3A98B

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
190
Chain Sequence
b'SGPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 190
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.920 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a98B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a98B02
2GJYA 3SV1A 1OMWA 1AWEA 5FI1A 4NSWA 2OQBA 2PZ1A 1UNQA 1NI2A 4IAPA 3P7ZA 2VRWB 3G9WA 1ZSQA 1NTYA 1DROA 1MIXA 5HE3A 1KZ7A 1NU2A 1RJ2A 1EF1A 4IOYX 1NTVA 1X86A 1LB1A 2QKMA 1BTKA 3CIKA 4EJNA 4GN1A 2N0YA 1V5UA 3U7DA 5C5BA 1OQNA 1UEFA 2UVMA 3AU4A 3WA0A 4A6FA 4P7IA 4TKNA 2ELBA 1DBHA 3HW2B 3DXDA 3VIAA 3TO1A 3A8QA 1WG7A 2DX5A 3D8EA 4PNKA 5DHAB 1M7RA 3PVUA 1WI1A 1Q67A 1I2HA 1W1HA 2VKIA 5JHGA 2GCJA 1FHXA 4HDOA 4KHBB 1FHOA 4A6FB 4DX90 4HAUB 5HE2A 4HAVB 3PVWA 5DI9B 4KAXB 2I1KA 3SO6A 3ZDTA 1Z87A 2YRYA 4WVFB 2I5CA 1MAIA 3IVFA 3OANA 2RLOA 4K81A 5J3QA 2R0DA 2RVBB 3SNHA 5LONB 1FGYA 1XKEA 3ML4A 2NMBA 1UNRA 3GYOA 4CHMA 5KCVA 2E2XA 2YS1A 2R09A 4CHJA 1UNPA 1AQCA 3DXEA 3FSSA 4C0AA 1W1GA 4PQ0A 2LYDA 2LOXA 3LJUX 1PMSA 1WGUA 2D9XA 4GZUA 1PFJA 2AL6A 5L81A 2DFKA 1WVHA 2DTCA 2Z0OA 2ADZA 2W2WA 2LG1A 2KGXB 2RSGA 3V5WA 5KQ4A 2UZRA 1P6SA 3NSUA 2YT1A 2RGNB 1FAOA 2LKOA 2V76A 2EJ8A 3TW1A 3T06A 1Y5OA 2Z0QA 4H8SA 1J19A 2L1CA 1BAKA 3CXBB 1SHCA 2NZ8B 2DX1A 3X23A 2D11A 1K5GB 1GC7A 3FM8C 3QIJA 1MK7B 5DHFB 2MFQA 3PVLA 5JLJB 4K2OA 2DKQA 1MK9B 5HE1A 3SUZA 4Z2NA 5JP4A 3MPXA 4DBBA 1XD4A 2EMTA 2GS0A 3WYFB 2IYBA 1FHWA 1P5TA 1DYNA 1ZC4B 4EMOA 3ODXA 4MY6A 4HB0B 4CYEA 4ZRIA 2D2QA 1X11A 2HTHB 1U5DA 4HB4B 5KQ1A 3U8ZA 2MWNB 2J0KA 1GG3A 2YS3A 4MK0A 1WGQA 2W2XC 2DHKA 5C5BB 2Z0PA 1XCGA 2DN6A 1U2BA 1QC6A 4BBKA 3D8FA 4GMVA 2CY5A 1DDWA 5J3TA 4Z2MB 3PZDA 5JHHA 1V5MA 5D3XA 3A98B 4Y94A 3P6AA 1UPQA 3RCPA 3AU5A 5C79A 2K2JA 1X1GA 4A6HA 3KY9A 1U27A 4GMXB 5FI0A 2J0JA 2ROVA 2Q13A 1K5DB 3TVVA 1TXDA 2OTXA 2D9VA 3D8DA 3M1IB 1M7EA 2GCLA 1DDVA 1N3HA 2W2XD 3F5RA 1FB8A 3A8PA 5GOWB 2COAA 1E5WA 2M14A 4XWXA 3SYXA 5C6RA 2X18A 2D9WA 3ULCA 2DHJA 1FOEA 1EGXA 1U29A 2UZSA 1MIZB 2YT0A 2D9ZA 3DXCA 5D27A 1PLSA 1RRPB 4EKUA 4HHVA 4WSFA 1UPRA 2P0HA 2Y8FA 4A6KA 3KSYA 1V5PA 3HQCA 1W1DA 2COFA 3TFMA 1WJ1A 1TJ6A 1WJMA 1KI1B 1H10A 1BTNA 4MT7A 1Y19B 4GXBA 4ZRKA 2H7EA 3UZTA 4IFSA 2CRFA 3F0WA 4YONA 4HATB 2G35A 3QWMA 5DIFB 1X1FA 1ZC3B 2DYNA 4A5KA 1J0WA 2J59M 3BINA 1I7AA 1ISNA 4NY0A 3PEGA 4KHOA 2DYQA 5D3VA 5C16A 2I1JA 1KZGA 4DX8A 2YSZA 1GC6A 1XODA 1XX0A 5DH9B 1X05A 5D3YA 2K00A 1V88A 3PG7A 1U5FA 1ZVRA 2ELAA 2ZPYA 5HE0A 2Y7BA 2DA0A 2D10A 2BCJA 3ODWA 1EAZA 4HDQA 2RNRB 2DHIA 1SGHA 3QBVB 1XR0B 2MDXA 3PSCA 2P0FA 1OY2A 5LOPB 2IFSA 5J3YA 1TQZA 2CODA 3ZVRA 4F7GA 2KUPA 4KVGB 3TCAA 1H4RA 2H7DA 3ODOA 3KRXA 2MKRA 2Y8GA 2CY4A 2LOZA 2LULA 2K2UA 4D0NB 4GPTB 3O96A 4HB3B 5CLLB 4DXAB 2ROZB 2P8VA 1LW3A 2VSZA 4HAZB 2JP2A 2RUKB 5EFXA 1EVHA 2P0DA 4F7HA 1V61A 4L6EA 2DLWA 3FEHA 1FGZA 2COCA 3N7CA 1U5EA 3PP2A 2YVCA 1U5GA 2J0MA 4HB2B 2CAYA 2M38A 3ULBA 2N23A 5CLQB 4HAYB 2KCJA 3GYPA 1V89A 1QQGA 1MPHA 4KHAA 2L2IA 2AEHA 4B6HA 3HK0A 4K2PA 3MDBC 4YL8A 4HAXB 2YF0A 2DKPA 2YS5A 1DDMA 2D9YA 1MKEA 3AJ4A 3KRWA 1BWNA 2D4QA 4F7UP 4TYZA 4WJ7A 1B55A 3KZ1A 4ZRJA 2EMSA 2I5FA 2HE7A 2XQNM 3VOQA 1P3RA 1ZM0A 4K17A 5D3WA 2FJLA 3BJIA 4HAWB 1IRSA 2EC1A 2QKLA
chains in the Genus database with same CATH superfamily
1AWEA 3U6CA 2GNOA 4M0WA 4NSWA 1D0LA 1NI2A 2JY8A 1ZSQA 4JI7M 1VDDA 3KOYE 5HE3A 1GABA 3AJIB 1X86A 3ILKA 4X66M 2DZLA 4NC6A 3UGJA 3CIKA 2LBCA 4LFAM 3HJ8A 1DV0A 3PNYA 2N0YA 2DHYA 4DUYM 3U7DA 4FCTA 4M9ZA 4TKNA 4G3OA 2G3QA 1DBHA 4F2LA 3TO1A 3FVCA 4LJ5A 1W1HA 2QNJA 5JHGA 5KPTA 1D0KA 4IIWA 5ITXA 5DI9B 1E94E 5JI2E 4KAXB 3A45A 3SO6A 1WXQA 2YRYA 4GNKB 5KPRA 5J3QA 2RLOA 2R0DA 5A2QS 3LVVA 1FGYA 1UNRA 4CHMA 5DYGA 3R8FA 3GPPA 1AQCA 4C0AA 4CSQA 1W1GA 1IN6A 4PQ0A 2R6FA 2QP9X 1NV9A 3HJSA 4AKHA 3I4YA 4G4RA 2BWBA 1TH4A 2KZUA 3I01M 2CV2A 5EP4A 4IBEA 5I2MA 2W2WA 3IECA 3GLGA 4LRSA 1EE8A 2YT1A 2V76A 3R9XB 3TW1A 3GPXA 4R7GA 4JN6A 2CHVA 3SC3A 3GLIA 2KA6B 4H8SA 4TUWA 5FSWA 1K5GB 1Z6TA 2EO2A 3HX3A 2R44A 3FUUA 5DHFB 4QHSA 2MR9A 3B7QA 1D0MA 3BBZA 3SUZA 5H37D 2FJUB 4LJ9A 3TPZA 3MPXA 4KO8A 2QPAA 1Z5CA 2KIEA 2LHGA 1P5TA 4EMOA 1KFVA 3Q8GA 1NHGC 4MY6A 4IBBA 3C9PA 2DAEA 2KEBA 4IBFA 1U5DA 2LVOC 3U8ZA 2MWNB 5BPVA 3M7GA 2K9DA 2C5RA 4L1RA 2YS3A 4MK0A 1WGQA 4GHAA 1DGBA 3M0EA 4ZPXA 1XCGA 3B7ZA 4MGIE 3U6PA 1J7KA 1QC6A 1IY2A 1IBKM 1OQYA 5JHHA 5C18A 5D3XA 1NSFA 4BBAA 4Y94A 3RCPA 3QYBA 3KS8A 3GPYA 1WIVA 5FI0A 2KRKA 2WSFF 1K3XA 2I7NA 1K5DB 2N35A 3TVVA 3W0FA 3HHZA 1TXDA 2D9VA 3D8DA 4AG6A 2ZM6M 1M7EA 2GCLA 1N3HA 2W2XD 5ITTA 1K82A 3JR5A 3A8PA 3PVSA 5GOWB 2VF8A 1N77A 1L2DA 2JY6B 1SXJA 1U29A 2YT0A 2D9ZA 1IM2A 4HHVA 1EFUB 2C99A 4HLQA 2XEPA 1P3QQ 1TH2A 1TDHA 2Y8FA 3HIEA 1V5PA 3CF6E 3RGPA 1WJ1A 1A5TA 4D6WA 1BTNA 4MT7A 4GXBA 3UZTA 1IN8A 3F0WA 1PJIA 3U60B 1YE9A 1V34A 3HJQA 3EIEA 2JWSA 3OTOM 3SATA 4LGYA 5FTMA 1I7AA 3V76A 3KXEC 4GIPA 3RE8A 2I1JA 2YSZA 3NWFA 3OHMB 1XODA 5D3YA 3IG8A 3HSAA 4NRVA 1ZVRA 2ELAA 4DV4M 4WURA 2DA0A 2D10A 2BCJA 3ODWA 3DFZA 2JZ0A 2M60A 3NW8A 4M0DA 4S12A 3HY5A 4PDGA 2DHIA 1J5EM 1XR0B 2JZ1A 2P0FA 1XNQM 5LOPB 2L7HA 1TQZA 3ZVRA 1IQPA 3NWDA 2CRUA 5DNYA 2DWLA 4G6ZA 2CY4A 4D0NB 4IBCA 7CATA 2CE7A 3U6QA 4HAZB 3GLFE 2RUKB 4RNAA 2P0DA 4F7HA 1V61A 2R62A 3AL0C 3FEHA 2COCA 3GLFB 2JUJA 3N7CA 2P5TA 2OOBA 2HWJA 1U5EA 3PP2A 1ZMUA 2EKKA 4CHTB 4OVZA 4DR4M 2BJWA 2XH9A 3U61B 1Z5BA 3ULBA 2N23A 2VIIA 5CLQB 4HAYB 3FD9A 4QXAB 1V89A 4KHAA 2AEHA 2XFTA 5E26A 2VDBB 2YF0A 3A42A 3FYCA 1DDMA 3U6MA 2J7OA 1XXHB 1E9RA 1ZMVA 1NV8A 1KYIA 3VDPA 4WJ7A 3QYEA 2K49A 4ZRJA 3VOQA 4QOZC 3TQSA 1OMWA 2K47A 2QCUA 4ANRA 3KDSE 2PZ1A 4KLNA 4UN2B 3P7ZA 3TE6A 1NTYA 1R6BX 1Q3CA 1DROA 1EF1A 5F3WA 1LB1A 4JI1M 4AI6A 1T3TA 4DV7M 1V92A 2F5SA 2UXCM 4GN1A 1R2YA 1V5UA 5LMUM 3A46A 4A6FA 4P7IA 4L78A 4W5WA 4WW0A 3HW2B 3L29A 3HKPA 1Y8GA 3PVUA 1WI1A 3GO8A 1Q67A 1I2HA 3M6AA 2DAKA 2VKIA 1OAIA 2DNAA 3HHXA 2MJ5B 1Z59A 2EJSA 4DX90 4KT0F 3PVWA 3ZDTA 4HSIA 1Z87A 2I5CA 2CHQA 1R7RA 2CV1A 3OANA 4K81A 3SNHA 5LONB 1XWIA 4XK8F 1XKEA 3ML4A 2NMBA 3GYOA 5JI3E 2R09A 5IT9S 1UNPA 2Z13A 1YUBA 3L28A 2RRFA 1JR3A 1PMSA 2D9XA 1QUSA 3B74A 2AL6A 5L81A 1WVHA 5ITRA 1XB2B 3CF2A 1G41A 4LF9M 2LHCA 3V5WA 2L4FA 1P6SA 2RGNB 1FAOA 1TH3A 1T77A 4Z6YA 2LKOA 1VQ1A 2Z8YM 5BR8M 2DENA 3TWLA 2EJ8A 1Y5OA 1ORYB 4Q7JA 1SHCA 4GC9A 2NZ8B 1VEJA 2DAMA 4LF7M 3UZUA 4DV2M 2D11A 1GC7A 4LF6M 3FM8C 3QIJA 2Y0TA 