FP5A 3UO6A 3UYTA 2NO3A 3C9WA 4DEGA 4BICA 5JQ8A 2VU3A 3FQEA 4XBRA 3R7VA 4AA5A 3QGYA 4FYOA 2XS0A 3H3CA 4A9RA 4R7IA 4U79A 5JGDA 4O0YA 3LCSA 2QO7A 4M84A 2ONLC 3EL8A 3FMHA 3OY1A 3RK7A 2UW0A 1PXIA 4CLJA 1MRUA 3RALA 3RJCA 5LVPA 4AAAA 3OXTA 2ZV7A 4CEGA 2ITUA 3DTWA 1FQ1B 3KMMA 3R7GA 4MNEA 3ZSHA 4TZRA 4W4WA 5HTCA 4G31A 2OU7A 3CIKA 3P4KA 4KRCA 4MWIA 4RJ6A 4RLKA 1JSTA 4IANA 4ZXTA 3FEGA 3MFTA 3BI6A 3FWQA 4IWPA 3TNHA 4FVRA 4ANOA 5BUEA 5DN3A 4F99A 2X2MA 3QQUA 1Q3WA 4DFYA 5EHLA 4UYNA 3VULA 4FTTA 4R7BA 3Q2MA 4QNAA 2ITOA 3O0GA 1OIUA 2GHGA 4FZFB 2XNNA 3KL8A 3MA3A 4QP1A 4XG2A 3IS5A 4GG5A 4ZSLA 2R3MA 4F6SA 2EXMA 2GNFA 3EKNA 1YI4A 4JOAA 3DB8A 2IZTA 2ZDTA 4RQVA 5CEIA 3ULZA 5C4KA 4I0TA 4F1OA 4NW6A 4X2KA 2WQBA 4UMPA 4QNYA 4FGBA 2LAVA 4E6DA 4O83A 3HRCA 4Y85A 3VAPA 4AT3A 4KBKA 4UBAA 3BV2A 2DWBA 2X8IA 4O21A 4ZY6A 3V6SA 3R9NA 2XNEA 4E93A 4UEUA 1ND4A 2EWAA 3FXXA 3DBCA 1PXKA 3L8PA 2HZIA 3MTLA 2X39A 1EH4A 4CYJA 2WQNA 3WF7A 5I4NA 4AG8A 3PVGA 3ELJA 3ORMA 4IX4A 2C5XA 1BI8A 2CDZA 2JAVA 4HYSA 3A8WA 4XP3A 4X3JA 3VUKA 4AACA 3LFQA 4FOBA 2QOQA 3CBLA 2ITYA 2WMXA 2XVDA 2PUUA 5BUJA 2P2HA 3CJGA 1Q3DA 3E8EA 4OT5A 3HAMA 3P1AA 5CS6A 5E92A 5GINE 2Y6OA 4EL9A 3FZ1A 5KMOA 3D5XA 4U8ZA 4I24A 1M7QA 5KNJA 3KA0A 4RX9A 1K9AA 2J0LA 4MF0A 4LRJA 5LVLA 1U59A 2CKEA 4L3LA 4O2ZA 4ASDA 3CSVA 3BELA 3F2NA 3UP7A 2HY0A 5A46A 3HDMA 3C4XA 1HOWA 4TYHB 4IX6A 3EJ1A 4GVAA 4YURA 5DHJA 2PVYA 3Q04A 3R22A 3TEIA 4GL9A 2E9VA 4BIBA 3E3BX 2B9IA 2J0JA 3DXNA 3QRJA 4K6ZA 2PVLA 3D9VA 3MTFA 4KD1A 4RZWA 4XLVA 2WTKB 2BDFA 2WB8A 5B2MA 5L2IA 4O7YA 3FJQE 3S1HA 5CZIA 5IQGA 3FY2A 2UVXA 1UV5A 4IDTA 5KO1A 2OK1A 4IC8A 2UZUE 1OIRA 3IQ7A 3PP0A 3Q9ZA 3AOXA 2WQEA 3QYZA 5E8ZA 3VC4A 3W8LA 5IZFA 3NNWA 4AGUA 5AP7A 5BVDA 3TIYA 2GFCA 5IQAA 4Y5HA 3W16A 4FNXA 1U4DA 4R6VA 4YMJA 1PMUA 3RINA 4BF2A 4U81A 4FV4A 3RK5A 3HDNA 4DG2E 3KFAA 5E4HA 3EQGA 1X8BA 2J0IA 2YWPA 1YXVA 5H3QA 4CRSA 4W4VA 4C58A 5ANDA 3OT8A 1ZZLA 3TV6A 4FZAB 4R1YA 3O50A 4U42A 3ATTA 3RZFA 2IW6A 3K5VA 2IJMA 3HEGA 3V8SA 4D28A 4BCMA 4R77A 2YM7A 4KIKA 4PL5A 2GS2A 5AUWA 2BVAA 4GFGA 4KIKB 1UU9A 2ETRA 2XKCA 4WSQA 4XV2A 5KMIA 5L2QA 2VX1A 3D83A 4LL0A 3EB0A 2CGUA 4EH2A 1JBPE 2ZVAA 5CXHA 4QPAA 5J8IA 4BDDA 4C0TA 2CSNA 5DH3A 3U4WA 4OAVB 5B0XA 4ACMA 3QA8A 1YW2A 1XH4A 1GJOA 4PL3A 4EHZA 3PVWA 3U8WA 2NRUA 2OJIA 5AR8A 4GW8A 5DYJA 2I6LA 4TWNA 3WZEA 4FT3A 2VO7A 2JDSA 2C0TA 3ENHA 3C4FA 1PKDA 1IASA 3EMGA 4YHJA 2IZSA 3OCSA 4ZTNA 4Q9ZA 3U54A 1H1RA 5KUPA 1TQMA 4AGDA 4D55A 5I9VA 3R9OA 4Q2AA 1LP4A 2VWUA 2UZOA 3ACKA 2X0GA 4A4LA 5HVJA 3LFCA 1KE6A 2VTNA 2QOLA 3UC4A 1J7LA 4EOQA 4O7NA 1JKLA 3PG1A 3C0IA 4G6NA 4XRJA 4OAUC 4IXPA 3IOKA 3F2AA 2BAJA 2C47A 3KXGA 4R3RA 4FZ6A 3UQCA 2NNWB 2PPQA 2FGIA 5HBHA 4WNOA 5EI6A 3DZQA 4KRDA 3HP2A 4F9BA 3ZEWA 2YDJA 4U9AA 3R0TA 4MXOA 4R3PA 5IQBA 5E7RA 2YLEA 5CQUA 4XMOA 3M1SA 4GH2A 3ZRKA 2IVVA 4IM3A 3K54A 5KMJA 1GIIA 4F63A 5J9LA 3VBQA 4FG7A 1Y57A 2W1IA 3EFLA 4EH3A 1WMKA 3DU8A 2O2UA 2X4ZA 5EM8A 3E92A 3F5XA 4BTJA 3MN3A 2YFXA 3ERKA 3EN5A 5IA3A 4RT7A 1FPUA 3AMAA 4MWHA 3WZKA 3PA4A 3LFFA 3AD6A 1PXNA 1VYWA 3RHKA 4CTBA 1YWNA 2VZ6A 3ORNA 3RNIA 4HPUE 1OPJA 5DMZA 4FSYA 3A7FA 4UZHA 1YRPA 4RA5A 5F20A 2F49A 3T3UA 5JFWA 4P90A 5JGBA 2GQGA 5HCZA 1R3CA 1Y6AA 3NAYA 4FTMA 4Z3VA 3BRBA 4IJ9A 4E6AA 1MRYA 4IACA 5A4EA 5K4IA 3GFWA 1NVQA 4XLIA 3AC8A 5EYKA 2Y9QA 4OLIA 1YXSA 3OBJA 3QD4A 5CSVA 2UZDA 2RL5A 4UMRA 3SA0A 3OW4A 3ROYA 4JDHA 2W7XA 4G34A 2R3GA 4B9DA 3F5GA 5HBJA 3A61A 3QTRA 4ZZNA 5J7HA 5L2TA 5AX9A 3R2YA 3GBZA 3VRZA 1W83A 3SXRA 3F5PA 4S34A 2WMSA 4HYIA 5CT0A 4BGHA 3B2TA 3RWQA 1G3NA 1U5RA 2C6TA 5KBQA 4HVDA 4IEBA 1KE9A 2OH0E 4FEUA 4RVMA 3MVLA 3TZ9A 5IPJA 1KSWA 