3A98B

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
190
Chain Sequence
SGPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 190
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.920 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a98B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a98B02
5DI9B 1QC6A 3CXBB 1NI2A 5KQ4A 1FHXA 2K00A 3OANA 5C5BB 1RRPB 4PQ0A 3N7CA 4ZRKA 1B55A 1UNRA 3A8QA 3KRXA 2CAYA 1FHWA 2VSZA 2DYNA 2P0DA 5JP4A 4IFSA 2CY4A 5C16A 4K2OA 2D9YA 2DA0A 1MIZB 4NY0A 2H7DA 3SUZA 1V89A 1TQZA 1MK9B 1LW3A 2J0KA 1WG7A 1ISNA 1X1FA 4ZRIA 1V61A 4CHJA 1WGUA 2UZSA 5D27A 1EVHA 4HB4B 2DX5A 2G35A 3NSUA 2GCLA 3AU5A 4A6HA 2KUPA 4GN1A 2DKQA 2IFSA 2LOZA 2ROZB 4XWXA 1BWNA 3SV1A 2MDXA 3P7ZA 1UEFA 2YVCA 3VOQA 5HE2A 3VIAA 2LYDA 4EMOA 1KI1B 5D3WA 1I2HA 1TXDA 2YS3A 3TW1A 1ZC4B 2R0DA 2GCJA 2D9ZA 4WVFB 3KRWA 4C0AA 1MK7B 2MKRA 1XD4A 5DH9B 2IYBA 2YT0A 4DX90 1W1GA 2DFKA 2D2QA 3GYPA 2Z0OA 4EJNA 3PEGA 2DHIA 1KZGA 3HW2B 2COFA 2OQBA 2YS1A 4HDOA 4A5KA 5DHFB 2ADZA 3MPXA 2COCA 2KGXB 5J3QA 3A98B 2ELAA 1P3RA 1BTNA 1XODA 4A6FA 3ULCA 1X1GA 2DYQA 3UZTA 2N23A 1WVHA 3PP2A 3T06A 4YL8A 2AEHA 4A6FB 1E5WA 4F7HA 2RGNB 5GOWB 1I7AA 4TKNA 5KQ1A 2RNRB 1K5DB 3ODXA 3HK0A 2JP2A 2Z0PA 3PZDA 4HAVB 2UVMA 2Y8FA 1U27A 1U5DA 4K2PA 2NZ8B 1FGYA 1V5PA 4YONA 2LKOA 1WGQA 2K2UA 1ZM0A 1Q67A 2R09A 4ZRJA 1M7EA 4HAZB 1LB1A 2DX1A 2XQNM 1FGZA 4K81A 1NU2A 2M38A 1X86A 4HAYB 4HB3B 5HE3A 1ZC3B 2HE7A 4Y94A 4IAPA 3AJ4A 2BCJA 3PVLA 3D8EA 3F0WA 2OTXA 3DXDA 2COAA 2YT1A 3IVFA 1WJMA 1DDMA 2HTHB 3MDBC 2DHKA 4MT7A 1Z87A 2LOXA 2GJYA 2I1KA 2NMBA 3GYOA 1W1DA 1H10A 1BAKA 2L2IA 2LG1A 2W2XC 1AWEA 2Y7BA 2VKIA 4GZUA 2DLWA 1M7RA 2CY5A 3BINA 3DXEA 2RLOA 2YRYA 1UPQA 5DHAB 3ULBA 3WA0A 1Y19B 2EMSA 2UZRA 4DX8A 1U2BA 2P0HA 4HAWB 3SNHA 5CLLB 1FB8A 4B6HA 2ROVA 2D9XA 1V88A 1OY2A 2EC1A 1WI1A 2K2JA 2AL6A 2M14A 3FSSA 1DYNA 3QBVB 1FHOA 1XCGA 3ML4A 2MWNB 3RCPA 1KZ7A 1UPRA 2DHJA 1SHCA 1GC7A 2FJLA 5J3TA 3KY9A 3FEHA 4GXBA 2X18A 1J19A 2ELBA 1MKEA 2E2XA 2D9WA 2J0MA 3WYFB 4HAUB 2W2XD 4DBBA 1FOEA 2CODA 2J0JA 5D3XA 1U5EA 1GC6A 1Y5OA 3QIJA 2Y8GA 4K17A 2PZ1A 2D11A 1XKEA 3D8FA 1V5UA 4HATB 1FAOA 4H8SA 2P0FA 5FI1A 4Z2NA 3ODWA 1MAIA 1W1HA 4KAXB 3TVVA 1RJ2A 4CYEA 1EGXA 5JLJB 1NTVA 2D4QA 3FM8C 5C79A 4F7GA 1WJ1A 3U8ZA 4KVGB 4HB2B 4F7UP 2KCJA 2RSGA 1U29A 2CRFA 2D9VA 1DROA 2W2WA 1PFJA 2EJ8A 2MFQA 1XR0B 1EF1A 4DXAB 4PNKA 1P5TA 2P8VA 4GPTB 1TJ6A 4HHVA 2YS5A 3ZVRA 4KHOA 5FI0A 2DTCA 1U5GA 2DN6A 1K5GB 2DKPA 1ZVRA 5LONB 4HDQA 3O96A 4WSFA 2GS0A 4KHAA 4GMXB 1DBHA 5LOPB 3TFMA 2YSZA 2YF0A 1IRSA 3TO1A 1XX0A 2D10A 1UNPA 4CHMA 1DDWA 4NSWA 3D8DA 5JHGA 1U5FA 2J59M 3BJIA 1NTYA 1MPHA 1X11A 1BTKA 4GMVA 1OMWA 2VRWB 3A8PA 1GG3A 3DXCA 3AU4A 5J3YA 1EAZA 5L81A 4BBKA 3SO6A 4P7IA 2LULA 3F5RA 5DIFB 1P6SA 2I1JA 4KHBB 3V5WA 2QKMA 2EMTA 3U7DA 4HB0B 1AQCA 4IOYX 2H7EA 5HE0A 5HE1A 4Z2MB 2V76A 1DDVA 3X23A 5KCVA 3ZDTA 4MY6A 1PMSA 3HQCA 3SYXA 1SGHA 2I5FA 1N3HA 3P6AA 2Z0QA 4EKUA 3TCAA 3ODOA 3PVWA 4D0NB 1V5MA 1X05A 4A6KA 3KZ1A 2QKLA 3QWMA 2L1CA 3M1IB 2N0YA 1H4RA 4L6EA 5D3YA 5JHHA 5EFXA 4TYZA 1QQGA 3PSCA 1UNQA 2RUKB 2ZPYA 3PVUA 1PLSA 5CLQB 5D3VA 3LJUX 4WJ7A 3G9WA 3CIKA 1ZSQA 4MK0A 2I5CA 3KSYA 5C5BA 1MIXA 4HAXB 5C6RA 1J0WA 3PG7A 1OQNA 2Q13A 2RVBB
chains in the Genus database with same CATH superfamily
1VG5A 1R7RA 1UFZA 1YE9A 2CHVA 3OANA 4PQ0A 1UNRA 5EXXA 3KRXA 2BWBA 1FHWA 2VSZA 2BJWA 2P0DA 3A58A 4QHTA 5C16A 5EJCA 3A45A 3KVWA 2C96A 4F2LA 2DKLA 2GQFA 2C9CA 4CSQA 1V89A 1TQZA 3R9XB 1LW3A 4B7GA 1NHGC 5KPZA 5LMUM 1WG7A 1AIPC 1SG9A 1CUKA 1V61A 1WGUA 1NJGA 5M4YB 4L16A 1EVHA 2Z13A 3NSUA 2GCLA 4A6HA 2BNKA 2F5QA 4LF6M 1HQCA 1N34M 5D3WA 2JZ0A 4JI6M 1R2ZA 1SXJA 2R0DA 3AOGA 4FVMA 2C99A 4C0AA 2E5LM 1AUAA 2H1RA 4QJ4B 4Z8XA 2DWLA 3AV0A 3GLHB 1TH2A 2XFTA 3KOXE 2D2QA 4AKGA 1WHCA 2Z0OA 5C18A 4HDOA 5DHFB 4NC6A 3MPXA 4FWHA 1OFHA 2COCA 2KGXB 1W5TA 1BTNA 1XODA 3ZC7B 1IN7A 1ZMWA 3ULCA 3RFWA 2LHGA 2DYQA 3T1HM 1GL7A 1WVHA 4YL8A 2AEHA 3LVVA 4IBEA 1XB2B 1XXHA 1QAQA 2RGNB 5GOWB 1IBLM 2RNRB 2CV1A 3HHYA 2RRUA 4L8RC 1IXRC 2KRUA 3GLFA 2JP2A 2L2DA 2QQ8A 3NWLA 2Z4SA 4OX9M 3B7QA 5BPVA 3E4RA 1Z6TA 1V5PA 2FFJA 1VQ1A 2K2UA 4FW9A 4PD2A 2KA6B 3DOAA 4LZZA 4ZRJA 1HJPA 2RRFA 4FD2A 1FGZA 2L4FA 2R0IA 3GPYA 2LNHC 4MGIE 3FUUA 5E26A 1NU2A 4DBGB 1X86A 4DR4M 1J09A 2F5SA 2BCJA 5LMNM 4B7HA 2HAKA 4IBDA 4X62M 1MI1A 3VDUA 4LGMA 4D81A 2QCUA 2OTXA 3DXDA 5EXTA 4BLCA 1T6OA 3MDBC 4WW0A 2LVOC 2GJYA 2I1KA 3L25A 3J27B 2NMBA 1E94E 1GL6A 2KRKA 5DYGA 3GLHE 3KSXA 1XHBA 3GLGA 2R65A 2O25A 1UPQA 2KIEA 5DHAB 2RKOA 3ULBA 3WA0A 2QNJA 2UZRA 4DX8A 4HAWB 2EA0A 1SXJD 4B7FA 2EC1A 1WI1A 4QNRA 1PJQA 4Z6YA 2M14A 3W68A 4OSNA 2LVNC 1XCGA 3GLIA 3V76A 3HHXA 5EP1A 2DHJA 2ZANA 3UJNA 1SHCA 3WHKA 5J3TA 3FEHA 3K8ZA 4AZFA 4DV5M 2DXIA 2ELBA 1WR1B 2XLJA 2J0MA 4EIWA 2HCBA 4LF4M 4HAUB 4DBBA 3DFZA 1Z5AA 5JI3E 3NBXX 1J7KA 2X49A 5D3XA 1U5EA 2VDBB 3QIJA 3T15A 4S12A 5JI2E 3E46A 2DAGA 2P0FA 5FI1A 4Z2NA 2OPFA 3U6EA 4CYEA 3HU3A 3AKZA 4F7GA 3U8ZA 8CATA 2XZFA 1IXSB 2KHHA 2CFOA 3U6OA 2FS1A 1K3XA 1XR0B 1GJTA 4DXAB 4PNKA 1P5TA 3K2LA 4JI4M 3T1YM 2ZKMX 4L1RA 3TWMA 3SFZA 1UM8A 4MM3B 2ZAOA 4HHVA 2Z4DA 4NSRA 3SHGB 5FI0A 2JA2A 1U5GA 2DKPA 3U6LA 4HDQA 3FTFA 3O96A 2GS0A 1IBMM 1GABA 2DZNB 3TFMA 1QZEA 3PXGA 3M0EA 1DGFA 4LF8M 3SYKA 4XBOA 1S3SA 1NVMA 2DWNA 3K9PA 4I4LA 3HY5A 2EJSA 2JUJA 2R6FA 1NTYA 2DAKA 1MPHA 2OQ4A 3A8PA 3AU4A 4DV3M 3JR5A 1TH3A 