1DO0A 2MFQA 3FUXA 5EP3A 5IREB 1C7YA 4DR6M 3FUWA 4GH9A 3VKHA 2KXEA 4GMQA 1BVSA 2RGOA 1XD4A 1EIJA 3UK6A 2IYBA 1Q02A 2O01F 1JB0F 5EP2A 1ZC4B 1DYNA 3ODXA 1MJGM 4ZRIA 3PXGA 2D2QA 3I51A 4LF4M 2KRUA 3UMMA 2MROB 4L15A 1N36M 3JR4A 1K3WA 4HB4B 3MMPA 4LJ6A 4QNMA 2J0KA 1IFYA 1TTEA 4Y28F 2L4EA 4MGZE 1TGUA 5C5BB 3CF0A 4NOOB 3J27B 2Z0PA 1XHBA 1U2BA 2L6OA 3D8FA 5L8RF 3T1YM 2JY7A 2V6ZM 4L16A 1S3SA 3A98B 1OIZA 2R46A 3GLHE 1IXSB 2OO9A 2RKOA 1X1GA 2OPFA 5I2SA 3SHFA 2J0JA 2ROVA 2Z4DA 5IZ7D 4L8RC 1GL7A 2R2YA 3F92A 1E5WA 4GOUA 1VG5A 1XXHA 2UZSA 1MIZB 5D27A 3DXCA 1DGFA 1PM5A 4EKUA 2AHMA 2X8AA 1UPRA 2DI0A 1IN5A 3KSYA 1W1DA 1WGNA 3TFMA 1WJMA 4M9XA 4JI8M 1T6OA 1H10A 3W68A 1NJFA 4DR2M 1I4WA 1YSYA 3KS4A 3KVWA 4YONA 4RF0A 2FE8A 4HATB 1Q39A 1HT2E 4II7A 1X1FA 4DV6M 1ZYIA 3MJ5A 4QHTA 2DYNA 1J0WA 3GRVA 3BINA 4LJ8A 1ISNA 2X49A 1QAOA 1GKIA 1D2NA 4IBJA 2DYQA 1GLNA 1KZGA 4DX8A 1AIPC 1E32A 2C9CA 3DZDA 1X05A 1OIPA 4DR1M 4NSRA 1U5FA 3RFWA 3E46A 5HE0A 2CV0A 5EXSA 2Z4SA 4IBIA 4F1IA 2G8LA 3ZQJA 2K6BA 2ERCA 1QDTA 3QBVB 3GRRA 1J09A 1WJ7A 2CODA 4MB7A 2L2DA 4AW4A 5DFLA 4KVGB 2HL7A 3TCAA 3FTFA 2H7DA 3U6OA 3B89A 2YNMD 2LTUA 4IJEA 3KW6A 2YFQA 2LOZA 3Q8XA 2RGHA 1XMQM 3C58A 2VSZA 3FRIA 2F5OA 3SAWA 3HU3A 1L8QA 4L6EA 3LMMA 1IBLM 3AOEC 3FTCA 1JR3D 2QBYB 4LZZA 3DOAA 2CAYA 3KSJA 3W0LB 2M38A 3NWLA 1IN7A 2KCJA 3GYPA 3HU1A 4NSOB 2UUBM 2DXIA 3WHLA 3MDBC 4YL8A 4HAXB 1G8PA 2HCBA 2Q2EB 2D9YA 2DWMA 3U6LA 2WSCF 2D4QA 4F7UP 4AG5A 2CHGA 3HGIA 3KZ1A 4CIZA 3SMPA 4LF8M 1ZMWA 2HE7A 4RF1A 5D3WA 3T6PA 1IRSA 2EC1A 2FS1A 2GJYA 4G4QA 3K2LA 5FI1A 1UNQA 4IAPA 1IXZA 2VRWB 3G9WA 2O5RA 3U12A 2QSFX 4L4UA 4NXMM 3SFZA 2VQEM 1KZ7A 1NU2A 4GKJM 3K9PA 4IOYX 4LRTA 2I7PA 2H5XA 1BTKA 1XNRM 4EJNA 5ITQA 4I81A 2XF3A 5C5BA 2UVMA 4X65M 1L1TA 2ELBA 3FTEA 3J80S 2LVPC 3A8QA 1WG7A 3U5ZB 2Z59A 3D8EA 5DHAB 1M7RA 3RGSA 2DHRA 4EIWA 3E21A 4IBKA 1IXSA 5EXPA 4KHBB 2YR0A 4BLCA 1FHOA 4NRWA 1NO1A 4OW0A 5HE2A 2A5YB 3UJNA 4JI6M 1VEKA 3SAVA 3T15A 4WVFB 1MAIA 5ITXE 4I8OA 5KCVA 3ZC7B 2E2XA 2Z14A 3FRHA 5IWAM 4HEOA 3SYLA 4FWHA 2LYDA 3J2PB 2LOXA 4GZUA 1WGUA 2XZFA 3H4JA 1HNWM 5KQ8A 1PFJA 5LG4B 2R4JA 2DFKA 4CISA 4FVMA 1G4AE 2G5GX 5KQ4A 3VLFB 2R65A 3LCVB 5EP1A 4OU7A 3GP1A 3GLGE 3T06A 1SG9A 2E5LM 2Z0QA 4B7HA 1QYRA 1J19A 2L1CA 3GQ5A 2EUCA 1BAKA 3CXBB 2KDLA 2D7EA 4FCWA 4MM3B 3GLGB 3LQRA 2ZTCA 2DX1A 3X23A 3L26A 4FW9A 3LCUA 1JQJC 4D81A 3GLIE 2R0IA 1MK7B 5JLJB 1NNJA 2KUQA 2DKQA 4P16A 2XZUA 1HQCA 5GKNA 5JP4A 2R45A 4CJ6A 2EMTA 3DA1A 2GS0A 2QQ8A 4MH0E 1L1ZA 2UXDM 4IBDA 1G3IA 1DGGA 2LXEA 4OT1A 3IG5A 3BOSA 4CYEA 1TDZA 2VQFM 4AZFA 3D8BA 3KFUG 4MGYE 5KQ1A 2C9OA 3FTDA 1NY5A 3J81S 5KPZA 4YHHM 4I5SA 1PJJA 1QAQA 3AOGA 2XSZD 3GQ3A 4BBKA 4GMVA 4LJ7A 4Z2MB 3PZDA 4FWDA 2DAGA 4PT5A 2DVWB 4FCVA 3H4MA 5C79A 2K2JA 4G4NA 3THGA 1W5TA 1N75A 2WSEF 1U27A 2DWNA 4GMXB 1VDLA 2QBYA 2B3TA 2K0BX 1H6UA 2QZ4A 1FNNA 1IN4A 1PJSA 5EXXA 2YT2A 2OTXA 1PGYA 2BJVA 2CWBA 3F5RA 3B77A 2ZAMA 3CGWA 2LVQD 2COAA 2LWXA 3SYXA 2D9WA 1PJQA 1FOEA 3HHYA 3KOWE 3U60A 1MN3A 2P0HA 1SXJE 1L2BA 4LY6A 5KO3A 2COFA 3T1HM 2UXBM 3HWSA 1KI1B 1NVMA 2RRUA 1SXJB 2H7EA 4NL4H 1OKSA 2F5NA 3C3DA 4IFSA 2CRFA 4YY3M 2XFSA 2G35A 5FTNA 4A3VB 1ZC3B 3MK6A 3QWLA 1FJGM 4AKGA 4B08A 3A58A 5ITYA 4JI3M 1QDRA 4B7GA 5C16A 1GJSA 1GC6A 1GJTA 1XX0A 3KSXA 3U5ZA 2K00A 3TWMA 3VFDA 2Y7BA 4JI5M 4OSNA 2DWZB 2OQ4A 1EAZA 1HT1E 4KHBA 4HDQA 3GQ4A 2RNRB 1SGHA 2FOIC 4GKKM 2MDXA 2ZAOA 1OY2A 5J3YA 3U6DA 4LFCM 2Y0QA 1Q3BA 2X4AA 8CATA 2MH8A 2KW0A 4JYAM 4LF5M 1OTRA 3IHPA 2BNKA 3GLFA 3NBIA 2LULA 1SXJC 5FTLA 1MU5A 4GPTB 4HB3B 3U61A 2CP8A 2QHOB 5DYIA 3GLHB 4XBOA 5FLXS 1C1KA 2EA0A 1R4GA 2DLWA 4DBGB 1E9SA 1TR8A 1WR1B 3K1JA 2YVCA 2EKFA 2L7IA 2FNAA 1XMOM 3LQQA 5KQDA 1R2ZA 4DUZM 1MPHA 4R71A 2L2IA 4ITQA 4B6HA 3HK0A 5FTJA 4K2PA 2H1RA 4LJAA 4MGKE 2OOAA 2WZJA 2D7HA 1QAMA 4OVZB 1MKEA 4QJ5B 2KNAA 4DIXA 3KOZE 3KRWA 1BWNA 4TYZA 3ZCBB 4RKUF 1B55A 2Y20A 3HHWA 1I94M 1UFZA 2XQNM 1P3RA 4QOSA 4K17A 2FJLA 2KR0A 2LNHC 4IBGA 4HAWB 2J5YA 2QKLA 3U6SA 2UU9M 3SV1A 3PFIA 2OQBA 1QVRA 3MHVC 5C1BA 1MIXA 1RJ2A 2YQZA 4LG2A 5E6JA 1NTVA 4DR3M 2QKMA 1DGHB 4B3SM 1V33A 2C98A 4XGIA 1VEGA 1N78A 1AUAA 1OFIA 1OQNA 1T43A 1UEFA 4QNRA 3AU4A 3WA0A 1QANA 3NWAA 2JP7A 2KNVA 3SBJA 4GITA 3VIAA 3DXDA 3SHGB 2DX5A 4PNKA 4M9SA 2KIGA 2APLA 2XSZA 2ZANA 4P17A 2GCJA 1FHXA 4HDOA 1N34M 3TWKA 4A6FB 4HAUB 4HAVB 2XGNA 3SAUA 2I1KA 4PCZA 3HU2A 2NBVA 3E9SA 2O25A 2F5PA 3IVFA 3CTWB 4B3MM 2RVBB 2HKJA 3JAMS 2JNHA 2YS1A 1WGLA 4CHJA 1X37A 1MX0A 3DXEA 3FSSA 1HNXM 4PD2A 4IJFA 3LJUX 1HQYE 1Z5AA 4DR5M 4G4OA 2LH0A 4FD2A 1QQWA 2L09A 2DTCA 2VF7A 2Z0OA 3VK7A 2ADZA 2LG1A 1QZEA 2KGXB 2RSGA 1JR3E 1QZMA 3L2AA 2UZRA 3AFHA 3B9PA 4DV5M 3NSUA 3QAUA 3FUTA 3AKZA 2FH0A 4JI4M 1NY6A 4FWGA 3J7BA 3KP1E 4PDIA 1ZAEA 4MGHA 2KHHA 3KP0E 2M5ZA 3K9OA 1ZV1A 2CUZA 1G59A 4JV5M 4Z8XA 1XC8A 3SMSA 4DR7M 2LVNC 4JI2M 4X64M 3PVLA 1IY1A 4K2OA 1PRBA 3L27A 1MK9B 5HE1A 4GEWA 1NJGA 4Z2NA 2DAIA 4DBBA 5FTKA 3W67A 3WYFB 1FHWA 3FKEA 4HB0B 4DV0M 2FFJA 4BB9A 3HZJA 3I4VA 1X11A 3DCXA 2D7GA 2HTHB 3NBXX 1GG3A 4I4LA 3FUVA 2R18A 4R3DA 2W2XC 2DHKA 4D80A 2J7NA 4GHLA 2DN6A 3GLHA 4D82A 1F4IA 2CY5A 1DDWA 5J3TA 3SARA 2QENA 1IXRC 2JA2A 1OFHA 1MI1A 4WP2A 3LVWA 1V5MA 1QUTA 4L6V6 3P6AA 1UPQA 3AU5A 2Z7JA 4A6HA 1IY0A 2CEAA 3KY9A 2LVAA 4CGYB 2Q13A 2HAKA 3L25A 3E4RA 3M1IB 2V1CA 3ZH9B 1DDVA 1UM8A 1HNZM 2UUCM 4QJ3B 1FB8A 1N32M 4REZA 4OX9M 2M14A 4XWXA 5C6RA 2GQFA 1NHWC 2X18A 4B7FA 2ZKMX 3ULCA 2DHJA 1EGXA 1LV7A 3GRYA 2MGWA 1PLSA 1RRPB 3LW5F 3GPUA 4WSFA 5EJCA 1GO5A 1XXHE 1G71A 5ITUA 4A6KA 4LFBM 1NNUC 3HQCA 1TJ6A 1WHCA 3AOEA 2HHHM 4GRIA 4KHPM 5EXTA 1Y19B 4DV3M 4ZRKA 1CUKA 1OJLA 2XLJA 3QWMA 5DIFB 4A5KA 2JXNA 2CFOA 2ZTDA 1DGHA 2J59M 3GRUA 1OAOC 3GLIB 1L2CA 4NY0A 2Z4RA 3PEGA 2UUAM 4KHOA 5D3VA 2NQ8C 2Y21A 3EIHA 3I04M 5DH9B 4JXJA 1V88A 3PG7A 1W5SA 2KZSA 2ZPYA 4LGMA 1LTMA 3VDUA 4LCBA 1DO2A 3K8ZA 1R5LA 2F4VM 2ZBKB 3B7NA 2F5QA 2KNZA 2K8EA 3PSCA 2W82A 4QJ4B 2IFSA 4AQYM 1GVNA 3TL4X 4F7GA 2DZOB 4KODA 2KUPA 1N33M 1KSFX 4X62M 1H4RA 3ODOA 1IBMM 3KRXA 1TF0B 2MKRA 2Y8GA 4AKIA 3FE3A 2K2UA 4NXNM 3O96A 3U6EA 5CLLB 4DXAB 2ROZB 2DZNB 2P8VA 1LW3A 2DKLA 1PJTA 2JP2A 4DV1M 5EFXA 1EVHA 3SYKA 3SASA 3K92A 1FGZA 2C96A 3WHKA 4B3RM 1YLAA 3AV0A 3BXWA 3VKGA 1U5GA 4LJ4A 3PNVA 2J0MA 4HB2B 1ZQ9A 1RU3A 3J7AS 1GL6A 3FYDA 4GC5A 1QQGA 1SXJD 3D8LA 4LZJA 3VK8A 2GUMA 4HL4A 1HJPA 2DKPA 1HR0M 5EQTA 2YS5A 3AJ4A 2BWEA 5IRSA 4K0KM 2JY5A 3T38A 2EMSA 2I5FA 2V1UA 3C3EA 1ZM0A 2Z3XA 3KOXE 4JI0M 2R4EA 5LMNM 5M4YB 3BJIA 4B3TM
