3A98B

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
190
Chain Sequence
SGPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 46
structure length 190
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.920 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a98B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a98B02
1FB8A 5C6RA 3CIKA 2DHKA 3KRXA 1X86A 3TW1A 2GS0A 4CHJA 1SHCA 2RGNB 2YRYA 2YSZA 4YONA 1U5FA 2GCJA 3NSUA 1UPQA 5JHGA 2VRWB 1EGXA 3GYOA 2COCA 1WJ1A 2R0DA 4MT7A 1X1GA 2YF0A 1OY2A 2Z0PA 2CY4A 1GC6A 2MKRA 3AU4A 3RCPA 3O96A 5KQ4A 3D8FA 2EC1A 1QQGA 2DHIA 2Z0OA 3G9WA 5FI1A 2HTHB 2ROZB 1ISNA 2MFQA 2P0HA 1U5DA 1V88A 4EJNA 1DDWA 3FM8C 3HK0A 2D9VA 3CXBB 4ZRJA 3KZ1A 4CHMA 4K81A 5HE0A 4Y94A 5LOPB 1MKEA 2J0KA 3OANA 2ADZA 2J0MA 1K5GB 2Y8FA 4D0NB 3ZVRA 4KHBB 4C0AA 1X11A 1XKEA 1WGQA 4Z2NA 1M7RA 1SGHA 2Z0QA 2EMSA 1ZC4B 2MDXA 3ODXA 2YS5A 4F7GA 2DX1A 4DXAB 3ODOA 1FHOA 1WVHA 1FHXA 2H7EA 1TXDA 5J3YA 5LONB 5DHAB 3WA0A 2DA0A 4HAXB 4P7IA 3PG7A 1RJ2A 2ZPYA 1KZ7A 4F7HA 3SYXA 3SNHA 3PSCA 2DX5A 1XD4A 4GPTB 2NMBA 2DN6A 1LW3A 2MWNB 1V5UA 1FAOA 2DFKA 2DYNA 2L2IA 2H7DA 2W2XC 3PZDA 5D3VA 1FOEA 2D9WA 3V5WA 1MK9B 4ZRIA 5D3YA 1EAZA 1WGUA 2UZRA 5KQ1A 1MPHA 3AJ4A 2COFA 2D11A 4H8SA 3N7CA 2EMTA 2YVCA 2KUPA 4GN1A 3MDBC 2D9YA 1U5GA 2QKMA 2DHJA 3D8DA 4GZUA 1GG3A 1OQNA 2UZSA 5D27A 4HATB 2N0YA 3MPXA 2N23A 1P5TA 4MY6A 1B55A 1ZSQA 5GOWB 5C5BA 1H10A 5D3XA 5KCVA 1U27A 3VOQA 4KVGB 2D9XA 2K2JA 5C79A 1N3HA 2XQNM 4WJ7A 3U7DA 2LYDA 2LULA 2P0FA 1DYNA 1X05A 1Y5OA 2RLOA 1BTKA 1U5EA 1X1FA 2CAYA 2JP2A 4HAUB 4HB4B 4PQ0A 5HE2A 2J59M 3HW2B 1UPRA 1KZGA 2KGXB 1V89A 2UVMA 3PVUA 3AU5A 4BBKA 4GMXB 2VKIA 3IVFA 3SV1A 4A6FA 3HQCA 4HAZB 4KAXB 3WYFB 4K2PA 2LOXA 3QBVB 3DXDA 4WSFA 3LJUX 3TCAA 1UNQA 4B6HA 4DX90 2YT1A 1I2HA 2EJ8A 3TO1A 2PZ1A 5FI0A 5C5BB 4HAVB 2D10A 1K5DB 2D2QA 2LG1A 4KHAA 1V5PA 1GC7A 1W1HA 4PNKA 2COAA 3F0WA 2AL6A 4IFSA 1DROA 3T06A 1MK7B 2K2UA 1P6SA 3ODWA 1BAKA 1RRPB 2DKPA 4EMOA 2DYQA 2GCLA 3PVLA 2P0DA 1NI2A 4K17A 3UZTA 2CODA 3BINA 5J3QA 5CLLB 1E5WA 3SUZA 1FGYA 2R09A 2BCJA 2FJLA 2Q13A 2D9ZA 2RSGA 4KHOA 1DDMA 2KCJA 2ROVA 2YT0A 1FHWA 1DBHA 4HAYB 1TJ6A 2E2XA 4NY0A 2M14A 4Z2MB 5DHFB 1J19A 1DDVA 2W2XD 2GJYA 3ULCA 1AWEA 2I1KA 2OTXA 3ML4A 3P6AA 3KRWA 3TVVA 2Y8GA 2IFSA 2Y7BA 4HB2B 1PFJA 3M1IB 2W2WA 3A98B 2VSZA 1NTVA 3X23A 4HDQA 3FEHA 4IOYX 2RVBB 3U8ZA 1H4RA 1W1GA 2ELAA 1PMSA 2I5CA 1U2BA 1EVHA 2CY5A 1LB1A 4TYZA 4DX8A 1BWNA 5J3TA 1TQZA 4YL8A 1MIZB 2G35A 3DXEA 5DIFB 4A6KA 1P3RA 3KY9A 5JLJB 1AQCA 2AEHA 2I1JA 1V5MA 2YS3A 1I7AA 2HE7A 4MK0A 1U29A 5C16A 2LKOA 1Z87A 1J0WA 2QKLA 4IAPA 3A8PA 3PVWA 2CRFA 4HB3B 1M7EA 3VIAA 3QWMA 1IRSA 5DH9B 3KSYA 2P8VA 4XWXA 3ULBA 4GMVA 5CLQB 1UEFA 1ZVRA 1NU2A 3D8EA 2IYBA 3A8QA 2I5FA 5L81A 1WG7A 2RNRB 1XR0B 3BJIA 4EKUA 3TFMA 5HE1A 4TKNA 3DXCA 1MAIA 4L6EA 1KI1B 1Q67A 1WI1A 5JHHA 3PP2A 4A6FB 2X18A 4ZRKA 2NZ8B 2J0JA 4HAWB 1BTNA 4WVFB 4HDOA 4NSWA 1XX0A 2RUKB 2L1CA 2DKQA 1OMWA 5HE3A 4F7UP 2DTCA 3SO6A 2ELBA 5DI9B 4K2OA 3GYPA 3FSSA 1ZC3B 2K00A 3PEGA 4CYEA 1FGZA 1XODA 1QC6A 2V76A 4GXBA 1V61A 1XCGA 4A6HA 1NTYA 1MIXA 2M38A 2YS1A 1Y19B 5D3WA 2LOZA 2DLWA 3ZDTA 1W1DA 4A5KA 4HB0B 3F5RA 5JP4A 5EFXA 4HHVA 3QIJA 1ZM0A 1PLSA 3P7ZA 1UNRA 1EF1A 2D4QA 4DBBA 1WJMA 1UNPA 2OQBA
chains in the Genus database with same CATH superfamily
1FB8A 3W68A 3MHVC 3CIKA 4JV5M 1HQCA 4M9XA 4KO8A 1HNZM 2YRYA 1TH4A 1K82A 2F5SA 4FW9A 4PT5A 3HU2A 1UM8A 2CHQA 2BNKA 3AOEC 4OX9M 2K6BA 1YLAA 1EGXA 1WJ1A 2R0DA 4L15A 2V1UA 3JR5A 2CY4A 3SARA 3FYCA 3U5ZB 2MKRA 1IXRC 3A42A 3O96A 3C58A 4Z6YA 1I4WA 2V1CA 2DHIA 2Z4SA 3AOEA 1IM2A 2MFQA 2P0HA 3J81S 1U5DA 2J7NA 5DYIA 2LTUA 3PFIA 4Y94A 5LOPB 3U6LA 2R45A 1G3IA 1IBLM 1MJGM 4MM3B 4D0NB 2QSFX 3M7GA 1XKEA 4NXNM 1E9SA 2Z0QA 4EIWA 2EMSA 1P3QQ 1ZC4B 2JNHA 2DX1A 1FHOA 3GPPA 5BR8M 4GNKB 3H4JA 2UUBM 2DA0A 2FNAA 4HAXB 4P7IA 1F4IA 1KZ7A 3H4MA 1R2YA 4LFCM 4GPTB 1SXJB 2HHHM 1N33M 1FAOA 2DFKA 2C5RA 1ZMVA 2FOIC 3FE3A 3C3EA 2D7HA 1FOEA 2D9WA 1MK9B 4G3OA 2R0IA 1EAZA 2UZRA 3MMPA 5FTJA 3T38A 2WSCF 1DO2A 3N7CA 1EIJA 2KUPA 4GN1A 3MDBC 2DAEA 3GLFB 2D9YA 3LCVB 4L16A 4GZUA 1GG3A 2UZSA 5D27A 1XMOM 1C1KA 3D8LA 2UXBM 3MPXA 3GPYA 2J7OA 1ZSQA 4JYAM 2QHOB 3NBIA 2XLJA 1T3TA 5LMNM 1FNNA 5KCVA 1U27A 2K2JA 4MGKE 3KDSE 2ZBKB 3U6PA 2HKJA 3KSJA 3U6EA 1QZEA 3QYEA 1DYNA 1X1FA 1Y5OA 2L6OA 2O01F 2JP2A 2OPFA 4G4RA 4PQ0A 2I7NA 1KZGA 2MROB 4BBKA 4GMXB 3HQCA 4HAZB 5L8RF 5M4YB 2CFOA 1SXJC 3DXDA 1UNQA 2WSFF 2EJ8A 1W5TA 2DHYA 2KZUA 3K8ZA 5FI0A 2D10A 1K5DB 2D2QA 2LG1A 5FTNA 1V5PA 3GLIE 3U5ZA 2X8AA 1VEJA 1WXQA 2LVOC 4LRSA 3F0WA 1ZQ9A 1RRPB 4B3RM 4NL4H 2DYQA 2VIIA 3PVLA 2P0DA 4OW0A 3KOZE 2QQ8A 3B7QA 3DFZA 1WHCA 3SUZA 1FGYA 3MJ5A 2BCJA 2UXCM 2Q13A 1QVRA 2RSGA 3HHWA 4IBDA 3E9SA 3NWDA 1TF0B 1FHWA 1DBHA 1TJ6A 4B3SM 4NY0A 2JY5A 4Z2MB 1D0LA 3B74A 2XH9A 2BWBA 2L7HA 4CISA 2JWSA 4BLCA 1TGUA 4LJ7A 3KS8A 1D0KA 1OKSA 4P16A 3SAUA 1NTVA 3X23A 1HT2E 2RVBB 4JI7M 2QNJA 1U2BA 3KOXE 4AI6A 5KPRA 5JI3E 2ZKMX 3ZH9B 2VQEM 1BWNA 2L2DA 4LF8M 2KNVA 4GIPA 2FE8A 4A6KA 1P3RA 1XXHE 3FRIA 1AQCA 2AEHA 2YS3A 3FKEA 1M7EA 2R2YA 1IRSA 4Y28F 5LG4B 2Y0TA 1LTMA 2KRUA 1L1ZA 2JA2A 3LQRA 3A8QA 3FUWA 3B9PA 1WG7A 1QYRA 1XHBA 5KPZA 1OAIA 2ZAMA 3VKHA 2DVWB 3SASA 1MAIA 3I51A 3MK6A 3TL4X 4QJ5B 1V34A 5EP2A 1R7RA 1VEGA 4R71A 2JY7A 2BJVA 2NZ8B 4ZRKA 4IBKA 3W0LB 5DYGA 4FWHA 3L25A 2RUKB 2L1CA 5IRSA 4BBAA 2DWZB 4X65M 2XFTA 2DTCA 4JI8M 1TH3A 2O5RA 1E94E 1OIZA 3GPXA 2FFJA 3CF6E 1T43A 3C9PA 2E5LM 4GXBA 2XZUA 1NTYA 5ITTA 4MGIE 4WURA 2DLWA 3ZDTA 3L29A 3AFHA 2ZAOA 4KODA 3M0EA 4GC9A 3QIJA 2YQZA 2DAGA 3HHYA 1EF1A 2Q2EB 1DGFA 1WJMA 1QQWA 5KQDA 1ZV1A 2BJWA 2R44A 2DHKA 3GRVA 3KRXA 4LZJA 3SHFA 1IXSA 2YSZA 2DWMA 4YONA 3C3DA 2K49A 3NWFA 3A45A 2I7PA 2GCJA 3U6SA 2VRWB 2HWJA 1ZMWA 2DZLA 4GMQA 4AZFA 4MT7A 1X1GA 1OY2A 5C1BA 2YT2A 1GC6A 3RCPA 3AU4A 2ZM6M 3RFWA 3THGA 5FTLA 4GITA 4M0DA 2EC1A 2Y0QA 5ITRA 1UFZA 1QQGA 2HTHB 4UN2B 3GLGE 4FCTA 5A2QS 1JQJC 4FWDA 1V88A 1DDWA 2FJUB 4DR4M 4ZRJA 4CHMA 3U6CA 3AJIB 3I01M 2J0KA 1CUKA 2J0MA 4JI1M 1DO0A 1K5GB 2Y8FA 3JR4A 2LVPC 2C9OA 3KP1E 3HJQA 1AIPC 3V76A 1ZAEA 3B7NA 2MDXA 3JAMS 3U60B 3AV0A 1WVHA 2H7EA 4AKIA 4LGMA 3WA0A 4FCVA 3PG7A 2KA6B 2KXEA 4F7HA 1MU5A 3PNVA 1DV0A 1XD4A 2LVQD 2NMBA 2DN6A 4W5WA 5KO3A 2QBYA 3PZDA 4QJ4B 4B3MM 1IN6A 3OHMB 4WP2A 1WGUA 1MPHA 5EQTA 2O25A 3GLIB 3GQ5A 2EMTA 4FD2A 3Q8XA 2M60A 4KT0F 3LCUA 3FTDA 2DENA 3T6PA 4HATB 