2W82A 4FWDA 2I1JA 2QKMA 2K6BA 4HB0B 4JXJA 2CV0A 4Z2MB 2V76A 4AQYM 1DDVA 3HJ8A 5IREB 4MY6A 3U60A 1PMSA 2R45A 3SYXA 2K49A 3NW8A 1N3HA 2WSCF 5EP4A 3FVCA 3P6AA 2Z0QA 3DZDA 1IFYA 4M9SA 1KFVA 2DAEA 1QDRA 1QQWA 3U6DA 3EIHA 1R6BX 2GUMA 2JY6B 4DR5M 2XFSA 4L6EA 5EFXA 4I8OA 2ZM6M 3HSAA 3RE8A 2RUKB 1NHWC 2G8LA 1PLSA 3LJUX 2JY8A 1ZSQA 4QJ5B 4PDGA 2LTUA 5EP2A 1JQJC 3F92A 4QHSA 2JZ1A 3DA1A 1G41A 1QC6A 3CXBB 1NI2A 3HZJA 5KQ4A 4IBIA 2K00A 2I7NA 5C5BB 3U5ZB 1RRPB 4ZRKA 1B55A 1QDTA 3A8QA 1VDLA 2CAYA 1QAMA 2Z3XA 2EO2A 2KNZA 5JP4A 4GHLA 1K82A 1D0KA 2D9YA 2H7DA 2CHQA 3PNYA 1TDHA 1X1FA 4D80A 3H4MA 5D27A 3IHPA 1D0MA 1Y8GA 2G35A 1G4AE 2DKQA 4XWXA 1OKSA 3KS8A 1JR3E 4GMQA 1UEFA 3I04M 2FJUB 2YVCA 4DV0M 3VOQA 4CIZA 3VIAA 1KYIA 5KQ8A 4NL4H 4BBAA 1ZC4B 4W5WA 3QWLA 3GLHA 2D9ZA 1ZQ9A 2K8EA 1ZMVA 5ITTA 4I81A 1L2DA 2IYBA 2LH0A 4DX90 3HGIA 1J5EM 5H37D 3GYPA 4EJNA 2LVQD 1Z5BA 1DGBA 2DHIA 4GRIA 2COFA 2A5YB 1K3WA 2NQ8C 3U60B 3ZQJA 1P3RA 4G3OA 5IZ7D 2MH8A 3SATA 2DHRA 2F5PA 3PNVA 2VQFM 3I4YA 1GJSA 3AL0C 3H4JA 1YUBA 1I7AA 5KQ1A 3HK0A 4AKHA 4KODA 2Z0PA 3PZDA 4BB9A 2NZ8B 1FGYA 4OW0A 3E21A 5ITRA 4YONA 1WGQA 1NO1A 3SARA 1ZM0A 1OFIA 2AHMA 3L29A 4JI5M 2DX1A 1E9RA 3LCVB 4GNKB 1ZMUA 1PRBA 2FE8A 1Z59A 4HAYB 3C3DA 5HE3A 5FTNA 1W5SA 3AJ4A 3PVLA 2UXCM 3LQRA 1OIPA 1H6UA 2CWBA 2CEAA 3F0WA 2DWZB 3U6CA 2COAA 1DDMA 5BR8M 2DHKA 4MT7A 2KIGA 5EXPA 2Y0QA 3UK6A 2LVAA 3D8LA 2L2IA 2LG1A 1R5LA 4GZUA 2DLWA 2CY5A 5A2QS 3B9PA 3L27A 5EP3A 2RLOA 2YRYA 4LRTA 4A3VB 2EMSA 3QAUA 2J5YA 5CLLB 3U6MA 1FB8A 2ROVA 3GQ3A 1TF0B 2D9XA 4JI2M 3T38A 3B77A 4KHPM 3U61A 2AL6A 1G3IA 4MGKE 2DWMA 2L7IA 4JI8M 1HQYE 2CV2A 4FCTA 1HNWM 1GC7A 2FJLA 1IY0A 1TR8A 3TQSA 3FKEA 1QZMA 3Q8GA 5EQTA 2Y0TA 3KP1E 1L1TA 1MKEA 3MHVC 2R4JA 5GKNA 4IIWA 1DO0A 1N78A 3WYFB 1XMOM 1FOEA 2CODA 1OTRA 4LJ4A 3CTWB 1GC6A 2Z7JA 1XKEA 3EIEA 3D8FA 1IY1A 2QPAA 2F4VM 4HATB 3GRRA 3M7GA 1IXSA 4OVZB 4ANRA 1EGXA 1NTVA 3GP1A 2D4QA 1IBKM 3B7ZA 5C79A 4GC5A 4YHHM 4AI6A 1WJ1A 3B7NA 4F7UP 1WGNA 2CRFA 1WGLA 1U29A 4R71A 1PFJA 2EJ8A 2MFQA 1I4WA 5IRSA 1SXJC 1OQYA 2FOIC 4GPTB 2APLA 3MJ5A 3HIEA 2DN6A 2LVPC 1K5GB 5KO3A 2ZBKB 2CE7A 5LONB 4WSFA 4K0KM 4P16A 1PJIA 2Q2EB 2YSZA 1NNUC 1IRSA 3IECA 1V34A 3TE6A 1L2CA 2Z4RA 1T43A 1N77A 4LJ8A 4CHMA 4NSWA 5JHGA 1NNJA 4LRSA 3HX3A 1X11A 5J3YA 1PM5A 3M6AA 4P7IA 1E9SA 3F5RA 5DIFB 4LCBA 4LJ9A 1L8QA 2ZTDA 2M5ZA 3U7DA 3FD9A 1AQCA 3U61B 1N32M 3ZDTA 1QUSA 1IM2A 3AOEA 4LJAA 4RNAA 2I5FA 4G4OA 4G6ZA 2CHGA 4EKUA 5DNYA 1V5MA 1NY5A 4LGYA 2R18A 5E6JA 4DR7M 3M1IB 4DR3M 2N0YA 2EUCA 2KZUA 2UU9M 5JHHA 1YLAA 4M0DA 1UNQA 5F3WA 1IXZA 2XF3A 4JI0M 4IBFA 4WJ7A 3G9WA 3L28A 2QP9X 3KFUG 1HT1E 2MR9A 4G4NA 4MK0A 3SYLA 5C5BA 3U5ZA 5C6RA 3TWKA 2R46A 2WSEF 2DNAA 4OT1A 4M9ZA 3AJIB 3R8FA 4B3MM 4L6V6 4DR2M 1QYRA 2DYNA 4IFSA 4LJ7A 2QBYB 1MIZB 4FCWA 2R44A 3SUZA 3VLFB 1ZYIA 1MK9B 2J0KA 4NXNM 2M60A 2JXNA 2OOBA 3HU2A 4CHJA 3AOEC 4IBJA 4HB4B 2DX5A 1PGYA 2J7OA 1FNNA 4TUWA 2IFSA 2LOZA 2ROZB 3VKGA 3SV1A 1T3TA 3HJSA 1BVSA 1T77A 4EMOA 4NRVA 1TXDA 2YS3A 2EKKA 1FJGM 2K47A 1DO2A 3I4VA 3KRWA 1MU5A 1XD4A 1C7YA 4NRWA 2JY5A 2WZJA 2ZAMA 2DFKA 4AG6A 2XH9A 3PEGA 4UN2B 1KZGA 2OQBA 4A5KA 5FSWA 1L2BA 2D7GA 2X4AA 3UZTA 3ZCBB 3PP2A 3IG8A 3T06A 1XXHE 2VF7A 5KPTA 1N75A 4A6FB 3FYCA 3A42A 1RU3A 3GLFE 3W67A 3OHMB 2NBVA 4P17A 2YT2A 3ODXA 3I51A 2UVMA 1U5DA 4QOSA 2LKOA 2DZLA 5IT9S 2XEPA 3GPUA 3VKHA 3MK6A 1ZV1A 4HAZB 2I7PA 4DV2M 3AFHA 4DV6M 1G8PA 4X65M 2KW0A 2M38A 4Y94A 1NV8A 5C1BA 3C9PA 5DFLA 3JR4A 1WJ7A 3SAVA 3FYDA 2V6ZM 3D8EA 4KO8A 2RGHA 1Q02A 4GOUA 2HTHB 4DV4M 2LOXA 1HT2E 3GYOA 5ITXE 1W1DA 4XGIA 1H10A 4PCZA 2JWSA 3TL4X 5ITUA 1AWEA 4LFCM 1Q3CA 1EIJA 1Y19B 1C1KA 3LCUA 4X66M 1DGHB 3U12A 2K0BX 3SMSA 3J2PB 3SNHA 1HR0M 1V88A 2HL7A 5IWAM 3FSSA 2H5XA 3U6QA 2XZUA 4LF5M 3QBVB 1GLNA 2Z14A 3RCPA 1UPRA 2KR0A 1DGGA 3NWFA 3KY9A 2RGOA 4DV7M 4G4QA 2X18A 4MGHA 2D9WA 3FUWA 3K9OA 3W0FA 1VEGA 1VDDA 4GC9A 4R7GA 2J0JA 3GRYA 1Y5OA 3LMMA 2XSZA 4OVZA 2PZ1A 3J80S 4B3SM 1V5UA 2DHYA 4M9XA 1IN5A 2ERCA 2JP7A 1YSYA 3ODWA 1W1HA 4KAXB 4MGYE 1RJ2A 3FTDA 3OTOM 3FM8C 3KXEC 3CF0A 2J7NA 4KVGB 1VEKA 2KCJA 2RSGA 2D7HA 3HJQA 4AG5A 2D9VA 3KOWE 2KEBA 3SASA 1IN6A 1EF1A 2BJVA 4CISA 2JY7A 2HHHM 4NSOB 2YS5A 2F5OA 3SAWA 3SMPA 2YR0A 5I2SA 3HWSA 4B3TM 1PJSA 4MH0E 4KHAA 4GMXB 2QZ4A 1DBHA 5LOPB 3RGPA 2C9OA 2YF0A 3PFIA 4KLNA 4LFBM 3KP0E 4IBBA 2D10A 5FTKA 4JI7M 1DDWA 1I94M 4RF0A 2WSFF 3SAUA 2VQEM 2QHOB 1EFUB 2J59M 4RF1A 3BJIA 3VK7A 5L8RF 1BTKA 2N35A 4GMVA 2P5TA 2VRWB 3DXCA 1D2NA 1GG3A 1LTMA 4WURA 5L81A 3HU1A 3WHLA 2LULA 2L6OA 1TH4A 3SHFA 1P6SA 2JNHA 2KXEA 2VF8A 1HNXM 1OAIA 3QYBA 4KHBB 2EMTA 1ORYB 3TWLA 3ILKA 2H7EA 2Z8YM 5HE1A 1WIVA 4B08A 5KCVA 2D7EA 5FLXS 2V1CA 4IJFA 4DR1M 2FH0A 1N33M 5KQDA 3NWAA 1SGHA 5FTMA 1L1ZA 3TCAA 3ZH9B 3ODOA 3PVWA 3FUTA 1X05A 3FTEA 3KZ1A 2L1CA 3GPPA 1H4RA 3C58A 1A5TA 1X37A 1N36M 1QQGA 3PSCA 1XMQM 1GKIA 5CLQB 1TTEA 1R4GA 2L4EA 3GQ5A 3NWDA 2DI0A 2XSZD 3CIKA 1JB0F 3J7BA 4GHAA 2I5CA 2KNVA 3KSYA 1MIXA 4HAXB 2DZOB 2R62A 4FCVA 1GO5A 1J0WA 1OAOC 3K92A 4JV5M 5DI9B 4R3DA 2V1UA 1Q3BA 1FHXA 1Z5CA 2DAIA 3N7CA 2QBYA 3SBJA 4NXMM 4LG2A 2B3TA 2CY4A 4K2OA 2DA0A 2GNOA 4X64M 4NY0A 3FUXA 1OJLA 2KZSA 4AW4A 3JAMS 3I01M 1ISNA 4ZRIA 1QUTA 3HHWA 2UZSA 3UMMA 1D0LA 2ZTCA 3AU5A 2KUPA 4GN1A 1XC8A 3A46A 1BWNA 2DENA 2MDXA 2OOAA 2C5RA 3P7ZA 4WP2A 4YY3M 3LW5F 5HE2A 3RGSA 5ITXA 2LYDA 1KI1B 1JR3A 1Q39A 2G3QA 1I2HA 3TW1A 2GCJA 4WVFB 