chains in the Genus database with same CATH topology
2GJYA 2UU9M 3SV1A 4G4QA 1OMWA 3K2LA 1AWEA 3PFIA 5FI1A 2K47A 3U6CA 2QCUA 4M0WA 4NSWA 3KDSE 2OQBA 2PZ1A 1QVRA 3MHVC 4KLNA 1UNQA 1NI2A 4IAPA 1IXZA 3P7ZA 2VRWB 3G9WA 3TE6A 2O5RA 4L4UA 4NXMM 1NTYA 1R6BX 1Q3CA 1ZSQA 4JI7M 1DROA 1VDDA 3SFZA 3KOYE 5C1BA 1MIXA 2VQEM 1KZ7A 5HE3A 3AJIB 1NU2A 1RJ2A 2YQZA 4GKJM 1EF1A 4LG2A 5E6JA 4LRTA 1NTVA 1X86A 5F3WA 1LB1A 3ILKA 4IOYX 4X66M 4JI1M 4AI6A 4DR3M 1T3TA 4DV7M 2I7PA 3UGJA 1BTKA 1DGHB 2QKMA 3CIKA 4B3SM 1XNRM 2D9XA 4LFAM 4EJNA 3HJ8A 2C98A 4XGIA 3PNYA 5ITQA 2F5SA 2UXCM 1N78A 4I81A 2XF3A 2N0YA 4GN1A 1R2YA 1OFIA 1V5UA 4DUYM 3U7DA 5LMUM 5C5BA 4FCTA 1OQNA 1UEFA 3A46A 2UVMA 4QNRA 3AU4A 4M9ZA 4X65M 3WA0A 4A6FA 4P7IA 4TKNA 1L1TA 2ELBA 1QANA 4L78A 3FTEA 3J80S 4W5WA 3SBJA 1DBHA 4GITA 4WW0A 3HW2B 3DXDA 3VIAA 3TO1A 3SHGB 3A8QA 1WG7A 3L29A 2DX5A 3U5ZB 3D8EA 4PNKA 4M9SA 5DHAB 3HKPA 1M7RA 3RGSA 2DHRA 3PVUA 1WI1A 2XSZA 2ZANA 4EIWA 3GO8A 4LJ5A 1Q67A 4IBKA 3M6AA 1I2HA 1W1HA 2VKIA 5JHGA 5EXPA 2GCJA 1FHXA 4HDOA 1N34M 4KHBB 5KPTA 2YR0A 3HHXA 3TWKA 4BLCA 1FHOA 4NRWA 4A6FB 1Z59A 4IIWA 4OW0A 4DX90 5ITXA 4HAUB 5HE2A 4HAVB 3PVWA 5DI9B 1E94E 5JI2E 2XGNA 2A5YB 3SAUA 4KAXB 2I1KA 3UJNA 4JI6M 3A45A 3SO6A 4PCZA 3HU2A 3ZDTA 1WXQA 1Z87A 3E9SA 3SAVA 3T15A 2YRYA 4WVFB 2I5CA 1MAIA 2F5PA 2CHQA 5KPRA 1R7RA 2CV1A 3IVFA 3OANA 2RLOA 4K81A 5J3QA 3CTWB 4B3MM 2R0DA 2RVBB 5ITXE 3SNHA 5LONB 1XWIA 5A2QS 3LVVA 1FGYA 1XKEA 4I8OA 2HKJA 3JAMS 1UNRA 2NMBA 3GYOA 5DYGA 3ML4A 4CHMA 3ZC7B 5KCVA 2E2XA 2YS1A 5JI3E 2R09A 5IT9S 5IWAM 4CHJA 1UNPA 1X37A 1MX0A 3SYLA 3R8FA 4GZUA 4FWHA 3GPPA 1AQCA 3DXEA 3FSSA 4C0AA 1HNXM 1W1GA 1IN6A 4PQ0A 2LYDA 1YUBA 3L28A 4PD2A 3J2PB 4IJFA 2QP9X 2LOXA 1JR3A 3LJUX 1PMSA 1WGUA 3HJSA 4AKHA 1HQYE 1Z5AA 3I4YA 4G4RA 4G4OA 4DR5M 2LH0A 4FD2A 2XZFA 1QQWA 1HNWM 1TH4A 5KQ8A 2L09A 1PFJA 2KZUA 2CV2A 2AL6A 2R4JA 2DFKA 5L81A 4CISA 1WVHA 4FVMA 2DTCA 2Z0OA 5EP4A 4IBEA 1G4AE 3VK7A 5ITRA 2ADZA 2W2WA 3CF2A 1G41A 2LG1A 2G5GX 4LF9M 2KGXB 2RSGA 3V5WA 3GLGA 1QZMA 3L2AA 4LRSA 5KQ4A 1EE8A 3AFHA 3B9PA 4DV5M 1P6SA 3QAUA 3VLFB 2UZRA 2YT1A 2RGNB 3NSUA 3FUTA 1FAOA 1TH3A 2R65A 3AKZA 4JI4M 4Z6YA 1NY6A 2LKOA 2V76A 4FWGA 5EP1A 4OU7A 5BR8M 3R9XB 3TWLA 2EJ8A 3GP1A 3TW1A 3J7BA 3GPXA 3KP1E 4R7GA 3T06A 4JN6A 2CHVA 3SC3A 2E5LM 4PDIA 1ZAEA 2KA6B 3GLIA 4MGHA 3KP0E 1Y5OA 2Z0QA 4B7HA 1ORYB 4H8SA 1QYRA 2M5ZA 1J19A 2L1CA 3GQ5A 2CUZA 2EUCA 4TUWA 3CXBB 1BAKA 1G59A 5FSWA 4JV5M 2D7EA 4FCWA 4GC9A 4Z8XA 1XC8A 1SHCA 2NZ8B 4MM3B 3GLGB 3LQRA 3SMSA 4LF7M 4DR7M 3UZUA 2DX1A 4DV2M 2D11A 3X23A 3L26A 1GC7A 1K5GB 4FW9A 4LF6M 1Z6TA 3FM8C 3QIJA 2EO2A 1JQJC 4D81A 1MK7B 3FUUA 2Y0TA 4JI2M 5DHFB 4QHSA 1DO0A 2MFQA 4X64M 3PVLA 3FUXA 5EP3A 1IY1A 5IREB 1NNJA 4K2OA 5JLJB 2DKQA 3L27A 4P16A 1MK9B 2XZUA 4DR6M 5HE1A 3SUZA 1HQCA 3FUWA 5H37D 1NJGA 4GH9A 3VKHA 2KXEA 5GKNA 4GMQA 4Z2NA 5JP4A 2RGOA 4LJ9A 2R45A 3TPZA 3MPXA 4DBBA 4KO8A 1XD4A 2QPAA 1Z5CA 3DA1A 4MH0E 5FTKA 3UK6A 2EMTA 2GS0A 2IYBA 3WYFB 1FHWA 1L1ZA 2UXDM 5EP2A 1P5TA 1DYNA 1ZC4B 4IBDA 1G3IA 4EMOA 1DGGA 2LXEA 3ODXA 1KFVA 1NHGC 3FKEA 4MY6A 4IBBA 3IG5A 4HB0B 3BOSA 4ZRIA 4CYEA 1DDMA 3PXGA 4DV0M 1TDZA 2FFJA 4BB9A 2D2QA 3I51A 2VQFM 2KEBA 3I4VA 4LF4M 2KRUA 1X11A 3UMMA 2D7GA 4IBFA 4L15A 2HTHB 1N36M 4AZFA 3D8BA 3JR4A 1K3WA 1U5DA 3KFUG 4MGYE 4HB4B 5KQ1A 3U8ZA 4LJ6A 2C9OA 4QNMA 5BPVA 2J0KA 3M7GA 2MWNB 3FTDA 1NY5A 1GG3A 4I4LA 2C5RA 3J81S 4MGZE 2YS3A 4MK0A 3FUVA 5KPZA 1TGUA 2R18A 4R3DA 1WGQA 4YHHM 4GHAA 2W2XC 1DGBA 2DHKA 5C5BB 3CF0A 3M0EA 4D80A 4NOOB 3J27B 4I5SA 2J7NA 4ZPXA 2Z0PA 1PJJA 1XHBA 1QAQA 3AOGA 2XSZD 3GQ3A 4GHLA 1XCGA 2DN6A 1U2BA 4MGIE 3U6PA 3GLHA 1J7KA 1QC6A 2L6OA 3D8FA 4GMVA 4D82A 4BBKA 2CY5A 4LJ7A 3T1YM 1DDWA 5J3TA 3SARA 4Z2MB 3PZDA 2QENA 1IXRC 1IY2A 2JA2A 2V6ZM 4FWDA 4PT5A 1IBKM 1OFHA 5JHHA 3LVWA 5C18A 1V5MA 4L16A 2DVWB 5D3XA 4FCVA 1NSFA 1S3SA 3A98B 3H4MA 4BBAA 3P6AA 4Y94A 1UPQA 2R46A 3RCPA 1IXSB 3AU5A 5C79A 2K2JA 2Z7JA 2RKOA 4G4NA 1X1GA 4A6HA 1IY0A 3THGA 1W5TA 2CEAA 1N75A 3GPYA 3KS8A 1U27A 3KY9A 2DWNA 2OPFA 4GMXB 2QBYA 5FI0A 2KRKA 3SHFA 2J0JA 4CGYB 1K3XA 2I7NA 2Q13A 2ROVA 1K5DB 3L25A 3TVVA 3E4RA 5IZ7D 1H6UA 2QZ4A 3W0FA 1FNNA 3HHZA 1IN4A 5EXXA 1TXDA 2OTXA 2BJVA 2D9VA 4AG6A 3D8DA 3M1IB 2ZM6M 2V1CA 1M7EA 2GCLA 3ZH9B 1DDVA 1N3HA 1UM8A 2W2XD 3F5RA 5ITTA 1K82A 4L8RC 1GL7A 3JR5A 1HNZM 2UUCM 2ZAMA 1FB8A 3A8PA 1N32M 3PVSA 4REZA 4OX9M 2COAA 5GOWB 1N77A 1E5WA 2M14A 2LWXA 4XWXA 1L2DA 3SYXA 5C6RA 1XXHA 1NHWC 1SXJA 2X18A 4B7FA 2D9WA 3ULCA 2DHJA 1FOEA 1LV7A 1U29A 1EGXA 3GRYA 2UZSA 1MIZB 2YT0A 2D9ZA 3DXCA 5D27A 1PLSA 1IM2A 3HHYA 1DGFA 1RRPB 1PM5A 4EKUA 2AHMA 3KOWE 3GPUA 4HHVA 3U60A 4WSFA 2X8AA 5EJCA 1UPRA 2C99A 4HLQA 2XEPA 2P0HA 1IN5A 1SXJE 1TH2A 1TDHA 2Y8FA 1L2BA 5ITUA 4A6KA 4LFBM 1V5PA 1NNUC 3KSYA 3HQCA 4LY6A 5KO3A 3CF6E 3T1HM 1W1DA 2COFA 3TFMA 3RGPA 1WJ1A 1TJ6A 2UXBM 1WJMA 3HWSA 3AOEA 4M9XA 1KI1B 1NVMA 4JI8M 2HHHM 4GRIA 1SXJB 4KHPM 1BTNA 1H10A 4MT7A 5EXTA 1Y19B 4DV3M 4GXBA 1NJFA 4ZRKA 4DR2M 1I4WA 2H7EA 4NL4H 1YSYA 3KS4A 3UZTA 2F5NA 4IFSA 1IN8A 2CRFA 3KVWA 4YY3M 2XFSA 1PJIA 3F0WA 1OJLA 4YONA 4RF0A 2FE8A 4HATB 1Q39A 3U60B 2XLJA 2G35A 1HT2E 1YE9A 4II7A 1X1FA 5FTNA 4DV6M 4A3VB 3QWMA 1ZC3B 5DIFB 3MJ5A 3MK6A 4QHTA 2DYNA 4A5KA 3HJQA 3EIEA 3QWLA 2CFOA 1FJGM 1J0WA 1DGHA 2J59M 3OTOM 3SATA 4LGYA 3GRUA 3GRVA 3BINA 5FTMA 3GLIB 1I7AA 1L2CA 4LJ8A 4AKGA 4B08A 2X49A 1ISNA 4NY0A 2Z4RA 1QAOA 3KXEC 3PEGA 1GKIA 2UUAM 1D2NA 5ITYA 4IBJA 4JI3M 4B7GA 4GIPA 4KHOA 3RE8A 2DYQA 5D3VA 1GLNA 5C16A 2I1JA 2NQ8C 2Y21A 1KZGA 4DX8A 3EIHA 1E32A 2YSZA 1GC6A 2C9CA 1XODA 1XX0A 3DZDA 5DH9B 1X05A 5D3YA 3KSXA 4DR1M 4JXJA 3U5ZA 2K00A 1V88A 3TWMA 3PG7A 1W5SA 2KZSA 3IG8A 4NSRA 3VFDA 4NRVA 3RFWA 4LGMA 1U5FA 1ZVRA 2ELAA 2ZPYA 4DV4M 3VDUA 4LCBA 4WURA 5HE0A 1DO2A 5EXSA 2Z4SA 4IBIA 2CV0A 2D10A 2BCJA 4JI5M 2DA0A 3K8ZA 2Y7BA 2DWZB 3DFZA 3ODWA 2OQ4A 1EAZA 1HT1E 2G8LA 2M60A 4HDQA 2F4VM 2ZBKB 4M0DA 4S12A 2ERCA 4PDGA 2F5QA 3GQ4A 2DHIA 1SGHA 2RNRB 3QBVB 2FOIC 3GRRA 4GKKM 1J5EM 1XR0B 2MDXA 1J09A 3PSCA 2W82A 2ZAOA 2P0FA 1XNQM 1OY2A 5LOPB 2L7HA 2IFSA 5J3YA 3U6DA 4LFCM 4AQYM 2Y0QA 1GVNA 1TQZA 1IQPA 4MB7A 3TL4X 2CODA 3ZVRA 4F7GA 2DZOB 4AW4A 1Q3BA 4KODA 2KUPA 4KVGB 2X4AA 8CATA 2HL7A 1N33M 1KSFX 3TCAA 4X62M 1H4RA 3FTFA 2KW0A 4JYAM 4LF5M 5DNYA 3U6OA 2H7DA 2YNMD 3ODOA 2DWLA 1IBMM 2BNKA 4IJEA 