2N23A 4YY3M 1B55A 4CSQA 1Z5AA 5C5BA 4I4LA 1H10A 3F92A 2H5XA 4AG6A 2Z4DA 1NY6A 4QNRA 3FUTA 1N3HA 4WJ7A 3U7DA 2RRUA 1X05A 1SXJA 2YR0A 1S3SA 2Z7JA 1KFVA 1UPRA 1VG5A 2ERCA 3KXEC 1E9RA 4NOOB 2FH0A 3PVUA 3AU5A 2W82A 4REZA 1G71A 2VKIA 4M9SA 2Z4RA 3OTOM 2KIEA 2JXNA 4WSFA 3QBVB 3E21A 4DX90 2YT1A 4ANRA 5C5BB 3ILKA 4KHAA 4LF9M 1GC7A 4IBJA 3HSAA 2COAA 2UUCM 4F2LA 2GUMA 3T06A 1MK7B 2K2UA 3SYKA 1P6SA 3U61A 1BAKA 4NRWA 1J09A 2DKPA 2Z13A 1V92A 2OOBA 2R4EA 4HEOA 4NC6A 2CODA 5J3QA 3DZDA 4OT1A 1E5WA 1L2DA 1R5LA 2R6FA 5EP3A 4DV6M 2VQFM 2R09A 1NNUC 2QP9X 3NW8A 4F1IA 3GLHA 2YT0A 4HAYB 1IN4A 2GNOA 3U60A 3L26A 3FTFA 2E2XA 3U6MA 5I2SA 3TPZA 2M14A 2DXIA 1DGBA 1J19A 4GOUA 5ITXA 4OSNA 2DAIA 3SMSA 3HZJA 3Q8GA 2CV1A 3HIEA 3TVVA 3UZUA 2IFSA 3ZC7B 2VSZA 4LG2A 4HDQA 3FEHA 5EJCA 4HSIA 3LMMA 4B08A 1PMSA 3A46A 4X62M 4WW0A 3J7BA 1GLNA 2KEBA 2Y20A 4YL8A 5DIFB 3DXEA 4L6V6 3KY9A 5JLJB 1I7AA 2HE7A 4MK0A 5C16A 2F5NA 1HQYE 5DFLA 4IAPA 3A8PA 2CRFA 5ITQA 4HB3B 3TQSA 2CEAA 2MH8A 2P8VA 2Z8YM 1IY1A 3LVWA 1ZVRA 1L2BA 2Z14A 2XEPA 1DGHB 4JI2M 1NU2A 1QANA 2K9DA 4HL4A 4NSRA 3UK6A 2DWLA 2L7IA 1OFHA 3QWLA 4QHSA 1T77A 3TFMA 5HE1A 3DXCA 1IQPA 4L6EA 1SG9A 1KI1B 1WI1A 5KQ8A 4A6FB 2J0JA 4DUYM 3AKZA 3B7ZA 1BTNA 4NSWA 1XX0A 2KHHA 1PRBA 2DKQA 2M5ZA 3U61B 2DWNA 3AL0C 2CRUA 4L78A 2ELBA 5DI9B 2KZSA 1PJSA 1LV7A 1WGLA 4QJ3B 5E26A 1VDDA 1XWIA 4CYEA 1XODA 1XXHA 1DGHA 4IJFA 1QC6A 3J27B 4OU7A 3EIHA 3A58A 3NBXX 4R7GA 2LHGA 3GLGB 2QENA 2CV0A 1MIXA 3U12A 2KDLA 3VFDA 1W1DA 4A5KA 4IJEA 2QCUA 1TTEA 1R6BX 2CE7A 1Q02A 1N36M 1UNRA 4DBBA 2OQBA 4DIXA 4NSOB 4CJ6A 4JI0M 4XGIA 1YSYA 2KUQA 1X86A 3HHZA 4PCZA 2GS0A 4X66M 4GKJM 4JI5M 3KW6A 4CHJA 2ZANA 1SHCA 2RGNB 1TDHA 2EKFA 4QXAB 1U5FA 2LVNC 1GL6A 5EXXA 3NSUA 1UPQA 2ZTDA 4B3TM 3GYOA 2COCA 1JR3D 4G4QA 2Z0PA 1GJSA 4OVZB 3GLIA 2UXDM 3GRYA 3I04M 1WR1B 4KHPM 4NXMM 3G9WA 4IBIA 2ROZB 1ISNA 1YUBA 2CHVA 1MX0A 4LFAM 1ORYB 1QUSA 4EJNA 2QBYB 3HK0A 3FM8C 5JI2E 3SMPA 2D9VA 2DHRA 3CXBB 3KZ1A 2GQFA 2KIGA 5IWAM 4BB9A 4JXJA 3OANA 4DV5M 4C0AA 1X11A 1WGQA 2RKOA 4Z2NA 1SGHA 2DZNB 3ODOA 3IECA 1FHXA 2OO9A 1QAQA 2EUCA 5LONB 4GHAA 2C9CA 4D81A 2ZPYA 3SYXA 1TR8A 5ITYA 1NO1A 3L27A 4AG5A 2AHMA 5GKNA 1DGGA 1HR0M 2MWNB 1V5UA 4B7FA 4HLQA 1XB2B 1N34M 4QHTA 5D3VA 2W2XC 3UJNA 1L2CA 2KR0A 4LGYA 2C96A 3VKGA 1K3XA 1QAOA 4ZRIA 5D3YA 4X64M 1HJPA 5KQ1A 2COFA 2RGHA 4XBOA 1PJJA 2DAKA 5FLXS 2X49A 2L09A 3FVCA 4H8SA 3GP1A 3HWSA 1Z5CA 1GKIA 3T1YM 2DHJA 2UUAM 2VF8A 3K9OA 1OQNA 3T15A 1HNWM 4AKGA 3TE6A 4LF4M 1Q39A 2VF7A 3QAUA 3ZCBB 4RF0A 1OQYA 1QAMA 5GOWB 1XC8A 3VOQA 4KVGB 5C79A 4LJ8A 3DOAA 2LULA 2DKLA 1OJLA 1R4GA 2RLOA 1BTKA 4HAUB 4M9ZA 1XNRM 3W67A 2KGXB 2UVMA 4LY6A 4GRIA 3KP0E 1H6UA 3SAWA 1D2NA 5EXTA 3IVFA 3SV1A 2RRFA 4K2PA 3KOWE 2LOXA 2HAKA 4DV0M 1I2HA 1N32M 3RE8A 3TO1A 3TWLA 2X4AA 3PNYA 2JZ0A 4DV1M 4YHHM 4CGYB 3CGWA 5ITXE 2HL7A 2NBVA 1W1HA 2J5YA 3GO8A 3FYDA 1DROA 4IFSA 3ODWA 2K47A 4EMOA 1WJ7A 4K0KM 1SXJE 3UZTA 1NJFA 1HT1E 3EIEA 2CHGA 2FJLA 4LJ6A 4KHOA 3HY5A 3IHPA 2KCJA 2ROVA 1NJGA 1GL7A 4Q7JA 2Z59A 3FRHA 3ZQJA 1EE8A 4FWGA 2APLA 4GC5A 1DDVA 2W2XD 2GJYA 3ULCA 2OTXA 2EKKA 2Y8GA 2XSZA 2Y21A 2Y7BA 3M6AA 2MGWA 4DUZM 3U6OA 1PFJA 3A98B 3NWAA 4AW4A 1GVNA 1G59A 3W0FA 4GKKM 4IBCA 1NNJA 1H4RA 2LWXA 1W1GA 3TWKA 2LHCA 2XFSA 2P5TA 1IXSB 3GLGA 4JI4M 3HJSA 2I5CA 1EVHA 2CY5A 1IN8A 3J2PB 4TYZA 4DX8A 3RGSA 1PJIA 5J3TA 4FCWA 4DR3M 1G8PA 4CIZA 1G41A 1MIZB 3UMMA 2G35A 1GABA 1ZYIA 4KHBA 1IN5A 1EFUB 1SXJD 1W5SA 3SATA 2LKOA 1J0WA 1IBKM 2CV2A 3VIAA 1BVSA 4L8RC 3QWMA 1MI1A 1XXHB 5CLQB 4DV3M 2IYBA 3SHGB 5BPVA 2I5FA 5L81A 2RNRB 1XR0B 3SAVA 4LJ9A 3BJIA 2JZ1A 2MR9A 2JUJA 4QOSA 3KFUG 4TKNA 4GH9A 1RU3A 1Q67A 3PP2A 2C99A 4HAWB 3FUXA 4D80A 3BBZA 4HDOA 4GHLA 1J7KA 2ZTCA 1OMWA 4LJ5A 4K2OA 2L4FA 3GYPA 3FSSA 3SFZA 2CUZA 3PEGA 3KS4A 3GRUA 2V76A 4ITQA 1V61A 4A6HA 3U6QA 3GQ3A 1Y19B 5D3WA 2LOZA 1N77A 4HB0B 3F5RA 3AOGA 2A5YB 5JP4A 5EFXA 1PLSA 2WSEF 3P7ZA 2LH0A 2D4QA 2WZJA 2UU9M 3BXWA 1J5EM 1JR3A 2JY6B 3HHXA 1Z5BA 3VLFB 5C6RA 3VDUA 4XK8F 4QOZC 3WHLA 3TW1A 4DR1M 3CF0A 2LVAA 1GJTA 4DV2M 4G6ZA 4Z8XA 3BOSA 3U6DA 3K1JA 1OIPA 5JHGA 2LNHC 1PGYA 2YF0A 3E4RA 2K0BX 4DR5M 4B7GA 4LFBM 5KQ4A 3D8FA 3PXGA 4AKHA 2XF3A 4G4NA 2Z0OA 5FI1A 2NQ8C 3IG8A 7CATA 3KOYE 2B3TA 3DA1A 4CHTB 3NWLA 4R3DA 5FTKA 1QZMA 1GO5A 4RKUF 4K81A 5HE0A 1WIVA 3FTCA 1MKEA 2KNZA 4MGHA 2ADZA 4IBEA 1Y8GA 2C98A 3LQQA 4LJAA 3ZVRA 5KPTA 4KHBB 1M7RA 4IIWA 3HKPA 5LMUM 1V33A 4LRTA 1NSFA 3ODXA 3R9XB 4M0WA 1OAOC 2YS5A 4F7GA 4DXAB 1C7YA 1IY2A 1TH2A 3HGIA 1TXDA 2D7EA 5J3YA 5DHAB 4PD2A 4OVZA 1L1TA 1RJ2A 1TDZA 2KNAA 1FJGM 3SNHA 3QYBA 4TUWA 1QDTA 5EP1A 3PSCA 4D6WA 2N35A 2DX5A 2JY8A 3SC3A 4MGYE 1LW3A 1OFIA 2L4EA 2YFQA 3CTWB 5IZ7D 3K2LA 2DYNA 2L2IA 5F3WA 2H7DA 2V6ZM 3V5WA 3SBJA 1JB0F 3AJ4A 2D11A 1Z59A 4IBBA 4MB7A 4DR7M 5E6JA 3FTEA 2YVCA 1NHWC 2R18A 3TWMA 1U5GA 2QKMA 3D8DA 3HU3A 1K3WA 2G8LA 2DI0A 4I5SA 2DZOB 2YNMD 5IREB 1NVMA 2H1RA 2LBCA 2LXEA 2N0YA 4LF6M 4JI3M 1P5TA 2G5GX 4MY6A 2R4JA 5D3XA 1Q3BA 4LF5M 4ZPXA 2QPAA 4MH0E 2D9XA 1Z6TA 1R2ZA 1N75A 2XQNM 5ITUA 4LJ4A 2LYDA 1KYIA 2P0FA 2Z3XA 3VDPA 3J7AS 1XNQM 1OTRA 1IFYA 1U5EA 2CAYA 2CWBA 4HB4B 5HE2A 2J59M 3HW2B 3UGJA 4KLNA 1V89A 3I4YA 1G4AE 4D82A 3GLFA 3L28A 3VK7A 4A6FA 5DNYA 4JN6A 4KAXB 2R62A 3DCXA 3WYFB 5I2MA 3LJUX 3TCAA 5FSWA 4B6HA 1AUAA 2FS1A 2PZ1A 2BWEA 4HAVB 3RGPA 3I4VA 3J80S 4PNKA 2AL6A 1VDLA 4FVMA 1A5TA 3R8FA 4P17A 2GCLA 2D7GA 4NRVA 1NI2A 4K17A 3FUVA 4PDIA 3BINA 2K8EA 5CLLB 3GLFE 3IG5A 4LZZA 1PM5A 3HJ8A 2RGOA 3KSXA 4L1RA 5C18A 4GEWA 4IBFA 2QZ4A 2D9ZA 1QUTA 2R65A 4LCBA 1DDMA 3L2AA 4MGZE 4G4OA 2CP8A 2OQ4A 4S12A 1VQ1A 2XZFA 3SYLA 5DHFB 1XMQM 4B7HA 1VEKA 1AWEA 2I1KA 3ML4A 3P6AA 1WGNA 1NV9A 3KRWA 4I8OA 4DBGB 4HB2B 3M1IB 2W2WA 3D8BA 4DV7M 1IY0A 4IOYX 3FUUA 3U8ZA 2ELAA 1QDRA 3E46A 1PJQA 5H37D 1E32A 2F5QA 5IT9S 1LB1A 4DR6M 3KVWA 3LW5F 1I94M 3CF2A 5EXPA 1TQZA 1IBMM 3LVVA 2EJSA 1NV8A 1Q3CA 2DAMA 1PJTA 2I1JA 1V5MA 3HX3A 1U29A 3B77A 2XGNA 1Z87A 4DV4M 2QKLA 3PVWA 3WHKA 4DR2M 2HCBA 5DH9B 1IXZA 3KSYA 4XWXA 4LF7M 3FD9A 3ULBA 4GMVA 1UEFA 1L8QA 2VDBB 3PVSA 3D8EA 3B89A 2G3QA 1MN3A 2XSZD 4EKUA 3K92A 2F5PA 4RF1A 1NHGC 4IBGA 2KW0A 2OOAA 3GQ4A 1ZMUA 5JHHA 3GLHE 1HNXM 3HU1A 8CATA 2X18A 3GPUA 1NY5A 1YE9A 4WVFB 4II7A 2EA0A 2JP7A 5EXSA 5HE3A 4F7UP 2EO2A 2F5OA 3SO6A 1KSFX 5FTMA 4JI6M 5EP4A 1T6OA 1ZC3B 2K00A 2F4VM 2R46A 1FGZA 4I81A 4L4UA 3K9PA 4A3VB 1XCGA 4QNMA 2M38A 2YS1A 1X37A 1N78A 1IN7A 2DNAA 4RNAA 1D0MA 2KRKA 3T1HM 3GRRA 2MJ5B 4HHVA 3VK8A 1ZM0A 4AQYM 3GLHB 4PDGA 1JR3E 1UNPA