3BBZA 3LVWA 1MK7B 2MKRA 4DUZM 5DH9B 4DR6M 1SXJB 2YT0A 2OO9A 2CRUA 1W1GA 3B74A 3THGA 3KOYE 3HW2B 2YS1A 2LWXA 2ADZA 5J3QA 3A98B 4LZJA 2ELAA 4L4UA 4A6FA 1X1GA 3L26A 4LJ6A 1QAOA 2N23A 4GITA 2KUQA 3U6SA 1E5WA 4F7HA 3KOZE 3KSJA 4CHTB 1IN8A 4TKNA 2BWEA 3KS4A 5FTJA 1K5DB 3BOSA 1WXQA 4M0WA 2VIIA 3UZUA 3C3EA 4CJ6A 3KDSE 4REZA 4HAVB 1XXHB 2Y8FA 1U27A 4K2PA 2QSFX 3UGJA 4PDIA 3PVSA 4DIXA 2YQZA 1V92A 3GLFB 3BXWA 4XK8F 1Q67A 2R09A 1M7EA 4QJ3B 2O5RA 4HLQA 5FTLA 1TGUA 1LB1A 2XQNM 5I2MA 2EKFA 2DAMA 3GO8A 4K81A 2R2YA 2MJ5B 4JI1M 4HB3B 1ZC3B 2HE7A 4IAPA 3VDPA 2LHCA 3FUVA 1PJJA 3FRHA 2L7HA 5KPRA 2YT1A 3IVFA 1WJMA 3IG5A 3E9SA 1Z87A 3D8BA 2O01F 1MN3A 4FWGA 3GPXA 1BAKA 4DUYM 4Y28F 2W2XC 4Q7JA 1SXJE 7CATA 2LXEA 2Y7BA 4JN6A 2VKIA 2F5NA 1M7RA 1DGHA 3BINA 2MGWA 3DXEA 3NBIA 4IJEA 3W0LB 3GLGB 1U2BA 1JR3D 2P0HA 4RKUF 2UXDM 1IQPA 2Y21A 4B6HA 2K9DA 2Y20A 3Q8XA 3FE3A 2Z59A 4I5SA 5LG4B 4ZPXA 2KNAA 1OY2A 1P3QQ 4NOOB 3HHZA 2K2JA 1DYNA 3VK8A 1FHOA 3ML4A 2MWNB 1F4IA 1QVRA 1KZ7A 3GQ4A 4LF7M 4II7A 3J7AS 3QYEA 2G5GX 3HKPA 2LBCA 4GXBA 3TPZA 3GLIB 3CGWA 1J19A 2E2XA 3DCXA 4CGYB 3K1JA 4LY6A 2W2XD 2YNMD 1OIZA 2Y8GA 4K17A 2D11A 5ITQA 2YFQA 1NY6A 1FAOA 4H8SA 3J81S 1MJGM 3VFDA 4QXAB 1MAIA 4JYAM 3TVVA 5JLJB 2UXBM 4GIPA 4HB2B 3MMPA 4IBCA 1EE8A 4DV1M 3L2AA 2W2WA 1DROA 1LV7A 1G59A 2L09A 4IBGA 4KT0F 3GRUA 1PJTA 2QENA 4L15A 2P8VA 1TJ6A 1IY2A 1XNRM 4MGZE 3T6PA 3ZVRA 4KHOA 2DTCA 3CF6E 1ZVRA 3LQQA 2R4EA 1IN4A 1QANA 3KW6A 4MB7A 3FTCA 2FNAA 1E32A 2HKJA 2X8AA 1ZAEA 2C98A 4D82A 4LFAM 3GLGE 3TO1A 1XX0A 2MROB 4L78A 5DYIA 1UNPA 2CP8A 4QNMA 1V33A 4GKKM 3FRIA 3D8DA 4G4RA 1U5FA 5EXSA 4F1IA 4QOZC 4JI3M 1KSFX 4KHBA 1OMWA 1EAZA 3U6PA 3SO6A 4BBKA 1VEJA 3GLIE 1GVNA 4ITQA 3V5WA 4PT5A 1MX0A 4IOYX 5HE0A 4IBKA 4B3RM 2UUCM 4GEWA 3X23A 3HQCA 1DV0A 2DVWB 1NSFA 2UUBM 2CUZA 3SC3A 4HSIA 1XNQM 4D0NB 4A6KA 1XWIA 3CF2A 4OU7A 2QKLA 1G71A 1NV9A 3QWMA 2UUAM 4GKJM 5D3YA 3GRVA 4TYZA 5ITYA 2XGNA 4HL4A 1R2YA 2ZPYA 3PVUA 5D3VA 1NJFA 4HEOA 1HNZM 4GH9A 2HWJA 3B89A 1TDZA 4D6WA 4LJ5A 4AKIA 2KDLA 4LF9M 3PG7A 1OQNA 2Q13A 2RVBB
chains in the Genus database with same CATH topology
5DI9B 1QC6A 3CXBB 4R3DA 2V1UA 1Q3BA 1NI2A 1R7RA 1YE9A 5KQ4A 2CHVA 1Z5CA 4IBIA 2I7NA 1FHXA 2K00A 3OANA 5C5BB 3U5ZB 4M9ZA 1RRPB 3N7CA 1B55A 3AJIB 1UNRA 5EXXA 4PQ0A 4ZRKA 3R8FA 3A8QA 4B3MM 2CRFA 3KRXA 4DR2M 2CAYA 1FHWA 1QAMA 2QBYA 1QYRA 2Z3XA 3SBJA 2DYNA 2VSZA 4NXMM 4LG2A 2BJWA 5L81A 2EO2A 2P0DA 5JP4A 4GHLA 4IFSA 4GN1A 2CY4A 1K82A 4QHTA 5C16A 4LJ7A 5EJCA 4K2OA 3A45A 3KVWA 2D9YA 2DA0A 2C96A 2QBYB 4X64M 1MIZB 4NY0A 4FCWA 3FUXA 2H7DA 2C9CA 3VLFB 3SUZA 1OJLA 2CHQA 1V89A 2KZSA 4AW4A 1TQZA 3R9XB 3PNYA 1MK9B 1LW3A 4B7GA 2J0KA 4NXNM 3JAMS 2M60A 1NHGC 5KPZA 1TDHA 5LMUM 1WG7A 1ISNA 1X1FA 4ZRIA 4D80A 1V61A 3HU2A 4CHJA 3H4MA 4WSFA 3HHWA 1WGUA 1NJGA 2UZSA 5D27A 3AOEC 4IBJA 4L16A 3UMMA 1EVHA 2DX5A 4HB4B 2G35A 3NSUA 1G4AE 2J7OA 2GCLA 3AU5A 4A5KA 1FNNA 2BNKA 4TUWA 1XC8A 2DKQA 3A46A 2F5QA 2IFSA 2KUPA 1BWNA 2LOZA 3KS8A 3VKGA 2ROZB 4XWXA 2MDXA 3SV1A 4EMOA 4GMQA 2C5RA 1T3TA 3P7ZA 1UEFA 4YY3M 4LF6M 2YVCA 4DV0M 3VOQA 5HE2A 1HQCA 1N34M 3HJSA 3RGSA 5ITXA 2LYDA 1KI1B 5D3WA 1KYIA 3VIAA 1JR3A 1Q39A 1I2HA 4JI6M 5KQ8A 4NRVA 1R2ZA 1TXDA 2YS3A 3TW1A 4NL4H 1SXJA 4BBAA 1ZC4B 4W5WA 3AOGA 3QWLA 2R0DA 2GCJA 3GLHA 4FVMA 2D9ZA 4WVFB 1FJGM 2K47A 1DO2A 1ZQ9A 2C99A 3I4VA 3LVWA 1MK7B 3KRWA 4C0AA 2MKRA 1MU5A 4DUZM 2E5LM 2H1RA 5ITTA 4DR6M 1XD4A 5DH9B 4I81A 4NRWA 1SXJB 4Z8XA 2DWLA 1L2DA 2IYBA 3AV0A 3GLHB 2LH0A 1TH2A 2XFTA 2ZAMA 2YT0A 3KOXE 4DX90 3HGIA 1W1GA 2DFKA 3THGA 4AG6A 2D2QA 1J5EM 5H37D 3GYPA 3KOYE 4AKGA 2XH9A 2Z0OA 5C18A 4EJNA 1Z5BA 3PEGA 1DGBA 1KZGA 2DHIA 4GRIA 2COFA 2A5YB 1K3WA 2OQBA 2LWXA 2YS1A 5FSWA 2ADZA 4HDOA 5DHFB 3MPXA 2NQ8C 4FWHA 3U60B 1OFHA 2COCA 2KGXB 5J3QA 1W5TA 3A98B 4LZJA 1L2BA 1P3RA 2ELAA 2D7GA 4L4UA 1BTNA 1XODA 4A6FA 2X4AA 3ZC7B 1IN7A 5IZ7D 3ULCA 3RFWA 1X1GA 2DYQA 3L26A 3T1HM 4LJ6A 3SATA 1QAOA 3UZTA 1GL7A 1WVHA 2DHRA 3ZCBB 2F5PA 2N23A 3IG8A 3PP2A 3T06A 4B6HA 4YL8A 4GITA 5KPTA 3PNVA 3U6SA 1N75A 2AEHA 4A6FB 3LVVA 4IBEA 1E5WA 4F7HA 3FYCA 3KOZE 2VQFM 3I4YA 3A42A 3AL0C 3KSJA 1XXHA 1QAQA 2RGNB 5GOWB 1YUBA 4CHTB 1I7AA 1IN8A 4TKNA 1IBLM 2RNRB 5KQ1A 3KS4A 1K5DB 5FTJA 2CV1A 3BOSA 3ODXA 3HHYA 4L8RC 1WXQA 4AKHA 1IXRC 3HK0A 4M0WA 2KRUA 3GLFA 2VIIA 3UZUA 2JP2A 4KODA 3KDSE 2Z0PA 3I51A 4REZA 3PZDA 4HAVB 1XXHB 2UVMA 2Y8FA 3NWLA 4BB9A 2Z4SA 1U27A 1U5DA 4OX9M 4K2PA 3UGJA 2NZ8B 1FGYA 4OW0A 4PDIA 5BPVA 4QOSA 3PVSA 3E4RA 2YQZA 1Z6TA 1V5PA 5ITRA 3GLFB 4YONA 4A6HA 2LKOA 1WGQA 2FFJA 3SARA 2K2UA 4FW9A 4PD2A 1ZM0A 5IT9S 2KA6B 2XEPA 1Q67A 3DOAA 4LZZA 1OFIA 3GPUA 3VKHA 3MK6A 2R09A 5LONB 4ZRJA 1M7EA 2AHMA 2O5RA 4HLQA 5FTLA 4HAZB 1TGUA 3L29A 4JI5M 2I7PA 4DV2M 1LB1A 2DX1A 4FD2A 3AFHA 4DV6M 1FGZA 1E9RA 2XQNM 1G8PA 4X65M 3GPYA 2LNHC 3GO8A 4MGIE 4K81A 3FUUA 2KW0A 5E26A 1NU2A 2FE8A 1Z59A 2M38A 1X86A 4DR4M 4JI1M 4HB3B 4HAYB 1ZC3B 5HE3A 2HE7A 1J09A 4Y94A 5FTNA 1W5SA 4IAPA 2F5SA 5C1BA 3AJ4A 2BCJA 3PVLA 5LMNM 4B7HA 2UXCM 3VDPA 3JR4A 3LQRA 3SAVA 3FYDA 2V6ZM 3D8EA 1H6UA 3HW2B 4IBDA 4KO8A 2CEAA 3FUVA 4X62M 1PJJA 3F0WA 2L7HA 4LGMA 2DWZB 3VDUA 4D81A 2QCUA 5KPRA 2OTXA 3DXDA 5EXTA 4BLCA 3U6CA 2COAA 2YT1A 2RGHA 3IVFA 1WJMA 1DDMA 3IG5A 5BR8M 2HTHB 4DV4M 3MDBC 2DHKA 2EJ8A 4WW0A 3E9SA 4MT7A 1Z87A 2LOXA 2GJYA 1HT2E 3L25A 3J27B 3D8BA 2I1KA 2NMBA 4HDQA 1E94E 5EXPA 5ITXE 3GYOA 2Y0QA 4FWGA 1GL6A 3UK6A 