3KW6A 4G6ZA 3GLFA 3KRXA 2YFQA 3NBIA 2MKRA 2Y8GA 4AKIA 2CY4A 2LOZA 2LULA 1SXJC 5FTLA 3Q8XA 1MU5A 2RGHA 4NXNM 2K2UA 3O96A 4GPTB 4IBCA 4D0NB 4HB3B 7CATA 3U6EA 3U61A 5CLLB 4DXAB 2CE7A 2ROZB 2DZNB 1XMQM 3U6QA 2P8VA 5DYIA 3C58A 1LW3A 2VSZA 2F5OA 4HAZB 3GLHB 2JP2A 3SAWA 3HU3A 4DV1M 2RUKB 5EFXA 1EVHA 4XBOA 4RNAA 3SYKA 5FLXS 1C1KA 2EA0A 3SASA 2P0DA 4F7HA 3K92A 1L8QA 1V61A 2R62A 4L6EA 3AL0C 2DLWA 3FEHA 1FGZA 2C96A 3LMMA 2COCA 3WHKA 3GLFB 4B3RM 3N7CA 1IBLM 2P5TA 1E9SA 3AV0A 3K1JA 3AOEC 3FTCA 3VKGA 1U5EA 3PP2A 2YVCA 1JR3D 1U5GA 4LJ4A 2L7IA 4CHTB 3PNVA 2J0MA 4OVZA 4HB2B 4DR4M 2QBYB 1ZQ9A 2BJWA 2FNAA 2XH9A 3DOAA 4LZZA 3U61B 3J7AS 3KSJA 1GL6A 2CAYA 3FYDA 1XMOM 3W0LB 3LQQA 4GC5A 5KQDA 3NWLA 2M38A 1Z5BA 1IN7A 1R2ZA 3ULBA 2N23A 2VIIA 4DUZM 4HAYB 3FD9A 5CLQB 2KCJA 3GYPA 3HU1A 1V89A 1QQGA 1SXJD 3D8LA 4NSOB 1MPHA 4KHAA 2L2IA 4LZJA 2UUBM 4ITQA 2AEHA 3VK8A 4B6HA 2DXIA 3WHLA 5FTJA 2XFTA 3HK0A 4K2PA 3MDBC 4YL8A 2H1RA 4HL4A 4LJAA 4MGKE 5E26A 4HAXB 2YF0A 2D7HA 3A42A 3FYCA 2DKPA 1G8PA 1HR0M 5EQTA 2YS5A 2HCBA 2Q2EB 2D9YA 1QAMA 2J7OA 4OVZB 1XXHB 3U6MA 1MKEA 3AJ4A 2DWMA 3U6LA 3KOZE 3KRWA 1BWNA 1E9RA 2D4QA 4F7UP 4TYZA 3ZCBB 1KYIA 3VDPA 4AG5A 4WJ7A 1B55A 4K0KM 2CHGA 3HGIA 2Y20A 3HHWA 3KZ1A 1I94M 3T38A 4ZRJA 2EMSA 3SMPA 2I5FA 4LF8M 2HE7A 2V1UA 2XQNM 3VOQA 1P3RA 4RF1A 2Z3XA 3KOXE 4QOSA 1ZM0A 4K17A 4JI0M 5D3WA 2R4EA 5LMNM 2LNHC 2FJLA 4QOZC 3BJIA 4IBGA 4HAWB 1IRSA 3U6SA 2EC1A 2QKLA 4B3TM 3TQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJY A;  3SV1 A;  1OMW A;  1AWE A;  5FI1 A;  4NSW A;  2OQB A;  2PZ1 A;  1UNQ A;  1NI2 A;  4IAP A;  3P7Z A;  2VRW B;  3G9W A;  1ZSQ A;  1NTY A;  1DRO A;  1MIX A;  5HE3 A;  1KZ7 A;  1NU2 A;  1RJ2 A;  1EF1 A;  4IOY X;  1NTV A;  1X86 A;  1LB1 A;  2QKM A;  1BTK A;  3CIK A;  4EJN A;  4GN1 A;  2N0Y A;  1V5U A;  3U7D A;  5C5B A;  1OQN A;  1UEF A;  2UVM A;  3AU4 A;  3WA0 A;  4A6F A;  4P7I A;  4TKN A;  2ELB A;  1DBH A;  3HW2 B;  3DXD A;  3VIA A;  3TO1 A;  3A8Q A;  1WG7 A;  2DX5 A;  3D8E A;  4PNK A;  5DHA B;  1M7R A;  3PVU A;  1WI1 A;  1Q67 A;  1I2H A;  1W1H A;  2VKI A;  5JHG A;  2GCJ A;  1FHX A;  4HDO A;  4KHB B;  1FHO A;  4A6F B;  4DX9 0;  4HAU B;  5HE2 A;  4HAV B;  3PVW A;  5DI9 B;  4KAX B;  2I1K A;  3SO6 A;  3ZDT A;  1Z87 A;  2YRY A;  4WVF B;  2I5C A;  1MAI A;  3IVF A;  3OAN A;  2RLO A;  4K81 A;  5J3Q A;  2R0D A;  2RVB B;  3SNH A;  5LON B;  1FGY A;  1XKE A;  3ML4 A;  2NMB A;  1UNR A;  3GYO A;  4CHM A;  5KCV A;  2E2X A;  2YS1 A;  2R09 A;  4CHJ A;  1UNP A;  1AQC A;  3DXE A;  3FSS A;  4C0A A;  1W1G A;  4PQ0 A;  2LYD A;  2LOX A;  3LJU X;  1PMS A;  1WGU A;  2D9X A;  4GZU A;  1PFJ A;  2AL6 A;  5L81 A;  2DFK A;  1WVH A;  2DTC A;  2Z0O A;  2ADZ A;  2W2W A;  2LG1 A;  2KGX B;  2RSG A;  3V5W A;  5KQ4 A;  2UZR A;  1P6S A;  3NSU A;  2YT1 A;  2RGN B;  1FAO A;  2LKO A;  2V76 A;  2EJ8 A;  3TW1 A;  3T06 A;  1Y5O A;  2Z0Q A;  4H8S A;  1J19 A;  2L1C A;  1BAK A;  3CXB B;  1SHC A;  2NZ8 B;  2DX1 A;  3X23 A;  2D11 A;  1K5G B;  1GC7 A;  3FM8 C;  3QIJ A;  1MK7 B;  5DHF B;  2MFQ A;  3PVL A;  5JLJ B;  4K2O A;  2DKQ A;  1MK9 B;  5HE1 A;  3SUZ A;  4Z2N A;  5JP4 A;  3MPX A;  4DBB A;  1XD4 A;  2EMT A;  2GS0 A;  3WYF B;  2IYB A;  1FHW A;  1P5T A;  1DYN A;  1ZC4 B;  4EMO A;  3ODX A;  4MY6 A;  4HB0 B;  4CYE A;  4ZRI A;  2D2Q A;  1X11 A;  2HTH B;  1U5D A;  4HB4 B;  5KQ1 A;  3U8Z A;  2MWN B;  2J0K A;  1GG3 A;  2YS3 A;  4MK0 A;  1WGQ A;  2W2X C;  2DHK A;  5C5B B;  2Z0P A;  1XCG A;  2DN6 A;  1U2B A;  1QC6 A;  4BBK A;  3D8F A;  4GMV A;  2CY5 A;  1DDW A;  5J3T A;  4Z2M B;  3PZD A;  5JHH A;  1V5M A;  5D3X A;  3A98 B;  4Y94 A;  3P6A A;  1UPQ A;  3RCP A;  3AU5 A;  5C79 A;  2K2J A;  1X1G A;  4A6H A;  3KY9 A;  1U27 A;  4GMX B;  5FI0 A;  2J0J A;  2ROV A;  2Q13 A;  1K5D B;  3TVV A;  1TXD A;  2OTX A;  2D9V A;  3D8D A;  3M1I B;  1M7E A;  2GCL A;  1DDV A;  1N3H A;  2W2X D;  3F5R A;  1FB8 A;  3A8P A;  5GOW B;  2COA A;  1E5W A;  2M14 A;  4XWX A;  3SYX A;  5C6R A;  2X18 A;  2D9W A;  3ULC A;  2DHJ A;  1FOE A;  1EGX A;  1U29 A;  2UZS A;  1MIZ B;  2YT0 A;  2D9Z A;  3DXC A;  5D27 A;  1PLS A;  1RRP B;  4EKU A;  4HHV A;  4WSF A;  1UPR A;  2P0H A;  2Y8F A;  4A6K A;  3KSY A;  1V5P A;  3HQC A;  1W1D A;  2COF A;  3TFM A;  1WJ1 A;  1TJ6 A;  1WJM A;  1KI1 B;  1H10 A;  1BTN A;  4MT7 A;  1Y19 B;  4GXB A;  4ZRK A;  2H7E A;  3UZT A;  4IFS A;  2CRF A;  3F0W A;  4YON A;  4HAT B;  2G35 A;  3QWM A;  5DIF B;  1X1F A;  1ZC3 B;  2DYN A;  4A5K A;  1J0W A;  2J59 M;  3BIN A;  1I7A A;  1ISN A;  4NY0 A;  3PEG A;  4KHO A;  2DYQ A;  5D3V A;  5C16 A;  2I1J A;  1KZG A;  4DX8 A;  2YSZ A;  1GC6 A;  1XOD A;  1XX0 A;  5DH9 B;  1X05 A;  5D3Y A;  2K00 A;  1V88 A;  3PG7 A;  1U5F A;  1ZVR A;  2ELA A;  2ZPY A;  5HE0 A;  2Y7B A;  2DA0 A;  2D10 A;  2BCJ A;  3ODW A;  1EAZ A;  4HDQ A;  2RNR B;  2DHI A;  1SGH A;  3QBV B;  1XR0 B;  2MDX A;  3PSC A;  2P0F A;  1OY2 A;  5LOP B;  2IFS A;  5J3Y A;  1TQZ A;  2COD A;  3ZVR A;  4F7G A;  2KUP A;  4KVG B;  3TCA A;  1H4R A;  2H7D A;  3ODO A;  3KRX A;  2MKR A;  2Y8G A;  2CY4 A;  2LOZ A;  2LUL A;  2K2U A;  4D0N B;  4GPT B;  3O96 A;  4HB3 B;  5CLL B;  4DXA B;  2ROZ B;  2P8V A;  1LW3 A;  2VSZ A;  4HAZ B;  2JP2 A;  2RUK B;  5EFX A;  1EVH A;  2P0D A;  4F7H A;  1V61 A;  4L6E A;  2DLW A;  3FEH A;  1FGZ A;  2COC A;  3N7C A;  1U5E A;  3PP2 A;  2YVC A;  1U5G A;  2J0M A;  4HB2 B;  2CAY A;  2M38 A;  3ULB A;  2N23 A;  5CLQ B;  4HAY B;  2KCJ A;  3GYP A;  1V89 A;  1QQG A;  1MPH A;  4KHA A;  2L2I A;  2AEH A;  4B6H A;  3HK0 A;  4K2P A;  3MDB C;  4YL8 A;  4HAX B;  2YF0 A;  2DKP A;  2YS5 A;  1DDM A;  2D9Y A;  1MKE A;  3AJ4 A;  3KRW A;  1BWN A;  2D4Q A;  4F7U P;  4TYZ A;  4WJ7 A;  1B55 A;  3KZ1 A;  4ZRJ A;  2EMS A;  2I5F A;  2HE7 A;  2XQN M;  3VOQ A;  1P3R A;  1ZM0 A;  4K17 A;  5D3W A;  2FJL A;  3BJI A;  4HAW B;  1IRS A;  2EC1 A;  2QKL A; 
#chains in the Genus database with same CATH topology