chains in the Genus database with same CATH topology
2UU9M 2BJWA 4NSOB 3MHVC 1FB8A 1J5EM 4JI0M 1JR3A 4XGIA 3HHXA 1YSYA 1Z5BA 3VLFB 5C6RA 3CIKA 4JV5M 2DHKA 3GRVA 1X86A 3VDUA 3KRXA 4QOZC 3HHZA 3WHLA 3TW1A 4PCZA 1HQCA 4DR1M 4LZJA 2GS0A 4X66M 3CF0A 4GKJM 4M9XA 4JI5M 4KO8A 1HNZM 3KW6A 3SHFA 2RNRB 4CHJA 2ZANA 1SHCA 2RGNB 2YRYA 1TDHA 1TH4A 4DV2M 1K82A 2DWMA 2YSZA 4YONA 2F5SA 4FW9A 4G6ZA 3HU2A 4PT5A 1U5FA 1UM8A 3A45A 4Z8XA 2CHQA 2BNKA 3BOSA 3AOEC 4OX9M 2I7PA 1GL6A 2GCJA 5EXXA 3NSUA 3U6DA 3K1JA 1UPQA 3U6SA 4B3TM 5JHGA 2VRWB 1EGXA 3GYOA 2COCA 1JR3D 2LNHC 1WJ1A 4GMQA 4AZFA 2R0DA 4MT7A 1X1GA 2YF0A 4L15A 4G4QA 2V1UA 1OY2A 5C1BA 3JR5A 3E4RA 3SARA 2CY4A 3FYCA 2Z0PA 1GC6A 3U5ZB 4DR5M 2MKRA 3AU4A 3RCPA 4OVZB 1IXRC 3A42A 4B7GA 4LFBM 2ZM6M 3GLIA 3RFWA 3THGA 3C58A 3O96A 5FTLA 4GITA 4M0DA 5KQ4A 3D8FA 2UXDM 3GRYA 4Z6YA 2EC1A 2Y0QA 5ITRA 1I4WA 3PXGA 4KHPM 1QQGA 2V1CA 4NXMM 4AKHA 2Z4SA 2DHIA 2XF3A 4G4NA 2Z0OA 3AOEA 4IBIA 3G9WA 5FI1A 1IM2A 2NQ8C 2HTHB 1ISNA 2ROZB 1YUBA 4FCTA 2CHVA 1MX0A 3IG8A 5A2QS 1JQJC 4LFAM 3KOYE 7CATA 3J81S 4FWDA 2MFQA 1U5DA 1V88A 1ORYB 2J7NA 4EJNA 2QBYB 3DA1A 5DYIA 1DDWA 5JI2E 3FM8C 3HK0A 3SMPA 4CHTB 2D9VA 2DHRA 3NWLA 4DR4M 4R3DA 3PFIA 5FTKA 1V5UA 3CXBB 3KZ1A 1QZMA 3U6CA 4K81A 4CHMA 5IWAM 4BB9A 4JXJA 4Y94A 3AJIB 5HE0A 3U6LA 5LOPB 1MKEA 3FTCA 2J0KA 2R45A 1G3IA 4MGHA 2ADZA 3OANA 2J0MA 1IBLM 4IBEA 4JI1M 2C98A 1DO0A 3LQQA 4MM3B 4LJAA 4DV5M 3M7GA 5KPTA 1K5GB 2Y8FA 1X11A 4KHBB 1WGQA 1XKEA 3JR4A 4C0AA 2RKOA 4NXNM 1M7RA 4Z2NA 2C9OA 4IIWA 1SGHA 3KP1E 1E9SA 3HJQA 3HKPA 2Z0QA 5LMUM 4EIWA 1ZAEA 2EMSA 4LRTA 1ZC4B 1NSFA 2MDXA 3ODXA 3JAMS 3R9XB 3U60B 4M0WA 2YS5A 4F7GA 2DX1A 4DXAB 2DZNB 1IY2A 3AV0A 3ODOA 3GPPA 1TH2A 1WVHA 1FHOA 1FHXA 3HGIA 4AKIA 1TXDA 5BR8M 2H7EA 2D7EA 2UUBM 1QAQA 2EUCA 5J3YA 4GHAA 5LONB 4LGMA 5DHAB 4PD2A 4OVZA 3WA0A 2DA0A 2FNAA 4HAXB 2C9CA 4FCVA 4P7IA 4D81A 1L1TA 3PG7A 1RJ2A 2ZPYA 1KZ7A 1TDZA 2KA6B 2KXEA 4F7HA 3H4MA 3SYXA 1FJGM 1MU5A 3PNVA 1R2YA 4TUWA 5EP1A 4LFCM 5ITYA 3PSCA 3SNHA 2DX5A 1XD4A 3L27A 4AG5A 2AHMA 5GKNA 1DGGA 4GPTB 3SC3A 2NMBA 4MGYE 2DN6A 1SXJB 1LW3A 1HR0M 2HHHM 1OFIA 2MWNB 4W5WA 2YFQA 3CTWB 4B7FA 4HLQA 5IZ7D 5KO3A 2QBYA 1N33M 2C5RA 1N34M 1FAOA 2DFKA 3K2LA 4QHTA 2DYNA 2L2IA 5F3WA 2FOIC 2H7DA 2W2XC 2D7HA 2V6ZM 3PZDA 1FOEA 2D9WA 3V5WA 3UJNA 1L2CA 4B3MM 3SBJA 4LGYA 1MK9B 2C96A 1IN6A 3VKGA 1K3XA 1QAOA 4ZRIA 5D3YA 1EAZA 4X64M 1WGUA 2UZRA 5KQ1A 1MPHA 3AJ4A 2COFA 1Z59A 2D11A 5EQTA 5FTJA 2RGHA 4IBBA 4XBOA 5FLXS 1PJJA 2X49A 3T38A 2L09A 4MB7A 1DO2A 3GLIB 4DR7M 3N7CA 3GP1A 3GQ5A 2EMTA 4H8SA 4FD2A 5E6JA 3FTEA 3HWSA 2KUPA 2YVCA 1Z5CA 4GN1A 1GKIA 3ZVRA 1NHWC 3Q8XA 3GLFB 3MDBC 2D9YA 4L16A 2R18A 3TWMA 1U5GA 3T1YM 2QKMA 2DHJA 3D8DA 3HU3A 1K3WA 2UUAM 1GG3A 4GZUA 2G8LA 2M60A 1OQNA 2UZSA 3T15A 1HNWM 4AKGA 4I5SA 2DZOB 3FTDA 3TE6A 5D27A 2YNMD 5IREB 1NVMA 1XMOM 4LF4M 1C1KA 3D8LA 2H1RA 4HATB 2UXBM 2LXEA 1Q39A 2N0YA 3MPXA 3QAUA 3ZCBB 4LF6M 3GPYA 4JI3M 2N23A 4YY3M 1P5TA 2G5GX 2J7OA 1B55A 1ZSQA 1ZVRA 4MY6A 4RF0A 4JYAM 3NBIA 1QAMA 1Z5AA 2XLJA 5GOWB 2R4JA 1T3TA 4I4LA 5LMNM 1XC8A 1FNNA 5C5BA 1H10A 5D3XA 1Q3BA 5KCVA 4LF5M 4ZPXA 1U27A 3VOQA 2QPAA 4MH0E 4AG6A 1NY6A 4KVGB 2D9XA 1Z6TA 4QNRA 4MGKE 1R2ZA 1N75A 2K2JA 5C79A 3FUTA 1N3HA 2XQNM 4WJ7A 3KDSE 2ZBKB 5ITUA 4LJ4A 2HKJA 3KSJA 3DOAA 1KYIA 4LJ8A 3U6EA 3U6PA 2LULA 2LYDA 2Z3XA 3VDPA 1OJLA 2P0FA 3J7AS 1DYNA 1XNQM 1X05A 1BTKA 1U5EA 2L6OA 1X1FA 1Y5OA 2RLOA 1SXJA 2CAYA 2JP2A 2YR0A 2OPFA 1S3SA 2Z7JA 4G4RA 4HAUB 4HB4B 4PQ0A 5HE2A 2J59M 4M9ZA 3HW2B 1KFVA 1UPRA 2ERCA 3KXEC 2I7NA 1XNRM 1E9RA 1KZGA 4NOOB 3UGJA 4KLNA 2KGXB 1V89A 2UVMA 4LY6A 3I4YA 4GRIA 3PVUA 1G4AE 3KP0E 1H6UA 3AU5A 3SAWA 4BBKA 4D82A 3GLFA 1D2NA 2W82A 4GMXB 4REZA 3L28A 2VKIA 3VK7A 5EXTA 3IVFA 3SV1A 4A6FA 5DNYA 3HQCA 4JN6A 4M9SA 4HAZB 2Z4RA 4KAXB 3OTOM 2R62A 3WYFB 4K2PA 2CFOA 3KOWE 1SXJC 2LOXA 3DXDA 3QBVB 4WSFA 3LJUX 4D0NB 4DV0M 3TCAA 5FSWA 1UNQA 4B6HA 4DX90 2YT1A 1I2HA 1N32M 2EJ8A 1W5TA 3RE8A 3TO1A 2PZ1A 2KZUA 3K8ZA 3TWLA 5FI0A 2X4AA 5C5BB 3ILKA 3PNYA 4HAVB 2D10A 4DV1M 1K5DB 2D2QA 4YHHM 4CGYB 5ITXE 2LG1A 2HL7A 5FTNA 4KHAA 1V5PA 3RGPA 3U5ZA 2X8AA 3I4VA 1WXQA 4LF9M 1GC7A 3J80S 4IBJA 4LRSA 1W1HA 2COAA 4PNKA 2UUCM 3GO8A 3F0WA 3FYDA 2AL6A 4IFSA 1DROA 3T06A 1MK7B 2K2UA 3SYKA 1P6SA 1ZQ9A 4FVMA 3ODWA 3R8FA 3U61A 1BAKA 1RRPB 4NRWA 2K47A 4NL4H 4B3RM 1J09A 2DKPA 4EMOA 2R4EA 2VIIA 2DYQA 2GCLA 3PVLA 2D7GA 4NRVA 2P0DA 4OW0A 1NI2A 4K17A 4K0KM 1SXJE 3FUVA 2CODA 5D3VA 3KOZE 4PDIA 3BINA 5J3QA 3UZTA 3DZDA 5CLLB 1NJFA 3DFZA 3IG5A 4LZZA 1PM5A 1L2DA 3HJ8A 1E5WA 1HT1E 3SUZA 1FGYA 3EIEA 2RGOA 3KSXA 3MJ5A 5EP3A 5C18A 4DV6M 2VQFM 2CHGA 2R09A 1NNUC 4IBFA 2QP9X 2BCJA 2FJLA 2UXCM 2QZ4A 4LJ6A 2Q13A 1QVRA 2D9ZA 2RSGA 3HHWA 4KHOA 2R65A 4LCBA 1DDMA 4IBDA 2KCJA 2ROVA 3E9SA 3GLHA 2YT0A 1NJGA 3L2AA 4MGZE 1GL7A 1DBHA 1FHWA 4G4OA 4HAYB 1IN4A 2OQ4A 4S12A 3U60A 3L26A 3FTFA 1TJ6A 2E2XA 3U6MA 4B3SM 4NY0A 3TPZA 1EE8A 4FWGA 2M14A 2XZFA 4Z2MB 3SYLA 2DXIA 5DHFB 1DGBA 1XMQM 1J19A 2XH9A 4GC5A 1DDVA 4B7HA 2W2XD 2L7HA 5ITXA 2GJYA 4CISA 4BLCA 3ULCA 1TGUA 1AWEA 3SMSA 2I1KA 2OTXA 4LJ7A 3ML4A 3P6AA 2CV1A 3KRWA 3KS8A 4I8OA 3TVVA 2Y8GA 2XSZA 3UZUA 2Y21A 4P16A 2IFSA 2Y7BA 3M6AA 4DUZM 3ZC7B 3U6OA 1PFJA 3A98B 3SAUA 2W2WA 3M1IB 4HB2B 1NTVA 2VSZA 3X23A 3D8BA 4AW4A 4LG2A 4HDQA 1GVNA 1IY0A 4DV7M 1G59A 3FEHA 4IOYX 3W0FA 1HT2E 4GKKM 4IBCA 2RVBB 1NNJA 3FUUA 3U8ZA 1H4RA 2LWXA 1W1GA 3TWKA 2ELAA 5EJCA 4JI7M 3LMMA 2XFSA 4B08A 2P5TA 5H37D 1IXSB 3GLGA 1PMSA 4JI4M 3HJSA 2I5CA 1U2BA 1E32A 1EVHA 2CY5A 3KOXE 1IN8A 4AI6A 3A46A 5KPRA 4WW0A 5JI3E 4X62M 3J2PB 2F5QA 5IT9S 3J7BA 4DR6M 1LB1A 4TYZA 3ZH9B 2VQEM 4DX8A 3RGSA 1BWNA 1PJIA 5J3TA 3KVWA 4FCWA 4DR3M 1G8PA 1GLNA 1I94M 4LF8M 3CF2A 5EXPA 2KEBA 2Y20A 1IBMM 1TQZA 3LVVA 1G41A 4GIPA 1MIZB 2FE8A 3UMMA 2G35A 3DXEA 4YL8A 5DIFB 4A6KA 1Q3CA 1P3RA 3KY9A 5JLJB 1IN5A 1AQCA 2AEHA 2I1JA 1SXJD 1I7AA 1V5MA 2YS3A 2HE7A 3FKEA 4MK0A 1U29A 2F5NA 1W5SA 3SATA 2LKOA 5C16A 1HQYE 2XGNA 3U7DA 1Z87A 4DV4M 1J0WA 2QKLA 4IAPA 1IBKM 3A8PA 3PVWA 2CRFA 2CV2A 3WHKA 5ITQA 1M7EA 4HB3B 4DR2M 2HCBA 3TQSA 2P0HA 3VIAA 4L8RC 3QWMA 1IRSA 5DH9B 1IXZA 2CEAA 3KSYA 2P8VA 1XXHB 4LF7M 1IY1A 4XWXA 2Y0TA 3FD9A 3ULBA 4GMVA 5CLQB 3LVWA 1UEFA 2KRUA 1L8QA 2XEPA 1DGHB 1L2BA 4DV3M 1L1ZA 4JI2M 2JA2A 1NU2A 3PVSA 3D8EA 2IYBA 3SHGB 3LQRA 