1W1DA 4XGIA 3D8LA 2KRKA 3GPXA 1H10A 1BAKA 4PCZA 2L2IA 4DUYM 2LG1A 2W2XC 1SXJE 3TL4X 5DYGA 7CATA 2LXEA 3KSXA 5ITUA 2Y7BA 1AWEA 4LFCM 4JN6A 2VKIA 4GZUA 2F5NA 2DLWA 1M7RA 1DGHA 1XHBA 3GLGA 2CY5A 2R65A 3BINA 1Q3CA 3DXEA 5A2QS 3B9PA 3L27A 5EP3A 2RLOA 1UPQA 2YRYA 5DHAB 2RKOA 3ULBA 3WA0A 4LRTA 4A3VB 3NBIA 1Y19B 2EMSA 1C1KA 4IJEA 3W0LB 4X66M 3QAUA 2UZRA 1DGHB 4DX8A 3GLGB 1U2BA 1JR3D 2P0HA 4HAWB 3SMSA 2UXDM 3J2PB 3SNHA 1IQPA 2EA0A 5CLLB 1SXJD 4B7FA 2Y21A 3U6MA 1HR0M 1FB8A 2Y20A 2ROVA 3Q8XA 3GQ3A 2D9XA 4I5SA 4JI2M 4ZPXA 1V88A 1OY2A 2HL7A 4NOOB 3T38A 2EC1A 3HHZA 4KHPM 1WI1A 4QNRA 3U61A 4Z6YA 2K2JA 5IWAM 2AL6A 1G3IA 2M14A 3FSSA 3U6QA 1DYNA 4MGKE 3VK8A 2XZUA 4LF5M 1XCGA 3QBVB 1FHOA 3ML4A 3GLIA 1GLNA 2DWMA 2MWNB 2L7IA 4JI8M 1QVRA 1KZ7A 3RCPA 1HQYE 2CV2A 1UPRA 3HHXA 4FCTA 5EP1A 1HNWM 2ZANA 3UJNA 3GQ4A 1SHCA 2DHJA 4LF7M 1GC7A 4II7A 1DGGA 3J7AS 3WHKA 2FJLA 2G5GX 1IY0A 3HKPA 3TQSA 5J3TA 3KY9A 3FKEA 3FEHA 1QZMA 2RGOA 4GXBA 3TPZA 4DV7M 4G4QA 3GLIB 3K8ZA 2Y0TA 5EQTA 2X18A 4MGHA 3KP1E 4AZFA 4DV5M 2DXIA 1L1TA 1J19A 2ELBA 1MKEA 2E2XA 3MHVC 4CGYB 2XLJA 4EIWA 2R4JA 2D9WA 2J0MA 3FUWA 5GKNA 4IIWA 3K1JA 3W0FA 1DO0A 2HCBA 4LF4M 4LY6A 1N78A 4HAUB 1XMOM 2W2XD 2YNMD 3WYFB 1FOEA 3DFZA 4DBBA 1Z5AA 2CODA 5JI3E 1J7KA 2X49A 4LJ4A 1VDDA 4GC9A 4R7GA 2J0JA 5D3XA 3CTWB 1U5EA 1GC6A 3GRYA 1Y5OA 3LMMA 2Z7JA 3QIJA 2Y8GA 4K17A 2XSZA 4OVZA 2PZ1A 3J80S 5ITQA 2YFQA 2D11A 1NY6A 1XKEA 3EIEA 3T15A 4B3SM 3D8FA 4S12A 1IY1A 1V5UA 2QPAA 2F4VM 5JI2E 4HATB 1FAOA 4H8SA 4M9XA 2P0FA 5FI1A 3GRRA 3J81S 4Z2NA 1IN5A 2ERCA 3M7GA 3VFDA 1YSYA 2OPFA 4OVZB 3U6EA 3ODWA 1MAIA 1W1HA 4KAXB 4JYAM 4MGYE 3TVVA 1RJ2A 4CYEA 1EGXA 5JLJB 1NTVA 3HU3A 3GP1A 3AKZA 2UXBM 3FTDA 2D4QA 1IBKM 3OTOM 3FM8C 5C79A 4GC5A 4YHHM 4AI6A 1WJ1A 3KXEC 4GIPA 3U8ZA 3CF0A 4F7GA 2J7NA 8CATA 2XZFA 4KVGB 1IXSB 4HB2B 4F7UP 2KCJA 2RSGA 2CFOA 1EE8A 2D7HA 3HJQA 4IBCA 4AG5A 3L2AA 4DV1M 3U6OA 1LV7A 3KOWE 1PFJA 2D9VA 1G59A 2KEBA 2L09A 3SASA 1I4WA 4IBGA 1K3XA 1XR0B 2MFQA 1IN6A 1EF1A 3GRUA 1SXJC 4DXAB 4PNKA 2BJVA 2QENA 4CISA 1P5TA 2FOIC 4L15A 3K2LA 4JI4M 2P8VA 4GPTB 3T1YM 2HHHM 3TWMA 1TJ6A 1IY2A 1UM8A 4MM3B 2ZAOA 3SFZA 1XNRM 4HHVA 4NSOB 4MGZE 2YS5A 3MJ5A 2F5OA 3ZVRA 4NSRA 3SHGB 4KHOA 2JA2A 3SAWA 2DTCA 5FI0A 3CF6E 1U5GA 2DN6A 1K5GB 2DKPA 1ZVRA 3LQQA 2R4EA 5KO3A 3SMPA 1IN4A 2ZBKB 2CE7A 1QANA 2YR0A 3U6LA 3KW6A 3HWSA 4B3TM 3FTFA 4K0KM 2GS0A 4P16A 3O96A 1PJIA 1IBMM 4MB7A 3FTCA 2FNAA 2Q2EB 4MH0E 4GMXB 2QZ4A 1E32A 2DZNB 1DBHA 4KHAA 2HKJA 3RGPA 2X8AA 5LOPB 2C9OA 1ZAEA 3TFMA 2YSZA 2YF0A 1NNUC 2C98A 1IRSA 3PXGA 3M0EA 1DGFA 3PFIA 4LF8M 4D82A 4LFAM 3SYKA 4KLNA 3TO1A 4LFBM 3KP0E 3TE6A 1L2CA 2Z4RA 4IBBA 1XX0A 4L78A 4XBOA 1S3SA 1NVMA 5DYIA 1N77A 1U29A 1UNPA 2D10A 2DWNA 4LJ8A 5FTKA 4QNMA 4JI7M 4GKKM 1DDWA 1I94M 4CHMA 4RF0A 4NSWA 3D8DA 4I4LA 3SAUA 4G4RA 2VQEM 5JHGA 1U5FA 5EXSA 1NNJA 4LRSA 2J59M 4RF1A 3BJIA 1NTYA 1MPHA 3VK7A 4QOZC 4JI3M 1X11A 1BTKA 1KSFX 4GMVA 2P5TA 2OQ4A 1OMWA 2VRWB 1D2NA 1GG3A 3A8PA 4DV3M 1PM5A 4WURA 1EAZA 3U6PA 3HU1A 3JR5A 3AU4A 3SO6A 4BBKA 3M6AA 4P7IA 1TH3A 3WHLA 1E9SA 2LULA 2L6OA 3F5RA 5DIFB 2W82A 1TH4A 4LCBA 3SHFA 1P6SA 2KXEA 4LJ9A 1L8QA 1HNXM 4FWDA 1GVNA 4ITQA 2I1JA 4KHBB 3V5WA 2QKMA 2M5ZA 2EMTA 1ORYB 3U7DA 4HB0B 3TWLA 3ILKA 3FD9A 4PT5A 2W2WA 1MX0A 1AQCA 2H7EA 4IOYX 5HE0A 4JXJA 4IBKA 5HE1A 2CV0A 4B3RM 4Z2MB 2V76A 4AQYM 2UUCM 1DDVA 3HJ8A 5IREB 4B08A 3U61B 2D7EA 5FLXS 1N32M 5J3YA 3X23A 3ZDTA 5KCVA 4MY6A 3U60A 1PMSA 2V1CA 3HQCA 4IJFA 4DR1M 2R45A 1N33M 1IM2A 5KQDA 3SYXA 3AOEA 4LJAA 4RNAA 1SGHA 2I5FA 1N3HA 2DVWB 4G4OA 5EP4A 4G6ZA 5FTMA 2CHGA 1L1ZA 3P6AA 2Z0QA 1NSFA 3DZDA 2UUBM 3DXCA 4EKUA 3TCAA 2CUZA 5DNYA 3ZH9B 4M9SA 1KFVA 3ODOA 3SC3A 3PVWA 1XNQM 3FUTA 4D0NB 1V5MA 1X05A 3FTEA 1QQWA 4A6KA 3U6DA 1XWIA 3EIHA 1R6BX 1NY5A 3KZ1A 3CF2A 4DR5M 4OU7A 2QKLA 4LGYA 3QWMA 2R18A 2XFSA 5E6JA 4DR7M 2L1CA 3GPPA 3M1IB 4DR3M 2UUAM 4GKJM 1H4RA 2N0YA 3C58A 2EUCA 2KZUA 2UU9M 4L6EA 5D3YA 5EFXA 5JHHA 4I8OA 3GRVA 2ZM6M 1X37A 1N36M 4TYZA 4M0DA 1QQGA 5ITYA 3PSCA 2XGNA 1UNQA 5F3WA 3RE8A 2RUKB 1IXZA 1NHWC 4HL4A 1XMQM 1R2YA 1GKIA 2G8LA 2XF3A 1PLSA 2ZPYA 4JI0M 3PVUA 5CLQB 3LJUX 3GQ5A 5D3VA 4IBFA 4WJ7A 3G9WA 1NJFA 2XSZD 3L28A 2QP9X 3CIKA 1HNZM 3KFUG 1HT1E 4GH9A 4G4NA 1DROA 1ZSQA 4MK0A 3SYLA 3J7BA 4GHAA 4PDGA 1TDZA 2I5CA 3KSYA 5C5BA 3U5ZA 4LJ5A 5EP2A 1MIXA 4HAXB 4AKIA 5C6RA 1JQJC 2R62A 2DZOB 4QHSA 4FCVA 3TWKA 3DA1A 4LF9M 1J0WA 3K92A 4JV5M 1OQNA 3PG7A 1G41A 2R46A 2Q13A 2RVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DI9 B;  1QC6 A;  3CXB B;  1NI2 A;  5KQ4 A;  1FHX A;  2K00 A;  3OAN A;  5C5B B;  1RRP B;  4PQ0 A;  3N7C A;  4ZRK A;  1B55 A;  1UNR A;  3A8Q A;  3KRX A;  2CAY A;  1FHW A;  2VSZ A;  2DYN A;  2P0D A;  5JP4 A;  4IFS A;  2CY4 A;  5C16 A;  4K2O A;  2D9Y A;  2DA0 A;  1MIZ B;  4NY0 A;  2H7D A;  3SUZ A;  1V89 A;  1TQZ A;  1MK9 B;  1LW3 A;  2J0K A;  1WG7 A;  1ISN A;  1X1F A;  4ZRI A;  1V61 A;  4CHJ A;  1WGU A;  2UZS A;  5D27 A;  1EVH A;  4HB4 B;  2DX5 A;  2G35 A;  3NSU A;  2GCL A;  3AU5 A;  4A6H A;  2KUP A;  4GN1 A;  2DKQ A;  2IFS A;  2LOZ A;  2ROZ B;  4XWX A;  1BWN A;  3SV1 A;  2MDX A;  3P7Z A;  1UEF A;  2YVC A;  3VOQ A;  5HE2 A;  3VIA A;  2LYD A;  4EMO A;  1KI1 B;  5D3W A;  1I2H A;  1TXD A;  2YS3 A;  3TW1 A;  1ZC4 B;  2R0D A;  2GCJ A;  2D9Z A;  4WVF B;  3KRW A;  4C0A A;  1MK7 B;  2MKR A;  1XD4 A;  5DH9 B;  2IYB A;  2YT0 A;  4DX9 