3GCPA 3GP0A 4KS7A 1JSUA 4APPA 2F7XE 3DLZA 4Y83A 2VGPA 2YIRA 5EKNA 4I94A 2R3NA 3A2CA 4DTBA 4U3YA 5JN2A 1FOTA 4ZTQA 5FXQA 5HQ0A 2QOHA 4NFMA 1ATPE 4MYGA 4EH7A 2G2IA 2YIYA 4C3PA 3AG9A 4JG8A 4YTFA 4IB0A 5JH6A 5IKWA 5AUXA 5T68A 2B55A 4S33A 5IA2A 3D5UA 3H9RA 3ZEPA 3QA0A 4X3FC 2HCKA 2A27A 4HGTA 2BIYA 2UVZA 1YXTA 2H6DA 1OKZA 2XM9A 2PVFA 2OZOA 4JNWA 4MAOA 1XH5A 4YO4A 2BRNA 5CX9A 2YZLA 3N51A 3HRBA 3UMWA 4DAWA 1Q97A 2GHLA 3ZLSA 5HO7A 1APME 4BCJA 3LFSA 4K33A 4QYGA 2IO6A 1LR4A 2QKWB 3PFQA 2GMXA 3ORPA 4LOPA 4BKYA 4FTCA 4RFMA 5HHWA 3WOWA 4EBWA 5TT7A 1OKWA 5EYMA 1OL1A 3BLRA 4CFMA 4LOQA 5H2UA 1Z57A 2PE0A 4MD9E 3T3VA 3GOKA 5J87A 3TNQB 4ERWA 5CTPA 2IWIA 3VJOA 4FTJA 4GIHA 3UOKA 3MFUA 4LG4A 3G6HA 2QO2A 4ZSGA 5C03A 1R1WA 5DT4A 5HICA 4YNEA 4F70A 3EWHA 5HOAA 2IG7A 4QMTA 3W2SA 1PYXA 3FXZA 5K0XA 4L3PA 2YA9A 4BCOA 1OMWA 3ZTXA 3DB6A 4B4LA 4DGOA 5BNJA 2WXVA 5AV4A 3KB7A 4YBKA 5K0KA 4CT1A 1IA9A 4EK5A 2YABA 3MI9A 2CNQA 1FBNA 2YDIA 2RKUA 4OTWA 2XUUA 2NPQA 3GC7A 3UVRA 1SNXA 1CKPA 5AR2A 4IB3A 4EOIA 4R78A 3BYMA 4FKPA 2JLDA 3QRIA 4DEIA 4PWNA 2JFLA 3H0ZA 4QP8A 4E7WA 3GU5A 4WNPA 4C4FA 3P78A 4FSTA 4QOXA 3ZDUA 3W2OA 3PE2A 4S31A 3RCJA 5F1ZA 3UTOA 4CCUA 3DA6A 3NUYA 5CVFA 4D4RA 4DG0E 3SW4A 4YZ9A 3OUKA 3FLSA 1YI3A 3I0QA 2P0CA 3LXLA 4BKZA 2YIQA 4K2RA 3LKMA 3KK9A 2JDRA 5DNRA 4CYIA 4DT9A 5CI7A 4ANQA 3VF8A 1ZMWA 5HCXA 5J5SA 4GJ2A 4KABA 1TQIA 2GNJA 1ZOGA 4O1PA 4DHFA 4WUNA 3V5WA 5IEXA 1NVRA 3H10A 4HVIA 3DY7A 4S30A 4I6QA 5CEMA 4FL1A 2REIA 3Q32A 5D10A 3AD4A 2QC6A 3KXZA 1Q8YA 1PKGA 4PTCA 2GFSA 5JK3A 3NLBA 4PF4A 2R7BA 2PULA 4DBXA 2SRCA 5BVKA 3FMEA 3KXMA 2IZRA 4R3CA 2B54A 3TKUA 5F9EA 3CTJA 2GQRA 2VO0A 3TDWA 4LRKA 1WBTA 2JBOA 3HNGA 2UW5A 3FLYA 5IQDA 2QHMA 3SW7A 4AW1A 2QOCA 3B8RA 4MVFA 3R7EA 1J91A 4ASEA 3BE9A 2WU7A 3FXWA 2BRGA 5GZ9A 3VO3A 2UZBA 4L3JA 4RBLA 2HZ0A 5HTIA 2UZVA 3OOGA 2HK5A 2C3LA 5AR7A 2ETKA 3ZO3A 3EN7A 4GYGA 5E8UA 4H3PA 4PTEA 4AT5A 3OVVA 3JVRA 4JBVA 3BHTA 4IC7A 3DFCB 4NK9A 4BCKA 4F7LA 3KK8A 4FSRA 4WRSA 3E88A 4X6QC 5FLFA 5LQFA 5A9UA 4M97A 2OXYA 4C2WA 4D4YA 1ZRZA 3W8QA 1Z9XA 3UE4A 3A4PA 3C4WA 3VIDA 5HU9A 3LXNA 2FO0A 2WHBA 3PRIA 3I0OA 4FIJA 3OHTA 2C6DA 2RIOA 3KU2A 4KSQA 4OTIA 5TE0A 4M12A 3OFMA 3FY0A 3QKMA 2OW3A 2JEDA 1ZYLA 2AC3A 3LLTA 4X3FA 2XB7A 3KF4A 5M08A 3DAEA 3FC2A 3QUDA 4CZYB 3WI6A 3LMGA 3HMOA 2O8YA 3KULA 5LJJA 3PLAE 3IW7A 4ZEGA 2JC6A 3O8TA 5EQPA 4EK8A 4HCUA 4OR5A 2VTMA 3NYXA 4ANNA 4GG7A 4B7TA 3NRMA 5M09A 3SAYA 2W1FA 4I5CA 4NM5A 5FWKK 3SDJA 2HW7A 3COIA 4BKJA 4GV1A 2QLQA 1JOWB 4G3FA 1A48A 5FUTA 4ZSJA 2GQSA 2BRHA 5J7BA 2QD9A 2OWBA 3G9LX 3JS2A 1OL5A 4ITIA 5CSXA 3TN8A 3PPZA 4U5JA 3GCSA 3QUEA 3BZ3A 4H05A 1YXXA 4X0MA 4AXAA 2A4LA 5CNOA 4R1VA 4IX5A 3TJCA 5M4CA 3SVVA 5M44A 4MNFA 2C1AA 3DK3A 2OBJA 4FUXA 1WVXA 1ZXEA 4RIWB 4XRLA 4C35A 1ZARA 3K3IA 3R8UA 5EYCA 4BI1A 4MEDA 4FA2A 2PE2A 2X7GA 5AV0A 4ZMEA 1KE5A 4RIXA 4W9WA 1ZMVA 2VWXA 1T46A 2W0JA 4FV2A 4GRBA 5HGIA 4WG5A 4CSVA 2LGCA 3SQQA 3P7BA 2PZ5A 4JDIA 5H8BA 4QT1A 4KSPA 3KCKA 3R6XA 4F9YA 1A06A 3VHKA 3WBLA 1B39A 3QQGA 5GJFA 4CCBA 3LFAA 5DE2A 4V04A 2BTSA 2X4FA 3GEQA 3PJCA 3CY3A 3V5PA 3HUBA 2I7QA 1P2AA 4HGSA 2V22A 3B8QA 1E9HA 3CJFA 1R0PA 3PA3A 3BU5A 3Q2JA 3A99A 1UU8A 1WBNA 2OSCA 2RG5A 3OC1A 4FZDB 5AR5A 4ZTLA 4TRLA 1YXUA 5FP6A 5AUYA 4ALWA 3P5KA 4M0ZA 1PMVA 2WGJA 2W17A 2X6EA 4RMZA 5EKOA 2QG5A 4ZS4A 4ZZMA 4J7BA 4ACDA 3SLSA 4IAZA 5C4LA 5EI2A 5K3YA 2UZLA 1JKTA 4ZY4A 4FF8A 5KCVA 2QG7A 2Q0BA 4LQMA 4M66A 3REPA 2UW9A 5CSWA 2QLUA 3M11A 3EZRA 2WOUA 3V5JA 3W18A 3ZHPC 2B1PA 5AIKA 3UGCA 4BWXA 4F6UA 4W4XA 4QYHA 4K9YA 3C5IA 3C50A 3PIXA 4XOYA 3COKA 2C6IA 4I93A 2HWPA 3PPKA 4XUFA 2FSMX 1H1PA 3BX5A 4ZS0A 