1QANA 5BPVA 2XSZD 3A8QA 3FUWA 4HL4A 4NSRA 3UK6A 3B9PA 2DWLA 2L7IA 2I5FA 5L81A 1OFHA 3QWLA 1QYRA 1XHBA 4QHSA 3SAVA 4LJ9A 1WG7A 5KPZA 3K92A 2F5PA 1XR0B 3BJIA 4EKUA 2ZAMA 4QOSA 3VKHA 4RF1A 1NHGC 3TFMA 5HE1A 2DVWB 4IBGA 3KFUG 3SASA 3DXCA 4TKNA 1IQPA 4GH9A 1MAIA 2KW0A 4L6EA 3I51A 3MK6A 3TL4X 3GQ4A 1KI1B 1Q67A 1WI1A 5JHHA 3PP2A 5EP2A 3HU1A 8CATA 1R7RA 1HNXM 5KQ8A 4A6FB 2X18A 2BJVA 2NZ8B 2J0JA 4ZRKA 2C99A 4DUYM 4HAWB 3FUXA 3AKZA 4D80A 3GPUA 1BTNA 1NY5A 1YE9A 4IBKA 4HDOA 4WVFB 4II7A 3W0LB 5DYGA 1XX0A 4NSWA 4FWHA 3L25A 2RUKB 2L1CA 4GHLA 4BBAA 2DKQA 2DWZB 1J7KA 2M5ZA 4X65M 2EA0A 3U61B 2DWNA 1OMWA 5EXSA 5HE3A 4LJ5A 2XFTA 4F7UP 2EO2A 3AL0C 2F5OA 2DTCA 4L78A 4JI8M 2ELBA 5DI9B 3SO6A 1TH3A 2KZSA 1KSFX 5FTMA 4K2OA 2O5RA 3GYPA 4JI6M 1LV7A 3FSSA 5EP4A 1E94E 2CUZA 5E26A 3SFZA 1VDDA 2FFJA 3GPXA 2F4VM 1ZC3B 2K00A 3PEGA 4ZRJA 1XWIA 4CYEA 2R46A 3CF6E 1FGZA 1XXHA 1XODA 1DGHA 3KS4A 4IJFA 1QC6A 3GRUA 3J27B 2V76A 4I81A 4OU7A 2E5LM 4L4UA 3EIHA 4ITQA 4A3VB 4GXBA 1V61A 1XCGA 4QNMA 2XZUA 1NTYA 4A6HA 4R7GA 3U6QA 3GLGB 2QENA 5ITTA 2CV0A 1MIXA 2M38A 2YS1A 3GQ3A 1X37A 1N78A 1IN7A 4RNAA 1Y19B 5D3WA 2KRKA 4MGIE 4WURA 3T1HM 1N77A 3VFDA 2DLWA 2LOZA 1W1DA 3ZDTA 3GRRA 4A5KA 4IJEA 4HB0B 3L29A 3F5RA 3AOGA 3AFHA 2QCUA 2A5YB 2ZAOA 5JP4A 1R6BX 5EFXA 4KODA 3M0EA 4GC9A 2CE7A 3QIJA 3VK8A 1ZM0A 1PLSA 4HHVA 1N36M 4AQYM 2YQZA 3P7ZA 2LH0A 3HHYA 1UNRA 1EF1A 3GLHB 2D4QA 4PDGA 2Q2EB 1DGFA 4DBBA 1WJMA 1UNPA 2OQBA 1QQWA 5KQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB8 A;  5C6R A;  3CIK A;  2DHK A;  3KRX A;  1X86 A;  3TW1 A;  2GS0 A;  4CHJ A;  1SHC A;  2RGN B;  2YRY A;  2YSZ A;  4YON A;  1U5F A;  2GCJ A;  3NSU A;  1UPQ A;  5JHG A;  2VRW B;  1EGX A;  3GYO A;  2COC A;  1WJ1 A;  2R0D A;  4MT7 A;  1X1G A;  2YF0 A;  1OY2 A;  2Z0P A;  2CY4 A;  1GC6 A;  2MKR A;  3AU4 A;  3RCP A;  3O96 A;  5KQ4 A;  3D8F A;  2EC1 A;  1QQG A;  2DHI A;  2Z0O A;  3G9W A;  5FI1 A;  2HTH B;  2ROZ B;  1ISN A;  2MFQ A;  2P0H A;  1U5D A;  1V88 A;  4EJN A;  1DDW A;  3FM8 C;  3HK0 A;  2D9V A;  3CXB B;  4ZRJ A;  3KZ1 A;  4CHM A;  4K81 A;  5HE0 A;  4Y94 A;  5LOP B;  1MKE A;  2J0K A;  3OAN A;  2ADZ A;  2J0M A;  1K5G B;  2Y8F A;  4D0N B;  3ZVR A;  4KHB B;  4C0A A;  1X11 A;  1XKE A;  1WGQ A;  4Z2N A;  1M7R A;  1SGH A;  2Z0Q A;  2EMS A;  1ZC4 B;  2MDX A;  3ODX A;  2YS5 A;  4F7G A;  2DX1 A;  4DXA B;  3ODO A;  1FHO A;  1WVH A;  1FHX A;  2H7E A;  1TXD A;  5J3Y A;  5LON B;  5DHA B;  3WA0 A;  2DA0 A;  4HAX B;  4P7I A;  3PG7 A;  1RJ2 A;  2ZPY A;  1KZ7 A;  4F7H A;  3SYX A;  3SNH A;  3PSC A;  2DX5 A;  1XD4 A;  4GPT B;  2NMB A;  2DN6 A;  1LW3 A;  2MWN B;  1V5U A;  1FAO A;  2DFK A;  2DYN A;  2L2I A;  2H7D A;  2W2X C;  3PZD A;  5D3V A;  1FOE A;  2D9W A;  3V5W A;  1MK9 B;  4ZRI A;  5D3Y A;  1EAZ A;  1WGU A;  2UZR A;  5KQ1 A;  1MPH A;  3AJ4 A;  2COF A;  2D11 A;  4H8S A;  3N7C A;  2EMT A;  2YVC A;  2KUP A;  4GN1 A;  3MDB C;  2D9Y A;  1U5G A;  2QKM A;  2DHJ A;  3D8D A;  4GZU A;  1GG3 A;  1OQN A;  2UZS A;  5D27 A;  4HAT B;  2N0Y A;  3MPX A;  2N23 A;  1P5T A;  4MY6 A;  1B55 A;  1ZSQ A;  5GOW B;  5C5B A;  1H10 A;  5D3X A;  5KCV A;  1U27 A;  3VOQ A;  4KVG B;  2D9X A;  2K2J A;  5C79 A;  1N3H A;  2XQN M;  4WJ7 A;  3U7D A;  2LYD A;  2LUL A;  2P0F A;  1DYN A;  1X05 A;  1Y5O A;  2RLO A;  1BTK A;  1U5E A;  1X1F A;  2CAY A;  2JP2 A;  4HAU B;  4HB4 B;  4PQ0 A;  5HE2 A;  2J59 M;  3HW2 B;  1UPR A;  1KZG A;  2KGX B;  1V89 A;  2UVM A;  3PVU A;  3AU5 A;  4BBK A;  4GMX B;  2VKI A;  3IVF A;  3SV1 A;  4A6F A;  3HQC A;  4HAZ B;  4KAX B;  3WYF B;  4K2P A;  2LOX A;  3QBV B;  3DXD A;  4WSF A;  3LJU X;  3TCA A;  1UNQ A;  4B6H A;  4DX9 0;  2YT1 A;  1I2H A;  2EJ8 A;  3TO1 A;  2PZ1 A;  5FI0 A;  5C5B B;  4HAV B;  2D10 A;  1K5D B;  2D2Q A;  2LG1 A;  4KHA A;  1V5P A;  1GC7 A;  1W1H A;  4PNK A;  2COA A;  3F0W A;  2AL6 A;  4IFS A;  1DRO A;  3T06 A;  1MK7 B;  2K2U A;  1P6S A;  3ODW A;  1BAK A;  1RRP B;  2DKP A;  4EMO A;  2DYQ A;  2GCL A;  3PVL A;  2P0D A;  1NI2 A;  4K17 A;  3UZT A;  2COD A;  3BIN A;  5J3Q A;  5CLL B;  1E5W A;  3SUZ A;  1FGY A;  2R09 A;  2BCJ A;  2FJL A;  2Q13 A;  2D9Z A;  2RSG A;  4KHO A;  1DDM A;  2KCJ A;  2ROV A;  2YT0 A;  1FHW A;  1DBH A;  4HAY B;  1TJ6 A;  2E2X A;  4NY0 A;  2M14 A;  4Z2M B;  5DHF B;  1J19 A;  1DDV A;  2W2X D;  2GJY A;  3ULC A;  1AWE A;  2I1K A;  2OTX A;  3ML4 A;  3P6A A;  3KRW A;  3TVV A;  2Y8G A;  2IFS A;  2Y7B A;  4HB2 B;  1PFJ A;  3M1I B;  2W2W A;  3A98 B;  2VSZ A;  1NTV A;  3X23 A;  4HDQ A;  3FEH A;  4IOY X;  2RVB B;  3U8Z A;  1H4R A;  1W1G A;  2ELA A;  1PMS A;  2I5C A;  1U2B A;  1EVH A;  2CY5 A;  1LB1 A;  4TYZ A;  4DX8 A;  1BWN A;  5J3T A;  1TQZ A;  4YL8 A;  1MIZ B;  2G35 A;  3DXE A;  5DIF B;  4A6K A;  1P3R A;  3KY9 A;  5JLJ B;  1AQC A;  2AEH A;  2I1J A;  1V5M A;  2YS3 A;  1I7A A;  2HE7 A;  4MK0 A;  1U29 A;  5C16 A;  2LKO A;  1Z87 A;  1J0W A;  2QKL A;  4IAP A;  3A8P A;  3PVW A;  2CRF A;  4HB3 B;  1M7E A;  3VIA A;  3QWM A;  1IRS A;  5DH9 B;  3KSY A;  2P8V A;  4XWX A;  3ULB A;  4GMV A;  5CLQ B;  1UEF A;  1ZVR A;  1NU2 A;  3D8E A;  2IYB A;  3A8Q A;  2I5F A;  5L81 A;  1WG7 A;  2RNR B;  1XR0 B;  3BJI A;  4EKU A;  3TFM A;  5HE1 A;  4TKN A;  3DXC A;  1MAI A;  4L6E A;  1KI1 B;  1Q67 A;  1WI1 A;  5JHH A;  3PP2 A;  4A6F B;  2X18 A;  4ZRK A;  2NZ8 B;  2J0J A;  4HAW B;  1BTN A;  4WVF B;  4HDO A;  4NSW A;  1XX0 A;  2RUK B;  2L1C A;  2DKQ A;  1OMW A;  5HE3 A;  4F7U P;  2DTC A;  3SO6 A;  2ELB A;  5DI9 B;  4K2O A;  3GYP A;  3FSS A;  1ZC3 B;  2K00 A;  3PEG A;  4CYE A;  1FGZ A;  1XOD A;  1QC6 A;  2V76 A;  4GXB A;  1V61 A;  1XCG A;  4A6H A;  1NTY A;  1MIX A;  2M38 A;  2YS1 A;  1Y19 B;  5D3W A;  2LOZ A;  2DLW A;  3ZDT A;  1W1D A;  4A5K A;  4HB0 B;  3F5R A;  5JP4 A;  5EFX A;  4HHV A;  3QIJ A;  1ZM0 A;  1PLS A;  3P7Z A;  1UNR A;  1EF1 A;  2D4Q A;  4DBB A;  1WJM A;  1UNP A;  2OQB A; 
#chains in the Genus database with same CATH topology