0;  1W1G A;  2DFK A;  2D2Q A;  3GYP A;  2Z0O A;  4EJN A;  3PEG A;  2DHI A;  1KZG A;  3HW2 B;  2COF A;  2OQB A;  2YS1 A;  4HDO A;  4A5K A;  5DHF B;  2ADZ A;  3MPX A;  2COC A;  2KGX B;  5J3Q A;  3A98 B;  2ELA A;  1P3R A;  1BTN A;  1XOD A;  4A6F A;  3ULC A;  1X1G A;  2DYQ A;  3UZT A;  2N23 A;  1WVH A;  3PP2 A;  3T06 A;  4YL8 A;  2AEH A;  4A6F B;  1E5W A;  4F7H A;  2RGN B;  5GOW B;  1I7A A;  4TKN A;  5KQ1 A;  2RNR B;  1K5D B;  3ODX A;  3HK0 A;  2JP2 A;  2Z0P A;  3PZD A;  4HAV B;  2UVM A;  2Y8F A;  1U27 A;  1U5D A;  4K2P A;  2NZ8 B;  1FGY A;  1V5P A;  4YON A;  2LKO A;  1WGQ A;  2K2U A;  1ZM0 A;  1Q67 A;  2R09 A;  4ZRJ A;  1M7E A;  4HAZ B;  1LB1 A;  2DX1 A;  2XQN M;  1FGZ A;  4K81 A;  1NU2 A;  2M38 A;  1X86 A;  4HAY B;  4HB3 B;  5HE3 A;  1ZC3 B;  2HE7 A;  4Y94 A;  4IAP A;  3AJ4 A;  2BCJ A;  3PVL A;  3D8E A;  3F0W A;  2OTX A;  3DXD A;  2COA A;  2YT1 A;  3IVF A;  1WJM A;  1DDM A;  2HTH B;  3MDB C;  2DHK A;  4MT7 A;  1Z87 A;  2LOX A;  2GJY A;  2I1K A;  2NMB A;  3GYO A;  1W1D A;  1H10 A;  1BAK A;  2L2I A;  2LG1 A;  2W2X C;  1AWE A;  2Y7B A;  2VKI A;  4GZU A;  2DLW A;  1M7R A;  2CY5 A;  3BIN A;  3DXE A;  2RLO A;  2YRY A;  1UPQ A;  5DHA B;  3ULB A;  3WA0 A;  1Y19 B;  2EMS A;  2UZR A;  4DX8 A;  1U2B A;  2P0H A;  4HAW B;  3SNH A;  5CLL B;  1FB8 A;  4B6H A;  2ROV A;  2D9X A;  1V88 A;  1OY2 A;  2EC1 A;  1WI1 A;  2K2J A;  2AL6 A;  2M14 A;  3FSS A;  1DYN A;  3QBV B;  1FHO A;  1XCG A;  3ML4 A;  2MWN B;  3RCP A;  1KZ7 A;  1UPR A;  2DHJ A;  1SHC A;  1GC7 A;  2FJL A;  5J3T A;  3KY9 A;  3FEH A;  4GXB A;  2X18 A;  1J19 A;  2ELB A;  1MKE A;  2E2X A;  2D9W A;  2J0M A;  3WYF B;  4HAU B;  2W2X D;  4DBB A;  1FOE A;  2COD A;  2J0J A;  5D3X A;  1U5E A;  1GC6 A;  1Y5O A;  3QIJ A;  2Y8G A;  4K17 A;  2PZ1 A;  2D11 A;  1XKE A;  3D8F A;  1V5U A;  4HAT B;  1FAO A;  4H8S A;  2P0F A;  5FI1 A;  4Z2N A;  3ODW A;  1MAI A;  1W1H A;  4KAX B;  3TVV A;  1RJ2 A;  4CYE A;  1EGX A;  5JLJ B;  1NTV A;  2D4Q A;  3FM8 C;  5C79 A;  4F7G A;  1WJ1 A;  3U8Z A;  4KVG B;  4HB2 B;  4F7U P;  2KCJ A;  2RSG A;  1U29 A;  2CRF A;  2D9V A;  1DRO A;  2W2W A;  1PFJ A;  2EJ8 A;  2MFQ A;  1XR0 B;  1EF1 A;  4DXA B;  4PNK A;  1P5T A;  2P8V A;  4GPT B;  1TJ6 A;  4HHV A;  2YS5 A;  3ZVR A;  4KHO A;  5FI0 A;  2DTC A;  1U5G A;  2DN6 A;  1K5G B;  2DKP A;  1ZVR A;  5LON B;  4HDQ A;  3O96 A;  4WSF A;  2GS0 A;  4KHA A;  4GMX B;  1DBH A;  5LOP B;  3TFM A;  2YSZ A;  2YF0 A;  1IRS A;  3TO1 A;  1XX0 A;  2D10 A;  1UNP A;  4CHM A;  1DDW A;  4NSW A;  3D8D A;  5JHG A;  1U5F A;  2J59 M;  3BJI A;  1NTY A;  1MPH A;  1X11 A;  1BTK A;  4GMV A;  1OMW A;  2VRW B;  3A8P A;  1GG3 A;  3DXC A;  3AU4 A;  5J3Y A;  1EAZ A;  5L81 A;  4BBK A;  3SO6 A;  4P7I A;  2LUL A;  3F5R A;  5DIF B;  1P6S A;  2I1J A;  4KHB B;  3V5W A;  2QKM A;  2EMT A;  3U7D A;  4HB0 B;  1AQC A;  4IOY X;  2H7E A;  5HE0 A;  5HE1 A;  4Z2M B;  2V76 A;  1DDV A;  3X23 A;  5KCV A;  3ZDT A;  4MY6 A;  1PMS A;  3HQC A;  3SYX A;  1SGH A;  2I5F A;  1N3H A;  3P6A A;  2Z0Q A;  4EKU A;  3TCA A;  3ODO A;  3PVW A;  4D0N B;  1V5M A;  1X05 A;  4A6K A;  3KZ1 A;  2QKL A;  3QWM A;  2L1C A;  3M1I B;  2N0Y A;  1H4R A;  4L6E A;  5D3Y A;  5JHH A;  5EFX A;  4TYZ A;  1QQG A;  3PSC A;  1UNQ A;  2RUK B;  2ZPY A;  3PVU A;  1PLS A;  5CLQ B;  5D3V A;  3LJU X;  4WJ7 A;  3G9W A;  3CIK A;  1ZSQ A;  4MK0 A;  2I5C A;  3KSY A;  5C5B A;  1MIX A;  4HAX B;  5C6R A;  1J0W A;  3PG7 A;  1OQN A;  2Q13 A;  2RVB B; 
#chains in the Genus database with same CATH topology
 1VG5 A;  1R7R A;  1UFZ A;  1YE9 A;  2CHV A;  3OAN A;  4PQ0 A;  1UNR A;  5EXX A;  3KRX A;  2BWB A;  1FHW A;  2VSZ A;  2BJW A;  2P0D A;  3A58 A;  4QHT A;  5C16 A;  5EJC A;  3A45 A;  3KVW A;  2C96 A;  4F2L A;  2DKL A;  2GQF A;  2C9C A;  4CSQ A;  1V89 A;  1TQZ A;  3R9X B;  1LW3 A;  4B7G A;  1NHG C;  5KPZ A;  5LMU M;  1WG7 A;  1AIP C;  1SG9 A;  1CUK A;  1V61 A;  1WGU A;  1NJG A;  5M4Y B;  4L16 A;  1EVH A;  2Z13 A;  3NSU A;  2GCL A;  4A6H A;  2BNK A;  2F5Q A;  4LF6 M;  1HQC A;  1N34 M;  5D3W A;  2JZ0 A;  4JI6 M;  1R2Z A;  1SXJ A;  2R0D A;  3AOG A;  4FVM A;  2C99 A;  4C0A A;  2E5L M;  1AUA A;  2H1R A;  4QJ4 B;  4Z8X A;  2DWL A;  3AV0 A;  3GLH B;  1TH2 A;  2XFT A;  3KOX E;  2D2Q A;  4AKG A;  1WHC A;  2Z0O A;  5C18 A;  4HDO A;  5DHF B;  4NC6 A;  3MPX A;  4FWH A;  1OFH A;  2COC A;  2KGX B;  1W5T A;  1BTN A;  1XOD A;  3ZC7 B;  1IN7 A;  1ZMW A;  3ULC A;  3RFW A;  2LHG A;  2DYQ A;  3T1H M;  1GL7 A;  1WVH A;  4YL8 A;  2AEH A;  3LVV A;  4IBE A;  1XB2 B;  1XXH A;  1QAQ A;  2RGN B;  5GOW B;  1IBL M;  2RNR B;  2CV1 A;  3HHY A;  2RRU A;  4L8R C;  1IXR C;  2KRU A;  3GLF A;  2JP2 A;  2L2D A;  2QQ8 A;  3NWL A;  2Z4S A;  4OX9 M;  3B7Q A;  5BPV A;  3E4R A;  1Z6T A;  1V5P A;  2FFJ A;  1VQ1 A;  2K2U A;  4FW9 A;  4PD2 A;  2KA6 B;  3DOA A;  4LZZ A;  4ZRJ A;  1HJP A;  2RRF A;  4FD2 A;  1FGZ A;  2L4F A;  2R0I A;  3GPY A;  2LNH C;  4MGI E;  3FUU A;  5E26 A;  1NU2 A;  4DBG B;  1X86 A;  4DR4 M;  1J09 A;  2F5S A;  2BCJ A;  5LMN M;  4B7H A;  2HAK A;  4IBD A;  4X62 M;  1MI1 A;  3VDU A;  4LGM A;  4D81 A;  2QCU A;  2OTX A;  3DXD A;  5EXT A;  4BLC A;  1T6O A;  3MDB C;  4WW0 A;  2LVO C;  2GJY A;  2I1K A;  3L25 A;  3J27 B;  2NMB A;  1E94 E;  1GL6 A;  2KRK A;  5DYG A;  3GLH E;  3KSX A;  1XHB A;  3GLG A;  2R65 A;  2O25 A;  1UPQ A;  2KIE A;  5DHA B;  