3A98B

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
190
Chain Sequence
SGPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 46
structure length 190
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.920 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a98B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a98B02
1MAIA 4CYEA 4HAXB 3PZDA 3SNHA 4EMOA 2EMSA 1ZVRA 3RCPA 3D8EA 2UVMA 3FM8C 2AL6A 1X05A 2LYDA 2W2XC 2FJLA 2HTHB 1ZM0A 1MIZB 1BTNA 3DXDA 3PVUA 2XQNM 2I1KA 1J0WA 1SHCA 2EMTA 1OY2A 4WVFB 4ZRIA 5EFXA 3PVLA 2ZPYA 5GOWB 2YF0A 1ZSQA 4C0AA 5JHGA 1XD4A 2DYQA 2IFSA 2KGXB 5C16A 1NU2A 1K5DB 4K2OA 1FOEA 2N0YA 2DN6A 1KZ7A 4F7GA 4KHAA 4ZRJA 2ROVA 1QQGA 2J0KA 3ULBA 3FEHA 2UZSA 2H7EA 1X1FA 4L6EA 4GMXB 2RLOA 2V76A 5FI1A 2KUPA 1XCGA 1U5DA 2VKIA 4GPTB 1I2HA 1B55A 4YONA 2LULA 1WGUA 3ZDTA 2ROZB 2Z0OA 4F7HA 1X86A 2N23A 1MK7B 1EAZA 3KRWA 2QKMA 2Q13A 3SUZA 1FB8A 4KVGB 3BJIA 1OMWA 4GN1A 2P0FA 3HQCA 1AWEA 2D9XA 5DHFB 1UNPA 5KQ1A 3A8QA 1SGHA 1XR0B 3HW2B 4TKNA 2D4QA 2J0MA 1BWNA 4HAYB 2K2UA 5DHAB 2YS1A 3IVFA 3O96A 5DH9B 3TVVA 1NI2A 2NZ8B 2Z0QA 3KZ1A 2KCJA 4HB4B 2I5CA 3SYXA 3F0WA 1AQCA 1MKEA 1W1GA 1FHOA 4DXAB 3F5RA 1KI1B 2CY5A 3GYPA 4A6KA 1P3RA 2CAYA 3PG7A 5JHHA 2VRWB 2D9YA 4K17A 4HATB 5FI0A 4EKUA 3QBVB 2DTCA 1K5GB 2J0JA 5LOPB 1V88A 1N3HA 5HE2A 2MFQA 1V5MA 4F7UP 1TJ6A 1WJ1A 5KCVA 5DIFB 3LJUX 2PZ1A 4YL8A 1H10A 2EC1A 2P0HA 1W1DA 1XODA 4HAUB 2QKLA 2L1CA 3ULCA 1NTVA 1WVHA 2LOXA 1DDVA 3ODXA 1GG3A 1EGXA 2H7DA 1GC6A 4Y94A 2GCJA 4KHOA 2W2WA 2RUKB 2M38A 4IAPA 3M1IB 1DBHA 4KHBB 3U8ZA 4HB2B 1Y19B 2DHKA 1LW3A 3FSSA 2YSZA 5L81A 1U5EA 4KAXB 4TYZA 2DA0A 1E5WA 1J19A 4MT7A 3ODOA 3KSYA 5J3QA 1V89A 2HE7A 1WJMA 2R0DA 3D8FA 1RJ2A 2DHIA 1UEFA 1DROA 2D9ZA 1NTYA 2DYNA 5D3XA 3VOQA 3U7DA 5HE1A 2RSGA 3DXCA 1IRSA 1V5UA 1UPRA 2Y8GA 5JP4A 1U2BA 2YS5A 2Y8FA 5C5BA 4Z2NA 1ZC4B 4K2PA 1ZC3B 4IFSA 5J3TA 2DX5A 2ELBA 3AJ4A 3TFMA 2NMBA 2YS3A 1I7AA 4NY0A 2W2XD 2D2QA 1XKEA 2YRYA 1WGQA 1Y5OA 1Q67A 1PLSA 2VSZA 3G9WA 1BTKA 2RNRB 1U27A 2YT0A 3D8DA 2IYBA 3QIJA 2OQBA 4PNKA 2MKRA 2COFA 1WI1A 2ADZA 2P8VA 2EJ8A 2Y7BA 1V61A 2JP2A 2Z0PA 2YVCA 3WYFB 4A6FB 4XWXA 4HAVB 3VIAA 5C6RA 3ODWA 5C79A 2RVBB 2YT1A 2OTXA 4IOYX 2DKQA 2COAA 1H4RA 1V5PA 2GCLA 3PSCA 3SO6A 5CLQB 2X18A 4HAWB 3P7ZA 1PFJA 1KZGA 1FHWA 5HE3A 3TCAA 3MPXA 1DDWA 1LB1A 1QC6A 2CODA 2RGNB 4D0NB 2J59M 1DDMA 2CRFA 3AU4A 1FHXA 5DI9B 2DHJA 4PQ0A 4HDQA 5KQ4A 3QWMA 1U5FA 2LOZA 4Z2MB 1X11A 5D27A 3N7CA 1EF1A 1M7EA 4GZUA 5HE0A 2M14A 4A5KA 1RRPB 4BBKA 4DX90 2L2IA 2COCA 4NSWA 2D10A 3UZTA 3BINA 4DBBA 1Z87A 1W1HA 2MDXA 3MDBC 4CHMA 4EJNA 2I1JA 3KRXA 2LG1A 5D3WA 2I5FA 5C5BB 5D3VA 3ZVRA 5JLJB 3P6AA 4HDOA 3PEGA 4HAZB 4P7IA 1WG7A 5CLLB 2D11A 1M7RA 1XX0A 4B6HA 1GC7A 3A98B 3ML4A 2GS0A 2P0DA 4GMVA 2G35A 1U29A 4H8SA 4MK0A 2UZRA 3SV1A 3OANA 4K81A 1UNQA 4HB0B 3CXBB 2GJYA 2AEHA 2D9WA 3A8PA 2DX1A 5LONB 1BAKA 1P5TA 1U5GA 4MY6A 1EVHA 3AU5A 4HB3B 4A6HA 1MPHA 3V5WA 1OQNA 3DXEA 3T06A 2K2JA 3HK0A 1UPQA 1FAOA 2DFKA 3NSUA 1TQZA 3PP2A 3PVWA 4A6FA 2LKOA 3TW1A 3X23A 2E2XA 2ELAA 4GXBA 5J3YA 5D3YA 1P6SA 1UNRA 1FGZA 4WJ7A 4CHJA 1ISNA 2CY4A 2BCJA 2R09A 1PMSA 3KY9A 4WSFA 4ZRKA 4DX8A 3CIKA 3WA0A 4HHVA 1X1GA 2DKPA 1DYNA 1MIXA 1MK9B 2D9VA 2DLWA 1TXDA 1FGYA 2K00A 3TO1A 3GYOA 2MWNB
chains in the Genus database with same CATH superfamily
2DXIA 3PZDA 3SNHA 4AKIA 2JUJA 3RCPA 3D8EA 3AJIB 2WSCF 4LGYA 4LGMA 4GC9A 2MR9A 1Q3CA 2XZUA 1TH2A 4BB9A 2JP7A 2HTHB 4B7GA 3DXDA 3PVUA 2XF3A 1S3SA 2I1KA 1NNJA 1OFHA 4W5WA 4WVFB 3HGIA 5FTJA 2L09A 1ZSQA 3K2LA 5JHGA 2DYQA 1KFVA 2N0YA 2DN6A 5EP1A 1VQ1A 1Z5CA 4FWDA 2R18A 2UUBM 2ROVA 3RGPA 3KS4A 2C9CA 3FEHA 4JXJA 4AKHA 2OO9A 4FCTA 1Z59A 4AW4A 2Z0OA 4DR5M 2LWXA 2XH9A 4NL4H 1DGFA 2HCBA 5H37D 3CGWA 2M5ZA 3E9SA 1GO5A 5JI2E 4L16A 3U60B 2Q13A 3U6DA 1N33M 4LY6A 1R4GA 3EIHA 4CJ6A 2D9XA 1T3TA 3TWKA 2BWEA 3SASA 1IY1A 1VDDA 3HW2B 1X37A 2J0MA 3U6MA 4HAYB 4XBOA 2DENA 5ITRA 2YS1A 3CTWB 1GKIA 3SBJA 4DV7M 3SYXA 1AQCA 4M0WA 2BJWA 3QYEA 4Q7JA 1D0LA 1C1KA 1FHOA 2NQ8C 4FCWA 4D6WA 4IIWA 1G4AE 2F5SA 4A6KA 2CAYA 3A45A 3VDPA 3AFHA 4LZZA 3DOAA 2HHHM 4HATB 1XMQM 4EKUA 1K5GB 3KDSE 1OAOC 1V88A 3J2PB 4NC6A 2QBYB 1WJ1A 1N75A 1P3QQ 5KCVA 1IFYA 1H10A 1XODA 3FUXA 2JZ1A 4EIWA 3KSXA 5KPZA 1E9SA 2ZAMA 1XMOM 1I94M 4Y94A 3B89A 3U6LA 3J81S 4M9XA 3SATA 3FTFA 3M1IB 2HKJA 3FUTA 1Y19B 2R0IA 4DR7M 4RF1A 2H1RA 4MGZE 2F5QA 3KOXE 1E5WA 3LVVA 5EP3A 4FWGA 3KSYA 4ZPXA 1WJMA 1N77A 1NHGC 3SYLA 4PDIA 1NTYA 2DYNA 4A3VB 5HE1A 2JY6B 4NXNM 2V6ZM 1L2BA 5EXPA 2RSGA 4QJ4B 5JP4A 3GRRA 1U2BA 2L7IA 2W82A 4GIPA 4B3MM 3K92A 2LBCA 4DR2M 4QOSA 3L29A 4IFSA 3AJ4A 3TFMA 3TWMA 1I7AA 3H4JA 4OVZB 1IXZA 2W2XD 1OJLA 2K49A 2YRYA 1WGQA 1Y5OA 1Q67A 3IHPA 1BTKA 1W5TA 3JR4A 1G41A 2YT0A 3D8DA 3GLGB 3QIJA 2CP8A 4ITQA 2DAEA 4MGIE 3HZJA 1IXSB 1NHWC 1WI1A 2D7HA 1JR3A 4GHAA 2A5YB 2Z4SA 4Z6YA 1V61A 3HWSA 2YVCA 3ODWA 4GEWA 5C79A 2F5PA 3GQ3A 2YQZA 3BBZA 1V5PA 2GCLA 3T38A 3PSCA 2QZ4A 3GPUA 2EKFA 1QANA 3DZDA 1Z5BA 3KXEC 4IBDA 2R46A 5HE3A 1NNUC 3TCAA 2JY7A 4IBIA 2FJUB 3JR5A 5E6JA 2DKLA 2CODA 4D80A 3GLFE 2RGNB 5EXTA 2Z7JA 2H5XA 4HDQA 4WURA 2RGHA 3CF0A 5D27A 4XGIA 1WXQA 1QAOA 1M7EA 1QYRA 2M14A 1KYIA 1EE8A 2JWSA 2X4AA 3IECA 3WHLA 4DBBA 1IN7A 2MDXA 1E9RA 3HSAA 5D3VA 3ZVRA 2KRUA 1SXJB 3BOSA 3GRVA 4I5SA 1OAIA 2D11A 1XX0A 3GLIE 1R5LA 2K47A 1M7RA 4B6HA 3ILKA 4MGKE 3DFZA 4NOOB 2P0DA 2G35A 5BPVA 2ZKMX 3QYBA 2C99A 1VEJA 5ITYA 4TUWA 3NWAA 3VLFB 1T43A 2MH8A 4Y28F 1HR0M 1IY2A 4AI6A 3U5ZB 4YHHM 1EVHA 2Y20A 3SMPA 2CV1A 1DGHA 2Z3XA 2CV2A 4B7FA 2HWJA 4WW0A 2K2JA 5A2QS 1UPQA 1CUKA 1FAOA 4PCZA 2DFKA 2DNAA 3F92A 2LKOA 3TW1A 4QXAB 4LRSA 3KOZE 3L27A 2XFTA 2CV0A 3QAUA 1UNRA 3SHGB 3L2AA 3DCXA 4LF5M 2BCJA 1IXRC 2R09A 3KY9A 1SXJD 3GLIB 3GO8A 3E21A 1NJFA 1TXDA 1N34M 4RF0A 3TO1A 2L2DA 1JR3D 1MAIA 4HAXB 2EMSA 3B74A 2GUMA 2LVAA 4GHLA 3U12A 4X65M 2Z59A 2DHYA 3FKEA 3FM8C 2AL6A 4QJ5B 1X05A 2W2XC 2G8LA 3I4VA 2Z14A 1J0WA 5FSWA 4QOZC 2DZNB 1SHCA 5EFXA 2YF0A 5FTNA 4L1RA 1RU3A 1HT1E 4C0AA 5KPRA 4F2LA 2IFSA 2L6OA 3W67A 2DWNA 1NU2A 2RRUA 4B08A 3U6PA 2X49A 3LW5F 1N78A 2UZSA 2H7EA 4L6EA 2CHQA 5KQDA 5FI1A 8CATA 3VKHA 1U5DA 2VKIA 4GPTB 2L7HA 1B55A 4YY3M 4YONA 3ZDTA 4IBBA 1X86A 3FYDA 3Q8GA 3U6EA 4L78A 4LFCM 3KRWA 1L2DA 3A46A 2QKMA 2O25A 4FD2A 2HAKA 4FW9A 1KSFX 2DAKA 1FB8A 5EJCA 1NSFA 4MGYE 3BJIA 4GN1A 5L8RF 2QQ8A 3HQCA 4QHSA 2VIIA 2KZUA 5DHFB 5KQ1A 3GQ5A 2OOBA 2G3QA 4GKJM 3E46A 