 1AWE A;  3U6C A;  2GNO A;  4M0W A;  4NSW A;  1D0L A;  1NI2 A;  2JY8 A;  1ZSQ A;  4JI7 M;  1VDD A;  3KOY E;  5HE3 A;  1GAB A;  3AJI B;  1X86 A;  3ILK A;  4X66 M;  2DZL A;  4NC6 A;  3UGJ A;  3CIK A;  2LBC A;  4LFA M;  3HJ8 A;  1DV0 A;  3PNY A;  2N0Y A;  2DHY A;  4DUY M;  3U7D A;  4FCT A;  4M9Z A;  4TKN A;  4G3O A;  2G3Q A;  1DBH A;  4F2L A;  3TO1 A;  3FVC A;  4LJ5 A;  1W1H A;  2QNJ A;  5JHG A;  5KPT A;  1D0K A;  4IIW A;  5ITX A;  5DI9 B;  1E94 E;  5JI2 E;  4KAX B;  3A45 A;  3SO6 A;  1WXQ A;  2YRY A;  4GNK B;  5KPR A;  5J3Q A;  2RLO A;  2R0D A;  5A2Q S;  3LVV A;  1FGY A;  1UNR A;  4CHM A;  5DYG A;  3R8F A;  3GPP A;  1AQC A;  4C0A A;  4CSQ A;  1W1G A;  1IN6 A;  4PQ0 A;  2R6F A;  2QP9 X;  1NV9 A;  3HJS A;  4AKH A;  3I4Y A;  4G4R A;  2BWB A;  1TH4 A;  2KZU A;  3I01 M;  2CV2 A;  5EP4 A;  4IBE A;  5I2M A;  2W2W A;  3IEC A;  3GLG A;  4LRS A;  1EE8 A;  2YT1 A;  2V76 A;  3R9X B;  3TW1 A;  3GPX A;  4R7G A;  4JN6 A;  2CHV A;  3SC3 A;  3GLI A;  2KA6 B;  4H8S A;  4TUW A;  5FSW A;  1K5G B;  1Z6T A;  2EO2 A;  3HX3 A;  2R44 A;  3FUU A;  5DHF B;  4QHS A;  2MR9 A;  3B7Q A;  1D0M A;  3BBZ A;  3SUZ A;  5H37 D;  2FJU B;  4LJ9 A;  3TPZ A;  3MPX A;  4KO8 A;  2QPA A;  1Z5C A;  2KIE A;  2LHG A;  1P5T A;  4EMO A;  1KFV A;  3Q8G A;  1NHG C;  4MY6 A;  4IBB A;  3C9P A;  2DAE A;  2KEB A;  4IBF A;  1U5D A;  2LVO C;  3U8Z A;  2MWN B;  5BPV A;  3M7G A;  2K9D A;  2C5R A;  4L1R A;  2YS3 A;  4MK0 A;  1WGQ A;  4GHA A;  1DGB A;  3M0E A;  4ZPX A;  1XCG A;  3B7Z A;  4MGI E;  3U6P A;  1J7K A;  1QC6 A;  1IY2 A;  1IBK M;  1OQY A;  5JHH A;  5C18 A;  5D3X A;  1NSF A;  4BBA A;  4Y94 A;  3RCP A;  3QYB A;  3KS8 A;  3GPY A;  1WIV A;  5FI0 A;  2KRK A;  2WSF F;  1K3X A;  2I7N A;  1K5D B;  2N35 A;  3TVV A;  3W0F A;  3HHZ A;  1TXD A;  2D9V A;  3D8D A;  4AG6 A;  2ZM6 M;  1M7E A;  2GCL A;  1N3H A;  2W2X D;  5ITT A;  1K82 A;  3JR5 A;  3A8P A;  3PVS A;  5GOW B;  2VF8 A;  1N77 A;  1L2D A;  2JY6 B;  1SXJ A;  1U29 A;  2YT0 A;  2D9Z A;  1IM2 A;  4HHV A;  1EFU B;  2C99 A;  4HLQ A;  2XEP A;  1P3Q Q;  1TH2 A;  1TDH A;  2Y8F A;  3HIE A;  1V5P A;  3CF6 E;  3RGP A;  1WJ1 A;  1A5T A;  4D6W A;  1BTN A;  4MT7 A;  4GXB A;  3UZT A;  1IN8 A;  3F0W A;  1PJI A;  3U60 B;  1YE9 A;  1V34 A;  3HJQ A;  3EIE A;  2JWS A;  3OTO M;  3SAT A;  4LGY A;  5FTM A;  1I7A A;  3V76 A;  3KXE C;  4GIP A;  3RE8 A;  2I1J A;  2YSZ A;  3NWF A;  3OHM B;  1XOD A;  5D3Y A;  3IG8 A;  3HSA A;  4NRV A;  1ZVR A;  2ELA A;  4DV4 M;  4WUR A;  2DA0 A;  2D10 A;  2BCJ A;  3ODW A;  3DFZ A;  2JZ0 A;  2M60 A;  3NW8 A;  4M0D A;  4S12 A;  3HY5 A;  4PDG A;  2DHI A;  1J5E M;  1XR0 B;  2JZ1 A;  2P0F A;  1XNQ M;  5LOP B;  2L7H A;  1TQZ A;  3ZVR A;  1IQP A;  3NWD A;  2CRU A;  5DNY A;  2DWL A;  4G6Z A;  2CY4 A;  4D0N B;  4IBC A;  7CAT A;  2CE7 A;  3U6Q A;  4HAZ B;  3GLF E;  2RUK B;  4RNA A;  2P0D A;  4F7H A;  1V61 A;  2R62 A;  3AL0 C;  3FEH A;  2COC A;  3GLF B;  2JUJ A;  3N7C A;  2P5T A;  2OOB A;  2HWJ A;  1U5E A;  3PP2 A;  1ZMU A;  2EKK A;  4CHT B;  4OVZ A;  4DR4 M;  2BJW A;  2XH9 A;  3U61 B;  1Z5B A;  3ULB A;  2N23 A;  2VII A;  5CLQ B;  4HAY B;  3FD9 A;  4QXA B;  1V89 A;  4KHA A;  2AEH A;  2XFT A;  5E26 A;  2VDB B;  2YF0 A;  3A42 A;  3FYC A;  1DDM A;  3U6M A;  2J7O A;  1XXH B;  1E9R A;  1ZMV A;  1NV8 A;  1KYI A;  3VDP A;  4WJ7 A;  3QYE A;  2K49 A;  4ZRJ A;  3VOQ A;  4QOZ C;  3TQS A;  1OMW A;  2K47 A;  2QCU A;  4ANR A;  3KDS E;  2PZ1 A;  4KLN A;  4UN2 B;  3P7Z A;  3TE6 A;  1NTY A;  1R6B X;  1Q3C A;  1DRO A;  1EF1 A;  5F3W A;  1LB1 A;  4JI1 M;  4AI6 A;  1T3T A;  4DV7 M;  1V92 A;  2F5S A;  2UXC M;  4GN1 A;  1R2Y A;  1V5U A;  5LMU M;  3A46 A;  4A6F A;  4P7I A;  4L78 A;  4W5W A;  4WW0 A;  3HW2 B;  3L29 A;  3HKP A;  1Y8G A;  3PVU A;  1WI1 A;  3GO8 A;  1Q67 A;  1I2H A;  3M6A A;  2DAK A;  2VKI A;  1OAI A;  2DNA A;  3HHX A;  2MJ5 B;  1Z59 A;  2EJS A;  4DX9 0;  4KT0 F;  3PVW A;  3ZDT A;  4HSI A;  1Z87 A;  2I5C A;  2CHQ A;  1R7R A;  2CV1 A;  3OAN A;  4K81 A;  3SNH A;  5LON B;  1XWI A;  4XK8 F;  1XKE A;  3ML4 A;  2NMB A;  3GYO A;  5JI3 E;  2R09 A;  5IT9 S;  1UNP A;  2Z13 A;  1YUB A;  3L28 A;  2RRF A;  1JR3 A;  1PMS A;  2D9X A;  1QUS A;  3B74 A;  2AL6 A;  5L81 A;  1WVH A;  5ITR A;  1XB2 B;  3CF2 A;  1G41 A;  4LF9 M;  2LHC A;  3V5W A;  2L4F A;  1P6S A;  2RGN B;  1FAO A;  1TH3 A;  1T77 A;  4Z6Y A;  2LKO A;  1VQ1 A;  2Z8Y M;  5BR8 M;  2DEN A;  3TWL A;  2EJ8 A;  1Y5O A;  1ORY B;  4Q7J A;  1SHC A;  4GC9 A;  2NZ8 B;  1VEJ A;  2DAM A;  4LF7 M;  3UZU A;  4DV2 M;  2D11 A;  1GC7 A;  4LF6 M;  3FM8 C;  3QIJ A;  2Y0T A;  1DO0 A;  2MFQ A;  3FUX A;  5EP3 A;  5IRE B;  1C7Y A;  4DR6 M;  3FUW A;  4GH9 A;  3VKH A;  2KXE A;  4GMQ A;  1BVS A;  2RGO A;  1XD4 A;  1EIJ A;  3UK6 A;  2IYB A;  1Q02 A;  2O01 F;  1JB0 F;  5EP2 A;  1ZC4 B;  1DYN A;  3ODX A;  1MJG M;  4ZRI A;  3PXG A;  2D2Q A;  3I51 A;  4LF4 M;  2KRU A;  3UMM A;  2MRO B;  4L15 A;  1N36 M;  3JR4 A;  1K3W A;  4HB4 B;  3MMP A;  4LJ6 A;  4QNM A;  2J0K A;  1IFY A;  1TTE A;  4Y28 F;  2L4E A;  4MGZ E;  1TGU A;  5C5B B;  3CF0 A;  4NOO B;  3J27 B;  2Z0P A;  1XHB A;  1U2B A;  2L6O A;  3D8F A;  5L8R F;  3T1Y M;  2JY7 A;  2V6Z M;  4L16 A;  1S3S A;  3A98 B;  1OIZ A;  2R46 A;  3GLH E;  1IXS B;  2OO9 A;  2RKO A;  1X1G A;  2OPF A;  5I2S A;  3SHF A;  2J0J A;  2ROV A;  2Z4D A;  5IZ7 D;  4L8R C;  1GL7 A;  2R2Y A;  3F92 A;  1E5W A;  4GOU A;  1VG5 A;  1XXH A;  2UZS A;  1MIZ B;  5D27 A;  3DXC A;  1DGF A;  1PM5 A;  4EKU A;  2AHM A;  2X8A A;  1UPR A;  2DI0 A;  1IN5 A;  3KSY A;  1W1D A;  1WGN A;  3TFM A;  1WJM A;  4M9X A;  4JI8 M;  1T6O A;  1H10 A;  3W68 A;  1NJF A;  4DR2 M;  1I4W A;  1YSY A;  3KS4 A;  3KVW A;  4YON A;  4RF0 A;  2FE8 A;  4HAT B;  1Q39 A;  1HT2 E;  4II7 A;  1X1F A;  4DV6 M;  1ZYI A;  3MJ5 A;  4QHT A;  2DYN A;  1J0W A;  3GRV A;  3BIN A;  4LJ8 A;  1ISN A;  2X49 A;  1QAO A;  1GKI A;  1D2N A;  4IBJ A;  2DYQ A;  1GLN A;  1KZG A;  4DX8 A;  1AIP C;  1E32 A;  2C9C A;  3DZD A;  1X05 A;  1OIP A;  4DR1 M;  4NSR A;  1U5F A;  3RFW A;  3E46 A;  5HE0 A;  2CV0 A;  5EXS A;  2Z4S A;  4IBI A;  4F1I A;  2G8L A;  3ZQJ A;  2K6B A;  2ERC A;  1QDT A;  3QBV B;  3GRR A;  1J09 A;  1WJ7 A;  2COD A;  4MB7 A;  2L2D A;  4AW4 A;  5DFL A;  4KVG B;  2HL7 A;  3TCA A;  3FTF A;  2H7D A;  3U6O A;  3B89 A;  2YNM D;  2LTU A;  4IJE A;  3KW6 A;  2YFQ A;  2LOZ A;  3Q8X A;  2RGH A;  1XMQ M;  3C58 A;  2VSZ A;  3FRI A;  2F5O A;  3SAW A;  3HU3 A;  1L8Q A;  4L6E A;  3LMM A;  1IBL M;  3AOE C;  3FTC A;  1JR3 D;  2QBY B;  4LZZ A;  3DOA A;  2CAY A;  3KSJ A;  3W0L B;  2M38 A;  3NWL A;  1IN7 A;  2KCJ A;  3GYP A;  3HU1 A;  4NSO B;  2UUB M;  2DXI A;  3WHL A;  3MDB C;  4YL8 A;  4HAX B;  1G8P A;  2HCB A;  2Q2E B;  2D9Y A;  2DWM A;  3U6L A;  2WSC F;  2D4Q A;  4F7U P;  4AG5 A;  2CHG A;  3HGI A;  