2RKO A;  3ULB A;  3WA0 A;  2QNJ A;  2UZR A;  4DX8 A;  4HAW B;  2EA0 A;  1SXJ D;  4B7F A;  2EC1 A;  1WI1 A;  4QNR A;  1PJQ A;  4Z6Y A;  2M14 A;  3W68 A;  4OSN A;  2LVN C;  1XCG A;  3GLI A;  3V76 A;  3HHX A;  5EP1 A;  2DHJ A;  2ZAN A;  3UJN A;  1SHC A;  3WHK A;  5J3T A;  3FEH A;  3K8Z A;  4AZF A;  4DV5 M;  2DXI A;  2ELB A;  1WR1 B;  2XLJ A;  2J0M A;  4EIW A;  2HCB A;  4LF4 M;  4HAU B;  4DBB A;  3DFZ A;  1Z5A A;  5JI3 E;  3NBX X;  1J7K A;  2X49 A;  5D3X A;  1U5E A;  2VDB B;  3QIJ A;  3T15 A;  4S12 A;  5JI2 E;  3E46 A;  2DAG A;  2P0F A;  5FI1 A;  4Z2N A;  2OPF A;  3U6E A;  4CYE A;  3HU3 A;  3AKZ A;  4F7G A;  3U8Z A;  8CAT A;  2XZF A;  1IXS B;  2KHH A;  2CFO A;  3U6O A;  2FS1 A;  1K3X A;  1XR0 B;  1GJT A;  4DXA B;  4PNK A;  1P5T A;  3K2L A;  4JI4 M;  3T1Y M;  2ZKM X;  4L1R A;  3TWM A;  3SFZ A;  1UM8 A;  4MM3 B;  2ZAO A;  4HHV A;  2Z4D A;  4NSR A;  3SHG B;  5FI0 A;  2JA2 A;  1U5G A;  2DKP A;  3U6L A;  4HDQ A;  3FTF A;  3O96 A;  2GS0 A;  1IBM M;  1GAB A;  2DZN B;  3TFM A;  1QZE A;  3PXG A;  3M0E A;  1DGF A;  4LF8 M;  3SYK A;  4XBO A;  1S3S A;  1NVM A;  2DWN A;  3K9P A;  4I4L A;  3HY5 A;  2EJS A;  2JUJ A;  2R6F A;  1NTY A;  2DAK A;  1MPH A;  2OQ4 A;  3A8P A;  3AU4 A;  4DV3 M;  3JR5 A;  1TH3 A;  2W82 A;  4FWD A;  2I1J A;  2QKM A;  2K6B A;  4HB0 B;  4JXJ A;  2CV0 A;  4Z2M B;  2V76 A;  4AQY M;  1DDV A;  3HJ8 A;  5IRE B;  4MY6 A;  3U60 A;  1PMS A;  2R45 A;  3SYX A;  2K49 A;  3NW8 A;  1N3H A;  2WSC F;  5EP4 A;  3FVC A;  3P6A A;  2Z0Q A;  3DZD A;  1IFY A;  4M9S A;  1KFV A;  2DAE A;  1QDR A;  1QQW A;  3U6D A;  3EIH A;  1R6B X;  2GUM A;  2JY6 B;  4DR5 M;  2XFS A;  4L6E A;  5EFX A;  4I8O A;  2ZM6 M;  3HSA A;  3RE8 A;  2RUK B;  1NHW C;  2G8L A;  1PLS A;  3LJU X;  2JY8 A;  1ZSQ A;  4QJ5 B;  4PDG A;  2LTU A;  5EP2 A;  1JQJ C;  3F92 A;  4QHS A;  2JZ1 A;  3DA1 A;  1G41 A;  1QC6 A;  3CXB B;  1NI2 A;  3HZJ A;  5KQ4 A;  4IBI A;  2K00 A;  2I7N A;  5C5B B;  3U5Z B;  1RRP B;  4ZRK A;  1B55 A;  1QDT A;  3A8Q A;  1VDL A;  2CAY A;  1QAM A;  2Z3X A;  2EO2 A;  2KNZ A;  5JP4 A;  4GHL A;  1K82 A;  1D0K A;  2D9Y A;  2H7D A;  2CHQ A;  3PNY A;  1TDH A;  1X1F A;  4D80 A;  3H4M A;  5D27 A;  3IHP A;  1D0M A;  1Y8G A;  2G35 A;  1G4A E;  2DKQ A;  4XWX A;  1OKS A;  3KS8 A;  1JR3 E;  4GMQ A;  1UEF A;  3I04 M;  2FJU B;  2YVC A;  4DV0 M;  3VOQ A;  4CIZ A;  3VIA A;  1KYI A;  5KQ8 A;  4NL4 H;  4BBA A;  1ZC4 B;  4W5W A;  3QWL A;  3GLH A;  2D9Z A;  1ZQ9 A;  2K8E A;  1ZMV A;  5ITT A;  4I81 A;  1L2D A;  2IYB A;  2LH0 A;  4DX9 0;  3HGI A;  1J5E M;  5H37 D;  3GYP A;  4EJN A;  2LVQ D;  1Z5B A;  1DGB A;  2DHI A;  4GRI A;  2COF A;  2A5Y B;  1K3W A;  2NQ8 C;  3U60 B;  3ZQJ A;  1P3R A;  4G3O A;  5IZ7 D;  2MH8 A;  3SAT A;  2DHR A;  2F5P A;  3PNV A;  2VQF M;  3I4Y A;  1GJS A;  3AL0 C;  3H4J A;  1YUB A;  1I7A A;  5KQ1 A;  3HK0 A;  4AKH A;  4KOD A;  2Z0P A;  3PZD A;  4BB9 A;  2NZ8 B;  1FGY A;  4OW0 A;  3E21 A;  5ITR A;  4YON A;  1WGQ A;  1NO1 A;  3SAR A;  1ZM0 A;  1OFI A;  2AHM A;  3L29 A;  4JI5 M;  2DX1 A;  1E9R A;  3LCV B;  4GNK B;  1ZMU A;  1PRB A;  2FE8 A;  1Z59 A;  4HAY B;  3C3D A;  5HE3 A;  5FTN A;  1W5S A;  3AJ4 A;  3PVL A;  2UXC M;  3LQR A;  1OIP A;  1H6U A;  2CWB A;  2CEA A;  3F0W A;  2DWZ B;  3U6C A;  2COA A;  1DDM A;  5BR8 M;  2DHK A;  4MT7 A;  2KIG A;  5EXP A;  2Y0Q A;  3UK6 A;  2LVA A;  3D8L A;  2L2I A;  2LG1 A;  1R5L A;  4GZU A;  2DLW A;  2CY5 A;  5A2Q S;  3B9P A;  3L27 A;  5EP3 A;  2RLO A;  2YRY A;  4LRT A;  4A3V B;  2EMS A;  3QAU A;  2J5Y A;  5CLL B;  3U6M A;  1FB8 A;  2ROV A;  3GQ3 A;  1TF0 B;  2D9X A;  4JI2 M;  3T38 A;  3B77 A;  4KHP M;  3U61 A;  2AL6 A;  1G3I A;  4MGK E;  2DWM A;  2L7I A;  4JI8 M;  1HQY E;  2CV2 A;  4FCT A;  1HNW M;  1GC7 A;  2FJL A;  1IY0 A;  1TR8 A;  3TQS A;  3FKE A;  1QZM A;  3Q8G A;  5EQT A;  2Y0T A;  3KP1 E;  1L1T A;  1MKE A;  3MHV C;  2R4J A;  5GKN A;  4IIW A;  1DO0 A;  1N78 A;  3WYF B;  1XMO M;  1FOE A;  2COD A;  1OTR A;  4LJ4 A;  3CTW B;  1GC6 A;  2Z7J A;  1XKE A;  3EIE A;  3D8F A;  1IY1 A;  2QPA A;  2F4V M;  4HAT B;  3GRR A;  3M7G A;  1IXS A;  4OVZ B;  4ANR A;  1EGX A;  1NTV A;  3GP1 A;  2D4Q A;  1IBK M;  3B7Z A;  5C79 A;  4GC5 A;  4YHH M;  4AI6 A;  1WJ1 A;  3B7N A;  4F7U P;  1WGN A;  2CRF A;  1WGL A;  1U29 A;  4R71 A;  1PFJ A;  2EJ8 A;  2MFQ A;  1I4W A;  5IRS A;  1SXJ C;  1OQY A;  2FOI C;  4GPT B;  2APL A;  3MJ5 A;  3HIE A;  2DN6 A;  2LVP C;  1K5G B;  5KO3 A;  2ZBK B;  2CE7 A;  5LON B;  4WSF A;  4K0K M;  4P16 A;  1PJI A;  2Q2E B;  2YSZ A;  1NNU C;  1IRS A;  3IEC A;  1V34 A;  3TE6 A;  1L2C A;  2Z4R A;  1T43 A;  1N77 A;  4LJ8 A;  4CHM A;  4NSW A;  5JHG A;  1NNJ A;  4LRS A;  3HX3 A;  1X11 A;  5J3Y A;  1PM5 A;  3M6A A;  4P7I A;  1E9S A;  3F5R A;  5DIF B;  4LCB A;  4LJ9 A;  1L8Q A;  2ZTD A;  2M5Z A;  3U7D A;  3FD9 A;  1AQC A;  3U61 B;  1N32 M;  3ZDT A;  1QUS A;  1IM2 A;  3AOE A;  4LJA A;  4RNA A;  2I5F A;  4G4O A;  4G6Z A;  2CHG A;  4EKU A;  5DNY A;  1V5M A;  1NY5 A;  4LGY A;  2R18 A;  5E6J A;  4DR7 M;  3M1I B;  4DR3 M;  2N0Y A;  2EUC A;  2KZU A;  2UU9 M;  5JHH A;  1YLA A;  4M0D A;  1UNQ A;  5F3W A;  1IXZ A;  2XF3 A;  4JI0 M;  4IBF A;  4WJ7 A;  3G9W A;  3L28 A;  2QP9 X;  3KFU G;  1HT1 E;  2MR9 A;  4G4N A;  4MK0 A;  3SYL A;  5C5B A;  3U5Z A;  5C6R A;  3TWK A;  2R46 A;  2WSE F;  2DNA A;  4OT1 A;  4M9Z A;  3AJI B;  3R8F