3WE4A 4LV8A 2F4JA 5BVWA 5HX8A 5FEDA 3BWJA 3I4BA 4PDYA 5AUTA 4P5QA 3PJ8A 4WO5A 4H1JA 1Y8GA 4RX5A 5HLWA 3UG2A 5IQCA 4WKQA 4U6RA 4JDJA 4CKRA 2G01A 4MF1A 4G5PA 3QX4A 3IECA 4DT8A 5DOSA 3C4CA 4MH7A 4RFZA 3GC8A 5A14A 5AEPA 4DFUA 4LUEA 2YITA 2WMWA 5DWRA 4NU1A 3MSSA 4EH8A 2HW6A 3ZMMA 5AP5A 4YJNA 3NSZA 4O7ZA 4MBIA 1Q61A 2E9PA 3N9XA 4ARKA 4YJOA 4YP8A 4Z7GA 5BVEA 4BIEA 1ZOHA 4I6BA 4ITJA 5AUUA 4AP7A 5BUIA 4AW0A 1QPJA 2CKPA 1FVRA 2W06A 4C4GA 4HPTE 4MTAA 1ZY5A 4RC2A 4ALVA 4O0WA 2WQOA 5J9YA 2V7AA 4LFIA 5LWMA 4DH3A 4A06A 3UVPA 3W2PA 4DITA 2F7ZE 1AGWA 3IGOA 2PUPA 4O84A 5D9HA 4FV3A 2VO6A 2W5HA 4CVAA 4IB1A 3TXOA 2VTIA 2ITTA 3C13A 2ITXA 4DH8A 2B4SB 3CGOA 2ITQA 4EC9A 3VW8A 3UPZA 4UMUA 1PW2A 2W05A 5G1XA 1OITA 4IWDA 1REKA 3C0HA 4RJ7A 2XIYA 3W2CA 5GIPE 5FEEA 2BZKB 3VS1A 1J1CA 3ZO1A 4C59A 3KCFA 1KE8A 2DS1A 2ZJWA 3B2WA 3GNIB 5HD4A 1QCFA 3OEFX 3ORIA 4F08A 1JLUE 2HXLA 3VUMA 2C5OA 2UW7A 3UIMA 4I6HA 2C3KA 4IB5A 1ERKA 3ZLWA 1R78A 5ETCA 2J0MB 3ZONA 4ZK5A 4PTGA 4E5BA 4L7FA 4FIFA 4JR3A 4OTGA 2HWOA 1VR2A 3A8XA 3HMPA 3V5LA 4BCQA 5KKRB 5J1VA 2WTIA 1YOMA 3MY0A 2R7IA 5EFQA 3R7OA 5L4QA 1NVSA 3LJ0A 3C5UA 4G2FA 4G6OA 2OKRA 4GSBA 4MXYA 4FT9A 4LYNA 2YJRA 4AOIA 2HENA 1WZYA 3R73A 4GK4A 2BHEA 3RVGA 2R9SA 4FSZA 2YIWA 4BC6A 4PRJA 3UPXA 2ESMA 2JBPA 4RWLA 4K8AA 4QMWA 2BZJA 5AP0A 2ZYBA 5ETAA 3VW6A 3HMIA 3FQHA 3NCZA 1MQBA 3RKBA 3A62A 3A7JA 5BVOA 3U6HA 3PE1A 4HOKA 3ROCA 2XIKA 2O0UA 5HORA 1QPCA 4NW5A 2VNYA 4TKSA 2I0YA 2WTDA 2HOGA 4AW2A 1Y91A 4ITHA 2OO8X 3QAME 4IM2A 2O5KA 5CSHA 5FEQA 5GHVA 4EWQA 2XK7A 1W98A 4FKJA 2I40A 4BY9E 2BHHA 2JFMA 3DKFA 2RFEA 3NUNA 3A7GA 1JQHA 5DG5A 2R0IA 2YIXA 1XH9A 3KY2A 4D2RA 1UKIA 5CU4A 3CC6A 3E7VA 4XOZA 3EH9A 5HIBA 3VQHA 3HLLA 4YPDA 2UZEA 1BMKA 2YCQA 4DA5A 4EZ7A 3QCYA 3ORXA 4F0GA 4LI5A 2JITA 3BBTB 5GIOE 3AXWA 3D5VA 4U80A 4S2ZA 1G8AA 2VTRA 2CKQA 5C8NA 2CHLA 3ZDIA 4FVQA 4ZTSA 4IE9A 3C1XA 3PJ1A 3Q4CA 4JG7A 2OLCA 2PZPA 3U9CA 4MBJA 3KRXA 3T9IA 3DV3A 4WIHA 2C3JA 4BDFA 2J6MA 4X21A 5BYYA 3ID6C 3BLHA 3F82A 3OW3A 3JYAA 2W96B 5D1JA 4J8MA 4ZSEA 4LOOA 2UVYA 4FIGA 4L44A 3NNUA 1ZYJA 4QP9A 5CI6A 1K2PA 3VBWA 5JRQA 4FTKA 3E93A 4RSSA 2QONA 4C34A 5HKMA 4FTOA 3IO7A 2G2FA 1WVWA 3BU3A 4PX6A 5GZ8A 5HD7A 1CKIA 2VTTA 4JBPA 4DGNA 1GZNA 1OUYA 4F6WA 2WMAA 5I9XA 3QBNA 4OBQA 2XJ0A 3IDCA 1S9JA 3R63A 4OW8A 4C33A 3RTPA 4A9TA 2G9XA 1WAKA 4QMMA 4V01A 1M2QA 4IHPA 1W0XC 5C8MA 3QD3A 4CMTA 4DCAA 2UW3A 4NM0A 2CKOA 2W1EA 3PXFA 4XX9A 3EN9A 1HCKA 3SD0A 3C7QA 2IZUA 1JWHA 3OTUA 3PLSA 4HZSA 1KUTA 4FG8A 4XV3A 5FTQA 4PMPA 4TYEA 3SG8A 2YLFA 4G16A 4P4CA 4R8QA 5AM6A 3SRVA 4WNKA 3DJ5A 4NCTA 4Y72A 4O0RA 4MXZA 3UP2A 3V51A 5M4UA 3R83A 1H27A 2RFNA 2RG6A 3MPMA 5KZ0A 5ITAA 1KWPA 3FZSA 3EHAA 5CANA 2XK4A 3RPYA 3DJ6A 4JT3A 4KWPA 3UYSA 3PP1A 3UDBA 5IA0A 3DQWA 1NA7A 4YUQA 5KBRA 3KMUA 4C37A 2GS7A 4M69B 3QC4A 3WZDA 4D2TA 4M69A 3ENMA 3HMMA 5FM3A 3OCTA 5G6VA 3RPVA 4K18A 4FEVA 1H01A 3O17A 3PVBA 4O38A 3II5A 4AU8A 2W99B 2WOTA 4FT7A 4WNMA 2VNWA 2VTLA 4BR3A 4EBVA 3EQRA 4N70A 3DT1A 2W5AA 3CTQA 3I1AA 2EU9A 3ORZA 4IH8A 4D9TA 1ZYDA 2HAKA 5DLSA 5GJDA 5HESA 1XH6A 1H1WA 1SNUA 1LPUA 3ANQA 4G9CA 5B2LA 4NSTA 1H8FA 2CGWA 2X2KA 3G0FA 3Q9YA 4AUAA 5LMKC 3OZ6A 2XNGA 2WZJA 4FI1A 1H07A 2J90A 4IMYA 4Y46A 1H08A 3O2MA 4N57A 3NUXA 4S32A 1FVVA 2C0OA 2B9FA 2W4OA 2GU8A 3GU4A 3IK3A 2XK3A 3FPQA 4F9CA 5IA1A 1KOBA 2R64A 3TKHA 4YZCA 3ACJA 3CQEA 4PY1A 3LIJA 4WHZA 2PZRA 2QHNA 4O0SA 5DRBA 4B8LA 4FTQA 1JPAA 2P4IA 2IN6A 4FODA 1CKJA 4BTMA 3AC1A 2XNPA 3FLNC 3FKNA 4DH1A 4DC2A 4L46A 4QP7A 1FMKA 4E6CA 5BQ0A 3ORTA 4C7TA 2E9NA 4KB8A 4X3FB 3JXWA 3CCNA 3BHYA 5K5NA 4AGWA 4NH1A 4PV0A 5HI2A 4RA4A 1O6KA 3FSKA 5AA8A 3R9DA 