1IBLM 5IRSA 1OKSA 4OX9M 2K2UA 5DHAB 4LF4M 1NI2A 2FS1A 1TR8A 2LHCA 4HB4B 1XB2B 4IBEA 3F0WA 4KT0F 1T77A 3FTCA 4JI0M 3B77A 3L28A 5F3WA 1PJIA 5IZ7D 5LMUM 5IT9S 1OTRA 2VRWB 4AG5A 2DAIA 3QBVB 2FFJA 2J0JA 5LOPB 3HY5A 2MFQA 1QQWA 4F1IA 3GLFB 5KQ8A 2KXEA 5DYGA 2XLJA 2L4EA 2EC1A 1W1DA 1LTMA 2L1CA 1NTVA 1WVHA 1DDVA 1N32M 3ODXA 1EGXA 2DWLA 3BXWA 4KHOA 1UFZA 3MMPA 2Y0TA 2W2WA 2RUKB 4IAPA 1DBHA 1HNXM 3U8ZA 3GPXA 1WHCA 5LMNM 5EP4A 3TPZA 4TYZA 4LG2A 4LCBA 1WGLA 1J19A 4OW0A 4AZFA 2R65A 3ODOA 3GLGE 5J3QA 4KODA 2HE7A 2KW0A 4I81A 5FTKA 1MX0A 3KP0E 1TH4A 2D9ZA 4AG6A 4CGYB 3U7DA 1GVNA 3SYKA 3MJ5A 3D8LA 4JYAM 4I4LA 3M7GA 3DXCA 1V5UA 3J80S 2CFOA 1ZC4B 1Q39A 4L8RC 4CSQA 3U6CA 1GJTA 2YNMD 4AQYM 3SAWA 3NWFA 2D2QA 1XKEA 4JN6A 3W0LB 4LRTA 3G9WA 4DV5M 2UXDM 2RNRB 4R7GA 2RKOA 3C58A 3AV0A 2MKRA 5BR8M 3FVCA 1OIZA 1VEGA 4G3OA 2ADZA 4KO8A 2P8VA 1ZMUA 2QENA 2Z0PA 3WYFB 4M9SA 4XWXA 1QUSA 3SAUA 3KW6A 5C6RA 1TGUA 2RVBB 4IOYX 2ZAOA 3NBIA 3KP1E 3FTEA 1DGHB 1H4RA 3UK6A 5KPTA 3FRHA 3SO6A 5I2MA 3P7ZA 1PM5A 4DV4M 3R8FA 1E94E 1KZGA 5EXXA 1FHWA 1J09A 3J7BA 2JXNA 5ITQA 3C9PA 1QC6A 1QZEA 2J59M 3HX3A 4Z8XA 2DHJA 1SXJC 3GQ4A 1X11A 1N36M 3N7CA 2V1UA 1LV7A 5HE0A 3HHZA 1RRPB 4BBKA 2E5LM 2X8AA 4GRIA 1SXJA 3SFZA 3A42A 2Y0QA 3UZTA 4DV1M 2XZFA 4CHTB 3MDBC 2I7PA 2LVNC 5C5BB 3PEGA 2LNHC 1TF0B 2ZM6M 3UZUA 2GS0A 3FUUA 3ZH9B 4G4NA 2LVPC 1U29A 4H8SA 5FLXS 1XXHB 4IBJA 1ZV1A 2VQEM 2NBVA 3T6PA 3CF6E 1UNQA 3LQQA 3B7QA 1ORYB 2GJYA 5LONB 3HHXA 5JI3E 4LF6M 1R2YA 3FYCA 2C5RA 3TL4X 4REZA 1OQNA 1ZMWA 2K6BA 1WIVA 2KA6B 1YUBA 2XSZA 4B3TM 4G4QA 1OFIA 3L25A 3NSUA 3T1HM 3PP2A 4DR1M 1Y8GA 5J3YA 1E32A 5D3YA 1P6SA 1IXSA 1FGZA 3FRIA 5ITXE 1PMSA 4IBCA 4WSFA 4ZRKA 3PXGA 1NJGA 4LF8M 5DFLA 2D9VA 1YE9A 4OVZA 1K82A 2G5GX 1QZMA 4II7A 4QJ3B 3FE3A 4EMOA 2CWBA 1XNQM 4QHTA 1SG9A 3GRYA 4LZJA 4R3DA 1Z6TA 2CEAA 4MB7A 2JY8A 5C18A 1PJQA 2XQNM 2UUAM 2KDLA 3M6AA 1Q3BA 1G59A 5IWAM 4ZRIA 2ZPYA 1XD4A 2DZOB 4L15A 2KGXB 5C16A 1K5DB 1L8QA 2YR0A 3PFIA 4K2OA 4D82A 1DGGA 1NY5A 1NV8A 1HQYE 4KHAA 3AL0C 1QQGA 3TQSA 4GMXB 2KUPA 4IBFA 3FD9A 3KVWA 1WGUA 2ROZB 1MK7B 2QBYA 2F4VM 3SUZA 2OOAA 3PNVA 4KVGB 2ZTDA 3GLHB 2P0FA 1XXHA 3QWLA 2BJVA 1V92A 1J5EM 4NSOB 1GJSA 3I4YA 1GLNA 3A8QA 5E26A 1PGYA 3DA1A 3AOGA 4K0KM 2EUCA 4TKNA 2D4QA 1BWNA 2UXBM 1L1ZA 1AIPC 2NZ8B 2Z0QA 3KZ1A 4LJ9A 2BWBA 3ZCBB 3UJNA 3HJQA 2I5CA 4LF7M 3D8BA 1QVRA 4DR6M 1MKEA 1W1GA 2DVWB 3LVWA 2CY5A 3GYPA 4NSRA 1P3RA 1MN3A 2GQFA 4K17A 5FI0A 3UGJA 4KHPM 5ITTA 3R9XB 3VFDA 3H4MA 3J7AS 3U60A 1YSYA 1NVMA 5DIFB 3LJUX 4NRWA 3NWDA 2PZ1A 2EKKA 5DNYA 4HAUB 2QKLA 1QUTA 2LOXA 2QHOB 2H7DA 1MU5A 1WJ7A 1D2NA 1GC6A 1PJJA 2GCJA 4X66M 4DR3M 3HIEA 3HJ8A 5ITXA 3LCVB 4JI3M 2M38A 4KHBB 4S12A 3OTOM 2I7NA 3FSSA 3IG8A 1J7KA 5L81A 4JV5M 3W68A 1U5EA 4KAXB 2DA0A 4MT7A 3HHYA 3RGSA 3T15A 1V89A 3HKPA 3THGA 4LF9M 2R0DA 3D8FA 2DHIA 5M4YB 5D3XA 2XEPA 3VOQA 4DBGB 1T6OA 1A5TA 3FTDA 1IRSA 2V1CA 4GC5A 5FTMA 4K2PA 1R7RA 3LMMA 3MK6A 5J3TA 2R6FA 2ELBA 2NMBA 2YS3A 1TH3A 4NY0A 2J7NA 3OHMB 2KHHA 2J7OA 2N35A 2VSZA 1L2CA 1JR3E 4PNKA 4PDGA 4PD2A 3U6OA 2Y7BA 2OPFA 2JP2A 1Q02A 4A6FB 4HAVB 3VIAA 4JI1M 1XWIA 5DYIA 1SXJE 2OTXA 1JB0F 1R6BX 2DZLA 4JI6M 4HAWB 2ZTCA 4KLNA 2CHGA 1C7YA 4NRVA 1PFJA 4LJ5A 3GLFA 3B7NA 5FTLA 4HLQA 2LHGA 2OQ4A 3E4RA 4D0NB 2K0BX 1VDLA 2ERCA 4PQ0A 5KQ4A 1DGBA 2CE7A 3QWMA 1L1TA 1U5FA 1ZMVA 2LTUA 1EF1A 2LXEA 4A5KA 3VK8A 3FUVA 2EA0A 1NV9A 4LFAM 1QDRA 2D10A 3BINA 4M0DA 3Q8XA 1JQJC 3GPPA 1XNRM 4RKUF 1W1HA 2WSEF 4LJ7A 4EJNA 2I1JA 4IBKA 4HAZB 2YT2A 1V34A 4GOUA 1XC8A 1GC7A 2FOIC 2KNVA 2UZRA 3SV1A 1FJGM 1DV0A 5GKNA 4BLCA 3RFWA 1VG5A 4K81A 2DX1A 2BNKA 1P5TA 5I2SA 1U5GA 4KHBA 1OQYA 2QCUA 4MY6A 3AU5A 4HB3B 3JAMS 4A6HA 3V5WA 4DIXA 3T06A 1R2ZA 5C1BA 2Y21A 4M9ZA 2UUCM 2LVQD 1TQZA 2KIGA 3RE8A 4GXBA 4HEOA 2B3TA 4CHJA 2K8EA 1OIPA 3U61B 1I4WA 3CIKA 3WA0A 3C3EA 4R71A 4HHVA 2WZJA 4DV3M 2FH0A 2QSFX 1MIXA 2R45A 1MK9B 4HL4A 4LFBM 4MM3B 1FGYA 2K00A 3GYOA 4PT5A 2MWNB 2M60A 1AUAA 4CYEA 3HHWA 2L4FA 4GKKM 1ZVRA 1HJPA 4D81A 2CHVA 2R4JA 2LVOC 4GH9A 2DHRA 4AKGA 2Z13A 4OSNA 2UVMA 4GITA 3SC3A 3VKGA 3HU1A 2LYDA 1G8PA 4FCVA 1NO1A 2FJLA 1ZM0A 1MIZB 1BTNA 2KRKA 3I51A 3TE6A 4G6ZA 4DV2M 4WP2A 3GLIA 3U6SA 1UM8A 2EMTA 1OY2A 2HL7A 2VF8A 3PVLA 5GOWB 2C9OA 3KS8A 4RNAA 3GLHA 3PVSA 3C3DA 1FOEA 4DUZM 3NW8A 3T1YM 1XHBA 3SARA 1KZ7A 4F7GA 4ZRJA 2J0KA 3ULBA 4B3SM 1X1FA 2RLOA 2V76A 1XCGA 3WHKA 4GNKB 1I2HA 3AOEC 2FNAA 2LULA 3U5ZA 4X62M 4F7HA 2N23A 1IY0A 1EAZA 2AHMA 3EIEA 2C96A 1QDTA 4DV6M 2KZSA 1PRBA 2KNAA 3K1JA 1YLAA 1OMWA 3IG5A 3GP1A 1AWEA 4I8OA 1GABA 1WGNA 3L26A 1UNPA 1SGHA 1XR0B 2JNHA 3HJSA 2QP9X 1TTEA 4DUYM 2KR0A 3GLHE 2RRFA 4MGHA 4FWHA 3IVFA 3O96A 3AKZA 5DH9B 3TVVA 1IN5A 2KCJA 4IJEA 3LCUA 3SMSA 3W0FA 3A58A 4JI2M 1HNWM 2XGNA 3NWLA 3VDUA 2DWMA 3F5RA 2JY5A 4DXAB 2K9DA 1KI1B 2ZBKB 2O01F 4B3RM 3SAVA 4QNRA 3PG7A 5JHHA 3FUWA 2RGOA 4OU7A 1XXHE 3K8ZA 2F5OA 2D9YA 1TDZA 2WSFF 2DTCA 1W5SA 1ZYIA 1Z5AA 1N3HA 5HE2A 2KIEA 1MJGM 2Z8YM 2XSZD 1V5MA 1TJ6A 4F7UP 4YL8A 2P0HA 1WR1B 2KUQA 3B7ZA 3ULCA 2R44A 2EJSA 1GG3A 1NY6A 3UMMA 3KOYE 4CISA 1FNNA 3ZC7B 1G3IA 5EQTA 3HU2A 2MGWA 2CRUA 5EP2A 3ZQJA 2R2YA 1ZAEA 4HB2B 2O5RA 2DHKA 1LW3A 2APLA 4OT1A 4DV0M 3GLGA 2YSZA 2ZANA 3KFUG 1D0KA 2EO2A 1IQPA 3V76A 1V33A 2DAGA 3GRUA 1EFUB 2Z4RA 1DO0A 1RJ2A 1UEFA 1DROA 4LJAA 1D0MA 3K9PA 1DO2A 3GPYA 1K3XA 4X64M 1UPRA 2Y8GA 1F4IA 2YS5A 3LQRA 2Y8FA 5C5BA 4Z2NA 2F5NA 4IBGA 2MROB 1ZC3B 2GNOA 2DX5A 4G4RA 4JI4M 4DR4M 2MJ5B 1IN6A 1PLSA 4GMQA 4CIZA 4HSIA 1U27A 3U6QA 3U61A 2IYBA 2DAMA 2DI0A 2OQBA 2VF7A 3NBXX 2COFA 4JI5M 2EJ8A 4L6V6 2KNZA 2R62A 4QNMA 5KO3A 2YT1A 4NXMM 2DKQA 1VEKA 4G4OA 1PJTA 2COAA 4JI8M 1EIJA 1IN8A 1IBKM 2JA2A 3CF2A 3AOEA 5CLQB 2X18A 3KSJA 2VDBB 3VK7A 1GL6A 3MPXA 1DDWA 1LB1A 1H6UA 5EXSA 2QPAA 3J27B 1DDMA 2D7GA 2CRFA 3AU4A 1FHXA 5DI9B 1HT2E 2LOZA 4Z2MB 1MI1A 1HNZM 3I04M 4GZUA 2DWZB 4DX90 2L2IA 2COCA 4NSWA 2Z4DA 2CUZA 1Z87A 1ZQ9A 2J5YA 1GL7A 4CHMA 3KRXA 1HQCA 2LG1A 5D3WA 4LJ6A 2I5FA 3K9OA 5LG4B 2UU9M 5JLJB 3P6AA 4XK8F 2FE8A 4HDOA 4FVMA 4P7IA 5ITUA 4P17A 1WG7A 5CLLB 1TDHA 1QAMA 3A98B 3ML4A 3MHVC 4P16A 2P5TA 3B9PA 4GMVA 4MK0A 2UXCM 3M0EA 4ANRA 4L4UA 1K3WA 3OANA 2Q2EB 1G71A 4HB0B 3CXBB 1IM2A 2AEHA 2C98A 2D9WA 3A8PA 2QNJA 1BAKA 4BBAA 3HU3A 2D7EA 1BVSA 3PNYA 1MPHA 3KOWE 3DXEA 4MH0E 3HK0A 3PVWA 4A6FA 2YFQA 2XFSA 4LJ4A 2E2XA 2ELAA 3X23A 4IJFA 4JI7M 1PJSA 2LH0A 1IN4A 4WJ7A 3I01M 1ISNA 2CY4A 2R4EA 4LJ8A 2KEBA 1IBMM 4DX8A 3SHFA 4B7HA 7CATA 1X1GA 2DKPA 4UN2B 1DYNA 2JZ0A 2VQFM 2DLWA 1QAQA 3TWLA 5IREB