 1FB8 A;  3W68 A;  3MHV C;  3CIK A;  4JV5 M;  1HQC A;  4M9X A;  4KO8 A;  1HNZ M;  2YRY A;  1TH4 A;  1K82 A;  2F5S A;  4FW9 A;  4PT5 A;  3HU2 A;  1UM8 A;  2CHQ A;  2BNK A;  3AOE C;  4OX9 M;  2K6B A;  1YLA A;  1EGX A;  1WJ1 A;  2R0D A;  4L15 A;  2V1U A;  3JR5 A;  2CY4 A;  3SAR A;  3FYC A;  3U5Z B;  2MKR A;  1IXR C;  3A42 A;  3O96 A;  3C58 A;  4Z6Y A;  1I4W A;  2V1C A;  2DHI A;  2Z4S A;  3AOE A;  1IM2 A;  2MFQ A;  2P0H A;  3J81 S;  1U5D A;  2J7N A;  5DYI A;  2LTU A;  3PFI A;  4Y94 A;  5LOP B;  3U6L A;  2R45 A;  1G3I A;  1IBL M;  1MJG M;  4MM3 B;  4D0N B;  2QSF X;  3M7G A;  1XKE A;  4NXN M;  1E9S A;  2Z0Q A;  4EIW A;  2EMS A;  1P3Q Q;  1ZC4 B;  2JNH A;  2DX1 A;  1FHO A;  3GPP A;  5BR8 M;  4GNK B;  3H4J A;  2UUB M;  2DA0 A;  2FNA A;  4HAX B;  4P7I A;  1F4I A;  1KZ7 A;  3H4M A;  1R2Y A;  4LFC M;  4GPT B;  1SXJ B;  2HHH M;  1N33 M;  1FAO A;  2DFK A;  2C5R A;  1ZMV A;  2FOI C;  3FE3 A;  3C3E A;  2D7H A;  1FOE A;  2D9W A;  1MK9 B;  4G3O A;  2R0I A;  1EAZ A;  2UZR A;  3MMP A;  5FTJ A;  3T38 A;  2WSC F;  1DO2 A;  3N7C A;  1EIJ A;  2KUP A;  4GN1 A;  3MDB C;  2DAE A;  3GLF B;  2D9Y A;  3LCV B;  4L16 A;  4GZU A;  1GG3 A;  2UZS A;  5D27 A;  1XMO M;  1C1K A;  3D8L A;  2UXB M;  3MPX A;  3GPY A;  2J7O A;  1ZSQ A;  4JYA M;  2QHO B;  3NBI A;  2XLJ A;  1T3T A;  5LMN M;  1FNN A;  5KCV A;  1U27 A;  2K2J A;  4MGK E;  3KDS E;  2ZBK B;  3U6P A;  2HKJ A;  3KSJ A;  3U6E A;  1QZE A;  3QYE A;  1DYN A;  1X1F A;  1Y5O A;  2L6O A;  2O01 F;  2JP2 A;  2OPF A;  4G4R A;  4PQ0 A;  2I7N A;  1KZG A;  2MRO B;  4BBK A;  4GMX B;  3HQC A;  4HAZ B;  5L8R F;  5M4Y B;  2CFO A;  1SXJ C;  3DXD A;  1UNQ A;  2WSF F;  2EJ8 A;  1W5T A;  2DHY A;  2KZU A;  3K8Z A;  5FI0 A;  2D10 A;  1K5D B;  2D2Q A;  2LG1 A;  5FTN A;  1V5P A;  3GLI E;  3U5Z A;  2X8A A;  1VEJ A;  1WXQ A;  2LVO C;  4LRS A;  3F0W A;  1ZQ9 A;  1RRP B;  4B3R M;  4NL4 H;  2DYQ A;  2VII A;  3PVL A;  2P0D A;  4OW0 A;  3KOZ E;  2QQ8 A;  3B7Q A;  3DFZ A;  1WHC A;  3SUZ A;  1FGY A;  3MJ5 A;  2BCJ A;  2UXC M;  2Q13 A;  1QVR A;  2RSG A;  3HHW A;  4IBD A;  3E9S A;  3NWD A;  1TF0 B;  1FHW A;  1DBH A;  1TJ6 A;  4B3S M;  4NY0 A;  2JY5 A;  4Z2M B;  1D0L A;  3B74 A;  2XH9 A;  2BWB A;  2L7H A;  4CIS A;  2JWS A;  4BLC A;  1TGU A;  4LJ7 A;  3KS8 A;  1D0K A;  1OKS A;  4P16 A;  3SAU A;  1NTV A;  3X23 A;  1HT2 E;  2RVB B;  4JI7 M;  2QNJ A;  1U2B A;  3KOX E;  4AI6 A;  5KPR A;  5JI3 E;  2ZKM X;  3ZH9 B;  2VQE M;  1BWN A;  2L2D A;  4LF8 M;  2KNV A;  4GIP A;  2FE8 A;  4A6K A;  1P3R A;  1XXH E;  3FRI A;  1AQC A;  2AEH A;  2YS3 A;  3FKE A;  1M7E A;  2R2Y A;  1IRS A;  4Y28 F;  5LG4 B;  2Y0T A;  1LTM A;  2KRU A;  1L1Z A;  2JA2 A;  3LQR A;  3A8Q A;  3FUW A;  3B9P A;  1WG7 A;  1QYR A;  1XHB A;  5KPZ A;  1OAI A;  2ZAM A;  3VKH A;  2DVW B;  3SAS A;  1MAI A;  3I51 A;  3MK6 A;  3TL4 X;  4QJ5 B;  1V34 A;  5EP2 A;  1R7R A;  1VEG A;  4R71 A;  2JY7 A;  2BJV A;  2NZ8 B;  4ZRK A;  4IBK A;  3W0L B;  5DYG A;  4FWH A;  3L25 A;  2RUK B;  2L1C A;  5IRS A;  4BBA A;  2DWZ B;  4X65 M;  2XFT A;  2DTC A;  4JI8 M;  1TH3 A;  2O5R A;  1E94 E;  1OIZ A;  3GPX A;  2FFJ A;  3CF6 E;  1T43 A;  3C9P A;  2E5L M;  4GXB A;  2XZU A;  1NTY A;  5ITT A;  4MGI E;  4WUR A;  2DLW A;  3ZDT A;  3L29 A;  3AFH A;  2ZAO A;  4KOD A;  3M0E A;  4GC9 A;  3QIJ A;  2YQZ A;  2DAG A;  3HHY A;  1EF1 A;  2Q2E B;  1DGF A;  1WJM A;  1QQW A;  5KQD A;  1ZV1 A;  2BJW A;  2R44 A;  2DHK A;  3GRV A;  3KRX A;  4LZJ A;  3SHF A;  1IXS A;  2YSZ A;  2DWM A;  4YON A;  3C3D A;  2K49 A;  3NWF A;  3A45 A;  2I7P A;  2GCJ A;  3U6S A;  2VRW B;  2HWJ A;  1ZMW A;  2DZL A;  4GMQ A;  4AZF A;  4MT7 A;  1X1G A;  1OY2 A;  5C1B A;  2YT2 A;  1GC6 A;  3RCP A;  3AU4 A;  2ZM6 M;  3RFW A;  3THG A;  5FTL A;  4GIT A;  4M0D A;  2EC1 A;  2Y0Q A;  5ITR A;  1UFZ A;  1QQG A;  2HTH B;  4UN2 B;  3GLG E;  4FCT A;  5A2Q S;  1JQJ C;  4FWD A;  1V88 A;  1DDW A;  2FJU B;  4DR4 M;  4ZRJ A;  4CHM A;  3U6C A;  3AJI B;  3I01 M;  2J0K A;  1CUK A;  2J0M A;  4JI1 M;  1DO0 A;  1K5G B;  2Y8F A;  3JR4 A;  2LVP C;  2C9O A;  3KP1 E;  3HJQ A;  1AIP C;  3V76 A;  1ZAE A;  3B7N A;  2MDX A;  3JAM S;  3U60 B;  3AV0 A;  1WVH A;  2H7E A;  4AKI A;  4LGM A;  3WA0 A;  4FCV A;  3PG7 A;  2KA6 B;  2KXE A;  4F7H A;  1MU5 A;  3PNV A;  1DV0 A;  1XD4 A;  2LVQ D;  2NMB A;  2DN6 A;  4W5W A;  5KO3 A;  2QBY A;  3PZD A;  4QJ4 B;  4B3M M;  1IN6 A;  3OHM B;  4WP2 A;  1WGU A;  1MPH A;  5EQT A;  2O25 A;  3GLI B;  3GQ5 A;  2EMT A;  4FD2 A;  3Q8X A;  2M60 A;  4KT0 F;  3LCU A;  3FTD A;  2DEN A;  3T6P A;  4HAT B;  2N23 A;  4YY3 M;  1B55 A;  4CSQ A;  1Z5A A;  5C5B A;  4I4L A;  1H10 A;  3F92 A;  2H5X A;  4AG6 A;  2Z4D A;  1NY6 A;  4QNR A;  3FUT A;  1N3H A;  4WJ7 A;  3U7D A;  2RRU A;  1X05 A;  1SXJ A;  2YR0 A;  1S3S A;  2Z7J A;  1KFV A;  1UPR A;  1VG5 A;  2ERC A;  3KXE C;  1E9R A;  4NOO B;  2FH0 A;  3PVU A;  3AU5 A;  2W82 A;  4REZ A;  1G71 A;  2VKI A;  4M9S A;  2Z4R A;  3OTO M;  2KIE A;  2JXN A;  4WSF A;  3QBV B;  3E21 A;  4DX9 0;  2YT1 A;  4ANR A;  5C5B B;  3ILK A;  4KHA A;  4LF9 M;  1GC7 A;  4IBJ A;  3HSA A;  2COA A;  2UUC M;  4F2L A;  2GUM A;  3T06 A;  1MK7 B;  2K2U A;  3SYK A;  1P6S A;  3U61 A;  1BAK A;  4NRW A;  1J09 A;  2DKP A;  2Z13 A;  1V92 A;  2OOB A;  2R4E A;  4HEO A;  4NC6 A;  2COD A;  5J3Q A;  3DZD A;  4OT1 A;  1E5W A;  1L2D A;  1R5L A;  2R6F A;  5EP3 A;  4DV6 M;  2VQF M;  2R09 A;  1NNU C;  2QP9 X;  3NW8 A;  4F1I A;  3GLH A;  2YT0 A;  4HAY B;  1IN4 A;  2GNO A;  3U60 A;  3L26 A;  3FTF A;  2E2X A;  3U6M A;  5I2S A;  3TPZ A;  2M14 A;  2DXI A;  1DGB A;  1J19 A;  4GOU A;  5ITX A;  4OSN A;  2DAI A;  3SMS A;  3HZJ A;  3Q8G A;  2CV1 A;  3HIE A;  3TVV A;  3UZU A;  2IFS A;  3ZC7 B;  2VSZ A;  4LG2 A;  4HDQ A;  3FEH A;  5EJC A;  4HSI A;  3LMM A;  4B08 A;  1PMS A;  3A46 A;  4X62 M;  4WW0 A;  3J7B A;  1GLN A;  2KEB A;  2Y20 A;  4YL8 A;  5DIF B;  3DXE A;  4L6V 6;  3KY9 A;  5JLJ B;  1I7A A;  2HE7 A;  4MK0 A;  5C16 A;  2F5N A;  1HQY E;  5DFL A;  4IAP A;  3A8P A;  2CRF A;  5ITQ A;  4HB3 B;  3TQS A;  2CEA A;  2MH8 A;  2P8V A;  2Z8Y M;  1IY1 A;  3LVW A;  1ZVR A;  1L2B A;  2Z14 A;  2XEP A;  1DGH B;  4JI2 M;  1NU2 A;  1QAN A;  2K9D A;  4HL4 A;  4NSR A;  3UK6 A;  2DWL A;  2L7I A;  1OFH A;  3QWL A;  4QHS A;  1T77 A;  3TFM A;  5HE1 A;  3DXC A;  1IQP A;  4L6E A;  1SG9 A;  1KI1 B;  1WI1 A;  5KQ8 A;  4A6F B;  2J0J A;  4DUY M;  3AKZ A;  3B7Z A;  1BTN A;  4NSW A;  1XX0 A;  2KHH A;  1PRB A;  2DKQ A;  2M5Z A;  3U61 B;  2DWN A;  3AL0 C;  2CRU A;  4L78 A;  2ELB A;  5DI9 B;  2KZS A;  1PJS A;  1LV7 A;  1WGL A;  4QJ3 B;  5E26 A;  1VDD A;  1XWI A;  4CYE A;  1XOD A;  1XXH A;  1DGH A;  4IJF A;  1QC6 A;  3J27 B;  4OU7 A;  3EIH A;  3A58 A;  3NBX X;  4R7G A;  2LHG A;  3GLG B;  2QEN A;  2CV0 A;  1MIX A;  3U12 A;  2KDL A;  