3UODA 2J9MA 1OVEA 2BCJA 4H3QA 2GNHA 4NUSA 4XV1A 4ASZA 1Q8UA 1B6CB 2R3HA 2PVNA 1GIJA 4KKHA 3QZGA 4RJ8A 4YLJA 5CENA 4BDHA 4ERKA 2YJSA 3SOCA 4D1ZA 4C4HA 1Q99A 3QWKA 1IR3A 2VN9A 3FC1X 2JKQA 4U97A 3W55A 3ZFYA 5ANOA 5JZJA 4ZJJA 3RAHA 3BBWA 4I5HA 3DBDA 4APCA 5EH0A 4YGAA 3NZ0A 2CMWA 2XCHA 4IWQA 4EZ3A 2Y8OA 4FIIA 4QMUA 2EXCX 3MY5A 1LEZA 2QNJA 4C4EA 2KULA 4AN9A 3LM5A 4CKJA 3QUPA 1PXPA 3MYGA 1OL6A 4ZSAA 1H28A 5CYIA 4X2JA 5T3QA 2CN8A 2J5EA 5HO8A 3UQGA 2C6OA 3P23A 2CGVA 3GUBA 2GPHA 3BYSA 4YPSA 3QTUA 5HNBA 3ULIA 5F94A 3QTXA 4OTPA 3OMVA 1YWRA 4O86A 1YOLA 3QLFA 4RIXB 4IJPA 4QYEA 4ENYA 3FI2A 3BKBA 5IMEA 1H25A 4C2VA 3R9RA 3TJDA 5HIDA 2PUIA 3OTVA 5L2WA 4TWOA 1DI8A 4ZTHA 3PWDA 5HNIX 4CG9A 4EOOA 5HTBA 1XWSA 4C57A 3NW5A 4XG9A 1ZAOA 4DH7A 5FRIA 1IG1A 4CT2A 4LGHA 5DEYA 1V0PA 5GNKA 2FB8A 4CFFA 2R2PA 3I6WA 4IVBA 4MKCA 3FE3A 5BMMA 3LQ3A 3TWJA 2WTJA 2VTSA 3DBFA 3GB2A 4PP9A 4NCTC 1IEPA 4CFWA 2C5YA 4YTCA 3EN4A 3PXZA 4FKOA 4C38A 2VTOA 2CLXA 2JKKA 5HE0A 4BB4A 4NJ3A 3KN5A 2F2CB 4CG8A 4KA3A 3AGMA 4AZSA 2UZWE 3SHEA 1ZYSA 4D1XA 3W2QA 2WMQA 3NUUA 5BX0A 2OIBA 5ANEA 5LMAA 5M55A 2VGOA 3ZU7A 3L9LA 5AP4A 1UU3A 3N4UA 3PJ2A 2F57A 3QWJA 3DKGA 4CQGA 4XV9A 2XIZA 3OG7A 4D58A 4EJ7A 2X8EA 2YZAA 4OT6A 4QP6A 4JQ7A 4TNDA 1YOJA 2BDJA 3G6GA 5CT7A 4D2SA 2G15A 4GMYA 3P7CA 2PU8A 5IF1A 4JVGA 2XNOA 5AR4A 2R3KA 3EFJA 4Y8DA 5JZNA 4BDJA 5AA9A 4E3CA 1IA8A 4F64A 3P79A 1LEWA 3EQHA 4MD7E 1YVJA 1LUFA 4NT4A 5DEWA 5ANJA 4IAFA 5EOLA 5JGAA 4PMSA 4JLCA 4YHTA 5E8XA 3E8CA 2XJ2A 2PMIA 3PIYA 3UBDA 3ODYX 3MB7A 4QP4A 5I9WA 5AJQA 3VS5A 4CQEA 4ENXA 3G5DA 4D5KA 4ZLYA 3R2BA 3DPKA 3TZMA 5H8GA 2R3IA 2R3JA 1T45A 3CE3A 4BWPA 4Z7HA 5CF6A 5CEKA 3W10A 3PSCA 5FQDC 4IWOA 5CEQA 3H30A 3M42A 1I09A 4CFNA 3OXIA 3AC4A 4IAAA 4XJ0A 3ZCLA 4AE6A 4W8EA 1OPKA 1BX6A 5FBOA 4RLLA 3QZIA 5LCKA 3QLGA 5ANIA 5ETIA 3F7ZA 3KVXA 3W32A 4B8MA 2XEYA 5KX8A 1JNKA 3L8XA 3VS6A 4EJNA 3ZC5A 2BZHB 2JDOA 2XNBA 4C02A 5D41A 4M68A 4L00A 3ZSIA 1PXLA 5CVHA 4ZZOA 2CJMA 5D11A 4FIHA 2VTJA 1TQPA 4FKQA 1ZLTA 4FTLA 4PPAA 4ANSA 5JFVA 2PMNX 4F0IA 5I3OA 4HYHA 3HV4A 2CCIA 2OJGA 4L8MA 1MRVA 1PY5A 4QTAA 1F3MC 4IW0A 3E8NA 3JY9A 3VUTA 3WYYA 4NYEA 2X6DA 5J9ZA 2ERZE 3EL7A 2WKMA 3OWPA 3ZZWA 4LV5A 4ANMA 4FSQA 4KS8A 4XG4A 5IQFA 4FK3A 2PVKA 3U51A 5IH5A 3HRFA 3NPCA 3Q53A 4XHKB 3UNKA 1G5SA 3LCDA 2WMBA 3LJ1A 1M14A 1OECA 4IAIA 4A4OA 2BPMA 3C0GA 3F88A 1M2RA 3ZC6A 3S00A 4QQ5A 3MH2A 3HV5A 1PYEA 3N4VA 2QCSA 3NVMB 3EQDA 1F0QA 3R04A 3OF0A 4BCIA 5K4JA 3H0YA 4G3DA 4YZBA 4YTIA 4JL9A 1PRYA 5HO6A 3ZO4A 4UN0C 4BHNA 1MQ4A 3HUCA 5KKRC 3NYOA 3RZBA 3VQUA 5F95A 5LOHA 1OM1A 4EZ5A 5FTGA 1FINA 1BLXA 5CU2A 4DEDA 1RQQA 4YBJA 4O1OA 3QRKA 4RX7A 5ANGA 5A6OA 3PXKA 4TWPA 3FYJX 3Q4TA 1UKHA 4IADA 4TT7A 3FSFA 4USEA 5IEYA 3BGPA 1V0BA 3EQBA 5IISA 3LQ8A 4RJ3A 5FXRA 5E8VA 3LFNA 5HZNA 5IUHA 5EHOA 4F7JA 4L7SA 4BIDA 5A4CA 4FOCA 5M4FA 4YJVA 4AOJA 3KRLA 3EKKA 3D2IA 2GNIA 4I41A 4M7IA 2X9FA 5TF9A 3W33A 4CZUA 1OBGA 4FSUA 1KOAA 4YJUA 5DVRA 5CQWA 2WEVA 2CNVA 1V0OA 3AT4A 4CV9A 1M17A 3WZJA 4AX8A 3HA6A 1H4LA 4JX3A 4O7VA 4NL0A 3HX4A 4FSNA 2RF9A 4OGRA 4DINA 3Q6UA 1PJKA 1XBBA 4DLJA 2V55A 4RWKA 4CFUA 3S95A 4EKKA 1SVHA 1YHWA 2X81A 3QHRA 3HP5A 2Y0AA 3V04A 4DEHA 5IMXA 4IZ7A 2JIIA 1J1BA 2X2LA 5D7AA 4KIPA 2HZ4A 4BDEA 3DQXA 5H9BA 1H26A 1WBSA 3E62A 4FKRA 2HZNA 1PMNA 2YEXA 4BFMA 4IX3A 3HL7A 4WBBB 4ZY5A 3PPJA 1U5QA 3EOCA 4ZOGA 5EW3A 5KE0A 4EQCA 5HBEA 2C69A 3BCEA 4XG6A 3TI1A 2C6LA 3MGYA 4YC6A 4QPSA 3TNPC 4GK3A 3VHEA 4RIYA 4O2PA 3R7IA 3LCKA 4GU6A 2FH9A 2BKZA 2OGVA 2BAQA 2XF0A 1WVYA 5AX3A 4ASXA 5KMLA 5IH6A 1UA2A 5FTOA 3CR0A 3D7ZA 1QMZA 4MXAA 3OT3A 5DRDA 3QZHA 5L6WL 4IIRA 4FTUA 3TUBA 4GCJA 4YC3A 