chains in the Genus database with same CATH topology
1MAIA 4CYEA 2DXIA 4HAXB 3HHWA 3PZDA 3SNHA 4EMOA 4AKIA 2EMSA 4GKKM 1ZVRA 3RCPA 4GHLA 3D8EA 1XNQM 4QHTA 4X65M 3AJIB 4D81A 2CHVA 2R4JA 3GRYA 4GH9A 4LZJA 4R3DA 1Z6TA 2DHRA 2CEAA 4LGYA 4AKGA 4LGMA 4GITA 2UVMA 3SC3A 3FKEA 3FM8C 4GC9A 2AL6A 4MB7A 3VKGA 1X05A 3HU1A 2LYDA 2W2XC 1G8PA 4FCVA 1Q3CA 2XZUA 1TH2A 2FJLA 4BB9A 2HTHB 4B7GA 1ZM0A 5C18A 1MIZB 1BTNA 3DXDA 3PVUA 2KRKA 2XQNM 3I51A 3TE6A 4G6ZA 2G8LA 2XF3A 3I4VA 4DV2M 2UUAM 1S3SA 2I1KA 1J0WA 1NNJA 1OFHA 5FSWA 3GLIA 3U6SA 1UM8A 3M6AA 4W5WA 1Q3BA 2DZNB 1G59A 4QOZC 1SHCA 1OY2A 2HL7A 5IWAM 2EMTA 3HGIA 3PVLA 2ZPYA 4WVFB 2C9OA 5FTJA 2L09A 3KS8A 5FTNA 1ZSQA 2YF0A 5GOWB 1HT1E 3K2LA 4C0AA 5KPRA 5JHGA 1XD4A 2DZOB 4L15A 2DYQA 2IFSA 2L6OA 2DWNA 4RNAA 3GLHA 3PVSA 2KGXB 5C16A 1KFVA 1NU2A 1K5DB 1L8QA 2YR0A 3PFIA 4K2OA 1FOEA 4D82A 1DGGA 4DUZM 2N0YA 3T1YM 2DN6A 5EP1A 1NY5A 1XHBA 4B08A 3SARA 1Z5CA 4FWDA 3U6PA 2R18A 1KZ7A 4F7GA 1HQYE 2X49A 4KHAA 1N78A 4ZRJA 3AL0C 2UUBM 2ROVA 1QQGA 2J0KA 3RGPA 3KS4A 2C9CA 3ULBA 3FEHA 3TQSA 2UZSA 4JXJA 4B3SM 1X1FA 2H7EA 4GMXB 4L6EA 4AKHA 2CHQA 2RLOA 4FCTA 5KQDA 2V76A 5FI1A 2KUPA 8CATA 3VKHA 1XCGA 3WHKA 1U5DA 1Z59A 2VKIA 1I2HA 2L7HA 4GPTB 3AOEC 2FNAA 4IBFA 1B55A 4YY3M 3FD9A 4AW4A 3KVWA 2LULA 1WGUA 3U5ZA 4X62M 2ROZB 2Z0OA 4DR5M 3ZDTA 4IBBA 4F7HA 1X86A 2N23A 1MK7B 2LWXA 3FYDA 2XH9A 1IY0A 1EAZA 2AHMA 3EIEA 3U6EA 4L78A 4LFCM 4NL4H 3KRWA 1DGFA 2HCBA 1L2DA 3A46A 5H37D 2QKMA 2M5ZA 3E9SA 2QBYA 4FD2A 2C96A 2F4VM 5JI2E 4FW9A 4L16A 3U60B 2Q13A 4DV6M 3SUZA 2KZSA 1KSFX 3U6DA 3PNVA 5EJCA 4LY6A 1N33M 1FB8A 3K1JA 4KVGB 1NSFA 3EIHA 4MGYE 3BJIA 1OMWA 3IG5A 3GLHB 4GN1A 3GP1A 2P0FA 1XXHA 3QWLA 2BJVA 3HQCA 1AWEA 2D9XA 1T3TA 4I8OA 2VIIA 4QHSA 1J5EM 4NSOB 2KZUA 3I4YA 3L26A 3TWKA 5DHFB 1GLNA 1UNPA 5KQ1A 3A8QA 5E26A 3DA1A 3GQ5A 3SASA 1IY1A 1VDDA 3AOGA 1SGHA 1XR0B 4K0KM 3HJSA 2QP9X 3HW2B 4DUYM 2EUCA 4GKJM 1X37A 1IBLM 4TKNA 4ZRIA 4MGHA 2D4QA 1BWNA 2J0MA 4FWHA 3U6MA 2UXBM 4HAYB 4XBOA 4OX9M 2K2UA 5DHAB 1L1ZA 5ITRA 2YS1A 3IVFA 3O96A 4LF4M 3CTWB 3AKZA 5DH9B 3TVVA 1GKIA 1NI2A 2NZ8B 2Z0QA 1IN5A 3KZ1A 3SBJA 4LJ9A 3ZCBB 2KCJA 5J3QA 4IJEA 3UJNA 3SMSA 4HB4B 4DV7M 3HJQA 2I5CA 4LF7M 3F0WA 4IBEA 3W0FA 3SYXA 1AQCA 4M0WA 4JI2M 3D8BA 1QVRA 2BJWA 1HNWM 4DR6M 1MKEA 3FTCA 1W1GA 4JI0M 2XGNA 4MT7A 3L28A 1FHOA 1C1KA 3NWLA 3VDUA 5F3WA 2DWMA 3F5RA 4DXAB 2NQ8C 4FCWA 2DVWB 1KI1B 4IIWA 1PJIA 2ZBKB 3LVWA 5IZ7D 1G4AE 2CY5A 3GYPA 4NSRA 5LMUM 2F5SA 4B3RM 5IT9S 1P3RA 4A6KA 3SAVA 4QNRA 2CAYA 3PG7A 5JHHA 3FUWA 2RGOA 3A45A 4OU7A 2VRWB 3K8ZA 2F5OA 4AG5A 3VDPA 3AFHA 4LZZA 2D9YA 4K17A 3DOAA 2HHHM 4HATB 5FI0A 1XMQM 3UGJA 1TDZA 4EKUA 3QBVB 2FFJA 4KHPM 1K5GB 2DTCA 5ITTA 3R9XB 2J0JA 3VFDA 3H4MA 1W5SA 5EFXA 5LOPB 3KDSE 1V88A 3J7AS 3U60A 1Z5AA 1YSYA 3J2PB 1N3HA 5HE2A 2MFQA 2QBYB 1NVMA 1QQWA 2XSZD 1V5MA 1TJ6A 1WJ1A 4F7UP 1N75A 3GLFB 5KCVA 5KQ8A 2KXEA 5DYGA 5DIFB 2XLJA 3LJUX 4NRWA 2PZ1A 4YL8A 1H10A 2EC1A 2P0HA 5DNYA 1W1DA 1XODA 3FUXA 4HAUB 2QKLA 4EIWA 2L1CA 3ULCA 3KSXA 1NTVA 5KPZA 1WVHA 2LOXA 1DDVA 1N32M 3ODXA 1GG3A 1NY6A 1E9SA 2ZAMA 1EGXA 1XMOM 3UMMA 3KOYE 2H7DA 4CISA 1MU5A 1D2NA 1I94M 2DWLA 1GC6A 4Y94A 1FNNA 3ZC7B 1PJJA 2GCJA 4KHOA 1G3IA 4X66M 5EQTA 3HU2A 3U6LA 3J81S 4DR3M 2Y0TA 2W2WA 3HJ8A 4M9XA 3SATA 5EP2A 5ITXA 2RUKB 3FTFA 4JI3M 2M38A 4IAPA 3M1IB 1DBHA 2HKJA 1HNXM 4KHBB 1ZAEA 4HB2B 2O5RA 4YONA 3GPXA 3U8ZA 4S12A 3FUTA 1Y19B 1LW3A 2DHKA 3OTOM 2I7NA 4DR7M 4RF1A 4DV0M 3IG8A 2H1RA 3GLGA 3FSSA 1J7KA 2YSZA 5LMNM 4MGZE 5EP4A 5L81A 4JV5M 3TPZA 1U5EA 4LG2A 2F5QA 2ZANA 4LCBA 3KFUG 4KAXB 4TYZA 3KOXE 2DA0A 1E5WA 2EO2A 1J19A 4OW0A 1IQPA 3LVVA 5EP3A 4AZFA 2R65A 4FWGA 3HHYA 3RGSA 3KSYA 3ODOA 3T15A 4KODA 3HKPA 3THGA 2KW0A 4ZPXA 1V89A 3GRUA 4I81A 1WJMA 2HE7A 1N77A 5FTKA 4LF9M 2Z4RA 2R0DA 1MX0A 1DO0A 1RJ2A 2DHIA 1NHGC 3KP0E 3SYLA 1UEFA 1TH4A 4PDIA 2D9ZA 1NTYA 1DROA 2DYNA 2XEPA 4A3VB 5D3XA 3VOQA 4LJAA 4AG6A 4CGYB 3U7DA 1GVNA 5HE1A 3SYKA 3MJ5A 3D8LA 4JYAM 4NXNM 1DO2A 4I4LA 3M7GA 3FTDA 3GPYA 2V6ZM 1K3XA 1L2BA 5EXPA 2RSGA 3DXCA 4X64M 1IRSA 1V5UA 2V1CA 3J80S 1UPRA 2Y8GA 5JP4A 3GRRA 1U2BA 2YS5A 3LQRA 2L7IA 2Y8FA 2W82A 4GC5A 5C5BA 4GIPA 4B3MM 4Z2NA 2CFOA 5FTMA 1Q39A 3K92A 2F5NA 1R7RA 4L8RC 1ZC4B 4DR2M 4K2PA 4IBGA 3LMMA 3U6CA 4QOSA 3L29A 3MK6A 1ZC3B 4IFSA 5J3TA 2DX5A 2YNMD 4G4RA 2ELBA 3AJ4A 3TFMA 2NMBA 4AQYM 3TWMA 4JI4M 1I7AA 4OVZB 2YS3A 3SAWA 1IXZA 1TH3A 4DR4M 2W2XD 4NY0A 2J7NA 1OJLA 2D2QA 1XKEA 2YRYA 4JN6A 1WGQA 1Y5OA 1Q67A 3W0LB 1IN6A 2J7OA 4LRTA 1PLSA 2VSZA 4GMQA 1BTKA 3G9WA 1W5TA 3JR4A 4DV5M 2UXDM 2RNRB 1G41A 1U27A 1L2CA 3U6QA 3GLGB 2YT0A 3D8DA 3U61A 2IYBA 3QIJA 4R7GA 2RKOA 3C58A 4ITQA 2OQBA 3AV0A 4PNKA 2MKRA 4PDGA 5BR8M 4JI5M 2COFA 4MGIE 1WI1A 1IXSB 1NHWC 2ADZA 2D7HA 4KO8A 4PD2A 1JR3A 2P8VA 3U6OA 4GHAA 2EJ8A 2A5YB 2Z4SA 2Y7BA 2QENA 4Z6YA 2OPFA 1V61A 2JP2A 2Z0PA 3HWSA 2YVCA 3WYFB 4A6FB 2R62A 4M9SA 4XWXA 4HAVB 4QNMA 3D8FA 3SAUA 3VIAA 3KW6A 4JI1M 5C6RA 3ODWA 1TGUA 5C79A 1XWIA 5DYIA 1SXJE 5KO3A 2RVBB 2F5PA 2OTXA 2YT1A 4IOYX 4NXMM 2ZAOA 2DKQA 4G4OA 3GQ3A 2COAA 3NBIA 2YQZA 3KP1E 3FTEA 1DGHB 1H4RA 3UK6A 4JI8M 1V5PA 1R6BX 2GCLA 3T38A 3PSCA 2QZ4A 1IN8A 5KPTA 3GPUA 1IBKM 2JA2A 3CF2A 3AOEA 3SO6A 5CLQB 2X18A 3KSJA 1QANA 3DZDA 4JI6M 4HAWB 3P7ZA 1PM5A 1Z5BA 4KLNA 2CHGA 3KXEC 4DV4M 3R8FA 4IBDA 4NRVA 1E94E 1KZGA 5EXXA 2R46A 3VK7A 4LJ5A 3GLFA 1FHWA 5HE3A 1J09A 1GL6A 1NNUC 5FTLA 3TCAA 3J7BA 4HLQA 3MPXA 2OQ4A 1DDWA 4IBIA 1LB1A 3JR5A 5ITQA 5E6JA 1H6UA 3E4RA 5EXSA 1QC6A 2QPAA 2CODA 3J27B 4D80A 2RGNB 4D0NB 2J59M 5EXTA 2ERCA 1DDMA 2Z7JA 2D7GA 2CRFA 3AU4A 4Z8XA 1FHXA 5DI9B 1HT2E 2DHJA 4PQ0A 1SXJC 4HDQA 5KQ4A 1DGBA 2CE7A 4WURA 3QWMA 1L1TA 1U5FA 3GQ4A 2LOZA 2RGHA 3CF0A 4Z2MB 1X11A 1N36M 5D27A 3N7CA 1HNZM 4XGIA 1LV7A 1WXQA 1QAOA 2V1UA 1EF1A 2LXEA 1QYRA 1M7EA 2M14A 4GZUA 5HE0A 4A5KA 2DWZB 3VK8A 3HHZA 1KYIA 1RRPB 4BBKA 2E5LM 1EE8A 2X8AA 4GRIA 3FUVA 2EA0A 2L2IA 4DX90 1SXJA 2COCA 3SFZA 4NSWA 3A42A 2X4AA 4LFAM 2Y0QA 2D10A 3UZTA 3BINA 3WHLA 2CUZA 4M0DA 3Q8XA 4DV1M 1JQJC 3GPPA 2XZFA 1Z87A 1XNRM 4DBBA 1ZQ9A 1W1HA 1IN7A 4CHTB 2MDXA 1GL7A 3MDBC 4CHMA 4LJ7A 4EJNA 2I1JA 1E9RA 1HQCA 2I7PA 2LG1A 3KRXA 5D3WA 4LJ6A 2I5FA 5C5BB 2UU9M 4IBKA 5D3VA 2KRUA 1SXJB 3BOSA 3GRVA 3P6AA 3ZVRA 5JLJB 2FE8A 4I5SA 4HDOA 4FVMA 3PEGA 4HAZB 2LNHC 5ITUA 4P7IA 1WG7A 5CLLB 2ZM6M 