A;  4B3M M;  4L6V 6;  4DR2 M;  1QYR A;  2DYN A;  4IFS A;  4LJ7 A;  2QBY B;  1MIZ B;  4FCW A;  2R44 A;  3SUZ A;  3VLF B;  1ZYI A;  1MK9 B;  2J0K A;  4NXN M;  2M60 A;  2JXN A;  2OOB A;  3HU2 A;  4CHJ A;  3AOE C;  4IBJ A;  4HB4 B;  2DX5 A;  1PGY A;  2J7O A;  1FNN A;  4TUW A;  2IFS A;  2LOZ A;  2ROZ B;  3VKG A;  3SV1 A;  1T3T A;  3HJS A;  1BVS A;  1T77 A;  4EMO A;  4NRV A;  1TXD A;  2YS3 A;  2EKK A;  1FJG M;  2K47 A;  1DO2 A;  3I4V A;  3KRW A;  1MU5 A;  1XD4 A;  1C7Y A;  4NRW A;  2JY5 A;  2WZJ A;  2ZAM A;  2DFK A;  4AG6 A;  2XH9 A;  3PEG A;  4UN2 B;  1KZG A;  2OQB A;  4A5K A;  5FSW A;  1L2B A;  2D7G A;  2X4A A;  3UZT A;  3ZCB B;  3PP2 A;  3IG8 A;  3T06 A;  1XXH E;  2VF7 A;  5KPT A;  1N75 A;  4A6F B;  3FYC A;  3A42 A;  1RU3 A;  3GLF E;  3W67 A;  3OHM B;  2NBV A;  4P17 A;  2YT2 A;  3ODX A;  3I51 A;  2UVM A;  1U5D A;  4QOS A;  2LKO A;  2DZL A;  5IT9 S;  2XEP A;  3GPU A;  3VKH A;  3MK6 A;  1ZV1 A;  4HAZ B;  2I7P A;  4DV2 M;  3AFH A;  4DV6 M;  1G8P A;  4X65 M;  2KW0 A;  2M38 A;  4Y94 A;  1NV8 A;  5C1B A;  3C9P A;  5DFL A;  3JR4 A;  1WJ7 A;  3SAV A;  3FYD A;  2V6Z M;  3D8E A;  4KO8 A;  2RGH A;  1Q02 A;  4GOU A;  2HTH B;  4DV4 M;  2LOX A;  1HT2 E;  3GYO A;  5ITX E;  1W1D A;  4XGI A;  1H10 A;  4PCZ A;  2JWS A;  3TL4 X;  5ITU A;  1AWE A;  4LFC M;  1Q3C A;  1EIJ A;  1Y19 B;  1C1K A;  3LCU A;  4X66 M;  1DGH B;  3U12 A;  2K0B X;  3SMS A;  3J2P B;  3SNH A;  1HR0 M;  1V88 A;  2HL7 A;  5IWA M;  3FSS A;  2H5X A;  3U6Q A;  2XZU A;  4LF5 M;  3QBV B;  1GLN A;  2Z14 A;  3RCP A;  1UPR A;  2KR0 A;  1DGG A;  3NWF A;  3KY9 A;  2RGO A;  4DV7 M;  4G4Q A;  2X18 A;  4MGH A;  2D9W A;  3FUW A;  3K9O A;  3W0F A;  1VEG A;  1VDD A;  4GC9 A;  4R7G A;  2J0J A;  3GRY A;  1Y5O A;  3LMM A;  2XSZ A;  4OVZ A;  2PZ1 A;  3J80 S;  4B3S M;  1V5U A;  2DHY A;  4M9X A;  1IN5 A;  2ERC A;  2JP7 A;  1YSY A;  3ODW A;  1W1H A;  4KAX B;  4MGY E;  1RJ2 A;  3FTD A;  3OTO M;  3FM8 C;  3KXE C;  3CF0 A;  2J7N A;  4KVG B;  1VEK A;  2KCJ A;  2RSG A;  2D7H A;  3HJQ A;  4AG5 A;  2D9V A;  3KOW E;  2KEB A;  3SAS A;  1IN6 A;  1EF1 A;  2BJV A;  4CIS A;  2JY7 A;  2HHH M;  4NSO B;  2YS5 A;  2F5O A;  3SAW A;  3SMP A;  2YR0 A;  5I2S A;  3HWS A;  4B3T M;  1PJS A;  4MH0 E;  4KHA A;  4GMX B;  2QZ4 A;  1DBH A;  5LOP B;  3RGP A;  2C9O A;  2YF0 A;  3PFI A;  4KLN A;  4LFB M;  3KP0 E;  4IBB A;  2D10 A;  5FTK A;  4JI7 M;  1DDW A;  1I94 M;  4RF0 A;  2WSF F;  3SAU A;  2VQE M;  2QHO B;  1EFU B;  2J59 M;  4RF1 A;  3BJI A;  3VK7 A;  5L8R F;  1BTK A;  2N35 A;  4GMV A;  2P5T A;  2VRW B;  3DXC A;  1D2N A;  1GG3 A;  1LTM A;  4WUR A;  5L81 A;  3HU1 A;  3WHL A;  2LUL A;  2L6O A;  1TH4 A;  3SHF A;  1P6S A;  2JNH A;  2KXE A;  2VF8 A;  1HNX M;  1OAI A;  3QYB A;  4KHB B;  2EMT A;  1ORY B;  3TWL A;  3ILK A;  2H7E A;  2Z8Y M;  5HE1 A;  1WIV A;  4B08 A;  5KCV A;  2D7E A;  5FLX S;  2V1C A;  4IJF A;  4DR1 M;  2FH0 A;  1N33 M;  5KQD A;  3NWA A;  1SGH A;  5FTM A;  1L1Z A;  3TCA A;  3ZH9 B;  3ODO A;  3PVW A;  3FUT A;  1X05 A;  3FTE A;  3KZ1 A;  2L1C A;  3GPP A;  1H4R A;  3C58 A;  1A5T A;  1X37 A;  1N36 M;  1QQG A;  3PSC A;  1XMQ M;  1GKI A;  5CLQ B;  1TTE A;  1R4G A;  2L4E A;  3GQ5 A;  3NWD A;  2DI0 A;  2XSZ D;  3CIK A;  1JB0 F;  3J7B A;  4GHA A;  2I5C A;  2KNV A;  3KSY A;  1MIX A;  4HAX B;  2DZO B;  2R62 A;  4FCV A;  1GO5 A;  1J0W A;  1OAO C;  3K92 A;  4JV5 M;  5DI9 B;  4R3D A;  2V1U A;  1Q3B A;  1FHX A;  1Z5C A;  2DAI A;  3N7C A;  2QBY A;  3SBJ A;  4NXM M;  4LG2 A;  2B3T A;  2CY4 A;  4K2O A;  2DA0 A;  2GNO A;  4X64 M;  4NY0 A;  3FUX A;  1OJL A;  2KZS A;  4AW4 A;  3JAM S;  3I01 M;  1ISN A;  4ZRI A;  1QUT A;  3HHW A;  2UZS A;  3UMM A;  1D0L A;  2ZTC A;  3AU5 A;  2KUP A;  4GN1 A;  1XC8 A;  3A46 A;  1BWN A;  2DEN A;  2MDX A;  2OOA A;  2C5R A;  3P7Z A;  4WP2 A;  4YY3 M;  3LW5 F;  5HE2 A;  3RGS A;  5ITX A;  2LYD A;  1KI1 B;  1JR3 A;  1Q39 A;  2G3Q A;  1I2H A;  3TW1 A;  2GCJ A;  4WVF B;  3BBZ A;  3LVW A;  1MK7 B;  2MKR A;  4DUZ M;  5DH9 B;  4DR6 M;  1SXJ B;  2YT0 A;  2OO9 A;  2CRU A;  1W1G A;  3B74 A;  3THG A;  3KOY E;  3HW2 B;  2YS1 A;  2LWX A;  2ADZ A;  5J3Q A;  3A98 B;  4LZJ A;  2ELA A;  4L4U A;  4A6F A;  1X1G A;  3L26 A;  4LJ6 A;  1QAO A;  2N23 A;  4GIT A;  2KUQ A;  3U6S A;  1E5W A;  4F7H A;  3KOZ E;  3KSJ A;  4CHT B;  1IN8 A;  4TKN A;  2BWE A;  3KS4 A;  5FTJ A;  1K5D B;  3BOS A;  1WXQ A;  4M0W A;  2VII A;  3UZU A;  3C3E A;  4CJ6 A;  3KDS E;  4REZ A;  4HAV B;  1XXH B;  2Y8F A;  1U27 A;  4K2P A;  2QSF X;  3UGJ A;  4PDI A;  3PVS A;  4DIX A;  2YQZ A;  1V92 A;  3GLF B;  3BXW A;  4XK8 F;  1Q67 A;  2R09 A;  1M7E A;  4QJ3 B;  2O5R A;  4HLQ A;  5FTL A;  1TGU A;  1LB1 A;  2XQN M;  5I2M A;  2EKF A;  2DAM A;  3GO8 A;  4K81 A;  2R2Y A;  2MJ5 B;  4JI1 M;  4HB3 B;  1ZC3 B;  2HE7 A;  4IAP A;  3VDP A;  2LHC A;  3FUV A;  1PJJ A;  3FRH A;  2L7H A;  5KPR A;  2YT1 A;  3IVF A;  1WJM A;  3IG5 A;  3E9S A;  1Z87 A;  3D8B A;  2O01 F;  1MN3 A;  4FWG A;  3GPX A;  1BAK A;  4DUY M;  4Y28 F;  2W2X C;  4Q7J A;  1SXJ E;  7CAT A;  2LXE A;  2Y7B A;  4JN6 A;  2VKI A;  2F5N A;  1M7R A;  1DGH A;  3BIN A;  2MGW A;  3DXE A;  3NBI A;  4IJE A;  3W0L B;  3GLG B;  1U2B A;  1JR3 D;  2P0H A;  4RKU F;  2UXD M;  1IQP A;  2Y21 A;  4B6H A;  2K9D A;  2Y20 A;  3Q8X A;  3FE3 A;  2Z59 A;  4I5S A;  5LG4 B;  4ZPX A;  2KNA A;  1OY2 A;  1P3Q Q;  4NOO B;  