4NM7A 4E5AX 3IDPA 5M53A 1CMKE 3DJ7A 2J0KA 4J1RA 4L6QA 2ACXA 4ORKA 2P33A 4KBCA 3OXZA 3EQCA 3R7YA 3IONA 3LXPA 3O7LB 4HW7A 3SOAA 5M07A 1GIHA 3OCBA 4XNEA 3BHUA 3UJGA 5HU3A 2VWBA 3LLAA 4BWKA 5ICPA 2ITZA 3UNZA 3FYKX 4EH5A 2WMTA 5DR9A 3VUHA 5LMBA 4U0IA 2Y4IB 5M4IA 1H0WA 4YHFA 4C36A 5KMNA 2BFXA 3QQKA 5FM2A 2XIRA 3ZM9A 2QO9A 3JVSA 2ZMCA 3KRJA 5E90A 4Z16A 2R3OA 5CAOA 3A4OX 3LW0A 1H1SA 4CFVA 2UW4A 4DBNA 2QR8A 3DNEA 4H58A 3DK7A 4P7EA 4PP7A 2OI4X 3AMBA 5HLPA 5D12A 5E1EA 2YERA 2VV9A 4MQ1A 4UV0A 4PDPA 5GJGA 2EB3A 4AOTA 5LVMA 1H0VA 3ZRMA 4KAOA 2XYNA 5A3XA 3QC9A 3DAJA 5JKGA 3TNIA 3DDQA 5TO8A 1YHSA 2QOFA 1JKSA 3A7HA 3GI3A 4G3CA 4PPBA 3SV0A 3O8UA 1BL7A 3C51A 1PXOA 4RPVA 4BTFA 3BYUA 4QQJA 3MIYA 3R1SA 4O0XA 4NWMA 2UZNA 4ZTMA 4O0VA 3FMJA 1Q62A 3R8VA 5EM6A 1FGKA 3FZRA 2ITVA 3F3ZA 4YZMA 3IW5A
chains in the Genus database with same CATH superfamily
2PY3A 3E8DA 4MQ2A 3V01A 3ZYAA 2BDWA 1YDTE 2E9OA 5EM5A 3SGCA 3KKVA 4QTEA 1MP8A 3GCVA 2R4BA 2JGZA 4EUUA 3RGFA 5J1WA 3NFGB 3VF9A 5LWNA 2Y7JA 3OP5A 4H1MA 3R28A 4FVPA 4TNBA 4E4XA 5I3RA 2XRWA 3UIBA 3HV7A 4O0UA 3UVQA 1OIYA 2WTVA 3KGAA 4R7HA 3V8TA 3R9HA 3NW7A 5JFSA 3FHRA 3EZVA 3EN6A 3F3VA 4FZ7A 4M8TA 4TW9A 5AAFA 3BWFA 1L3RE 3RNYA 3WF9A 4F9WA 4DTAA 2XM8A 3FAAA 3G33A 5AV3A 3Q52A 2I0HA 4CKIA 3WARA 2J7TA 3MVHA 4JBQA 3FKLA 2OF2A 3GU8A 3FI4A 4G1WA 4JS8A 4E73A 4ZAUA 1Q4LA 5CF4A 5L3AA 3KREA 4P2KA 4LM5A 4RVLA 4BZNA 3L1SA 4C3FA 4FV7A 4MUQA 4O4DA 4GJ3A 4J99A 4QMSA 5AV1A 5TOZA 2R3QA 4QMPA 1JAMA 1SYKA 3GQLA 2RFSA 2ZAZA 4WUAA 1TKIA 3CPBA 4DHIB 3EFWA 3NVKI 2UUEA 3FZTA 5BMSA 3QF9A 3AC5A 4E1ZA 3CY2A 3RAWA 3QTSA 5BVNA 2G1TA 2E2BA 1KE7A 4XG3A 4D2WA 4Q9SA 1BUHA 4BBMA 2PE1A 1BI7A 4FT0A 4DEAA 2IVSA 2ZOQA 3FBVA 2WPAA 1W82A 3QCQA 4EK6A 5C26A 4I23A 3BQRA 5A6NA 3C4ZA 3I7CA 2VUWA 3FL4A 3JUHA 4M67A 4WBOA 2XALA 4WA9A 3MV5A 3F3UA 4G9RA 2XK8A 3TZ8A 4A7CA 4L43A 5AAEA 4N6YA 4U3ZA 4GKIA 1HCLA 1H1QA 4XEYA 2WTKC 4FTAA 4CMOA 3G90X 3UO4A 4GUBA 4EHGA 3HECA 2NYAA 4IVCA 2B9HA 4O7WA 3D7TB 3THBA 3P0MA 3TTJA 2JIVA 3NNVA 3V8WA 2ZDUA 2PHKA 1KV2A 1Q5KA 4F09A 4TYJA 4H3BA 4NEUA 4EONA 3UOLA 3AKJA 4AFJA 1XH8A 4XP2A 3HAVA 3UDTA 4WRGA 2PTKA 4J96A 4O82A 1M7NA 4DEEA 4V0GA 3G9NA 3PZHA 1FMOE 3CTHA 4MNEB 2HY81 3E64A 3NIEA 3LVPA 3TIZA 1WBVA 2PSQA 3A7IA 3W0SA 4GUEA 5EDQA 4D0WA 1Q24A 3CPCA 3U6IA 3GCQA 4GIIA 1VJYA 3UDSA 4RZVA 5EM7A 4F9AA 2X1NA 3TNWA 3CP9A 1UVRA 2AC5A 3LFBA 3VVHA 4DLIA 3Q60A 3PFYA 4DT8A 5CEPA 4NKAA 3LMIA 2Q0NA 2ZM3A 3RI1A 1DAYA 1GZKA 1S9IA 4FUYA 3D5WA 5HCYA 1MUOA 2XMYA 3KXXA 4HZRA 3NAXA 4IFCA 4JDKA 1E1VA 4O4FA 3I81A 3FQSA 5AADA 4MXCA 3QALE 2QR7A 5KHXA 3ET7A 5E9EA 4UX9A 2QOKA 2NP8A 4LL5A 4BYIA 3I6UA 2R5TA 4UWCA 3TACA 1XBCA 4PUZA 4FBXA 4XG7A 2XZSA 4KIQA 2HXQA 1URWA 4EWHA 3Q96A 4Y73A 5CEOA 1OGUA 4QP2A 4O27B 4F7SA 3CEKA 4KNBA 3T9TA 3HV3A 3KRWA 5DGZA 1RJBA 5I5ZA 4W4YA 2JD5A 5JFXA 4CMUA 2YWVA 3P08A 3GU6A 3QD0A 3ANRA 2YISA 4JMQA 4X6RA 2PYWA 2VO3A 4HGEA 4XS2A 4FV9A 3QRUA 4D4SA 4B99A 3PY1A 3R1NA 5E8YA 3ZLYA 1OBDA 4AZEA 2IVTA 4RGJA 4AF3A 2GHMA 4FG9A 1CTPE 4AA4A 3S3IA 5CY3A 5AIRA 2BROA 4EHEA 2PL0A 3EYHA 2I0EA 1OI9A 2YAKA 4JIAA 3U87A 2BALA 4U40A 4QPMA 4DFXE 1GAGA 1RDQE 4G5JA 3NS9A 5EOBA 3D0EA 2ZV9A 3PIZA 4MX9A 3L8SA 3PY0A 3RAKA 2FA2A 3E7OA 4RWJA 3UZPA 2X7FA 3RK9A 4AQKA 3JY0A 3TZ7A 4OUCA 3CD8A 2C3IB 4LMNA 3NIZA 3GGFA 3BIZA 3LE6A 2O3PA 5DR6A 2FVDA 2VRXA 5CWZA 5EI8A 2OXDA 4QQCA 2OICA 4NKSA 4PL4A 4RC3A 4FSWA 4YTHA 5KZIA 2ONLA 5CVGA 1J3HA 4PQNA 2C6EA 2DUVA 1YQJA 2ERKA 4F7NA 5K5XA 3LFEA 3G51A 3MB6A 3SC1A 3DXPA 1UWHA 1WFCA 1XQZA 4X2NA 3PA5A 2W9ZB 2VWYA 4TTHB 5CSPA 1WBPA 5IU2A 2YM6A 4DCEA 5TR6A 2OFVA 3CLYA 4Q5EA 3QQHA 2R0UA 3IG7A 