1TDHA 2D11A 1QAMA 1XC8A 1M7RA 2K47A 3UZUA 1XX0A 1GC7A 3A98B 3ILKA 4MGKE 4B6HA 3ML4A 2GS0A 3MHVC 2FOIC 3FUUA 3ZH9B 4P16A 3DFZA 4NOOB 4G4NA 1PFJA 2P0DA 2P5TA 3B9PA 4GMVA 2G35A 1U29A 4H8SA 4MK0A 4PT5A 3M0EA 5FLXS 2UXCM 1XXHB 2UZRA 5BPVA 4L4UA 1FJGM 3SV1A 4IBJA 1K3WA 3OANA 2VQEM 2Q2EB 5GKNA 3RFWA 4BLCA 2C99A 5ITYA 4K81A 3CF6E 4TUWA 1UNQA 4HB0B 3LQQA 3CXBB 1ORYB 2GJYA 1IM2A 3VLFB 2AEHA 2C98A 2D9WA 3A8PA 2DX1A 2BNKA 5LONB 1BAKA 4BBAA 1HR0M 3HU3A 3HHXA 1P5TA 1IY2A 5JI3E 1U5GA 4LF6M 1R2YA 4AI6A 2D7EA 2QCUA 4YHHM 3U5ZB 4MY6A 1EVHA 3AU5A 4HB3B 3PNYA 3JAMS 2Y20A 3SMPA 2CV1A 3FYCA 1MPHA 1DGHA 2C5RA 3TL4X 4A6HA 4REZA 2Z3XA 3KOWE 3V5WA 2CV2A 1OQNA 4B7FA 1R2ZA 3DXEA 3T06A 4WW0A 5C1BA 2KA6B 1YUBA 2XSZA 2Y21A 4G4QA 1OFIA 4M9ZA 4MH0E 4B3TM 3L25A 2K2JA 2UUCM 5A2QS 1UPQA 1FAOA 3HK0A 4PCZA 2DFKA 3NSUA 3T1HM 1TQZA 3PP2A 3PVWA 4A6FA 2YFQA 2XFSA 2LKOA 3TW1A 4LJ4A 2E2XA 2ELAA 3X23A 4IJFA 3RE8A 4JI7M 4LRSA 4DR1M 4GXBA 5J3YA 3KOZE 2LH0A 3L27A 1E32A 5D3YA 2XFTA 1P6SA 1IN4A 2CV0A 3QAUA 1UNRA 1FGZA 4WJ7A 3SHGB 4CHJA 3L2AA 1ISNA 2CY4A 4LF5M 2BCJA 1IXRC 2R4EA 5ITXE 3U61B 2R09A 1I4WA 4LJ8A 1PMSA 4IBCA 2MWNB 1SXJD 2KEBA 3KY9A 4WSFA 3GLIB 1IBMM 4ZRKA 4DX8A 3PXGA 1NJGA 3SHFA 4B7HA 3CIKA 4HHVA 3WA0A 7CATA 3GO8A 4DV3M 1X1GA 2DKPA 4LF8M 1DYNA 1MIXA 2R45A 1MK9B 4HL4A 4LFBM 2VQFM 4MM3B 2D9VA 1NJFA 1YE9A 4OVZA 1K82A 2DLWA 1QAQA 1TXDA 1FGYA 2G5GX 1QZMA 4II7A 2K00A 3TWLA 1N34M 4RF0A 3GYOA 2M60A 3TO1A 1JR3D 5IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAI A;  4CYE A;  4HAX B;  3PZD A;  3SNH A;  4EMO A;  2EMS A;  1ZVR A;  3RCP A;  3D8E A;  2UVM A;  3FM8 C;  2AL6 A;  1X05 A;  2LYD A;  2W2X C;  2FJL A;  2HTH B;  1ZM0 A;  1MIZ B;  1BTN A;  3DXD A;  3PVU A;  2XQN M;  2I1K A;  1J0W A;  1SHC A;  2EMT A;  1OY2 A;  4WVF B;  4ZRI A;  5EFX A;  3PVL A;  2ZPY A;  5GOW B;  2YF0 A;  1ZSQ A;  4C0A A;  5JHG A;  1XD4 A;  2DYQ A;  2IFS A;  2KGX B;  5C16 A;  1NU2 A;  1K5D B;  4K2O A;  1FOE A;  2N0Y A;  2DN6 A;  1KZ7 A;  4F7G A;  4KHA A;  4ZRJ A;  2ROV A;  1QQG A;  2J0K A;  3ULB A;  3FEH A;  2UZS A;  2H7E A;  1X1F A;  4L6E A;  4GMX B;  2RLO A;  2V76 A;  5FI1 A;  2KUP A;  1XCG A;  1U5D A;  2VKI A;  4GPT B;  1I2H A;  1B55 A;  4YON A;  2LUL A;  1WGU A;  3ZDT A;  2ROZ B;  2Z0O A;  4F7H A;  1X86 A;  2N23 A;  1MK7 B;  1EAZ A;  3KRW A;  2QKM A;  2Q13 A;  3SUZ A;  1FB8 A;  4KVG B;  3BJI A;  1OMW A;  4GN1 A;  2P0F A;  3HQC A;  1AWE A;  2D9X A;  5DHF B;  1UNP A;  5KQ1 A;  3A8Q A;  1SGH A;  1XR0 B;  3HW2 B;  4TKN A;  2D4Q A;  2J0M A;  1BWN A;  4HAY B;  2K2U A;  5DHA B;  2YS1 A;  3IVF A;  3O96 A;  5DH9 B;  3TVV A;  1NI2 A;  2NZ8 B;  2Z0Q A;  3KZ1 A;  2KCJ A;  4HB4 B;  2I5C A;  3SYX A;  3F0W A;  1AQC A;  1MKE A;  1W1G A;  1FHO A;  4DXA B;  3F5R A;  1KI1 B;  2CY5 A;  3GYP A;  4A6K A;  1P3R A;  2CAY A;  3PG7 A;  5JHH A;  2VRW B;  2D9Y A;  4K17 A;  4HAT B;  5FI0 A;  4EKU A;  3QBV B;  2DTC A;  1K5G B;  2J0J A;  5LOP B;  1V88 A;  1N3H A;  5HE2 A;  2MFQ A;  1V5M A;  4F7U P;  1TJ6 A;  1WJ1 A;  5KCV A;  5DIF B;  3LJU X;  2PZ1 A;  4YL8 A;  1H10 A;  2EC1 A;  2P0H A;  1W1D A;  1XOD A;  4HAU B;  2QKL A;  2L1C A;  3ULC A;  1NTV A;  1WVH A;  2LOX A;  1DDV A;  3ODX A;  1GG3 A;  1EGX A;  2H7D A;  1GC6 A;  4Y94 A;  2GCJ A;  4KHO A;  2W2W A;  2RUK B;  2M38 A;  4IAP A;  3M1I B;  1DBH A;  4KHB B;  3U8Z A;  4HB2 B;  1Y19 B;  2DHK A;  1LW3 A;  3FSS A;  2YSZ A;  5L81 A;  1U5E A;  4KAX B;  4TYZ A;  2DA0 A;  1E5W A;  1J19 A;  4MT7 A;  3ODO A;  3KSY A;  5J3Q A;  1V89 A;  2HE7 A;  1WJM A;  2R0D A;  3D8F A;  1RJ2 A;  2DHI A;  1UEF A;  1DRO A;  2D9Z A;  1NTY A;  2DYN A;  5D3X A;  3VOQ A;  3U7D A;  5HE1 A;  2RSG A;  3DXC A;  1IRS A;  1V5U A;  1UPR A;  2Y8G A;  5JP4 A;  1U2B A;  2YS5 A;  2Y8F A;  5C5B A;  4Z2N A;  1ZC4 B;  4K2P A;  1ZC3 B;  4IFS A;  5J3T A;  2DX5 A;  2ELB A;  3AJ4 A;  3TFM A;  2NMB A;  2YS3 A;  1I7A A;  4NY0 A;  2W2X D;  2D2Q A;  1XKE A;  2YRY A;  1WGQ A;  1Y5O A;  1Q67 A;  1PLS A;  2VSZ A;  3G9W A;  1BTK A;  2RNR B;  1U27 A;  2YT0 A;  3D8D A;  2IYB A;  3QIJ A;  2OQB A;  4PNK A;  2MKR A;  2COF A;  1WI1 A;  2ADZ A;  2P8V A;  2EJ8 A;  2Y7B A;  1V61 A;  2JP2 A;  2Z0P A;  2YVC A;  3WYF B;  4A6F B;  4XWX A;  4HAV B;  3VIA A;  5C6R A;  3ODW A;  5C79 A;  2RVB B;  2YT1 A;  2OTX A;  4IOY X;  2DKQ A;  2COA A;  1H4R A;  1V5P A;  2GCL A;  3PSC A;  3SO6 A;  5CLQ B;  2X18 A;  4HAW B;  3P7Z A;  1PFJ A;  1KZG A;  1FHW A;  5HE3 A;  3TCA A;  3MPX A;  1DDW A;  1LB1 A;  1QC6 A;  2COD A;  2RGN B;  4D0N B;  2J59 M;  1DDM A;  2CRF A;  3AU4 A;  1FHX A;  5DI9 B;  2DHJ A;  4PQ0 A;  4HDQ A;  5KQ4 A;  3QWM A;  1U5F A;  2LOZ A;  4Z2M B;  1X11 A;  5D27 A;  3N7C A;  1EF1 A;  1M7E A;  4GZU A;  5HE0 A;  2M14 A;  4A5K A;  1RRP B;  4BBK A;  4DX9 0;  2L2I A;  2COC A;  4NSW A;  2D10 A;  3UZT A;  3BIN A;  4DBB A;  1Z87 A;  1W1H A;  2MDX A;  3MDB C;  4CHM A;  4EJN A;  2I1J A;  3KRX A;  2LG1 A;  5D3W A;  2I5F A;  5C5B B;  5D3V A;  3ZVR A;  5JLJ B;  3P6A A;  4HDO A;  3PEG A;  4HAZ B;  4P7I A;  1WG7 A;  5CLL B;  2D11 A;  1M7R A;  1XX0 A;  4B6H A;  1GC7 A;  3A98 B;  3ML4 A;  2GS0 A;  2P0D A;  4GMV A;  2G35 A;  1U29 A;  4H8S A;  4MK0 A;  2UZR A;  3SV1 A;  3OAN A;  4K81 A;  1UNQ A;  4HB0 B;  3CXB B;  2GJY A;  2AEH A;  2D9W A;  3A8P A;  2DX1 A;  5LON B;  1BAK A;  1P5T A;  1U5G A;  4MY6 A;  1EVH A;  3AU5 A;  4HB3 B;  4A6H A;  1MPH A;  3V5W A;  1OQN A;  3DXE A;  3T06 A;  2K2J A;  3HK0 A;  1UPQ A;  1FAO A;  2DFK A;  3NSU A;  1TQZ A;  3PP2 A;  3PVW A;  4A6F A;  2LKO A;  3TW1 A;  3X23 A;  2E2X A;  2ELA A;  4GXB A;  5J3Y A;  5D3Y A;  1P6S A;  1UNR A;  1FGZ A;  4WJ7 A;  4CHJ A;  1ISN A;  2CY4 A;  2BCJ A;  2R09 A;  1PMS A;  3KY9 A;  4WSF A;  4ZRK A;  4DX8 A;  3CIK A;  3WA0 A;  4HHV A;  1X1G A;  2DKP A;  1DYN A;  1MIX A;  1MK9 B;  2D9V A;  2DLW A;  1TXD A;  1FGY A;  2K00 A;  3TO1 A;  3GYO A;  2MWN B; 
#chains in the Genus database with same CATH topology