3VFD A;  1W1D A;  4A5K A;  4IJE A;  2QCU A;  1TTE A;  1R6B X;  2CE7 A;  1Q02 A;  1N36 M;  1UNR A;  4DBB A;  2OQB A;  4DIX A;  4NSO B;  4CJ6 A;  4JI0 M;  4XGI A;  1YSY A;  2KUQ A;  1X86 A;  3HHZ A;  4PCZ A;  2GS0 A;  4X66 M;  4GKJ M;  4JI5 M;  3KW6 A;  4CHJ A;  2ZAN A;  1SHC A;  2RGN B;  1TDH A;  2EKF A;  4QXA B;  1U5F A;  2LVN C;  1GL6 A;  5EXX A;  3NSU A;  1UPQ A;  2ZTD A;  4B3T M;  3GYO A;  2COC A;  1JR3 D;  4G4Q A;  2Z0P A;  1GJS A;  4OVZ B;  3GLI A;  2UXD M;  3GRY A;  3I04 M;  1WR1 B;  4KHP M;  4NXM M;  3G9W A;  4IBI A;  2ROZ B;  1ISN A;  1YUB A;  2CHV A;  1MX0 A;  4LFA M;  1ORY B;  1QUS A;  4EJN A;  2QBY B;  3HK0 A;  3FM8 C;  5JI2 E;  3SMP A;  2D9V A;  2DHR A;  3CXB B;  3KZ1 A;  2GQF A;  2KIG A;  5IWA M;  4BB9 A;  4JXJ A;  3OAN A;  4DV5 M;  4C0A A;  1X11 A;  1WGQ A;  2RKO A;  4Z2N A;  1SGH A;  2DZN B;  3ODO A;  3IEC A;  1FHX A;  2OO9 A;  1QAQ A;  2EUC A;  5LON B;  4GHA A;  2C9C A;  4D81 A;  2ZPY A;  3SYX A;  1TR8 A;  5ITY A;  1NO1 A;  3L27 A;  4AG5 A;  2AHM A;  5GKN A;  1DGG A;  1HR0 M;  2MWN B;  1V5U A;  4B7F A;  4HLQ A;  1XB2 B;  1N34 M;  4QHT A;  5D3V A;  2W2X C;  3UJN A;  1L2C A;  2KR0 A;  4LGY A;  2C96 A;  3VKG A;  1K3X A;  1QAO A;  4ZRI A;  5D3Y A;  4X64 M;  1HJP A;  5KQ1 A;  2COF A;  2RGH A;  4XBO A;  1PJJ A;  2DAK A;  5FLX S;  2X49 A;  2L09 A;  3FVC A;  4H8S A;  3GP1 A;  3HWS A;  1Z5C A;  1GKI A;  3T1Y M;  2DHJ A;  2UUA M;  2VF8 A;  3K9O A;  1OQN A;  3T15 A;  1HNW M;  4AKG A;  3TE6 A;  4LF4 M;  1Q39 A;  2VF7 A;  3QAU A;  3ZCB B;  4RF0 A;  1OQY A;  1QAM A;  5GOW B;  1XC8 A;  3VOQ A;  4KVG B;  5C79 A;  4LJ8 A;  3DOA A;  2LUL A;  2DKL A;  1OJL A;  1R4G A;  2RLO A;  1BTK A;  4HAU B;  4M9Z A;  1XNR M;  3W67 A;  2KGX B;  2UVM A;  4LY6 A;  4GRI A;  3KP0 E;  1H6U A;  3SAW A;  1D2N A;  5EXT A;  3IVF A;  3SV1 A;  2RRF A;  4K2P A;  3KOW E;  2LOX A;  2HAK A;  4DV0 M;  1I2H A;  1N32 M;  3RE8 A;  3TO1 A;  3TWL A;  2X4A A;  3PNY A;  2JZ0 A;  4DV1 M;  4YHH M;  4CGY B;  3CGW A;  5ITX E;  2HL7 A;  2NBV A;  1W1H A;  2J5Y A;  3GO8 A;  3FYD A;  1DRO A;  4IFS A;  3ODW A;  2K47 A;  4EMO A;  1WJ7 A;  4K0K M;  1SXJ E;  3UZT A;  1NJF A;  1HT1 E;  3EIE A;  2CHG A;  2FJL A;  4LJ6 A;  4KHO A;  3HY5 A;  3IHP A;  2KCJ A;  2ROV A;  1NJG A;  1GL7 A;  4Q7J A;  2Z59 A;  3FRH A;  3ZQJ A;  1EE8 A;  4FWG A;  2APL A;  4GC5 A;  1DDV A;  2W2X D;  2GJY A;  3ULC A;  2OTX A;  2EKK A;  2Y8G A;  2XSZ A;  2Y21 A;  2Y7B A;  3M6A A;  2MGW A;  4DUZ M;  3U6O A;  1PFJ A;  3A98 B;  3NWA A;  4AW4 A;  1GVN A;  1G59 A;  3W0F A;  4GKK M;  4IBC A;  1NNJ A;  1H4R A;  2LWX A;  1W1G A;  3TWK A;  2LHC A;  2XFS A;  2P5T A;  1IXS B;  3GLG A;  4JI4 M;  3HJS A;  2I5C A;  1EVH A;  2CY5 A;  1IN8 A;  3J2P B;  4TYZ A;  4DX8 A;  3RGS A;  1PJI A;  5J3T A;  4FCW A;  4DR3 M;  1G8P A;  4CIZ A;  1G41 A;  1MIZ B;  3UMM A;  2G35 A;  1GAB A;  1ZYI A;  4KHB A;  1IN5 A;  1EFU B;  1SXJ D;  1W5S A;  3SAT A;  2LKO A;  1J0W A;  1IBK M;  2CV2 A;  3VIA A;  1BVS A;  4L8R C;  3QWM A;  1MI1 A;  1XXH B;  5CLQ B;  4DV3 M;  2IYB A;  3SHG B;  5BPV A;  2I5F A;  5L81 A;  2RNR B;  1XR0 B;  3SAV A;  4LJ9 A;  3BJI A;  2JZ1 A;  2MR9 A;  2JUJ A;  4QOS A;  3KFU G;  4TKN A;  4GH9 A;  1RU3 A;  1Q67 A;  3PP2 A;  2C99 A;  4HAW B;  3FUX A;  4D80 A;  3BBZ A;  4HDO A;  4GHL A;  1J7K A;  2ZTC A;  1OMW A;  4LJ5 A;  4K2O A;  2L4F A;  3GYP A;  3FSS A;  3SFZ A;  2CUZ A;  3PEG A;  3KS4 A;  3GRU A;  2V76 A;  4ITQ A;  1V61 A;  4A6H A;  3U6Q A;  3GQ3 A;  1Y19 B;  5D3W A;  2LOZ A;  1N77 A;  4HB0 B;  3F5R A;  3AOG A;  2A5Y B;  5JP4 A;  5EFX A;  1PLS A;  2WSE F;  3P7Z A;  2LH0 A;  2D4Q A;  2WZJ A;  2UU9 M;  3BXW A;  1J5E M;  1JR3 A;  2JY6 B;  3HHX A;  1Z5B A;  3VLF B;  5C6R A;  3VDU A;  4XK8 F;  4QOZ C;  3WHL A;  3TW1 A;  4DR1 M;  3CF0 A;  2LVA A;  1GJT A;  4DV2 M;  4G6Z A;  4Z8X A;  3BOS A;  3U6D A;  3K1J A;  1OIP A;  5JHG A;  2LNH C;  1PGY A;  2YF0 A;  3E4R A;  2K0B X;  4DR5 M;  4B7G A;  4LFB M;  5KQ4 A;  3D8F A;  3PXG A;  4AKH A;  2XF3 A;  4G4N A;  2Z0O A;  5FI1 A;  2NQ8 C;  3IG8 A;  7CAT A;  3KOY E;  2B3T A;  3DA1 A;  4CHT B;  3NWL A;  4R3D A;  5FTK A;  1QZM A;  1GO5 A;  4RKU F;  4K81 A;  5HE0 A;  1WIV A;  3FTC A;  1MKE A;  2KNZ A;  4MGH A;  2ADZ A;  4IBE A;  1Y8G A;  2C98 A;  3LQQ A;  4LJA A;  3ZVR A;  5KPT A;  4KHB B;  1M7R A;  4IIW A;  3HKP A;  5LMU M;  1V33 A;  4LRT A;  1NSF A;  3ODX A;  3R9X B;  4M0W A;  1OAO C;  2YS5 A;  4F7G A;  4DXA B;  1C7Y A;  1IY2 A;  1TH2 A;  3HGI A;  1TXD A;  2D7E A;  5J3Y A;  5DHA B;  4PD2 A;  4OVZ A;  1L1T A;  1RJ2 A;  1TDZ A;  2KNA A;  1FJG M;  3SNH A;  3QYB A;  4TUW A;  1QDT A;  5EP1 A;  3PSC A;  4D6W A;  2N35 A;  2DX5 A;  2JY8 A;  3SC3 A;  4MGY E;  1LW3 A;  1OFI A;  2L4E A;  2YFQ A;  3CTW B;  5IZ7 D;  3K2L A;  2DYN A;  2L2I A;  5F3W A;  2H7D A;  2V6Z M;  3V5W A;  3SBJ A;  1JB0 F;  3AJ4 A;  2D11 A;  1Z59 A;  4IBB A;  4MB7 A;  4DR7 M;  5E6J A;  3FTE A;  2YVC A;  1NHW C;  2R18 A;  3TWM A;  1U5G A;  2QKM A;  3D8D A;  3HU3 A;  1K3W A;  2G8L A;  2DI0 A;  4I5S A;  2DZO B;  2YNM D;  5IRE B;  1NVM A;  2H1R A;  2LBC A;  2LXE A;  2N0Y A;  4LF6 M;  4JI3 M;  1P5T A;  2G5G X;  4MY6 A;  2R4J A;  5D3X A;  1Q3B A;  4LF5 M;  4ZPX A;  2QPA A;  4MH0 E;  2D9X A;  1Z6T A;  1R2Z A;  1N75 A;  2XQN M;  5ITU A;  4LJ4 A;  2LYD A;  1KYI A;  2P0F A;  2Z3X A;  3VDP A;  3J7A S;  1XNQ M;  1OTR A;  1IFY A;  1U5E A;  2CAY A;  2CWB A;  4HB4 B;  5HE2 A;  2J59 M;  3HW2 B;  3UGJ A;  4KLN A;  1V89 A;  3I4Y A;  1G4A E;  4D82 A;  3GLF A;  3L28 A;  3VK7 A;  4A6F A;  5DNY A;  4JN6 A;  4KAX B;  2R62 A;  3DCX A;  3WYF B;  5I2M A;  3LJU X;  3TCA A;  5FSW A;  4B6H A;  1AUA A;  2FS1 A;  2PZ1 A;  2BWE A;  4HAV B;  3RGP A;  3I4V A;  3J80 S;  4PNK A;  2AL6 A;  1VDL A;  4FVM A;  1A5T A;  3R8F A;  4P17 A;  2GCL A;  2D7G A;  4NRV A;  1NI2 A;  4K17 A;  3FUV A;  4PDI A;  3BIN A;  2K8E A;  5CLL B;  3GLF E;  3IG5 A;  4LZZ A;  1PM5 A;  3HJ8 A;  2RGO A;  3KSX A;  4L1R A;  5C18 A;  4GEW A;  4IBF A;  2QZ4 A;  2D9Z A;  1QUT A;  2R65 A;  4LCB A;  1DDM A;  3L2A A;  4MGZ E;  4G4O A;  2CP8 A;  2OQ4 A;  4S12 A;  1VQ1 A;  2XZF A;  3SYL A;  5DHF B;  1XMQ M;  4B7H A;  1VEK A;  1AWE A;  2I1K A;  3ML4 A;  3P6A A;  1WGN A;  1NV9 A;  3KRW A;  4I8O A;  4DBG B;  4HB2 B;  3M1I B;  2W2W A;  3D8B A;  4DV7 M;  1IY0 A;  4IOY X;  3FUU A;  3U8Z A;  2ELA A;  1QDR A;  3E46 