3QYWA 3R1YA 4FL2A 4YLLA 4BDIA 4G6LA 2FSTX 3LAUA 3E87A 2FSOX 1DS5A 2QKRA 3MH0A 3O71A 2BFYA 1Q8ZA 2W1CA 1F5QA 1Y6BA 2ZV2A 3DLSA 3H9FA 3P5JC 3QCSA 5M51A 5C8KA 1URCA 3LPBA 4U43A 4CLIA 4O96A 1QPEA 3TM0A 1E1XA 3PG3A 4TN6A 5FXSA 4RJ5A 2ETMA 5JQ5A 4YJSA 4BCPA 1SZMA 3KVWA 5C9CA 4AE9A 2WMRA 2W1GA 2VWVA 5D7VA 4BDGA 2I1MA 3H9OA 4NIFA 1FVTA 3VBYA 4BCNA 4C4IA 3UNJA 2H96A 3S0OA 3ZOSA 3FI8A 4L9IA 4CZTA 3UMXA 3LXKA 4AN2A 3NUAA 2Z7RA 3V3VA 4EC8A 2Z60A 3UZRA 5E1SA 3ATSA 4BCHA 5CASA 3F5UA 5KMMA 5A4QA 1XJDA 2C5NA 4TWCA 5E8TA 5HX6A 4M3QA 3Q4UA 3U4UA 2VTPA 4E26A 1YDRE 1RW8A 2PMOX 5C1QB 3PSBA 3KEXA 5DR2A 3F69A 4MXXA 3NFFB 3MH1A 3QTZA 3TYKA 4FEWA 4M13A 4H39A 5ACBC 2BIKB 4AXEA 5E8WA 4O7RA 4HYUA 5IDPA 2B52A 3AQVA 3FL5A 4FKLA 1OPLA 1U46A 5CAPA 3QTWA 4FTRA 4B6LA 3VUIA 3QQFA 3HGKA 4JBOA 2QODA 2XEZA 2XBAA 3UIXA 3ZH8A 3QKKA 2X8DA 3SX9A 4AA0A 4CXAA 4HGLA 4FE2A 4Y95A 4BBEA 5CU0A 1NW1A 5M06A 3ITZA 3G2FA 3OWKA 4BDAA 4X7QA 4FKWA 4GK2A 3VUGA 2YHVA 3FMNA 3CS9A 5IA4A 4O7TA 4E4LA 5AAGA 3R21A 5BYLA 4K11A 4LRMA 4JRVA 5LXMA 3DXQA 4JQEA 5B2KA 3VBTA 4UY9A 4O22A 3VRYA 2C30A 5JT2A 5DT3A 2VWWA 4ZJIA 3RPOA 3VBXA 2EB2A 3KXNA 4NJDA 2PMLX 4CV8A 2P2IA 2XIXA 5CLPA 2PK9A 5I9YA 4ZIMA 1P4OA 1OZ1A 3QRTA 4AN3A 4EEVA 3AC2A 3GOPA 3PUFC 4F78A 4IVDA 4FKSA 3GC0A 4YJTA 5CXZA 4A9SA 2BR1A 5AFVA 1YI6A 5L6OA 4PMMA 2W9FB 4EH6A 2WNTA 5CZHA 3ZLXA 2UW8A 3JPVA 3R00A 3CKWA 5EG3A 3TV4A 3WZUA 3L9MA 3MW1A 4WSYA 2DYLA 4LUDA 3RMFA 3ZUTA 5EQEA 1JSVA 2CGXA 4OTRA 4AQCA 1GY3A 2F2UA 2YDKA 3DKCA 5IH4A 5JSMA 4JQ8A 4EHVA 4L45A 4BDCA 4C62A 3TT0A 2YCRA 2OH4A 4FKVA 3DCVA 4J95A 4AWIA 4MHAA 3UZTA 2O63A 2XA4A 3MBLA 2KTYA 4FV8A 4P5ZA 3T8OA 2J4ZA 2YCFA 4O0TA 5I9UA 3RHXA 3VS7A 4YJQA 3ZUVA 3UC3A 2B0QA 1OIQA 5HE2A 3F3TA 1VYZA 1R39A 4FYNA 3TUDA 2ITNA 4DE4A 3S2PA 1UNGA 3OCGA 2C6MA 5HG8A 3W1FA 4FT5A 5DFPA 2IPXA 3PDTA 4DGGA 3TTIA 4ZLOA 5L6PA 3UQFA 5IQEA 3VS0A 4E4MA 3ZS5A 4QTCA 4QMXA 4U44A 4JI9A 3OWLA 4IAYA 4KKGA 5CF8A 3O96A 4IDVA 4TY1A 5J79A 2PVHA 4PNKA 3DGKA 2XP2A 2C68A 4I6FA 4QMVA 4EK4A 1GNGA 5EYDA 3MFRA 4BGGA 2ZMDA 3SRVB 4O7LA 4AW5A 3ZSGA 2R3RA 3O23A 4U45A 2JKOA 3R71A 5F4NA 4EH9A 1OUKA 3R02A 4NTSA 3TL8A 2W5BA 4O7SA 1Q41A 4QMQA 2UW6A 2IW8A 3PWYA 3KMWA 1AQ1A 3AGLA 2CLQA 3KRRA 2QURA 5AP2A 4CFXA 3ZZEA 3R7UA 3VNTA 4JXFA 1KV1A 3IOPA 4FL3A 3FLQA 3K2LA 4ZP5A 2XBJA 3FZPA 3NYNA 4JAJA 3CGFA 4FV6A 4QMZA 4JG6A 3TV7A 2W1ZA 1DM2A 2FSLX 2PVMA 3F61A 4HCVA 4W9XA 4D2PA 3ZXTA 4ANLA 4A9UA 1I44A 3SXFA 4EOPA 4QDEA 3AC3A 3BEGA 3BPRA 1W2FA 4IQ6A 5EW8A 3K5UA 4A9YA 5FGKA 1W8CA 1H24A 4TYIA 2GSFA 3OD6X 3PSDA 4FTNA 5J5TA 2XJ1A 3R30A 4G3GA 2HIWA 1PMEA 5LMKA 4BCGA 1UWJA 4Z55A 4JAIA 3ALOA 5JMSA 4EQMA 4ANBA 4IFGA 2UZTA 2WD1A 4DG3E 5E91A 4YC8A 4EOKA 3RPSA 2W1DA 4JIKA 4IZAA 3FMMA 5C01A 2Z7QA 4GEOA 5CAQA 3MIAA 4J52A 3FMKA 4K1BA 4I1ZA 4PMTA 4USDA 4Z9LA 3ZBFA 2I0VA 3BQCA 2P3GX 1M52A 4II5A 4RC4A 3MDYA 5AP1A 4UB7A 2XH5A 3HMNA 3E63A 3EIDA 4FKGA 2DQ7X 3OUNB 2QOOA 3QHWA 4YSMA 3SKCA 3EFKA 4BBFA 1BKXA 2OJJA 3WYXA 4NZWB 4OTHA 3A60A 3RPRA 3FMLA 3ZFXA 3L9NA 4G3EA 3PUPA 4ACGA 2OG8A 4DYMA 3BLQA 4EORA 3EYGA 1RE8A 2WEIA 3VN9A 4EK3A 3QTIA 3ETAA 3O8PA 4L42A 4RVTA 4O91A 2X7OA 3BEAA 2OZAB 4BZOA 3MPTA 1QPDA 4I92A 4GT4A 4HNFA 3DS6A 3GU7A 1VZOA 2V5QA 3KULB 3MA6A 1OL2A 5DBXA 5LARA 4E8AA 5M56A 3VBVA 4BCFA 2Z2WA 1SMHA 2B7AA 2OIDA 3V5TA 1NY3A 1UNHA 5IQIA 3AT3A 4O6LA 1NT2A 1H00A 1SM2A 4QD6A 4FGRA 2XKEA 4YJPA 1DAWA 2B9JA 4AZVA 4ID7A 3WF8A 1ZWSA 3FLZA 3QXPA 3ODZX 2FYSA 2WMUA 4MCVA 2XNMA 4MD8E 4DGMA 3FHIA 2A0CX 2J51A 1XBAA 1O6LA 2BUJA 2PWLA 4RIWA 4UWYA 4KKEA 4V05A 3D7TA 1G8KA 4OTFA 4R5YA 4GYIA 2QOIA 5BVFA 1BYGA 3TUCA 4GFMA 5DI1A 2BRMA 3NCGA 