3KZ1 A;  4CIZ A;  3SMP A;  4LF8 M;  1ZMW A;  2HE7 A;  4RF1 A;  5D3W A;  3T6P A;  1IRS A;  2EC1 A;  2FS1 A;  2GJY A;  4G4Q A;  3K2L A;  5FI1 A;  1UNQ A;  4IAP A;  1IXZ A;  2VRW B;  3G9W A;  2O5R A;  3U12 A;  2QSF X;  4L4U A;  4NXM M;  3SFZ A;  2VQE M;  1KZ7 A;  1NU2 A;  4GKJ M;  3K9P A;  4IOY X;  4LRT A;  2I7P A;  2H5X A;  1BTK A;  1XNR M;  4EJN A;  5ITQ A;  4I81 A;  2XF3 A;  5C5B A;  2UVM A;  4X65 M;  1L1T A;  2ELB A;  3FTE A;  3J80 S;  2LVP C;  3A8Q A;  1WG7 A;  3U5Z B;  2Z59 A;  3D8E A;  5DHA B;  1M7R A;  3RGS A;  2DHR A;  4EIW A;  3E21 A;  4IBK A;  1IXS A;  5EXP A;  4KHB B;  2YR0 A;  4BLC A;  1FHO A;  4NRW A;  1NO1 A;  4OW0 A;  5HE2 A;  2A5Y B;  3UJN A;  4JI6 M;  1VEK A;  3SAV A;  3T15 A;  4WVF B;  1MAI A;  5ITX E;  4I8O A;  5KCV A;  3ZC7 B;  2E2X A;  2Z14 A;  3FRH A;  5IWA M;  4HEO A;  3SYL A;  4FWH A;  2LYD A;  3J2P B;  2LOX A;  4GZU A;  1WGU A;  2XZF A;  3H4J A;  1HNW M;  5KQ8 A;  1PFJ A;  5LG4 B;  2R4J A;  2DFK A;  4CIS A;  4FVM A;  1G4A E;  2G5G X;  5KQ4 A;  3VLF B;  2R65 A;  3LCV B;  5EP1 A;  4OU7 A;  3GP1 A;  3GLG E;  3T06 A;  1SG9 A;  2E5L M;  2Z0Q A;  4B7H A;  1QYR A;  1J19 A;  2L1C A;  3GQ5 A;  2EUC A;  1BAK A;  3CXB B;  2KDL A;  2D7E A;  4FCW A;  4MM3 B;  3GLG B;  3LQR A;  2ZTC A;  2DX1 A;  3X23 A;  3L26 A;  4FW9 A;  3LCU A;  1JQJ C;  4D81 A;  3GLI E;  2R0I A;  1MK7 B;  5JLJ B;  1NNJ A;  2KUQ A;  2DKQ A;  4P16 A;  2XZU A;  1HQC A;  5GKN A;  5JP4 A;  2R45 A;  4CJ6 A;  2EMT A;  3DA1 A;  2GS0 A;  2QQ8 A;  4MH0 E;  1L1Z A;  2UXD M;  4IBD A;  1G3I A;  1DGG A;  2LXE A;  4OT1 A;  3IG5 A;  3BOS A;  4CYE A;  1TDZ A;  2VQF M;  4AZF A;  3D8B A;  3KFU G;  4MGY E;  5KQ1 A;  2C9O A;  3FTD A;  1NY5 A;  3J81 S;  5KPZ A;  4YHH M;  4I5S A;  1PJJ A;  1QAQ A;  3AOG A;  2XSZ D;  3GQ3 A;  4BBK A;  4GMV A;  4LJ7 A;  4Z2M B;  3PZD A;  4FWD A;  2DAG A;  4PT5 A;  2DVW B;  4FCV A;  3H4M A;  5C79 A;  2K2J A;  4G4N A;  3THG A;  1W5T A;  1N75 A;  2WSE F;  1U27 A;  2DWN A;  4GMX B;  1VDL A;  2QBY A;  2B3T A;  2K0B X;  1H6U A;  2QZ4 A;  1FNN A;  1IN4 A;  1PJS A;  5EXX A;  2YT2 A;  2OTX A;  1PGY A;  2BJV A;  2CWB A;  3F5R A;  3B77 A;  2ZAM A;  3CGW A;  2LVQ D;  2COA A;  2LWX A;  3SYX A;  2D9W A;  1PJQ A;  1FOE A;  3HHY A;  3KOW E;  3U60 A;  1MN3 A;  2P0H A;  1SXJ E;  1L2B A;  4LY6 A;  5KO3 A;  2COF A;  3T1H M;  2UXB M;  3HWS A;  1KI1 B;  1NVM A;  2RRU A;  1SXJ B;  2H7E A;  4NL4 H;  1OKS A;  2F5N A;  3C3D A;  4IFS A;  2CRF A;  4YY3 M;  2XFS A;  2G35 A;  5FTN A;  4A3V B;  1ZC3 B;  3MK6 A;  3QWL A;  1FJG M;  4AKG A;  4B08 A;  3A58 A;  5ITY A;  4JI3 M;  1QDR A;  4B7G A;  5C16 A;  1GJS A;  1GC6 A;  1GJT A;  1XX0 A;  3KSX A;  3U5Z A;  2K00 A;  3TWM A;  3VFD A;  2Y7B A;  4JI5 M;  4OSN A;  2DWZ B;  2OQ4 A;  1EAZ A;  1HT1 E;  4KHB A;  4HDQ A;  3GQ4 A;  2RNR B;  1SGH A;  2FOI C;  4GKK M;  2MDX A;  2ZAO A;  1OY2 A;  5J3Y A;  3U6D A;  4LFC M;  2Y0Q A;  1Q3B A;  2X4A A;  8CAT A;  2MH8 A;  2KW0 A;  4JYA M;  4LF5 M;  1OTR A;  3IHP A;  2BNK A;  3GLF A;  3NBI A;  2LUL A;  1SXJ C;  5FTL A;  1MU5 A;  4GPT B;  4HB3 B;  3U61 A;  2CP8 A;  2QHO B;  5DYI A;  3GLH B;  4XBO A;  5FLX S;  1C1K A;  2EA0 A;  1R4G A;  2DLW A;  4DBG B;  1E9S A;  1TR8 A;  1WR1 B;  3K1J A;  2YVC A;  2EKF A;  2L7I A;  2FNA A;  1XMO M;  3LQQ A;  5KQD A;  1R2Z A;  4DUZ M;  1MPH A;  4R71 A;  2L2I A;  4ITQ A;  4B6H A;  3HK0 A;  5FTJ A;  4K2P A;  2H1R A;  4LJA A;  4MGK E;  2OOA A;  2WZJ A;  2D7H A;  1QAM A;  4OVZ B;  1MKE A;  4QJ5 B;  2KNA A;  4DIX A;  3KOZ E;  3KRW A;  1BWN A;  4TYZ A;  3ZCB B;  4RKU F;  1B55 A;  2Y20 A;  3HHW A;  1I94 M;  1UFZ A;  2XQN M;  1P3R A;  4QOS A;  4K17 A;  2FJL A;  2KR0 A;  2LNH C;  4IBG A;  4HAW B;  2J5Y A;  2QKL A;  3U6S A;  2UU9 M;  3SV1 A;  3PFI A;  2OQB A;  1QVR A;  3MHV C;  5C1B A;  1MIX A;  1RJ2 A;  2YQZ A;  4LG2 A;  5E6J A;  1NTV A;  4DR3 M;  2QKM A;  1DGH B;  4B3S M;  1V33 A;  2C98 A;  4XGI A;  1VEG A;  1N78 A;  1AUA A;  1OFI A;  1OQN A;  1T43 A;  1UEF A;  4QNR A;  3AU4 A;  3WA0 A;  1QAN A;  3NWA A;  2JP7 A;  2KNV A;  3SBJ A;  4GIT A;  3VIA A;  3DXD A;  3SHG B;  2DX5 A;  4PNK A;  4M9S A;  2KIG A;  2APL A;  2XSZ A;  2ZAN A;  4P17 A;  2GCJ A;  1FHX A;  4HDO A;  1N34 M;  3TWK A;  4A6F B;  4HAU B;  4HAV B;  2XGN A;  3SAU A;  2I1K A;  4PCZ A;  3HU2 A;  2NBV A;  3E9S A;  2O25 A;  2F5P A;  3IVF A;  3CTW B;  4B3M M;  2RVB B;  2HKJ A;  3JAM S;  2JNH A;  2YS1 A;  1WGL A;  4CHJ A;  1X37 A;  1MX0 A;  3DXE A;  3FSS A;  1HNX M;  4PD2 A;  4IJF A;  3LJU X;  1HQY E;  1Z5A A;  4DR5 M;  4G4O A;  2LH0 A;  4FD2 A;  1QQW A;  2L09 A;  2DTC A;  2VF7 A;  2Z0O A;  3VK7 A;  2ADZ A;  2LG1 A;  1QZE A;  2KGX B;  2RSG A;  1JR3 E;  1QZM A;  3L2A A;  2UZR A;  3AFH A;  3B9P A;  4DV5 M;  3NSU A;  3QAU A;  3FUT A;  3AKZ A;  2FH0 A;  4JI4 M;  1NY6 A;  4FWG A;  3J7B A;  3KP1 E;  4PDI A;  1ZAE A;  4MGH A;  2KHH A;  3KP0 E;  2M5Z A;  3K9O A;  1ZV1 A;  2CUZ A;  1G59 A;  4JV5 M;  4Z8X A;  1XC8 A;  3SMS A;  4DR7 M;  2LVN C;  4JI2 M;  4X64 M;  3PVL A;  1IY1 A;  4K2O A;  1PRB A;  3L27 A;  1MK9 B;  5HE1 A;  4GEW A;  1NJG A;  4Z2N A;  2DAI A;  4DBB A;  5FTK A;  3W67 A;  3WYF B;  1FHW A;  3FKE A;  4HB0 B;  4DV0 M;  2FFJ A;  4BB9 A;  3HZJ A;  3I4V A;  1X11 A;  3DCX A;  2D7G A;  2HTH B;  3NBX X;  1GG3 A;  4I4L A;  3FUV A;  2R18 A;  4R3D A;  2W2X C;  2DHK A;  4D80 A;  2J7N A;  4GHL A;  2DN6 A;  3GLH A;  4D82 A;  1F4I A;  2CY5 A;  1DDW A;  5J3T A;  3SAR A;  2QEN A;  1IXR C;  2JA2 A;  1OFH A;  1MI1 A;  4WP2 A;  3LVW A;  1V5M A;  1QUT A;  4L6V 6;  3P6A A;  1UPQ A;  3AU5 A;  2Z7J A;  4A6H A;  1IY0 A;  2CEA A;  3KY9 A;  2LVA A;  4CGY B;  2Q13 A;  2HAK A;  3L25 A;  3E4R A;  3M1I B;  2V1C A;  3ZH9 B;  1DDV A;  1UM8 A;  1HNZ M;  2UUC M;  4QJ3 B;  1FB8 A;  1N32 M;  4REZ A;  4OX9 M;  2M14 A;  4XWX A;  5C6R A;  2GQF A;  1NHW C;  2X18 A;  4B7F A;  2ZKM X;  3ULC A;  2DHJ A;  1EGX A;  1LV7 A;  3GRY A;  2MGW A;  1PLS A;  1RRP B;  3LW5 F;  3GPU A;  4WSF A;  5EJC A;  1GO5 A;  1XXH E;  1G71 A;  5ITU A;  4A6K A;  4LFB M;  1NNU C;  3HQC A;  1TJ6 A;  1WHC A;  3AOE A;  2HHH M;  4GRI A;  4KHP M;  5EXT A;  1Y19 B;  4DV3 M;  4ZRK A;  1CUK A;  1OJL A;  2XLJ A;  3QWM A;  5DIF B;  4A5K A;  2JXN A;  2CFO A;  2ZTD A;  1DGH A;  2J59 M;  3GRU A;  1OAO C;  3GLI B;  1L2C A;  4NY0 A;  2Z4R A;  3PEG A;  2UUA M;  4KHO A;  5D3V A;  2NQ8 C;  