 2DXI A;  3PZD A;  3SNH A;  4AKI A;  2JUJ A;  3RCP A;  3D8E A;  3AJI B;  2WSC F;  4LGY A;  4LGM A;  4GC9 A;  2MR9 A;  1Q3C A;  2XZU A;  1TH2 A;  4BB9 A;  2JP7 A;  2HTH B;  4B7G A;  3DXD A;  3PVU A;  2XF3 A;  1S3S A;  2I1K A;  1NNJ A;  1OFH A;  4W5W A;  4WVF B;  3HGI A;  5FTJ A;  2L09 A;  1ZSQ A;  3K2L A;  5JHG A;  2DYQ A;  1KFV A;  2N0Y A;  2DN6 A;  5EP1 A;  1VQ1 A;  1Z5C A;  4FWD A;  2R18 A;  2UUB M;  2ROV A;  3RGP A;  3KS4 A;  2C9C A;  3FEH A;  4JXJ A;  4AKH A;  2OO9 A;  4FCT A;  1Z59 A;  4AW4 A;  2Z0O A;  4DR5 M;  2LWX A;  2XH9 A;  4NL4 H;  1DGF A;  2HCB A;  5H37 D;  3CGW A;  2M5Z A;  3E9S A;  1GO5 A;  5JI2 E;  4L16 A;  3U60 B;  2Q13 A;  3U6D A;  1N33 M;  4LY6 A;  1R4G A;  3EIH A;  4CJ6 A;  2D9X A;  1T3T A;  3TWK A;  2BWE A;  3SAS A;  1IY1 A;  1VDD A;  3HW2 B;  1X37 A;  2J0M A;  3U6M A;  4HAY B;  4XBO A;  2DEN A;  5ITR A;  2YS1 A;  3CTW B;  1GKI A;  3SBJ A;  4DV7 M;  3SYX A;  1AQC A;  4M0W A;  2BJW A;  3QYE A;  4Q7J A;  1D0L A;  1C1K A;  1FHO A;  2NQ8 C;  4FCW A;  4D6W A;  4IIW A;  1G4A E;  2F5S A;  4A6K A;  2CAY A;  3A45 A;  3VDP A;  3AFH A;  4LZZ A;  3DOA A;  2HHH M;  4HAT B;  1XMQ M;  4EKU A;  1K5G B;  3KDS E;  1OAO C;  1V88 A;  3J2P B;  4NC6 A;  2QBY B;  1WJ1 A;  1N75 A;  1P3Q Q;  5KCV A;  1IFY A;  1H10 A;  1XOD A;  3FUX A;  2JZ1 A;  4EIW A;  3KSX A;  5KPZ A;  1E9S A;  2ZAM A;  1XMO M;  1I94 M;  4Y94 A;  3B89 A;  3U6L A;  3J81 S;  4M9X A;  3SAT A;  3FTF A;  3M1I B;  2HKJ A;  3FUT A;  1Y19 B;  2R0I A;  4DR7 M;  4RF1 A;  2H1R A;  4MGZ E;  2F5Q A;  3KOX E;  1E5W A;  3LVV A;  5EP3 A;  4FWG A;  3KSY A;  4ZPX A;  1WJM A;  1N77 A;  1NHG C;  3SYL A;  4PDI A;  1NTY A;  2DYN A;  4A3V B;  5HE1 A;  2JY6 B;  4NXN M;  2V6Z M;  1L2B A;  5EXP A;  2RSG A;  4QJ4 B;  5JP4 A;  3GRR A;  1U2B A;  2L7I A;  2W82 A;  4GIP A;  4B3M M;  3K92 A;  2LBC A;  4DR2 M;  4QOS A;  3L29 A;  4IFS A;  3AJ4 A;  3TFM A;  3TWM A;  1I7A A;  3H4J A;  4OVZ B;  1IXZ A;  2W2X D;  1OJL A;  2K49 A;  2YRY A;  1WGQ A;  1Y5O A;  1Q67 A;  3IHP A;  1BTK A;  1W5T A;  3JR4 A;  1G41 A;  2YT0 A;  3D8D A;  3GLG B;  3QIJ A;  2CP8 A;  4ITQ A;  2DAE A;  4MGI E;  3HZJ A;  1IXS B;  1NHW C;  1WI1 A;  2D7H A;  1JR3 A;  4GHA A;  2A5Y B;  2Z4S A;  4Z6Y A;  1V61 A;  3HWS A;  2YVC A;  3ODW A;  4GEW A;  5C79 A;  2F5P A;  3GQ3 A;  2YQZ A;  3BBZ A;  1V5P A;  2GCL A;  3T38 A;  3PSC A;  2QZ4 A;  3GPU A;  2EKF A;  1QAN A;  3DZD A;  1Z5B A;  3KXE C;  4IBD A;  2R46 A;  5HE3 A;  1NNU C;  3TCA A;  2JY7 A;  4IBI A;  2FJU B;  3JR5 A;  5E6J A;  2DKL A;  2COD A;  4D80 A;  3GLF E;  2RGN B;  5EXT A;  2Z7J A;  2H5X A;  4HDQ A;  4WUR A;  2RGH A;  3CF0 A;  5D27 A;  4XGI A;  1WXQ A;  1QAO A;  1M7E A;  1QYR A;  2M14 A;  1KYI A;  1EE8 A;  2JWS A;  2X4A A;  3IEC A;  3WHL A;  4DBB A;  1IN7 A;  2MDX A;  1E9R A;  3HSA A;  5D3V A;  3ZVR A;  2KRU A;  1SXJ B;  3BOS A;  3GRV A;  4I5S A;  1OAI A;  2D11 A;  1XX0 A;  3GLI E;  1R5L A;  2K47 A;  1M7R A;  4B6H A;  3ILK A;  4MGK E;  3DFZ A;  4NOO B;  2P0D A;  2G35 A;  5BPV A;  2ZKM X;  3QYB A;  2C99 A;  1VEJ A;  5ITY A;  4TUW A;  3NWA A;  3VLF B;  1T43 A;  2MH8 A;  4Y28 F;  1HR0 M;  1IY2 A;  4AI6 A;  3U5Z B;  4YHH M;  1EVH A;  2Y20 A;  3SMP A;  2CV1 A;  1DGH A;  2Z3X A;  2CV2 A;  4B7F A;  2HWJ A;  4WW0 A;  2K2J A;  5A2Q S;  1UPQ A;  1CUK A;  1FAO A;  4PCZ A;  2DFK A;  2DNA A;  3F92 A;  2LKO A;  3TW1 A;  4QXA B;  4LRS A;  3KOZ E;  3L27 A;  2XFT A;  2CV0 A;  3QAU A;  1UNR A;  3SHG B;  3L2A A;  3DCX A;  4LF5 M;  2BCJ A;  1IXR C;  2R09 A;  3KY9 A;  1SXJ D;  3GLI B;  3GO8 A;  3E21 A;  1NJF A;  1TXD A;  1N34 M;  4RF0 A;  3TO1 A;  2L2D A;  1JR3 D;  1MAI A;  4HAX B;  2EMS A;  3B74 A;  2GUM A;  2LVA A;  4GHL A;  3U12 A;  4X65 M;  2Z59 A;  2DHY A;  3FKE A;  3FM8 C;  2AL6 A;  4QJ5 B;  1X05 A;  2W2X C;  2G8L A;  3I4V A;  2Z14 A;  1J0W A;  5FSW A;  4QOZ C;  2DZN B;  1SHC A;  5EFX A;  2YF0 A;  5FTN A;  4L1R A;  1RU3 A;  1HT1 E;  4C0A A;  5KPR A;  4F2L A;  2IFS A;  2L6O A;  3W67 A;  2DWN A;  1NU2 A;  2RRU A;  4B08 A;  3U6P A;  2X49 A;  3LW5 F;  1N78 A;  2UZS A;  2H7E A;  4L6E A;  2CHQ A;  5KQD A;  5FI1 A;  8CAT A;  3VKH A;  1U5D A;  2VKI A;  4GPT B;  2L7H A;  1B55 A;  4YY3 M;  4YON A;  3ZDT A;  4IBB A;  1X86 A;  3FYD A;  3Q8G A;  3U6E A;  4L78 A;  4LFC M;  3KRW A;  1L2D A;  3A46 A;  2QKM A;  2O25 A;  4FD2 A;  2HAK A;  4FW9 A;  1KSF X;  2DAK A;  1FB8 A;  5EJC A;  1NSF A;  4MGY E;  3BJI A;  4GN1 A;  5L8R F;  2QQ8 A;  3HQC A;  4QHS A;  2VII A;  2KZU A;  5DHF B;  5KQ1 A;  3GQ5 A;  2OOB A;  2G3Q A;  4GKJ M;  3E46 A;  1IBL M;  5IRS A;  1OKS A;  4OX9 M;  2K2U A;  5DHA B;  4LF4 M;  1NI2 A;  2FS1 A;  1TR8 A;  2LHC A;  4HB4 B;  1XB2 B;  4IBE A;  3F0W A;  4KT0 F;  1T77 A;  3FTC A;  4JI0 M;  3B77 A;  3L28 A;  5F3W A;  1PJI A;  5IZ7 D;  5LMU M;  5IT9 S;  1OTR A;  2VRW B;  4AG5 A;  2DAI A;  3QBV B;  2FFJ A;  2J0J A;  5LOP B;  3HY5 A;  2MFQ A;  1QQW A;  4F1I A;  3GLF B;  5KQ8 A;  2KXE A;  5DYG A;  2XLJ A;  2L4E A;  2EC1 A;  1W1D A;  1LTM A;  2L1C A;  1NTV A;  1WVH A;  1DDV A;  1N32 M;  3ODX A;  1EGX A;  2DWL A;  3BXW A;  4KHO A;  1UFZ A;  3MMP A;  2Y0T A;  2W2W A;  2RUK B;  4IAP A;  1DBH A;  1HNX M;  3U8Z A;  3GPX A;  1WHC A;  5LMN M;  5EP4 A;  3TPZ A;  4TYZ A;  4LG2 A;  4LCB A;  1WGL A;  1J19 A;  4OW0 A;  4AZF A;  2R65 A;  3ODO A;  3GLG E;  5J3Q A;  4KOD A;  2HE7 A;  2KW0 A;  4I81 A;  5FTK A;  1MX0 A;  3KP0 E;  1TH4 A;  2D9Z A;  4AG6 A;  4CGY B;  3U7D A;  1GVN A;  3SYK A;  3MJ5 A;  3D8L A;  4JYA M;  4I4L A;  3M7G A;  3DXC A;  1V5U A;  3J80 S;  2CFO A;  1ZC4 B;  1Q39 A;  4L8R C;  4CSQ A;  3U6C A;  1GJT A;  2YNM D;  4AQY M;  3SAW A;  3NWF A;  2D2Q A;  1XKE A;  4JN6 A;  3W0L B;  4LRT A;  3G9W A;  4DV5 M;  2UXD M;  2RNR B;  4R7G A;  2RKO A;  3C58 A;  3AV0 A;  2MKR A;  5BR8 M;  3FVC A;  1OIZ A;  1VEG A;  4G3O A;  2ADZ A;  4KO8 A;  2P8V A;  1ZMU A;  2QEN A;  2Z0P A;  3WYF B;  4M9S A;  4XWX A;  1QUS A;  3SAU A;  3KW6 A;  5C6R A;  1TGU A;  2RVB B;  4IOY X;  2ZAO A;  3NBI A;  3KP1 E;  3FTE A;  1DGH B;  1H4R A;  3UK6 A;  5KPT A;  3FRH A;  3SO6 A;  5I2M A;  3P7Z A;  1PM5 A;  4DV4 M;  3R8F A;  1E94 E;  1KZG A;  5EXX A;  1FHW A;  1J09 A;  3J7B A;  2JXN A;  5ITQ A;  3C9P A;  1QC6 A;  1QZE A;  2J59 M;  3HX3 A;  4Z8X A;  2DHJ A;  1SXJ C;  3GQ4 A;  1X11 A;  1N36 M;  3N7C A;  2V1U A;  1LV7 A;  5HE0 A;  3HHZ A;  1RRP B;  4BBK A;  2E5L M;  2X8A A;  4GRI A;  1SXJ A;  3SFZ A;  3A42 A;  2Y0Q A;  3UZT A;  4DV1 M;  2XZF A;  4CHT B;  3MDB C;  2I7P A;  2LVN C;  5C5B B;  3PEG A;  2LNH C;  1TF0 B;  2ZM6 M;  3UZU A;  2GS0 A;  3FUU A;  3ZH9 B;  4G4N A;  2LVP C;  1U29 A;  4H8S A;  5FLX S;  1XXH B;  4IBJ A;  1ZV1 A;  2VQE M;  2NBV A;  3T6P A;  3CF6 E;  1UNQ A;  3LQQ A;  3B7Q A;  1ORY B;  2GJY A;  5LON B;  3HHX A;  5JI3 E;  4LF6 M;  