A;  1PJQ A;  5H37 D;  1E32 A;  2F5Q A;  5IT9 S;  1LB1 A;  4DR6 M;  3KVW A;  3LW5 F;  1I94 M;  3CF2 A;  5EXP A;  1TQZ A;  1IBM M;  3LVV A;  2EJS A;  1NV8 A;  1Q3C A;  2DAM A;  1PJT A;  2I1J A;  1V5M A;  3HX3 A;  1U29 A;  3B77 A;  2XGN A;  1Z87 A;  4DV4 M;  2QKL A;  3PVW A;  3WHK A;  4DR2 M;  2HCB A;  5DH9 B;  1IXZ A;  3KSY A;  4XWX A;  4LF7 M;  3FD9 A;  3ULB A;  4GMV A;  1UEF A;  1L8Q A;  2VDB B;  3PVS A;  3D8E A;  3B89 A;  2G3Q A;  1MN3 A;  2XSZ D;  4EKU A;  3K92 A;  2F5P A;  4RF1 A;  1NHG C;  4IBG A;  2KW0 A;  2OOA A;  3GQ4 A;  1ZMU A;  5JHH A;  3GLH E;  1HNX M;  3HU1 A;  8CAT A;  2X18 A;  3GPU A;  1NY5 A;  1YE9 A;  4WVF B;  4II7 A;  2EA0 A;  2JP7 A;  5EXS A;  5HE3 A;  4F7U P;  2EO2 A;  2F5O A;  3SO6 A;  1KSF X;  5FTM A;  4JI6 M;  5EP4 A;  1T6O A;  1ZC3 B;  2K00 A;  2F4V M;  2R46 A;  1FGZ A;  4I81 A;  4L4U A;  3K9P A;  4A3V B;  1XCG A;  4QNM A;  2M38 A;  2YS1 A;  1X37 A;  1N78 A;  1IN7 A;  2DNA A;  4RNA A;  1D0M A;  2KRK A;  3T1H M;  3GRR A;  2MJ5 B;  4HHV A;  3VK8 A;  1ZM0 A;  4AQY M;  3GLH B;  4PDG A;  1JR3 E;  1UNP A; 
#chains in the Genus database with same CATH homology
 2UU9 M;  2BJW A;  4NSO B;  3MHV C;  1FB8 A;  1J5E M;  4JI0 M;  1JR3 A;  4XGI A;  3HHX A;  1YSY A;  1Z5B A;  3VLF B;  5C6R A;  3CIK A;  4JV5 M;  2DHK A;  3GRV A;  1X86 A;  3VDU A;  3KRX A;  4QOZ C;  3HHZ A;  3WHL A;  3TW1 A;  4PCZ A;  1HQC A;  4DR1 M;  4LZJ A;  2GS0 A;  4X66 M;  3CF0 A;  4GKJ M;  4M9X A;  4JI5 M;  4KO8 A;  1HNZ M;  3KW6 A;  3SHF A;  2RNR B;  4CHJ A;  2ZAN A;  1SHC A;  2RGN B;  2YRY A;  1TDH A;  1TH4 A;  4DV2 M;  1K82 A;  2DWM A;  2YSZ A;  4YON A;  2F5S A;  4FW9 A;  4G6Z A;  3HU2 A;  4PT5 A;  1U5F A;  1UM8 A;  3A45 A;  4Z8X A;  2CHQ A;  2BNK A;  3BOS A;  3AOE C;  4OX9 M;  2I7P A;  1GL6 A;  2GCJ A;  5EXX A;  3NSU A;  3U6D A;  3K1J A;  1UPQ A;  3U6S A;  4B3T M;  5JHG A;  2VRW B;  1EGX A;  3GYO A;  2COC A;  1JR3 D;  2LNH C;  1WJ1 A;  4GMQ A;  4AZF A;  2R0D A;  4MT7 A;  1X1G A;  2YF0 A;  4L15 A;  4G4Q A;  2V1U A;  1OY2 A;  5C1B A;  3JR5 A;  3E4R A;  3SAR A;  2CY4 A;  3FYC A;  2Z0P A;  1GC6 A;  3U5Z B;  4DR5 M;  2MKR A;  3AU4 A;  3RCP A;  4OVZ B;  1IXR C;  3A42 A;  4B7G A;  4LFB M;  2ZM6 M;  3GLI A;  3RFW A;  3THG A;  3C58 A;  3O96 A;  5FTL A;  4GIT A;  4M0D A;  5KQ4 A;  3D8F A;  2UXD M;  3GRY A;  4Z6Y A;  2EC1 A;  2Y0Q A;  5ITR A;  1I4W A;  3PXG A;  4KHP M;  1QQG A;  2V1C A;  4NXM M;  4AKH A;  2Z4S A;  2DHI A;  2XF3 A;  4G4N A;  2Z0O A;  3AOE A;  4IBI A;  3G9W A;  5FI1 A;  1IM2 A;  2NQ8 C;  2HTH B;  1ISN A;  2ROZ B;  1YUB A;  4FCT A;  2CHV A;  1MX0 A;  3IG8 A;  5A2Q S;  1JQJ C;  4LFA M;  3KOY E;  7CAT A;  3J81 S;  4FWD A;  2MFQ A;  1U5D A;  1V88 A;  1ORY B;  2J7N A;  4EJN A;  2QBY B;  3DA1 A;  5DYI A;  1DDW A;  5JI2 E;  3FM8 C;  3HK0 A;  3SMP A;  4CHT B;  2D9V A;  2DHR A;  3NWL A;  4DR4 M;  4R3D A;  3PFI A;  5FTK A;  1V5U A;  3CXB B;  3KZ1 A;  1QZM A;  3U6C A;  4K81 A;  4CHM A;  5IWA M;  4BB9 A;  4JXJ A;  4Y94 A;  3AJI B;  5HE0 A;  3U6L A;  5LOP B;  1MKE A;  3FTC A;  2J0K A;  2R45 A;  1G3I A;  4MGH A;  2ADZ A;  3OAN A;  2J0M A;  1IBL M;  4IBE A;  4JI1 M;  2C98 A;  1DO0 A;  3LQQ A;  4MM3 B;  4LJA A;  4DV5 M;  3M7G A;  5KPT A;  1K5G B;  2Y8F A;  1X11 A;  4KHB B;  1WGQ A;  1XKE A;  3JR4 A;  4C0A A;  2RKO A;  4NXN M;  1M7R A;  4Z2N A;  2C9O A;  4IIW A;  1SGH A;  3KP1 E;  1E9S A;  3HJQ A;  3HKP A;  2Z0Q A;  5LMU M;  4EIW A;  1ZAE A;  2EMS A;  4LRT A;  1ZC4 B;  1NSF A;  2MDX A;  3ODX A;  3JAM S;  3R9X B;  3U60 B;  4M0W A;  2YS5 A;  4F7G A;  2DX1 A;  4DXA B;  2DZN B;  1IY2 A;  3AV0 A;  3ODO A;  3GPP A;  1TH2 A;  1WVH A;  1FHO A;  1FHX A;  3HGI A;  4AKI A;  1TXD A;  5BR8 M;  2H7E A;  2D7E A;  2UUB M;  1QAQ A;  2EUC A;  5J3Y A;  4GHA A;  5LON B;  4LGM A;  5DHA B;  4PD2 A;  4OVZ A;  3WA0 A;  2DA0 A;  2FNA A;  4HAX B;  2C9C A;  4FCV A;  4P7I A;  4D81 A;  1L1T A;  3PG7 A;  1RJ2 A;  2ZPY A;  1KZ7 A;  1TDZ A;  2KA6 B;  2KXE A;  4F7H A;  3H4M A;  3SYX A;  1FJG M;  1MU5 A;  3PNV A;  1R2Y A;  4TUW A;  5EP1 A;  4LFC M;  5ITY A;  3PSC A;  3SNH A;  2DX5 A;  1XD4 A;  3L27 A;  4AG5 A;  2AHM A;  5GKN A;  1DGG A;  4GPT B;  3SC3 A;  2NMB A;  4MGY E;  2DN6 A;  1SXJ B;  1LW3 A;  1HR0 M;  2HHH M;  1OFI A;  2MWN B;  4W5W A;  2YFQ A;  3CTW B;  4B7F A;  4HLQ A;  5IZ7 D;  5KO3 A;  2QBY A;  1N33 M;  2C5R A;  1N34 M;  1FAO A;  2DFK A;  3K2L A;  4QHT A;  2DYN A;  2L2I A;  5F3W A;  2FOI C;  2H7D A;  2W2X C;  2D7H A;  2V6Z M;  3PZD A;  1FOE A;  2D9W A;  3V5W A;  3UJN A;  1L2C A;  4B3M M;  3SBJ A;  4LGY A;  1MK9 B;  2C96 A;  1IN6 A;  3VKG A;  1K3X A;  1QAO A;  4ZRI A;  5D3Y A;  1EAZ A;  4X64 M;  1WGU A;  2UZR A;  5KQ1 A;  1MPH A;  3AJ4 A;  2COF A;  1Z59 A;  2D11 A;  5EQT A;  5FTJ A;  2RGH A;  4IBB A;  4XBO A;  5FLX S;  1PJJ A;  2X49 A;  3T38 A;  2L09 A;  4MB7 A;  1DO2 A;  3GLI B;  4DR7 M;  3N7C A;  3GP1 A;  3GQ5 A;  2EMT A;  4H8S A;  4FD2 A;  5E6J A;  3FTE A;  3HWS A;  2KUP A;  2YVC A;  1Z5C A;  4GN1 A;  1GKI A;  3ZVR A;  1NHW C;  3Q8X A;  3GLF B;  3MDB C;  2D9Y A;  4L16 A;  2R18 A;  3TWM A;  1U5G A;  3T1Y M;  2QKM A;  2DHJ A;  3D8D A;  3HU3 A;  1K3W A;  2UUA M;  1GG3 A;  4GZU A;  2G8L A;  2M60 A;  1OQN A;  2UZS A;  3T15 A;  1HNW M;  4AKG A;  4I5S A;  2DZO B;  3FTD A;  3TE6 A;  5D27 A;  2YNM D;  5IRE B;  1NVM A;  1XMO M;  4LF4 M;  1C1K A;  3D8L A;  2H1R A;  4HAT B;  2UXB M;  2LXE A;  1Q39 A;  2N0Y A;  3MPX A;  3QAU A;  3ZCB B;  4LF6 M;  3GPY A;  4JI3 M;  2N23 A;  4YY3 M;  1P5T A;  2G5G X;  2J7O A;  1B55 A;  1ZSQ A;  1ZVR A;  4MY6 A;  4RF0 A;  4JYA M;  3NBI A;  1QAM A;  1Z5A A;  2XLJ A;  5GOW B;  2R4J A;  1T3T A;  4I4L A;  5LMN M;  1XC8 A;  1FNN A;  5C5B A;  1H10 A;  5D3X A;  1Q3B A;  5KCV A;  4LF5 M;  4ZPX A;  1U27 A;  3VOQ A;  2QPA A;  4MH0 E;  4AG6 A;  1NY6 A;  4KVG B;  2D9X A;  1Z6T A;  4QNR A;  4MGK E;  1R2Z A;  1N75 A;  2K2J A;  5C79 A;  3FUT A;  1N3H A;  2XQN M;  4WJ7 A;  3KDS E;  2ZBK B;  5ITU A;  4LJ4 A;  2HKJ A;  3KSJ A;  3DOA A;  1KYI A;  4LJ8 A;  3U6E A;  3U6P A;  2LUL A;  2LYD A;  2Z3X A;  3VDP A;  1OJL A;  2P0F A;  3J7A S;  1DYN A;  1XNQ M;  1X05 A;  1BTK A;  1U5E A;  2L6O A;  1X1F A;  1Y5O A;  2RLO A;  1SXJ A;  2CAY A;  2JP2 A;  2YR0 A;  2OPF A;  1S3S A;  2Z7J A;  4G4R A;  4HAU B;  4HB4 B;  4PQ0 A;  5HE2 A;  2J59 M;  4M9Z A;  3HW2 B;  1KFV A;  1UPR A;  2ERC A;  