2Y21 A;  3EIH A;  3I04 M;  5DH9 B;  4JXJ A;  1V88 A;  3PG7 A;  1W5S A;  2KZS A;  2ZPY A;  4LGM A;  1LTM A;  3VDU A;  4LCB A;  1DO2 A;  3K8Z A;  1R5L A;  2F4V M;  2ZBK B;  3B7N A;  2F5Q A;  2KNZ A;  2K8E A;  3PSC A;  2W82 A;  4QJ4 B;  2IFS A;  4AQY M;  1GVN A;  3TL4 X;  4F7G A;  2DZO B;  4KOD A;  2KUP A;  1N33 M;  1KSF X;  4X62 M;  1H4R A;  3ODO A;  1IBM M;  3KRX A;  1TF0 B;  2MKR A;  2Y8G A;  4AKI A;  3FE3 A;  2K2U A;  4NXN M;  3O96 A;  3U6E A;  5CLL B;  4DXA B;  2ROZ B;  2DZN B;  2P8V A;  1LW3 A;  2DKL A;  1PJT A;  2JP2 A;  4DV1 M;  5EFX A;  1EVH A;  3SYK A;  3SAS A;  3K92 A;  1FGZ A;  2C96 A;  3WHK A;  4B3R M;  1YLA A;  3AV0 A;  3BXW A;  3VKG A;  1U5G A;  4LJ4 A;  3PNV A;  2J0M A;  4HB2 B;  1ZQ9 A;  1RU3 A;  3J7A S;  1GL6 A;  3FYD A;  4GC5 A;  1QQG A;  1SXJ D;  3D8L A;  4LZJ A;  3VK8 A;  2GUM A;  4HL4 A;  1HJP A;  2DKP A;  1HR0 M;  5EQT A;  2YS5 A;  3AJ4 A;  2BWE A;  5IRS A;  4K0K M;  2JY5 A;  3T38 A;  2EMS A;  2I5F A;  2V1U A;  3C3E A;  1ZM0 A;  2Z3X A;  3KOX E;  4JI0 M;  2R4E A;  5LMN M;  5M4Y B;  3BJI A;  4B3T M; 
#chains in the Genus database with same CATH homology
 2GJY A;  2UU9 M;  3SV1 A;  4G4Q A;  1OMW A;  3K2L A;  1AWE A;  3PFI A;  5FI1 A;  2K47 A;  3U6C A;  2QCU A;  4M0W A;  4NSW A;  3KDS E;  2OQB A;  2PZ1 A;  1QVR A;  3MHV C;  4KLN A;  1UNQ A;  1NI2 A;  4IAP A;  1IXZ A;  3P7Z A;  2VRW B;  3G9W A;  3TE6 A;  2O5R A;  4L4U A;  4NXM M;  1NTY A;  1R6B X;  1Q3C A;  1ZSQ A;  4JI7 M;  1DRO A;  1VDD A;  3SFZ A;  3KOY E;  5C1B A;  1MIX A;  2VQE M;  1KZ7 A;  5HE3 A;  3AJI B;  1NU2 A;  1RJ2 A;  2YQZ A;  4GKJ M;  1EF1 A;  4LG2 A;  5E6J A;  4LRT A;  1NTV A;  1X86 A;  5F3W A;  1LB1 A;  3ILK A;  4IOY X;  4X66 M;  4JI1 M;  4AI6 A;  4DR3 M;  1T3T A;  4DV7 M;  2I7P A;  3UGJ A;  1BTK A;  1DGH B;  2QKM A;  3CIK A;  4B3S M;  1XNR M;  2D9X A;  4LFA M;  4EJN A;  3HJ8 A;  2C98 A;  4XGI A;  3PNY A;  5ITQ A;  2F5S A;  2UXC M;  1N78 A;  4I81 A;  2XF3 A;  2N0Y A;  4GN1 A;  1R2Y A;  1OFI A;  1V5U A;  4DUY M;  3U7D A;  5LMU M;  5C5B A;  4FCT A;  1OQN A;  1UEF A;  3A46 A;  2UVM A;  4QNR A;  3AU4 A;  4M9Z A;  4X65 M;  3WA0 A;  4A6F A;  4P7I A;  4TKN A;  1L1T A;  2ELB A;  1QAN A;  4L78 A;  3FTE A;  3J80 S;  4W5W A;  3SBJ A;  1DBH A;  4GIT A;  4WW0 A;  3HW2 B;  3DXD A;  3VIA A;  3TO1 A;  3SHG B;  3A8Q A;  1WG7 A;  3L29 A;  2DX5 A;  3U5Z B;  3D8E A;  4PNK A;  4M9S A;  5DHA B;  3HKP A;  1M7R A;  3RGS A;  2DHR A;  3PVU A;  1WI1 A;  2XSZ A;  2ZAN A;  4EIW A;  3GO8 A;  4LJ5 A;  1Q67 A;  4IBK A;  3M6A A;  1I2H A;  1W1H A;  2VKI A;  5JHG A;  5EXP A;  2GCJ A;  1FHX A;  4HDO A;  1N34 M;  4KHB B;  5KPT A;  2YR0 A;  3HHX A;  3TWK A;  4BLC A;  1FHO A;  4NRW A;  4A6F B;  1Z59 A;  4IIW A;  4OW0 A;  4DX9 0;  5ITX A;  4HAU B;  5HE2 A;  4HAV B;  3PVW A;  5DI9 B;  1E94 E;  5JI2 E;  2XGN A;  2A5Y B;  3SAU A;  4KAX B;  2I1K A;  3UJN A;  4JI6 M;  3A45 A;  3SO6 A;  4PCZ A;  3HU2 A;  3ZDT A;  1WXQ A;  1Z87 A;  3E9S A;  3SAV A;  3T15 A;  2YRY A;  4WVF B;  2I5C A;  1MAI A;  2F5P A;  2CHQ A;  5KPR A;  1R7R A;  2CV1 A;  3IVF A;  3OAN A;  2RLO A;  4K81 A;  5J3Q A;  3CTW B;  4B3M M;  2R0D A;  2RVB B;  5ITX E;  3SNH A;  5LON B;  1XWI A;  5A2Q S;  3LVV A;  1FGY A;  1XKE A;  4I8O A;  2HKJ A;  3JAM S;  1UNR A;  2NMB A;  3GYO A;  5DYG A;  3ML4 A;  4CHM A;  3ZC7 B;  5KCV A;  2E2X A;  2YS1 A;  5JI3 E;  2R09 A;  5IT9 S;  5IWA M;  4CHJ A;  1UNP A;  1X37 A;  1MX0 A;  3SYL A;  3R8F A;  4GZU A;  4FWH A;  3GPP A;  1AQC A;  3DXE A;  3FSS A;  4C0A A;  1HNX M;  1W1G A;  1IN6 A;  4PQ0 A;  2LYD A;  1YUB A;  3L28 A;  4PD2 A;  3J2P B;  4IJF A;  2QP9 X;  2LOX A;  1JR3 A;  3LJU X;  1PMS A;  1WGU A;  3HJS A;  4AKH A;  1HQY E;  1Z5A A;  3I4Y A;  4G4R A;  4G4O A;  4DR5 M;  2LH0 A;  4FD2 A;  2XZF A;  1QQW A;  1HNW M;  1TH4 A;  5KQ8 A;  2L09 A;  1PFJ A;  2KZU A;  2CV2 A;  2AL6 A;  2R4J A;  2DFK A;  5L81 A;  4CIS A;  1WVH A;  4FVM A;  2DTC A;  2Z0O A;  5EP4 A;  4IBE A;  1G4A E;  3VK7 A;  5ITR A;  2ADZ A;  2W2W A;  3CF2 A;  1G41 A;  2LG1 A;  2G5G X;  4LF9 M;  2KGX B;  2RSG A;  3V5W A;  3GLG A;  1QZM A;  3L2A A;  4LRS A;  5KQ4 A;  1EE8 A;  3AFH A;  3B9P A;  4DV5 M;  1P6S A;  3QAU A;  3VLF B;  2UZR A;  2YT1 A;  2RGN B;  3NSU A;  3FUT A;  1FAO A;  1TH3 A;  2R65 A;  3AKZ A;  4JI4 M;  4Z6Y A;  1NY6 A;  2LKO A;  2V76 A;  4FWG A;  5EP1 A;  4OU7 A;  5BR8 M;  3R9X B;  3TWL A;  2EJ8 A;  3GP1 A;  3TW1 A;  3J7B A;  3GPX A;  3KP1 E;  4R7G A;  3T06 A;  4JN6 A;  2CHV A;  3SC3 A;  2E5L M;  4PDI A;  1ZAE A;  2KA6 B;  3GLI A;  4MGH A;  3KP0 E;  1Y5O A;  2Z0Q A;  4B7H A;  1ORY B;  4H8S A;  1QYR A;  2M5Z A;  1J19 A;  2L1C A;  3GQ5 A;  2CUZ A;  2EUC A;  4TUW A;  3CXB B;  1BAK A;  1G59 A;  5FSW A;  4JV5 M;  2D7E A;  4FCW A;  4GC9 A;  4Z8X A;  1XC8 A;  1SHC A;  2NZ8 B;  4MM3 B;  3GLG B;  3LQR A;  3SMS A;  4LF7 M;  4DR7 M;  3UZU A;  2DX1 A;  4DV2 M;  2D11 A;  3X23 A;  3L26 A;  1GC7 A;  1K5G B;  4FW9 A;  4LF6 M;  1Z6T A;  3FM8 C;  3QIJ A;  2EO2 A;  1JQJ C;  4D81 A;  1MK7 B;  3FUU A;  2Y0T A;  4JI2 M;  5DHF B;  4QHS A;  1DO0 A;  2MFQ A;  4X64 M;  3PVL A;  3FUX A;  5EP3 A;  1IY1 A;  5IRE B;  1NNJ A;  4K2O A;  5JLJ B;  2DKQ A;  3L27 A;  4P16 A;  1MK9 B;  2XZU A;  4DR6 M;  5HE1 A;  3SUZ A;  1HQC A;  3FUW A;  5H37 D;  1NJG A;  4GH9 A;  3VKH A;  2KXE A;  5GKN A;  4GMQ A;  4Z2N A;  5JP4 A;  2RGO A;  4LJ9 A;  2R45 A;  3TPZ A;  3MPX A;  4DBB A;  4KO8 A;  1XD4 A;  2QPA A;  1Z5C A;  3DA1 A;  4MH0 E;  5FTK A;  3UK6 A;  2EMT A;  2GS0 A;  2IYB A;  3WYF B;  1FHW A;  1L1Z A;  2UXD M;  5EP2 A;  1P5T A;  1DYN A;  1ZC4 B;  4IBD A;  1G3I A;  4EMO A;  1DGG A;  2LXE A;  3ODX A;  1KFV A;  1NHG C;  3FKE A;  4MY6 A;  4IBB A;  3IG5 A;  4HB0 B;  3BOS A;  4ZRI A;  4CYE A;  1DDM A;  3PXG A;  4DV0 M;  1TDZ A;  2FFJ A;  4BB9 A;  2D2Q A;  3I51 A;  2VQF M;  2KEB A;  3I4V A;  4LF4 M;  2KRU A;  1X11 A;  3UMM A;  2D7G A;  4IBF A;  4L15 A;  2HTH B;  1N36 M;  4AZF A;  3D8B A;  3JR4 A;  1K3W A;  1U5D A;  3KFU G;  4MGY E;  4HB4 B;  5KQ1 A;  3U8Z A;  4LJ6 A;  2C9O A;  4QNM A;  5BPV A;  2J0K A;  3M7G A;  2MWN B;  3FTD A;  1NY5 A;  1GG3 A;  4I4L A;  2C5R A;  3J81 S;  4MGZ E;  2YS3 A;  4MK0 A;  3FUV A;  5KPZ A;  1TGU A;  2R18 A;  4R3D A;  1WGQ A;  4YHH M;  4GHA A;  2W2X C;  1DGB A;  2DHK A;  5C5B B;  3CF0 A;  3M0E A;  4D80 A;  4NOO B;  3J27 B;  4I5S A;  2J7N A;  