1R2Y A;  3FYC A;  2C5R A;  3TL4 X;  4REZ A;  1OQN A;  1ZMW A;  2K6B A;  1WIV A;  2KA6 B;  1YUB A;  2XSZ A;  4B3T M;  4G4Q A;  1OFI A;  3L25 A;  3NSU A;  3T1H M;  3PP2 A;  4DR1 M;  1Y8G A;  5J3Y A;  1E32 A;  5D3Y A;  1P6S A;  1IXS A;  1FGZ A;  3FRI A;  5ITX E;  1PMS A;  4IBC A;  4WSF A;  4ZRK A;  3PXG A;  1NJG A;  4LF8 M;  5DFL A;  2D9V A;  1YE9 A;  4OVZ A;  1K82 A;  2G5G X;  1QZM A;  4II7 A;  4QJ3 B;  3FE3 A;  4EMO A;  2CWB A;  1XNQ M;  4QHT A;  1SG9 A;  3GRY A;  4LZJ A;  4R3D A;  1Z6T A;  2CEA A;  4MB7 A;  2JY8 A;  5C18 A;  1PJQ A;  2XQN M;  2UUA M;  2KDL A;  3M6A A;  1Q3B A;  1G59 A;  5IWA M;  4ZRI A;  2ZPY A;  1XD4 A;  2DZO B;  4L15 A;  2KGX B;  5C16 A;  1K5D B;  1L8Q A;  2YR0 A;  3PFI A;  4K2O A;  4D82 A;  1DGG A;  1NY5 A;  1NV8 A;  1HQY E;  4KHA A;  3AL0 C;  1QQG A;  3TQS A;  4GMX B;  2KUP A;  4IBF A;  3FD9 A;  3KVW A;  1WGU A;  2ROZ B;  1MK7 B;  2QBY A;  2F4V M;  3SUZ A;  2OOA A;  3PNV A;  4KVG B;  2ZTD A;  3GLH B;  2P0F A;  1XXH A;  3QWL A;  2BJV A;  1V92 A;  1J5E M;  4NSO B;  1GJS A;  3I4Y A;  1GLN A;  3A8Q A;  5E26 A;  1PGY A;  3DA1 A;  3AOG A;  4K0K M;  2EUC A;  4TKN A;  2D4Q A;  1BWN A;  2UXB M;  1L1Z A;  1AIP C;  2NZ8 B;  2Z0Q A;  3KZ1 A;  4LJ9 A;  2BWB A;  3ZCB B;  3UJN A;  3HJQ A;  2I5C A;  4LF7 M;  3D8B A;  1QVR A;  4DR6 M;  1MKE A;  1W1G A;  2DVW B;  3LVW A;  2CY5 A;  3GYP A;  4NSR A;  1P3R A;  1MN3 A;  2GQF A;  4K17 A;  5FI0 A;  3UGJ A;  4KHP M;  5ITT A;  3R9X B;  3VFD A;  3H4M A;  3J7A S;  3U60 A;  1YSY A;  1NVM A;  5DIF B;  3LJU X;  4NRW A;  3NWD A;  2PZ1 A;  2EKK A;  5DNY A;  4HAU B;  2QKL A;  1QUT A;  2LOX A;  2QHO B;  2H7D A;  1MU5 A;  1WJ7 A;  1D2N A;  1GC6 A;  1PJJ A;  2GCJ A;  4X66 M;  4DR3 M;  3HIE A;  3HJ8 A;  5ITX A;  3LCV B;  4JI3 M;  2M38 A;  4KHB B;  4S12 A;  3OTO M;  2I7N A;  3FSS A;  3IG8 A;  1J7K A;  5L81 A;  4JV5 M;  3W68 A;  1U5E A;  4KAX B;  2DA0 A;  4MT7 A;  3HHY A;  3RGS A;  3T15 A;  1V89 A;  3HKP A;  3THG A;  4LF9 M;  2R0D A;  3D8F A;  2DHI A;  5M4Y B;  5D3X A;  2XEP A;  3VOQ A;  4DBG B;  1T6O A;  1A5T A;  3FTD A;  1IRS A;  2V1C A;  4GC5 A;  5FTM A;  4K2P A;  1R7R A;  3LMM A;  3MK6 A;  5J3T A;  2R6F A;  2ELB A;  2NMB A;  2YS3 A;  1TH3 A;  4NY0 A;  2J7N A;  3OHM B;  2KHH A;  2J7O A;  2N35 A;  2VSZ A;  1L2C A;  1JR3 E;  4PNK A;  4PDG A;  4PD2 A;  3U6O A;  2Y7B A;  2OPF A;  2JP2 A;  1Q02 A;  4A6F B;  4HAV B;  3VIA A;  4JI1 M;  1XWI A;  5DYI A;  1SXJ E;  2OTX A;  1JB0 F;  1R6B X;  2DZL A;  4JI6 M;  4HAW B;  2ZTC A;  4KLN A;  2CHG A;  1C7Y A;  4NRV A;  1PFJ A;  4LJ5 A;  3GLF A;  3B7N A;  5FTL A;  4HLQ A;  2LHG A;  2OQ4 A;  3E4R A;  4D0N B;  2K0B X;  1VDL A;  2ERC A;  4PQ0 A;  5KQ4 A;  1DGB A;  2CE7 A;  3QWM A;  1L1T A;  1U5F A;  1ZMV A;  2LTU A;  1EF1 A;  2LXE A;  4A5K A;  3VK8 A;  3FUV A;  2EA0 A;  1NV9 A;  4LFA M;  1QDR A;  2D10 A;  3BIN A;  4M0D A;  3Q8X A;  1JQJ C;  3GPP A;  1XNR M;  4RKU F;  1W1H A;  2WSE F;  4LJ7 A;  4EJN A;  2I1J A;  4IBK A;  4HAZ B;  2YT2 A;  1V34 A;  4GOU A;  1XC8 A;  1GC7 A;  2FOI C;  2KNV A;  2UZR A;  3SV1 A;  1FJG M;  1DV0 A;  5GKN A;  4BLC A;  3RFW A;  1VG5 A;  4K81 A;  2DX1 A;  2BNK A;  1P5T A;  5I2S A;  1U5G A;  4KHB A;  1OQY A;  2QCU A;  4MY6 A;  3AU5 A;  4HB3 B;  3JAM S;  4A6H A;  3V5W A;  4DIX A;  3T06 A;  1R2Z A;  5C1B A;  2Y21 A;  4M9Z A;  2UUC M;  2LVQ D;  1TQZ A;  2KIG A;  3RE8 A;  4GXB A;  4HEO A;  2B3T A;  4CHJ A;  2K8E A;  1OIP A;  3U61 B;  1I4W A;  3CIK A;  3WA0 A;  3C3E A;  4R71 A;  4HHV A;  2WZJ A;  4DV3 M;  2FH0 A;  2QSF X;  1MIX A;  2R45 A;  1MK9 B;  4HL4 A;  4LFB M;  4MM3 B;  1FGY A;  2K00 A;  3GYO A;  4PT5 A;  2MWN B;  2M60 A;  1AUA A;  4CYE A;  3HHW A;  2L4F A;  4GKK M;  1ZVR A;  1HJP A;  4D81 A;  2CHV A;  2R4J A;  2LVO C;  4GH9 A;  2DHR A;  4AKG A;  2Z13 A;  4OSN A;  2UVM A;  4GIT A;  3SC3 A;  3VKG A;  3HU1 A;  2LYD A;  1G8P A;  4FCV A;  1NO1 A;  2FJL A;  1ZM0 A;  1MIZ B;  1BTN A;  2KRK A;  3I51 A;  3TE6 A;  4G6Z A;  4DV2 M;  4WP2 A;  3GLI A;  3U6S A;  1UM8 A;  2EMT A;  1OY2 A;  2HL7 A;  2VF8 A;  3PVL A;  5GOW B;  2C9O A;  3KS8 A;  4RNA A;  3GLH A;  3PVS A;  3C3D A;  1FOE A;  4DUZ M;  3NW8 A;  3T1Y M;  1XHB A;  3SAR A;  1KZ7 A;  4F7G A;  4ZRJ A;  2J0K A;  3ULB A;  4B3S M;  1X1F A;  2RLO A;  2V76 A;  1XCG A;  3WHK A;  4GNK B;  1I2H A;  3AOE C;  2FNA A;  2LUL A;  3U5Z A;  4X62 M;  4F7H A;  2N23 A;  1IY0 A;  1EAZ A;  2AHM A;  3EIE A;  2C96 A;  1QDT A;  4DV6 M;  2KZS A;  1PRB A;  2KNA A;  3K1J A;  1YLA A;  1OMW A;  3IG5 A;  3GP1 A;  1AWE A;  4I8O A;  1GAB A;  1WGN A;  3L26 A;  1UNP A;  1SGH A;  1XR0 B;  2JNH A;  3HJS A;  2QP9 X;  1TTE A;  4DUY M;  2KR0 A;  3GLH E;  2RRF A;  4MGH A;  4FWH A;  3IVF A;  3O96 A;  3AKZ A;  5DH9 B;  3TVV A;  1IN5 A;  2KCJ A;  4IJE A;  3LCU A;  3SMS A;  3W0F A;  3A58 A;  4JI2 M;  1HNW M;  2XGN A;  3NWL A;  3VDU A;  2DWM A;  3F5R A;  2JY5 A;  4DXA B;  2K9D A;  1KI1 B;  2ZBK B;  2O01 F;  4B3R M;  3SAV A;  4QNR A;  3PG7 A;  5JHH A;  3FUW A;  2RGO A;  4OU7 A;  1XXH E;  3K8Z A;  2F5O A;  2D9Y A;  1TDZ A;  2WSF F;  2DTC A;  1W5S A;  1ZYI A;  1Z5A A;  1N3H A;  5HE2 A;  2KIE A;  1MJG M;  2Z8Y M;  2XSZ D;  1V5M A;  1TJ6 A;  4F7U P;  4YL8 A;  2P0H A;  1WR1 B;  2KUQ A;  3B7Z A;  3ULC A;  2R44 A;  2EJS A;  1GG3 A;  1NY6 A;  3UMM A;  3KOY E;  4CIS A;  1FNN A;  3ZC7 B;  1G3I A;  5EQT A;  3HU2 A;  2MGW A;  2CRU A;  5EP2 A;  3ZQJ A;  2R2Y A;  1ZAE A;  4HB2 B;  2O5R A;  2DHK A;  1LW3 A;  2APL A;  4OT1 A;  4DV0 M;  3GLG A;  2YSZ A;  2ZAN A;  3KFU G;  1D0K A;  2EO2 A;  1IQP A;  3V76 A;  1V33 A;  2DAG A;  3GRU A;  1EFU B;  2Z4R A;  1DO0 A;  1RJ2 A;  1UEF A;  1DRO A;  4LJA A;  1D0M A;  3K9P A;  1DO2 A;  3GPY A;  1K3X A;  4X64 M;  1UPR A;  2Y8G A;  1F4I A;  2YS5 A;  3LQR A;  2Y8F A;  5C5B A;  4Z2N A;  2F5N A;  4IBG A;  2MRO B;  1ZC3 B;  2GNO A;  2DX5 A;  4G4R A;  4JI4 M;  4DR4 M;  2MJ5 B;  1IN6 A;  1PLS A;  4GMQ A;  4CIZ A;  4HSI A;  1U27 A;  3U6Q A;  3U61 A;  2IYB A;  2DAM A;  2DI0 A;  2OQB A;  2VF7 A;  3NBX X;  2COF A;  4JI5 M;  2EJ8 A;  4L6V 6;  2KNZ A;  2R62 A;  4QNM A;  5KO3 A;  2YT1 A;  4NXM M;  2DKQ A;  1VEK A;  4G4O A;  1PJT A;  2COA A;  4JI8 M;  1EIJ A;  1IN8 A;  1IBK M;  2JA2 A;  3CF2 A;  3AOE A;  5CLQ B;  2X18 A;  3KSJ A;  2VDB B;  3VK7 A;  1GL6 A;  3MPX A;  1DDW A;  1LB1 A;  1H6U A;  5EXS A;  2QPA A;  3J27 B;  1DDM A;  2D7G