5EDRA 4IM0A 4QMLA 3ALNA 2QOBA 5HNGA 3O51A 5LCJA 2JDTA 3DBEA 3P86A 3ZXZA 2H34A 3DKOA 2Z8CA 4FMQA 4V0GB 4AAYA 3IKAA 2BZIB 2OIQA 4YO6A 4AFEA 4E4NA 3F9NA 2AUHA 2H9VA 4RX8A 5A4TA 3FKOA 1P4FA 2Q83A 1P14A 3F2RA 3CXWA 3G15A 4QP3A 1UNLA 1QL6A 4RRVA 3BGZA 2QU6A 5AP6A 2BAKA 4BRXA 3VS2A 4HJOA 2GCDA 1XO2B 5HG7A 4AZTA 4QTDA 3KIOC 5AM7A 4BHZA 4OBPA 4U41A 3GFEA 3WILA 3GVUA 1P5EA 3NUSA 4J53A 4WT6A 3COMA 4E20A 5HEZA 3PY3A 5FBNC 3D2KA 4O81A 2Y6MA 3FDNA 2W4JA 2BTRA 3LCOA 4JJRA 2A2AA 2BILB 2WAJA 4ACHA 5JRSA 3NX8A 5EK7A 5IEVA 2YM5A 4UXLA 4HVHA 2ZFYA 4FV5A 4PDOA 3QU0A 2WELA 2ZM1A 5EW9A 5AV2A 4Y5QA 3V6RA 4DTKA 2J5FA 1PXJA 3GC9A 3WF6A 3FLWA 3MWUA 5CALA 3PXRA 4N4SA 5AMNA 3RP9A 2WU6A 4UMQA 4E6QA 1VEBA 2C0IA 1IRKA 4O6EA 4FIEA 3HKOA 3WIGA 4YSJA 2X0OA 4IZ5A 4JRNA 3EQIA 3WIKA 5LVNA 3BHVA 4J8NA 3IW6A 2PUNA 3IW8A 3PTGA 3UG1A 2OJ9A 2VWIA 3C4EA 1WBWA 5IG1A 3PYYA 4FK6A 5CU3A 3CQWA 3LCTA 3LMHA 4HCTA 3AD5A 5KMKA 2XCKA 4XYFA 1JKKA 2YAAA 3MVMA 3RBWA 2W4KA 1XKKA 3LQ5A 2YM8A 3EQPA 3QZFA 5DA3A 3QGWA 3DAKA 3DBQA 1CSNA 4GS6A 3AKLA 2J2IB 1L8TA 4M14A 4TYHA 5M57A 1XMMA 3ZM4A 2PZIA 2CPKE 4FV1A 4I4EA 2QI8A 4I22A 3UOHA 5I9ZA 3IDBA 4D9UA 4QTBA 4F0FA 1R0EA 3F3WA 3IW4A 3NEWA 1ZMUA 3DZOA 3K3JA 2R3PA 4LGGA 4C61A 1OKYA 4CD0A 3UOJA 4NTTA 2QQ7A 3D14A 4RFYA 3OOMA 1JVPP 3HZTA 2IW9A 5A4LA 1W7HA 1XHAA 2JAMA 2P55A 2JDVA 3ORLA 3V5QA 2VX0A 4QMNA 3N4TA 3UO5A 4DFBA 3DOGA 4ACCA 4KIOA 4PNIA 3NWWA 4GT5A 2A19B 2GTMA 3TCPA 1SVGA 1OKVA 4J98A 2CCHA 3HYHA 4FR4A 4TYGA 3ZUUA 4KUJA 4I3ZA 3TKIA 1J7IA 3I7BA 3QD2B 5H8EA 3PZEA 4J71A 5DIAA 1K3AA 2VD5A 4JX7A 4K0YA 4M0YA 2AEGA 2Z7LA 4EYJA 5FDPA 3Q9WA 3PVUA 3MH3A 4FNZA 4QYYA 1OB3A 4FC0A 4FSMA 3F66A 1UU7A 4L68A 5J95A 4BYJA 4BI0A 3QL8A 4O4CA 3LM0A 4QO9A 5L8KA 3PXYA 5ETFA 4AT4A 5HG5A 3LFDA 4DEBA 2RSVA 4JR7A 5B7VA 4AXFA 4RWIA 2WIPA 4EQUA 4FKUA 4NIFB 3NDMA 4UXQA 5JEBA 4TPTA 4OTQA 3GQIA 1ZYCA 3F6XA 5FG8A 3FMDA 1YHVA 1TVOA 3R01A 3W2RA 4F65A 1IAJA 3NGAA 4BN1A 1G8SA 3OY3A 4IAKA 1PHKA 5FD2A 4GVJA 4YLKA 3LZBA 4YZNA 2C4GA 3ORKA 1IAHA 2CNUA 4NM3A 2O65A 2HELA 3BHHA 3OEZA 4FX3A 3D4QA 4EUTA 4ZJVA 3TDVA 3RM7A 2E9UA 4EOLA 1GZ8A 1YDSE 1SVEA 1Z5MA 2H8HA 4WG3A 4F1MA 3MS9A 2GS6A 4Q5HA 4IBMA 3HVCA 2OF4A 4RVKA 5DPVA 3Q3BA 3CQUA 1NXKA 2RGPA 4N0SA 2WO6A 2OFUA 5CF5A 2VTQA 3KF7A 1YWVA 4BVUA 2F7EE 3PXQA 4AS0A 2X9EA 5L2SA 4N6ZA 2YN8A 3L8VA 1ZOEA 4YU2A 3D15A 1CM8A 3RWPA 1WBOA 4A4XA 2G2HA 4RG0A 4XG8A 4QMOA 3LOKA 4LMUA 4C3RA 4UALA 4AGCA 4I0RA 2NRYA 2WTWA 2JIUA 2VTHA 3MESA 3BE2A 4KBAA 4X2GA 5AR3A 4BTKA 3H4JA 3MPAA 3OBGA 2XKFA 4YJRA 4DFZE 3QCXA 1CDKA 5HLNA 4WOVA 4XCUA 3ZO2A 2R3LA 3U9NA 2VX3A 4AZWA 3CD3A 4PDSA 2PVJA 2HYYA 4GU9A 4KINA 1XH7A 4I0SA 4IVAA 1DI9A 5FDXA 2Y4PA 2QU5A 3FI3A 4MBLA 5T6KA 4DN5A 3R1QA 4QQTA 3POZA 3GENA 2UV2A 3OROA 2V0DA 5CU6A 3I60A 3U6JA 3UDZA 2ITPA 5DT0A 4C8BA 4E5WA 4J97A 4PPCA 5KHWA 4DF3A 4CGAA 4C4JA 4NFNA 5AWMA 3WF5A 1BL6A 4RIOA 4FNWA 3RM6A 2OJFE 3P9JA 3I79A 4DGLC 4R5SA 2J50A 2IVUA 1GZOA 3NNXA 3NR9A 3Q5IA 2XYUA 2A1AB 3DK6A 5HE3A 4CRLA 4WD5A 5HE1A 5HIEA 1FGIA 1A9UA 4RQKA 3DDPA 4FICA 3BU6A 4FTIA 3S4QA 4USFA 4FKIA 4BGQA 1O9UA 5E8SA 5GZAA 1W2DA 2VTAA 4XH6A 4I20A 1J7UA 1YKRA 2V62A 3NYVA 3Q4ZA 4XP0A 1PXMA 2YM3A 4RJ4A 5IA5A 2PVRA 4D0XA 4QRCA 3ZBXA 2C1BA 3GCUA 3VWAA 5CNNA 3QQLA 3D94A 3BGQA 4ONAA 4UMTA 4B0GA 3F7WA 1TFFA 1Y8YA 2EUFB 3IPHA 2AYPA 1Q8TA 2WQMA 5C27A 2FUMA 2F9GA 5CAVA 3MFSA 1REJA 3QQJA 4X2FA 2BRBA 4EH4A 4LGDA 2XARA 3DFAA 4YNOA 2JKMA 2XRUA 4F4PA 5EQYA 3TG1A 3R8PA 1Q8WA 3BV3A 3GT8A 1O6YA 3O7LD 3POOA 5HG9A 4D1SA 3G0EA 3IGGA 2XKDA 4EYMA 5L8LA 4CNHA 3W0QA 5LVOA 5IQHA 3BYOA 2OXXA 4OTDA 1M2PA 3L9PA 4EOMA 2WMVA 1AD5A 3E3PA 2BMCA 