4ZPX A;  2Z0P A;  1PJJ A;  1XHB A;  1QAQ A;  3AOG A;  2XSZ D;  3GQ3 A;  4GHL A;  1XCG A;  2DN6 A;  1U2B A;  4MGI E;  3U6P A;  3GLH A;  1J7K A;  1QC6 A;  2L6O A;  3D8F A;  4GMV A;  4D82 A;  4BBK A;  2CY5 A;  4LJ7 A;  3T1Y M;  1DDW A;  5J3T A;  3SAR A;  4Z2M B;  3PZD A;  2QEN A;  1IXR C;  1IY2 A;  2JA2 A;  2V6Z M;  4FWD A;  4PT5 A;  1IBK M;  1OFH A;  5JHH A;  3LVW A;  5C18 A;  1V5M A;  4L16 A;  2DVW B;  5D3X A;  4FCV A;  1NSF A;  1S3S A;  3A98 B;  3H4M A;  4BBA A;  3P6A A;  4Y94 A;  1UPQ A;  2R46 A;  3RCP A;  1IXS B;  3AU5 A;  5C79 A;  2K2J A;  2Z7J A;  2RKO A;  4G4N A;  1X1G A;  4A6H A;  1IY0 A;  3THG A;  1W5T A;  2CEA A;  1N75 A;  3GPY A;  3KS8 A;  1U27 A;  3KY9 A;  2DWN A;  2OPF A;  4GMX B;  2QBY A;  5FI0 A;  2KRK A;  3SHF A;  2J0J A;  4CGY B;  1K3X A;  2I7N A;  2Q13 A;  2ROV A;  1K5D B;  3L25 A;  3TVV A;  3E4R A;  5IZ7 D;  1H6U A;  2QZ4 A;  3W0F A;  1FNN A;  3HHZ A;  1IN4 A;  5EXX A;  1TXD A;  2OTX A;  2BJV A;  2D9V A;  4AG6 A;  3D8D A;  3M1I B;  2ZM6 M;  2V1C A;  1M7E A;  2GCL A;  3ZH9 B;  1DDV A;  1N3H A;  1UM8 A;  2W2X D;  3F5R A;  5ITT A;  1K82 A;  4L8R C;  1GL7 A;  3JR5 A;  1HNZ M;  2UUC M;  2ZAM A;  1FB8 A;  3A8P A;  1N32 M;  3PVS A;  4REZ A;  4OX9 M;  2COA A;  5GOW B;  1N77 A;  1E5W A;  2M14 A;  2LWX A;  4XWX A;  1L2D A;  3SYX A;  5C6R A;  1XXH A;  1NHW C;  1SXJ A;  2X18 A;  4B7F A;  2D9W A;  3ULC A;  2DHJ A;  1FOE A;  1LV7 A;  1U29 A;  1EGX A;  3GRY A;  2UZS A;  1MIZ B;  2YT0 A;  2D9Z A;  3DXC A;  5D27 A;  1PLS A;  1IM2 A;  3HHY A;  1DGF A;  1RRP B;  1PM5 A;  4EKU A;  2AHM A;  3KOW E;  3GPU A;  4HHV A;  3U60 A;  4WSF A;  2X8A A;  5EJC A;  1UPR A;  2C99 A;  4HLQ A;  2XEP A;  2P0H A;  1IN5 A;  1SXJ E;  1TH2 A;  1TDH A;  2Y8F A;  1L2B A;  5ITU A;  4A6K A;  4LFB M;  1V5P A;  1NNU C;  3KSY A;  3HQC A;  4LY6 A;  5KO3 A;  3CF6 E;  3T1H M;  1W1D A;  2COF A;  3TFM A;  3RGP A;  1WJ1 A;  1TJ6 A;  2UXB M;  1WJM A;  3HWS A;  3AOE A;  4M9X A;  1KI1 B;  1NVM A;  4JI8 M;  2HHH M;  4GRI A;  1SXJ B;  4KHP M;  1BTN A;  1H10 A;  4MT7 A;  5EXT A;  1Y19 B;  4DV3 M;  4GXB A;  1NJF A;  4ZRK A;  4DR2 M;  1I4W A;  2H7E A;  4NL4 H;  1YSY A;  3KS4 A;  3UZT A;  2F5N A;  4IFS A;  1IN8 A;  2CRF A;  3KVW A;  4YY3 M;  2XFS A;  1PJI A;  3F0W A;  1OJL A;  4YON A;  4RF0 A;  2FE8 A;  4HAT B;  1Q39 A;  3U60 B;  2XLJ A;  2G35 A;  1HT2 E;  1YE9 A;  4II7 A;  1X1F A;  5FTN A;  4DV6 M;  4A3V B;  3QWM A;  1ZC3 B;  5DIF B;  3MJ5 A;  3MK6 A;  4QHT A;  2DYN A;  4A5K A;  3HJQ A;  3EIE A;  3QWL A;  2CFO A;  1FJG M;  1J0W A;  1DGH A;  2J59 M;  3OTO M;  3SAT A;  4LGY A;  3GRU A;  3GRV A;  3BIN A;  5FTM A;  3GLI B;  1I7A A;  1L2C A;  4LJ8 A;  4AKG A;  4B08 A;  2X49 A;  1ISN A;  4NY0 A;  2Z4R A;  1QAO A;  3KXE C;  3PEG A;  1GKI A;  2UUA M;  1D2N A;  5ITY A;  4IBJ A;  4JI3 M;  4B7G A;  4GIP A;  4KHO A;  3RE8 A;  2DYQ A;  5D3V A;  1GLN A;  5C16 A;  2I1J A;  2NQ8 C;  2Y21 A;  1KZG A;  4DX8 A;  3EIH A;  1E32 A;  2YSZ A;  1GC6 A;  2C9C A;  1XOD A;  1XX0 A;  3DZD A;  5DH9 B;  1X05 A;  5D3Y A;  3KSX A;  4DR1 M;  4JXJ A;  3U5Z A;  2K00 A;  1V88 A;  3TWM A;  3PG7 A;  1W5S A;  2KZS A;  3IG8 A;  4NSR A;  3VFD A;  4NRV A;  3RFW A;  4LGM A;  1U5F A;  1ZVR A;  2ELA A;  2ZPY A;  4DV4 M;  3VDU A;  4LCB A;  4WUR A;  5HE0 A;  1DO2 A;  5EXS A;  2Z4S A;  4IBI A;  2CV0 A;  2D10 A;  2BCJ A;  4JI5 M;  2DA0 A;  3K8Z A;  2Y7B A;  2DWZ B;  3DFZ A;  3ODW A;  2OQ4 A;  1EAZ A;  1HT1 E;  2G8L A;  2M60 A;  4HDQ A;  2F4V M;  2ZBK B;  4M0D A;  4S12 A;  2ERC A;  4PDG A;  2F5Q A;  3GQ4 A;  2DHI A;  1SGH A;  2RNR B;  3QBV B;  2FOI C;  3GRR A;  4GKK M;  1J5E M;  1XR0 B;  2MDX A;  1J09 A;  3PSC A;  2W82 A;  2ZAO A;  2P0F A;  1XNQ M;  1OY2 A;  5LOP B;  2L7H A;  2IFS A;  5J3Y A;  3U6D A;  4LFC M;  4AQY M;  2Y0Q A;  1GVN A;  1TQZ A;  1IQP A;  4MB7 A;  3TL4 X;  2COD A;  3ZVR A;  4F7G A;  2DZO B;  4AW4 A;  1Q3B A;  4KOD A;  2KUP A;  4KVG B;  2X4A A;  8CAT A;  2HL7 A;  1N33 M;  1KSF X;  3TCA A;  4X62 M;  1H4R A;  3FTF A;  2KW0 A;  4JYA M;  4LF5 M;  5DNY A;  3U6O A;  2H7D A;  2YNM D;  3ODO A;  2DWL A;  1IBM M;  2BNK A;  4IJE A;  3KW6 A;  4G6Z A;  3GLF A;  3KRX A;  2YFQ A;  3NBI A;  2MKR A;  2Y8G A;  4AKI A;  2CY4 A;  2LOZ A;  2LUL A;  1SXJ C;  5FTL A;  3Q8X A;  1MU5 A;  2RGH A;  4NXN M;  2K2U A;  3O96 A;  4GPT B;  4IBC A;  4D0N B;  4HB3 B;  7CAT A;  3U6E A;  3U61 A;  5CLL B;  4DXA B;  2CE7 A;  2ROZ B;  2DZN B;  1XMQ M;  3U6Q A;  2P8V A;  5DYI A;  3C58 A;  1LW3 A;  2VSZ A;  2F5O A;  4HAZ B;  3GLH B;  2JP2 A;  3SAW A;  3HU3 A;  4DV1 M;  2RUK B;  5EFX A;  1EVH A;  4XBO A;  4RNA A;  3SYK A;  5FLX S;  1C1K A;  2EA0 A;  3SAS A;  2P0D A;  4F7H A;  3K92 A;  1L8Q A;  1V61 A;  2R62 A;  4L6E A;  3AL0 C;  2DLW A;  3FEH A;  1FGZ A;  2C96 A;  3LMM A;  2COC A;  3WHK A;  3GLF B;  4B3R M;  3N7C A;  1IBL M;  2P5T A;  1E9S A;  3AV0 A;  3K1J A;  3AOE C;  3FTC A;  3VKG A;  1U5E A;  3PP2 A;  2YVC A;  1JR3 D;  1U5G A;  4LJ4 A;  2L7I A;  4CHT B;  3PNV A;  2J0M A;  4OVZ A;  4HB2 B;  4DR4 M;  2QBY B;  1ZQ9 A;  2BJW A;  2FNA A;  2XH9 A;  3DOA A;  4LZZ A;  3U61 B;  3J7A S;  3KSJ A;  1GL6 A;  2CAY A;  3FYD A;  1XMO M;  3W0L B;  3LQQ A;  4GC5 A;  5KQD A;  3NWL A;  2M38 A;  1Z5B A;  1IN7 A;  1R2Z A;  3ULB A;  2N23 A;  2VII A;  4DUZ M;  4HAY B;  3FD9 A;  5CLQ B;  2KCJ A;  3GYP A;  3HU1 A;  1V89 A;  1QQG A;  1SXJ D;  3D8L A;  4NSO B;  1MPH A;  4KHA A;  2L2I A;  4LZJ A;  2UUB M;  4ITQ A;  2AEH A;  3VK8 A;  4B6H A;  2DXI A;  3WHL A;  5FTJ A;  2XFT A;  3HK0 A;  4K2P A;  3MDB C;  4YL8 A;  2H1R A;  4HL4 A;  4LJA A;  4MGK E;  5E26 A;  4HAX B;  2YF0 A;  2D7H A;  3A42 A;  3FYC A;  2DKP A;  1G8P A;  1HR0 M;  5EQT A;  2YS5 A;  2HCB A;  2Q2E B;  2D9Y A;  1QAM A;  2J7O A;  4OVZ B;  1XXH B;  3U6M A;  1MKE A;  3AJ4 A;  2DWM A;  3U6L A;  3KOZ E;  3KRW A;  1BWN A;  1E9R A;  2D4Q A;  4F7U P;  4TYZ A;  3ZCB B;  1KYI A;  3VDP A;  4AG5 A;  4WJ7 A;  1B55 A;  4K0K M;  2CHG A;  3HGI A;  2Y20 A;  3HHW A;  3KZ1 A;  1I94 M;  3T38 A;  4ZRJ A;  2EMS A;  3SMP A;  2I5F A;  4LF8 M;  2HE7 A;  2V1U A;  2XQN M;  3VOQ A;  1P3R A;  4RF1 A;  2Z3X A;  3KOX E;  4QOS A;  1ZM0 A;  4K17 A;  4JI0 M;  5D3W A;  2R4E A;  5LMN M;  2LNH C;  2FJL A;  4QOZ C;  3BJI A;  4IBG A;  4HAW B;  1IRS A;  3U6S A;  2EC1 A;  2QKL A;  4B3T M;  3TQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...