A;  2CRF A;  3AU4 A;  1FHX A;  5DI9 B;  1HT2 E;  2LOZ A;  4Z2M B;  1MI1 A;  1HNZ M;  3I04 M;  4GZU A;  2DWZ B;  4DX9 0;  2L2I A;  2COC A;  4NSW A;  2Z4D A;  2CUZ A;  1Z87 A;  1ZQ9 A;  2J5Y A;  1GL7 A;  4CHM A;  3KRX A;  1HQC A;  2LG1 A;  5D3W A;  4LJ6 A;  2I5F A;  3K9O A;  5LG4 B;  2UU9 M;  5JLJ B;  3P6A A;  4XK8 F;  2FE8 A;  4HDO A;  4FVM A;  4P7I A;  5ITU A;  4P17 A;  1WG7 A;  5CLL B;  1TDH A;  1QAM A;  3A98 B;  3ML4 A;  3MHV C;  4P16 A;  2P5T A;  3B9P A;  4GMV A;  4MK0 A;  2UXC M;  3M0E A;  4ANR A;  4L4U A;  1K3W A;  3OAN A;  2Q2E B;  1G71 A;  4HB0 B;  3CXB B;  1IM2 A;  2AEH A;  2C98 A;  2D9W A;  3A8P A;  2QNJ A;  1BAK A;  4BBA A;  3HU3 A;  2D7E A;  1BVS A;  3PNY A;  1MPH A;  3KOW E;  3DXE A;  4MH0 E;  3HK0 A;  3PVW A;  4A6F A;  2YFQ A;  2XFS A;  4LJ4 A;  2E2X A;  2ELA A;  3X23 A;  4IJF A;  4JI7 M;  1PJS A;  2LH0 A;  1IN4 A;  4WJ7 A;  3I01 M;  1ISN A;  2CY4 A;  2R4E A;  4LJ8 A;  2KEB A;  1IBM M;  4DX8 A;  3SHF A;  4B7H A;  7CAT A;  1X1G A;  2DKP A;  4UN2 B;  1DYN A;  2JZ0 A;  2VQF M;  2DLW A;  1QAQ A;  3TWL A;  5IRE B; 
#chains in the Genus database with same CATH homology
 1MAI A;  4CYE A;  2DXI A;  4HAX B;  3HHW A;  3PZD A;  3SNH A;  4EMO A;  4AKI A;  2EMS A;  4GKK M;  1ZVR A;  3RCP A;  4GHL A;  3D8E A;  1XNQ M;  4QHT A;  4X65 M;  3AJI B;  4D81 A;  2CHV A;  2R4J A;  3GRY A;  4GH9 A;  4LZJ A;  4R3D A;  1Z6T A;  2DHR A;  2CEA A;  4LGY A;  4AKG A;  4LGM A;  4GIT A;  2UVM A;  3SC3 A;  3FKE A;  3FM8 C;  4GC9 A;  2AL6 A;  4MB7 A;  3VKG A;  1X05 A;  3HU1 A;  2LYD A;  2W2X C;  1G8P A;  4FCV A;  1Q3C A;  2XZU A;  1TH2 A;  2FJL A;  4BB9 A;  2HTH B;  4B7G A;  1ZM0 A;  5C18 A;  1MIZ B;  1BTN A;  3DXD A;  3PVU A;  2KRK A;  2XQN M;  3I51 A;  3TE6 A;  4G6Z A;  2G8L A;  2XF3 A;  3I4V A;  4DV2 M;  2UUA M;  1S3S A;  2I1K A;  1J0W A;  1NNJ A;  1OFH A;  5FSW A;  3GLI A;  3U6S A;  1UM8 A;  3M6A A;  4W5W A;  1Q3B A;  2DZN B;  1G59 A;  4QOZ C;  1SHC A;  1OY2 A;  2HL7 A;  5IWA M;  2EMT A;  3HGI A;  3PVL A;  2ZPY A;  4WVF B;  2C9O A;  5FTJ A;  2L09 A;  3KS8 A;  5FTN A;  1ZSQ A;  2YF0 A;  5GOW B;  1HT1 E;  3K2L A;  4C0A A;  5KPR A;  5JHG A;  1XD4 A;  2DZO B;  4L15 A;  2DYQ A;  2IFS A;  2L6O A;  2DWN A;  4RNA A;  3GLH A;  3PVS A;  2KGX B;  5C16 A;  1KFV A;  1NU2 A;  1K5D B;  1L8Q A;  2YR0 A;  3PFI A;  4K2O A;  1FOE A;  4D82 A;  1DGG A;  4DUZ M;  2N0Y A;  3T1Y M;  2DN6 A;  5EP1 A;  1NY5 A;  1XHB A;  4B08 A;  3SAR A;  1Z5C A;  4FWD A;  3U6P A;  2R18 A;  1KZ7 A;  4F7G A;  1HQY E;  2X49 A;  4KHA A;  1N78 A;  4ZRJ A;  3AL0 C;  2UUB M;  2ROV A;  1QQG A;  2J0K A;  3RGP A;  3KS4 A;  2C9C A;  3ULB A;  3FEH A;  3TQS A;  2UZS A;  4JXJ A;  4B3S M;  1X1F A;  2H7E A;  4GMX B;  4L6E A;  4AKH A;  2CHQ A;  2RLO A;  4FCT A;  5KQD A;  2V76 A;  5FI1 A;  2KUP A;  8CAT A;  3VKH A;  1XCG A;  3WHK A;  1U5D A;  1Z59 A;  2VKI A;  1I2H A;  2L7H A;  4GPT B;  3AOE C;  2FNA A;  4IBF A;  1B55 A;  4YY3 M;  3FD9 A;  4AW4 A;  3KVW A;  2LUL A;  1WGU A;  3U5Z A;  4X62 M;  2ROZ B;  2Z0O A;  4DR5 M;  3ZDT A;  4IBB A;  4F7H A;  1X86 A;  2N23 A;  1MK7 B;  2LWX A;  3FYD A;  2XH9 A;  1IY0 A;  1EAZ A;  2AHM A;  3EIE A;  3U6E A;  4L78 A;  4LFC M;  4NL4 H;  3KRW A;  1DGF A;  2HCB A;  1L2D A;  3A46 A;  5H37 D;  2QKM A;  2M5Z A;  3E9S A;  2QBY A;  4FD2 A;  2C96 A;  2F4V M;  5JI2 E;  4FW9 A;  4L16 A;  3U60 B;  2Q13 A;  4DV6 M;  3SUZ A;  2KZS A;  1KSF X;  3U6D A;  3PNV A;  5EJC A;  4LY6 A;  1N33 M;  1FB8 A;  3K1J A;  4KVG B;  1NSF A;  3EIH A;  4MGY E;  3BJI A;  1OMW A;  3IG5 A;  3GLH B;  4GN1 A;  3GP1 A;  2P0F A;  1XXH A;  3QWL A;  2BJV A;  3HQC A;  1AWE A;  2D9X A;  1T3T A;  4I8O A;  2VII A;  4QHS A;  1J5E M;  4NSO B;  2KZU A;  3I4Y A;  3L26 A;  3TWK A;  5DHF B;  1GLN A;  1UNP A;  5KQ1 A;  3A8Q A;  5E26 A;  3DA1 A;  3GQ5 A;  3SAS A;  1IY1 A;  1VDD A;  3AOG A;  1SGH A;  1XR0 B;  4K0K M;  3HJS A;  2QP9 X;  3HW2 B;  4DUY M;  2EUC A;  4GKJ M;  1X37 A;  1IBL M;  4TKN A;  4ZRI A;  4MGH A;  2D4Q A;  1BWN A;  2J0M A;  4FWH A;  3U6M A;  2UXB M;  4HAY B;  4XBO A;  4OX9 M;  2K2U A;  5DHA B;  1L1Z A;  5ITR A;  2YS1 A;  3IVF A;  3O96 A;  4LF4 M;  3CTW B;  3AKZ A;  5DH9 B;  3TVV A;  1GKI A;  1NI2 A;  2NZ8 B;  2Z0Q A;  1IN5 A;  3KZ1 A;  3SBJ A;  4LJ9 A;  3ZCB B;  2KCJ A;  5J3Q A;  4IJE A;  3UJN A;  3SMS A;  4HB4 B;  4DV7 M;  3HJQ A;  2I5C A;  4LF7 M;  3F0W A;  4IBE A;  3W0F A;  3SYX A;  1AQC A;  4M0W A;  4JI2 M;  3D8B A;  1QVR A;  2BJW A;  1HNW M;  4DR6 M;  1MKE A;  3FTC A;  1W1G A;  4JI0 M;  2XGN A;  4MT7 A;  3L28 A;  1FHO A;  1C1K A;  3NWL A;  3VDU A;  5F3W A;  2DWM A;  3F5R A;  4DXA B;  2NQ8 C;  4FCW A;  2DVW B;  1KI1 B;  4IIW A;  1PJI A;  2ZBK B;  3LVW A;  5IZ7 D;  1G4A E;  2CY5 A;  3GYP A;  4NSR A;  5LMU M;  2F5S A;  4B3R M;  5IT9 S;  1P3R A;  4A6K A;  3SAV A;  4QNR A;  2CAY A;  3PG7 A;  5JHH A;  3FUW A;  2RGO A;  3A45 A;  4OU7 A;  2VRW B;  3K8Z A;  2F5O A;  4AG5 A;  3VDP A;  3AFH A;  4LZZ A;  2D9Y A;  4K17 A;  3DOA A;  2HHH M;  4HAT B;  5FI0 A;  1XMQ M;  3UGJ A;  1TDZ A;  4EKU A;  3QBV B;  2FFJ A;  4KHP M;  1K5G B;  2DTC A;  5ITT A;  3R9X B;  2J0J A;  3VFD A;  3H4M A;  1W5S A;  5EFX A;  5LOP B;  3KDS E;  1V88 A;  3J7A S;  3U60 A;  1Z5A A;  1YSY A;  3J2P B;  1N3H A;  5HE2 A;  2MFQ A;  2QBY B;  1NVM A;  1QQW A;  2XSZ D;  1V5M A;  1TJ6 A;  1WJ1 A;  4F7U P;  1N75 A;  3GLF B;  5KCV A;  5KQ8 A;  2KXE A;  5DYG A;  5DIF B;  2XLJ A;  3LJU X;  4NRW A;  2PZ1 A;  4YL8 A;  1H10 A;  2EC1 A;  2P0H A;  5DNY A;  1W1D A;  1XOD A;  3FUX A;  4HAU B;  2QKL A;  4EIW A;  2L1C A;  3ULC A;  3KSX A;  1NTV A;  5KPZ A;  1WVH A;  2LOX A;  1DDV A;  1N32 M;  3ODX A;  1GG3 A;  1NY6 A;  1E9S A;  2ZAM A;  1EGX A;  1XMO M;  3UMM A;  3KOY E;  2H7D A;  4CIS A;  1MU5 A;  1D2N A;  1I94 M;  2DWL A;  1GC6 A;  4Y94 A;  1FNN A;  3ZC7 B;  1PJJ A;  2GCJ A;  4KHO A;  1G3I A;  4X66 M;  5EQT A;  3HU2 A;  3U6L A;  3J81 S;  4DR3 M;  2Y0T A;  2W2W A;  3HJ8 A;  4M9X A;  3SAT A;  5EP2 A;  5ITX A;  2RUK B;  3FTF A;  4JI3 M;  2M38 A;  4IAP A;  3M1I B;  1DBH A;  2HKJ A;  1HNX M;  4KHB B;  1ZAE A;  4HB2 B;  2O5R A;  4YON A;  3GPX A;  3U8Z A;  4S12 A;  3FUT A;  1Y19 B;  1LW3 A;  2DHK A;  3OTO M;  2I7N A;  4DR7 M;  4RF1 A;  4DV0 M;  3IG8 A;  2H1R A;  3GLG A;  3FSS A;  1J7K A;  2YSZ A;  5LMN M;  4MGZ E;  5EP4 A;  5L81 A;  4JV5 M;  3TPZ A;  1U5E A;  4LG2 A;  