3KXE C;  2I7N A;  1XNR M;  1E9R A;  1KZG A;  4NOO B;  3UGJ A;  4KLN A;  2KGX B;  1V89 A;  2UVM A;  4LY6 A;  3I4Y A;  4GRI A;  3PVU A;  1G4A E;  3KP0 E;  1H6U A;  3AU5 A;  3SAW A;  4BBK A;  4D82 A;  3GLF A;  1D2N A;  2W82 A;  4GMX B;  4REZ A;  3L28 A;  2VKI A;  3VK7 A;  5EXT A;  3IVF A;  3SV1 A;  4A6F A;  5DNY A;  3HQC A;  4JN6 A;  4M9S A;  4HAZ B;  2Z4R A;  4KAX B;  3OTO M;  2R62 A;  3WYF B;  4K2P A;  2CFO A;  3KOW E;  1SXJ C;  2LOX A;  3DXD A;  3QBV B;  4WSF A;  3LJU X;  4D0N B;  4DV0 M;  3TCA A;  5FSW A;  1UNQ A;  4B6H A;  4DX9 0;  2YT1 A;  1I2H A;  1N32 M;  2EJ8 A;  1W5T A;  3RE8 A;  3TO1 A;  2PZ1 A;  2KZU A;  3K8Z A;  3TWL A;  5FI0 A;  2X4A A;  5C5B B;  3ILK A;  3PNY A;  4HAV B;  2D10 A;  4DV1 M;  1K5D B;  2D2Q A;  4YHH M;  4CGY B;  5ITX E;  2LG1 A;  2HL7 A;  5FTN A;  4KHA A;  1V5P A;  3RGP A;  3U5Z A;  2X8A A;  3I4V A;  1WXQ A;  4LF9 M;  1GC7 A;  3J80 S;  4IBJ A;  4LRS A;  1W1H A;  2COA A;  4PNK A;  2UUC M;  3GO8 A;  3F0W A;  3FYD A;  2AL6 A;  4IFS A;  1DRO A;  3T06 A;  1MK7 B;  2K2U A;  3SYK A;  1P6S A;  1ZQ9 A;  4FVM A;  3ODW A;  3R8F A;  3U61 A;  1BAK A;  1RRP B;  4NRW A;  2K47 A;  4NL4 H;  4B3R M;  1J09 A;  2DKP A;  4EMO A;  2R4E A;  2VII A;  2DYQ A;  2GCL A;  3PVL A;  2D7G A;  4NRV A;  2P0D A;  4OW0 A;  1NI2 A;  4K17 A;  4K0K M;  1SXJ E;  3FUV A;  2COD A;  5D3V A;  3KOZ E;  4PDI A;  3BIN A;  5J3Q A;  3UZT A;  3DZD A;  5CLL B;  1NJF A;  3DFZ A;  3IG5 A;  4LZZ A;  1PM5 A;  1L2D A;  3HJ8 A;  1E5W A;  1HT1 E;  3SUZ A;  1FGY A;  3EIE A;  2RGO A;  3KSX A;  3MJ5 A;  5EP3 A;  5C18 A;  4DV6 M;  2VQF M;  2CHG A;  2R09 A;  1NNU C;  4IBF A;  2QP9 X;  2BCJ A;  2FJL A;  2UXC M;  2QZ4 A;  4LJ6 A;  2Q13 A;  1QVR A;  2D9Z A;  2RSG A;  3HHW A;  4KHO A;  2R65 A;  4LCB A;  1DDM A;  4IBD A;  2KCJ A;  2ROV A;  3E9S A;  3GLH A;  2YT0 A;  1NJG A;  3L2A A;  4MGZ E;  1GL7 A;  1DBH A;  1FHW A;  4G4O A;  4HAY B;  1IN4 A;  2OQ4 A;  4S12 A;  3U60 A;  3L26 A;  3FTF A;  1TJ6 A;  2E2X A;  3U6M A;  4B3S M;  4NY0 A;  3TPZ A;  1EE8 A;  4FWG A;  2M14 A;  2XZF A;  4Z2M B;  3SYL A;  2DXI A;  5DHF B;  1DGB A;  1XMQ M;  1J19 A;  2XH9 A;  4GC5 A;  1DDV A;  4B7H A;  2W2X D;  2L7H A;  5ITX A;  2GJY A;  4CIS A;  4BLC A;  3ULC A;  1TGU A;  1AWE A;  3SMS A;  2I1K A;  2OTX A;  4LJ7 A;  3ML4 A;  3P6A A;  2CV1 A;  3KRW A;  3KS8 A;  4I8O A;  3TVV A;  2Y8G A;  2XSZ A;  3UZU A;  2Y21 A;  4P16 A;  2IFS A;  2Y7B A;  3M6A A;  4DUZ M;  3ZC7 B;  3U6O A;  1PFJ A;  3A98 B;  3SAU A;  2W2W A;  3M1I B;  4HB2 B;  1NTV A;  2VSZ A;  3X23 A;  3D8B A;  4AW4 A;  4LG2 A;  4HDQ A;  1GVN A;  1IY0 A;  4DV7 M;  1G59 A;  3FEH A;  4IOY X;  3W0F A;  1HT2 E;  4GKK M;  4IBC A;  2RVB B;  1NNJ A;  3FUU A;  3U8Z A;  1H4R A;  2LWX A;  1W1G A;  3TWK A;  2ELA A;  5EJC A;  4JI7 M;  3LMM A;  2XFS A;  4B08 A;  2P5T A;  5H37 D;  1IXS B;  3GLG A;  1PMS A;  4JI4 M;  3HJS A;  2I5C A;  1U2B A;  1E32 A;  1EVH A;  2CY5 A;  3KOX E;  1IN8 A;  4AI6 A;  3A46 A;  5KPR A;  4WW0 A;  5JI3 E;  4X62 M;  3J2P B;  2F5Q A;  5IT9 S;  3J7B A;  4DR6 M;  1LB1 A;  4TYZ A;  3ZH9 B;  2VQE M;  4DX8 A;  3RGS A;  1BWN A;  1PJI A;  5J3T A;  3KVW A;  4FCW A;  4DR3 M;  1G8P A;  1GLN A;  1I94 M;  4LF8 M;  3CF2 A;  5EXP A;  2KEB A;  2Y20 A;  1IBM M;  1TQZ A;  3LVV A;  1G41 A;  4GIP A;  1MIZ B;  2FE8 A;  3UMM A;  2G35 A;  3DXE A;  4YL8 A;  5DIF B;  4A6K A;  1Q3C A;  1P3R A;  3KY9 A;  5JLJ B;  1IN5 A;  1AQC A;  2AEH A;  2I1J A;  1SXJ D;  1I7A A;  1V5M A;  2YS3 A;  2HE7 A;  3FKE A;  4MK0 A;  1U29 A;  2F5N A;  1W5S A;  3SAT A;  2LKO A;  5C16 A;  1HQY E;  2XGN A;  3U7D A;  1Z87 A;  4DV4 M;  1J0W A;  2QKL A;  4IAP A;  1IBK M;  3A8P A;  3PVW A;  2CRF A;  2CV2 A;  3WHK A;  5ITQ A;  1M7E A;  4HB3 B;  4DR2 M;  2HCB A;  3TQS A;  2P0H A;  3VIA A;  4L8R C;  3QWM A;  1IRS A;  5DH9 B;  1IXZ A;  2CEA A;  3KSY A;  2P8V A;  1XXH B;  4LF7 M;  1IY1 A;  4XWX A;  2Y0T A;  3FD9 A;  3ULB A;  4GMV A;  5CLQ B;  3LVW A;  1UEF A;  2KRU A;  1L8Q A;  2XEP A;  1DGH B;  1L2B A;  4DV3 M;  1L1Z A;  4JI2 M;  2JA2 A;  1NU2 A;  3PVS A;  3D8E A;  2IYB A;  3SHG B;  3LQR A;  1QAN A;  5BPV A;  2XSZ D;  3A8Q A;  3FUW A;  4HL4 A;  4NSR A;  3UK6 A;  3B9P A;  2DWL A;  2L7I A;  2I5F A;  5L81 A;  1OFH A;  3QWL A;  1QYR A;  1XHB A;  4QHS A;  3SAV A;  4LJ9 A;  1WG7 A;  5KPZ A;  3K92 A;  2F5P A;  1XR0 B;  3BJI A;  4EKU A;  2ZAM A;  4QOS A;  3VKH A;  4RF1 A;  1NHG C;  3TFM A;  5HE1 A;  2DVW B;  4IBG A;  3KFU G;  3SAS A;  3DXC A;  4TKN A;  1IQP A;  4GH9 A;  1MAI A;  2KW0 A;  4L6E A;  3I51 A;  3MK6 A;  3TL4 X;  3GQ4 A;  1KI1 B;  1Q67 A;  1WI1 A;  5JHH A;  3PP2 A;  5EP2 A;  3HU1 A;  8CAT A;  1R7R A;  1HNX M;  5KQ8 A;  4A6F B;  2X18 A;  2BJV A;  2NZ8 B;  2J0J A;  4ZRK A;  2C99 A;  4DUY M;  4HAW B;  3FUX A;  3AKZ A;  4D80 A;  3GPU A;  1BTN A;  1NY5 A;  1YE9 A;  4IBK A;  4HDO A;  4WVF B;  4II7 A;  3W0L B;  5DYG A;  1XX0 A;  4NSW A;  4FWH A;  3L25 A;  2RUK B;  2L1C A;  4GHL A;  4BBA A;  2DKQ A;  2DWZ B;  1J7K A;  2M5Z A;  4X65 M;  2EA0 A;  3U61 B;  2DWN A;  1OMW A;  5EXS A;  5HE3 A;  4LJ5 A;  2XFT A;  4F7U P;  2EO2 A;  3AL0 C;  2F5O A;  2DTC A;  4L78 A;  4JI8 M;  2ELB A;  5DI9 B;  3SO6 A;  1TH3 A;  2KZS A;  1KSF X;  5FTM A;  4K2O A;  2O5R A;  3GYP A;  4JI6 M;  1LV7 A;  3FSS A;  5EP4 A;  1E94 E;  2CUZ A;  5E26 A;  3SFZ A;  1VDD A;  2FFJ A;  3GPX A;  2F4V M;  1ZC3 B;  2K00 A;  3PEG A;  4ZRJ A;  1XWI A;  4CYE A;  2R46 A;  3CF6 E;  1FGZ A;  1XXH A;  1XOD A;  1DGH A;  3KS4 A;  4IJF A;  1QC6 A;  3GRU A;  3J27 B;  2V76 A;  4I81 A;  4OU7 A;  2E5L M;  4L4U A;  3EIH A;  4ITQ A;  4A3V B;  4GXB A;  1V61 A;  1XCG A;  4QNM A;  2XZU A;  1NTY A;  4A6H A;  4R7G A;  3U6Q A;  3GLG B;  2QEN A;  5ITT A;  2CV0 A;  1MIX A;  2M38 A;  2YS1 A;  3GQ3 A;  1X37 A;  1N78 A;  1IN7 A;  4RNA A;  1Y19 B;  5D3W A;  2KRK A;  4MGI E;  4WUR A;  3T1H M;  1N77 A;  3VFD A;  2DLW A;  2LOZ A;  1W1D A;  3ZDT A;  3GRR A;  4A5K A;  4IJE A;  4HB0 B;  3L29 A;  3F5R A;  3AOG A;  3AFH A;  2QCU A;  2A5Y B;  2ZAO A;  5JP4 A;  1R6B X;  5EFX A;  4KOD A;  3M0E A;  4GC9 A;  2CE7 A;  3QIJ A;  3VK8 A;  1ZM0 A;  1PLS A;  4HHV A;  1N36 M;  4AQY M;  2YQZ A;  3P7Z A;  2LH0 A;  3HHY A;  1UNR A;  1EF1 A;  3GLH B;  2D4Q A;  4PDG A;  2Q2E B;  1DGF A;  4DBB A;  1WJM A;  1UNP A;  2OQB A;  1QQW A;  5KQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...