4UYAA 5EDPA 2V7OA 3DTCA 3LHJA 3DNDA 4MK0A 4AZFA 4BZDA 2ZM4A 3ZRLA 3NW6A 3VJNA 4HVGA 5CAUA 4A07A 2ZV8A 3RAIA 3BYVA 5AUZA 3ZFMA 5ANKA 3M2WA 4IZYA 3FUPA 2EXEA 5K9IA 3I5ZA 4W8DA 4I5MA 4OBOA 4GKHA 3KC3A 1XR1A 5A54A 2BKKA 4YZDA 2XK9A 3Q9XA 4BDBA 3GXLA 2Z02A 3QXOA 2XK6A 3HA8A 4EI4A 4I4FA 4FEXA 3SXSA 4YR8A 4BI2A 5HVKA 2ZB1A 4HNIA 2B53A 3LJ2A 4QMYA 5IUIA 2O64A 2WFYA 3QKLA 4GT3A 4DFNA 2R3FA 3OWJA 3QX2A 4HVSA 3QFVA 2C6KA 1OL7A 2YM4A 5L8JA 3PJ3A 1STCE 3VUDA 4ZLZA 4QYFA 4FNYA 4RIYB 4DFLA 3E5AA 5BYZA 5TKDA 3MJ2A 4BDKA 2GDOA 4UWBA 4K77A 1ZZ2A 4D4VA 4FEQA 4TXCA 3QTQA 3FPMA 2EVAA 3Q5ZA 2RFDA 1B38A 1U54A 4ALUA 4F1TA 5IUGA 3U55A 2ZB0A 1U54B 4XBUA 3WE8A 4GFOA 4TL0A 3HV6A 4EKLA 4D2VA 4L52A 2CN5A 3OS3A 1V1KA 3EQFA 3FV8A 3KN6A 4BL1A 5ACKA 3FZOA 4M15A 4I5PA 4AXCA 3JR1A 3Q6WA 4DH5A 3R8MA 1GOLA 1ZY4A 2C5VA 3PRFA 3SG9A 3VS3A 5AP3A 4FV0A 5I0BA 2Z7SA 4WG4A 2OZAA 2PZYA 3CKXA 2WIHA 4G17A 2W1HA 3MVJA 4EOJA 2VAGA 2WTCA 3MJ1A 4L01A 3R8LA 3R8ZA 2ITWA 1PF8A 1WCCA 3KXHA 3VS4A 4L67A 4L53A 2GTNA 4ZTRA 5EHYA 3KQ7A 3NUPA 4FKTA 5AUVA 5IDNA 3UIUA 2Y4IC 3RCDA 4D5HA 2YCSA 4UZDA 4H36A 2YACA 2VWZA 2GNLA 2GNGA 5HVYA 3I5NA 4EOSA 4U7ZA 3NMUF 5BPYA 3COHA 4CTCA 3AMYA 3AT2A 3P7AA 4ZMFA 2QVSE 3MY1A 4I21A 1W84A 5FP5A 3UO6A 3UYTA 2NO3A 3C9WA 4DEGA 4BICA 5JQ8A 2VU3A 3FQEA 4XBRA 3R7VA 4AA5A 3QGYA 4FYOA 2XS0A 3H3CA 4A9RA 4R7IA 4U79A 5JGDA 3O5AA 4O0YA 3LCSA 2QO7A 4M84A 2ONLC 3TMOA 3EL8A 3FMHA 3OY1A 3RK7A 2UW0A 1PXIA 4FRFA 1MRUA 3RALA 4CLJA 4LDTA 3RJCA 5LVPA 4AAAA 3OXTA 2ZV7A 4CEGA 2ITUA 3DTWA 1FQ1B 3KMMA 3R7GA 4MNEA 3ZSHA 4TZRA 4W4WA 5HTCA 4G31A 2OU7A 3CIKA 3P4KA 4KRCA 4MWIA 4RJ6A 4RLKA 1JSTA 4IANA 4ZXTA 3FEGA 3MFTA 3BI6A 3FWQA 4IWPA 3TNHA 4FVRA 4ANOA 5BUEA 5DN3A 4F99A 2X2MA 3QQUA 1Q3WA 4DFYA 5EHLA 4UYNA 3VULA 4FTTA 4R7BA 3Q2MA 4QNAA 2ITOA 3O0GA 1OIUA 2GHGA 4FZFB 2XNNA 3KL8A 3MA3A 4QP1A 4XG2A 3IS5A 4GG5A 4ZSLA 2R3MA 4F6SA 2EXMA 2GNFA 3EKNA 1YI4A 4JOAA 3DB8A 2IZTA 2ZDTA 4RQVA 5CEIA 3ULZA 5C4KA 4I0TA 4F1OA 4NW6A 4X2KA 2WQBA 4UMPA 4QNYA 4FGBA 2LAVA 4E6DA 4O83A 3HRCA 4Y85A 3VAPA 4AT3A 4KBKA 4UBAA 3BV2A 2DWBA 2X8IA 4O21A 4ZY6A 3V6SA 3R9NA 2XNEA 4E93A 4UEUA 1ND4A 2EWAA 3FXXA 3DBCA 1PXKA 3L8PA 2HZIA 3MTLA 2X39A 1EH4A 4CYJA 2WQNA 3WF7A 5I4NA 4AG8A 3PVGA 3ELJA 3ORMA 4IX4A 2C5XA 1BI8A 2CDZA 2JAVA 4HYSA 3A8WA 4XP3A 4X3JA 3VUKA 4AACA 3LFQA 4FOBA 2QOQA 3CBLA 2ITYA 2WMXA 2XVDA 2PUUA 5BUJA 2P2HA 3CJGA 1Q3DA 3E8EA 4OT5A 3HAMA 3P1AA 5CS6A 5E92A 2AQXA 5GINE 2Y6OA 4EL9A 3FZ1A 5KMOA 3D5XA 4U8ZA 4I24A 1M7QA 5KNJA 3KA0A 4RX9A 1K9AA 2J0LA 4MF0A 4LRJA 5LVLA 1U59A 2CKEA 4L3LA 4O2ZA 4ASDA 3CSVA 3BELA 3F2NA 3UP7A 2HY0A 5A46A 4DDGA 3HDMA 3C4XA 1HOWA 4TYHB 4IX6A 4FJVA 3EJ1A 4GVAA 4YURA 5DHJA 2PVYA 3Q04A 3R22A 3TEIA 4GL9A 2E9VA 4BIBA 3E3BX 2B9IA 2J0JA 3DXNA 3QRJA 4K6ZA 2PVLA 3D9VA 3MTFA 4KD1A 4RZWA 4XLVA 2WTKB 2BDFA 2WB8A 5B2MA 5L2IA 4O7YA 3FJQE 3S1HA 5CZIA 5IQGA 3FY2A 2UVXA 1UV5A 4IDTA 5KO1A 2OK1A 4IC8A 2UZUE 1OIRA 3IQ7A 3PP0A 3Q9ZA 3AOXA 3W0RA 2WQEA 3QYZA 5E8ZA 3VC4A 3W8LA 5IZFA 3NNWA 4AGUA 5AP7A 5BVDA 3TIYA 2GFCA 5IQAA 4Y5HA 3W16A 4FNXA 1U4DA 4R6VA 4YMJA 1PMUA 3RINA 4BF2A 4U81A 2XAOA 4FV4A 3RK5A 3HDNA 4DG2E 3KFAA 5E4HA 3EQGA 1X8BA 2J0IA 2YWPA 1YXVA 5H3QA 4CRSA 4W4VA 4C58A 5ANDA 3OT8A 1ZZLA 3TV6A 4FZAB 4R1YA 3O50A 4U42A 3ATTA 3RZFA 2IW6A 3K5VA 2IJMA 3HEGA 3V8SA 4D28A 4BCMA 4R77A 2YM7A 4KIKA 4PL5A 2GS2A 5AUWA 2BVAA 4GFGA 4KIKB 1UU9A 2ETRA 2XKCA 4WSQA 4XV2A 5KMIA 5L2QA 2VX1A 3D83A 4LL0A 3EB0A 4O4EA 2CGUA 4EH2A 1JBPE 2ZVAA 5CXHA 4QPAA 5J8IA 4BDDA 4C0TA 2CSNA 5DH3A 3U4WA 4OAVB 5B0XA 4ACMA 3QA8A 1YW2A 1XH4A 1GJOA 4PL3A 4EHZA 3PVWA 3U8WA 2NRUA 2OJIA 5AR8A 4GW8A 5DYJA 2I6LA