2F5Q A;  2ZAN A;  4LCB A;  3KFU G;  4KAX B;  4TYZ A;  3KOX E;  2DA0 A;  1E5W A;  2EO2 A;  1J19 A;  4OW0 A;  1IQP A;  3LVV A;  5EP3 A;  4AZF A;  2R65 A;  4FWG A;  3HHY A;  3RGS A;  3KSY A;  3ODO A;  3T15 A;  4KOD A;  3HKP A;  3THG A;  2KW0 A;  4ZPX A;  1V89 A;  3GRU A;  4I81 A;  1WJM A;  2HE7 A;  1N77 A;  5FTK A;  4LF9 M;  2Z4R A;  2R0D A;  1MX0 A;  1DO0 A;  1RJ2 A;  2DHI A;  1NHG C;  3KP0 E;  3SYL A;  1UEF A;  1TH4 A;  4PDI A;  2D9Z A;  1NTY A;  1DRO A;  2DYN A;  2XEP A;  4A3V B;  5D3X A;  3VOQ A;  4LJA A;  4AG6 A;  4CGY B;  3U7D A;  1GVN A;  5HE1 A;  3SYK A;  3MJ5 A;  3D8L A;  4JYA M;  4NXN M;  1DO2 A;  4I4L A;  3M7G A;  3FTD A;  3GPY A;  2V6Z M;  1K3X A;  1L2B A;  5EXP A;  2RSG A;  3DXC A;  4X64 M;  1IRS A;  1V5U A;  2V1C A;  3J80 S;  1UPR A;  2Y8G A;  5JP4 A;  3GRR A;  1U2B A;  2YS5 A;  3LQR A;  2L7I A;  2Y8F A;  2W82 A;  4GC5 A;  5C5B A;  4GIP A;  4B3M M;  4Z2N A;  2CFO A;  5FTM A;  1Q39 A;  3K92 A;  2F5N A;  1R7R A;  4L8R C;  1ZC4 B;  4DR2 M;  4K2P A;  4IBG A;  3LMM A;  3U6C A;  4QOS A;  3L29 A;  3MK6 A;  1ZC3 B;  4IFS A;  5J3T A;  2DX5 A;  2YNM D;  4G4R A;  2ELB A;  3AJ4 A;  3TFM A;  2NMB A;  4AQY M;  3TWM A;  4JI4 M;  1I7A A;  4OVZ B;  2YS3 A;  3SAW A;  1IXZ A;  1TH3 A;  4DR4 M;  2W2X D;  4NY0 A;  2J7N A;  1OJL A;  2D2Q A;  1XKE A;  2YRY A;  4JN6 A;  1WGQ A;  1Y5O A;  1Q67 A;  3W0L B;  1IN6 A;  2J7O A;  4LRT A;  1PLS A;  2VSZ A;  4GMQ A;  1BTK A;  3G9W A;  1W5T A;  3JR4 A;  4DV5 M;  2UXD M;  2RNR B;  1G41 A;  1U27 A;  1L2C A;  3U6Q A;  3GLG B;  2YT0 A;  3D8D A;  3U61 A;  2IYB A;  3QIJ A;  4R7G A;  2RKO A;  3C58 A;  4ITQ A;  2OQB A;  3AV0 A;  4PNK A;  2MKR A;  4PDG A;  5BR8 M;  4JI5 M;  2COF A;  4MGI E;  1WI1 A;  1IXS B;  1NHW C;  2ADZ A;  2D7H A;  4KO8 A;  4PD2 A;  1JR3 A;  2P8V A;  3U6O A;  4GHA A;  2EJ8 A;  2A5Y B;  2Z4S A;  2Y7B A;  2QEN A;  4Z6Y A;  2OPF A;  1V61 A;  2JP2 A;  2Z0P A;  3HWS A;  2YVC A;  3WYF B;  4A6F B;  2R62 A;  4M9S A;  4XWX A;  4HAV B;  4QNM A;  3D8F A;  3SAU A;  3VIA A;  3KW6 A;  4JI1 M;  5C6R A;  3ODW A;  1TGU A;  5C79 A;  1XWI A;  5DYI A;  1SXJ E;  5KO3 A;  2RVB B;  2F5P A;  2OTX A;  2YT1 A;  4IOY X;  4NXM M;  2ZAO A;  2DKQ A;  4G4O A;  3GQ3 A;  2COA A;  3NBI A;  2YQZ A;  3KP1 E;  3FTE A;  1DGH B;  1H4R A;  3UK6 A;  4JI8 M;  1V5P A;  1R6B X;  2GCL A;  3T38 A;  3PSC A;  2QZ4 A;  1IN8 A;  5KPT A;  3GPU A;  1IBK M;  2JA2 A;  3CF2 A;  3AOE A;  3SO6 A;  5CLQ B;  2X18 A;  3KSJ A;  1QAN A;  3DZD A;  4JI6 M;  4HAW B;  3P7Z A;  1PM5 A;  1Z5B A;  4KLN A;  2CHG A;  3KXE C;  4DV4 M;  3R8F A;  4IBD A;  4NRV A;  1E94 E;  1KZG A;  5EXX A;  2R46 A;  3VK7 A;  4LJ5 A;  3GLF A;  1FHW A;  5HE3 A;  1J09 A;  1GL6 A;  1NNU C;  5FTL A;  3TCA A;  3J7B A;  4HLQ A;  3MPX A;  2OQ4 A;  1DDW A;  4IBI A;  1LB1 A;  3JR5 A;  5ITQ A;  5E6J A;  1H6U A;  3E4R A;  5EXS A;  1QC6 A;  2QPA A;  2COD A;  3J27 B;  4D80 A;  2RGN B;  4D0N B;  2J59 M;  5EXT A;  2ERC A;  1DDM A;  2Z7J A;  2D7G A;  2CRF A;  3AU4 A;  4Z8X A;  1FHX A;  5DI9 B;  1HT2 E;  2DHJ A;  4PQ0 A;  1SXJ C;  4HDQ A;  5KQ4 A;  1DGB A;  2CE7 A;  4WUR A;  3QWM A;  1L1T A;  1U5F A;  3GQ4 A;  2LOZ A;  2RGH A;  3CF0 A;  4Z2M B;  1X11 A;  1N36 M;  5D27 A;  3N7C A;  1HNZ M;  4XGI A;  1LV7 A;  1WXQ A;  1QAO A;  2V1U A;  1EF1 A;  2LXE A;  1QYR A;  1M7E A;  2M14 A;  4GZU A;  5HE0 A;  4A5K A;  2DWZ B;  3VK8 A;  3HHZ A;  1KYI A;  1RRP B;  4BBK A;  2E5L M;  1EE8 A;  2X8A A;  4GRI A;  3FUV A;  2EA0 A;  2L2I A;  4DX9 0;  1SXJ A;  2COC A;  3SFZ A;  4NSW A;  3A42 A;  2X4A A;  4LFA M;  2Y0Q A;  2D10 A;  3UZT A;  3BIN A;  3WHL A;  2CUZ A;  4M0D A;  3Q8X A;  4DV1 M;  1JQJ C;  3GPP A;  2XZF A;  1Z87 A;  1XNR M;  4DBB A;  1ZQ9 A;  1W1H A;  1IN7 A;  4CHT B;  2MDX A;  1GL7 A;  3MDB C;  4CHM A;  4LJ7 A;  4EJN A;  2I1J A;  1E9R A;  1HQC A;  2I7P A;  2LG1 A;  3KRX A;  5D3W A;  4LJ6 A;  2I5F A;  5C5B B;  2UU9 M;  4IBK A;  5D3V A;  2KRU A;  1SXJ B;  3BOS A;  3GRV A;  3P6A A;  3ZVR A;  5JLJ B;  2FE8 A;  4I5S A;  4HDO A;  4FVM A;  3PEG A;  4HAZ B;  2LNH C;  5ITU A;  4P7I A;  1WG7 A;  5CLL B;  2ZM6 M;  1TDH A;  2D11 A;  1QAM A;  1XC8 A;  1M7R A;  2K47 A;  3UZU A;  1XX0 A;  1GC7 A;  3A98 B;  3ILK A;  4MGK E;  4B6H A;  3ML4 A;  2GS0 A;  3MHV C;  2FOI C;  3FUU A;  3ZH9 B;  4P16 A;  3DFZ A;  4NOO B;  4G4N A;  1PFJ A;  2P0D A;  2P5T A;  3B9P A;  4GMV A;  2G35 A;  1U29 A;  4H8S A;  4MK0 A;  4PT5 A;  3M0E A;  5FLX S;  2UXC M;  1XXH B;  2UZR A;  5BPV A;  4L4U A;  1FJG M;  3SV1 A;  4IBJ A;  1K3W A;  3OAN A;  2VQE M;  2Q2E B;  5GKN A;  3RFW A;  4BLC A;  2C99 A;  5ITY A;  4K81 A;  3CF6 E;  4TUW A;  1UNQ A;  4HB0 B;  3LQQ A;  3CXB B;  1ORY B;  2GJY A;  1IM2 A;  3VLF B;  2AEH A;  2C98 A;  2D9W A;  3A8P A;  2DX1 A;  2BNK A;  5LON B;  1BAK A;  4BBA A;  1HR0 M;  3HU3 A;  3HHX A;  1P5T A;  1IY2 A;  5JI3 E;  1U5G A;  4LF6 M;  1R2Y A;  4AI6 A;  2D7E A;  2QCU A;  4YHH M;  3U5Z B;  4MY6 A;  1EVH A;  3AU5 A;  4HB3 B;  3PNY A;  3JAM S;  2Y20 A;  3SMP A;  2CV1 A;  3FYC A;  1MPH A;  1DGH A;  2C5R A;  3TL4 X;  4A6H A;  4REZ A;  2Z3X A;  3KOW E;  3V5W A;  2CV2 A;  1OQN A;  4B7F A;  1R2Z A;  3DXE A;  3T06 A;  4WW0 A;  5C1B A;  2KA6 B;  1YUB A;  2XSZ A;  2Y21 A;  4G4Q A;  1OFI A;  4M9Z A;  4MH0 E;  4B3T M;  3L25 A;  2K2J A;  2UUC M;  5A2Q S;  1UPQ A;  1FAO A;  3HK0 A;  4PCZ A;  2DFK A;  3NSU A;  3T1H M;  1TQZ A;  3PP2 A;  3PVW A;  4A6F A;  2YFQ A;  2XFS A;  2LKO A;  3TW1 A;  4LJ4 A;  2E2X A;  2ELA A;  3X23 A;  4IJF A;  3RE8 A;  4JI7 M;  4LRS A;  4DR1 M;  4GXB A;  5J3Y A;  3KOZ E;  2LH0 A;  3L27 A;  1E32 A;  5D3Y A;  2XFT A;  1P6S A;  1IN4 A;  2CV0 A;  3QAU A;  1UNR A;  1FGZ A;  4WJ7 A;  3SHG B;  4CHJ A;  3L2A A;  1ISN A;  2CY4 A;  4LF5 M;  2BCJ A;  1IXR C;  2R4E A;  5ITX E;  3U61 B;  2R09 A;  1I4W A;  4LJ8 A;  1PMS A;  4IBC A;  2MWN B;  1SXJ D;  2KEB A;  3KY9 A;  4WSF A;  3GLI B;  1IBM M;  4ZRK A;  4DX8 A;  3PXG A;  1NJG A;  3SHF A;  4B7H A;  3CIK A;  4HHV A;  3WA0 A;  7CAT A;  3GO8 A;  4DV3 M;  1X1G A;  2DKP A;  4LF8 M;  1DYN A;  1MIX A;  2R45 A;  1MK9 B;  4HL4 A;  4LFB M;  2VQF M;  4MM3 B;  2D9V A;  1NJF A;  1YE9 A;  4OVZ A;  1K82 A;  2DLW A;  1QAQ A;  1TXD A;  1FGY A;  2G5G X;  1QZM A;  4II7 A;  2K00 A;  3TWL A;  1N34 M;  4RF0 A;  3GYO A;  2M60 A;  3TO1 A;  1JR3 D;  5IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...