3HHZ A;  2K2J A;  1DYN A;  3VK8 A;  1FHO A;  3ML4 A;  2MWN B;  1F4I A;  1QVR A;  1KZ7 A;  3GQ4 A;  4LF7 M;  4II7 A;  3J7A S;  3QYE A;  2G5G X;  3HKP A;  2LBC A;  4GXB A;  3TPZ A;  3GLI B;  3CGW A;  1J19 A;  2E2X A;  3DCX A;  4CGY B;  3K1J A;  4LY6 A;  2W2X D;  2YNM D;  1OIZ A;  2Y8G A;  4K17 A;  2D11 A;  5ITQ A;  2YFQ A;  1NY6 A;  1FAO A;  4H8S A;  3J81 S;  1MJG M;  3VFD A;  4QXA B;  1MAI A;  4JYA M;  3TVV A;  5JLJ B;  2UXB M;  4GIP A;  4HB2 B;  3MMP A;  4IBC A;  1EE8 A;  4DV1 M;  3L2A A;  2W2W A;  1DRO A;  1LV7 A;  1G59 A;  2L09 A;  4IBG A;  4KT0 F;  3GRU A;  1PJT A;  2QEN A;  4L15 A;  2P8V A;  1TJ6 A;  1IY2 A;  1XNR M;  4MGZ E;  3T6P A;  3ZVR A;  4KHO A;  2DTC A;  3CF6 E;  1ZVR A;  3LQQ A;  2R4E A;  1IN4 A;  1QAN A;  3KW6 A;  4MB7 A;  3FTC A;  2FNA A;  1E32 A;  2HKJ A;  2X8A A;  1ZAE A;  2C98 A;  4D82 A;  4LFA M;  3GLG E;  3TO1 A;  1XX0 A;  2MRO B;  4L78 A;  5DYI A;  1UNP A;  2CP8 A;  4QNM A;  1V33 A;  4GKK M;  3FRI A;  3D8D A;  4G4R A;  1U5F A;  5EXS A;  4F1I A;  4QOZ C;  4JI3 M;  1KSF X;  4KHB A;  1OMW A;  1EAZ A;  3U6P A;  3SO6 A;  4BBK A;  1VEJ A;  3GLI E;  1GVN A;  4ITQ A;  3V5W A;  4PT5 A;  1MX0 A;  4IOY X;  5HE0 A;  4IBK A;  4B3R M;  2UUC M;  4GEW A;  3X23 A;  3HQC A;  1DV0 A;  2DVW B;  1NSF A;  2UUB M;  2CUZ A;  3SC3 A;  4HSI A;  1XNQ M;  4D0N B;  4A6K A;  1XWI A;  3CF2 A;  4OU7 A;  2QKL A;  1G71 A;  1NV9 A;  3QWM A;  2UUA M;  4GKJ M;  5D3Y A;  3GRV A;  4TYZ A;  5ITY A;  2XGN A;  4HL4 A;  1R2Y A;  2ZPY A;  3PVU A;  5D3V A;  1NJF A;  4HEO A;  1HNZ M;  4GH9 A;  2HWJ A;  3B89 A;  1TDZ A;  4D6W A;  4LJ5 A;  4AKI A;  2KDL A;  4LF9 M;  3PG7 A;  1OQN A;  2Q13 A;  2RVB B; 
#chains in the Genus database with same CATH homology
 5DI9 B;  1QC6 A;  3CXB B;  4R3D A;  2V1U A;  1Q3B A;  1NI2 A;  1R7R A;  1YE9 A;  5KQ4 A;  2CHV A;  1Z5C A;  4IBI A;  2I7N A;  1FHX A;  2K00 A;  3OAN A;  5C5B B;  3U5Z B;  4M9Z A;  1RRP B;  3N7C A;  1B55 A;  3AJI B;  1UNR A;  5EXX A;  4PQ0 A;  4ZRK A;  3R8F A;  3A8Q A;  4B3M M;  2CRF A;  3KRX A;  4DR2 M;  2CAY A;  1FHW A;  1QAM A;  2QBY A;  1QYR A;  2Z3X A;  3SBJ A;  2DYN A;  2VSZ A;  4NXM M;  4LG2 A;  2BJW A;  5L81 A;  2EO2 A;  2P0D A;  5JP4 A;  4GHL A;  4IFS A;  4GN1 A;  2CY4 A;  1K82 A;  4QHT A;  5C16 A;  4LJ7 A;  5EJC A;  4K2O A;  3A45 A;  3KVW A;  2D9Y A;  2DA0 A;  2C96 A;  2QBY B;  4X64 M;  1MIZ B;  4NY0 A;  4FCW A;  3FUX A;  2H7D A;  2C9C A;  3VLF B;  3SUZ A;  1OJL A;  2CHQ A;  1V89 A;  2KZS A;  4AW4 A;  1TQZ A;  3R9X B;  3PNY A;  1MK9 B;  1LW3 A;  4B7G A;  2J0K A;  4NXN M;  3JAM S;  2M60 A;  1NHG C;  5KPZ A;  1TDH A;  5LMU M;  1WG7 A;  1ISN A;  1X1F A;  4ZRI A;  4D80 A;  1V61 A;  3HU2 A;  4CHJ A;  3H4M A;  4WSF A;  3HHW A;  1WGU A;  1NJG A;  2UZS A;  5D27 A;  3AOE C;  4IBJ A;  4L16 A;  3UMM A;  1EVH A;  2DX5 A;  4HB4 B;  2G35 A;  3NSU A;  1G4A E;  2J7O A;  2GCL A;  3AU5 A;  4A5K A;  1FNN A;  2BNK A;  4TUW A;  1XC8 A;  2DKQ A;  3A46 A;  2F5Q A;  2IFS A;  2KUP A;  1BWN A;  2LOZ A;  3KS8 A;  3VKG A;  2ROZ B;  4XWX A;  2MDX A;  3SV1 A;  4EMO A;  4GMQ A;  2C5R A;  1T3T A;  3P7Z A;  1UEF A;  4YY3 M;  4LF6 M;  2YVC A;  4DV0 M;  3VOQ A;  5HE2 A;  1HQC A;  1N34 M;  3HJS A;  3RGS A;  5ITX A;  2LYD A;  1KI1 B;  5D3W A;  1KYI A;  3VIA A;  1JR3 A;  1Q39 A;  1I2H A;  4JI6 M;  5KQ8 A;  4NRV A;  1R2Z A;  1TXD A;  2YS3 A;  3TW1 A;  4NL4 H;  1SXJ A;  4BBA A;  1ZC4 B;  4W5W A;  3AOG A;  3QWL A;  2R0D A;  2GCJ A;  3GLH A;  4FVM A;  2D9Z A;  4WVF B;  1FJG M;  2K47 A;  1DO2 A;  1ZQ9 A;  2C99 A;  3I4V A;  3LVW A;  1MK7 B;  3KRW A;  4C0A A;  2MKR A;  1MU5 A;  4DUZ M;  2E5L M;  2H1R A;  5ITT A;  4DR6 M;  1XD4 A;  5DH9 B;  4I81 A;  4NRW A;  1SXJ B;  4Z8X A;  2DWL A;  1L2D A;  2IYB A;  3AV0 A;  3GLH B;  2LH0 A;  1TH2 A;  2XFT A;  2ZAM A;  2YT0 A;  3KOX E;  4DX9 0;  3HGI A;  1W1G A;  2DFK A;  3THG A;  4AG6 A;  2D2Q A;  1J5E M;  5H37 D;  3GYP A;  3KOY E;  4AKG A;  2XH9 A;  2Z0O A;  5C18 A;  4EJN A;  1Z5B A;  3PEG A;  1DGB A;  1KZG A;  2DHI A;  4GRI A;  2COF A;  2A5Y B;  1K3W A;  2OQB A;  2LWX A;  2YS1 A;  5FSW A;  2ADZ A;  4HDO A;  5DHF B;  3MPX A;  2NQ8 C;  4FWH A;  3U60 B;  1OFH A;  2COC A;  2KGX B;  5J3Q A;  1W5T A;  3A98 B;  4LZJ A;  1L2B A;  1P3R A;  2ELA A;  2D7G A;  4L4U A;  1BTN A;  1XOD A;  4A6F A;  2X4A A;  3ZC7 B;  1IN7 A;  5IZ7 D;  3ULC A;  3RFW A;  1X1G A;  2DYQ A;  3L26 A;  3T1H M;  4LJ6 A;  3SAT A;  1QAO A;  3UZT A;  1GL7 A;  1WVH A;  2DHR A;  3ZCB B;  2F5P A;  2N23 A;  3IG8 A;  3PP2 A;  3T06 A;  4B6H A;  4YL8 A;  4GIT A;  5KPT A;  3PNV A;  3U6S A;  1N75 A;  2AEH A;  4A6F B;  3LVV A;  4IBE A;  1E5W A;  4F7H A;  3FYC A;  3KOZ E;  2VQF M;  3I4Y A;  3A42 A;  3AL0 C;  3KSJ A;  1XXH A;  1QAQ A;  2RGN B;  5GOW B;  1YUB A;  4CHT B;  1I7A A;  1IN8 A;  4TKN A;  1IBL M;  2RNR B;  5KQ1 A;  3KS4 A;  1K5D B;  5FTJ A;  2CV1 A;  3BOS A;  3ODX A;  3HHY A;  4L8R C;  1WXQ A;  4AKH A;  1IXR C;  3HK0 A;  4M0W A;  2KRU A;  3GLF A;  2VII A;  3UZU A;  2JP2 A;  4KOD A;  3KDS E;  2Z0P A;  3I51 A;  4REZ A;  3PZD A;  4HAV B;  1XXH B;  2UVM A;  2Y8F A;  3NWL A;  4BB9 A;  2Z4S A;  1U27 A;  1U5D A;  4OX9 M;  4K2P A;  3UGJ A;  2NZ8 B;  1FGY A;  4OW0 A;  4PDI A;  5BPV A;  4QOS A;  3PVS A;  3E4R A;  2YQZ A;  1Z6T A;  1V5P A;  5ITR A;  3GLF B;  4YON A;  4A6H A;  2LKO A;  1WGQ A;  2FFJ A;  3SAR A;  2K2U A;  4FW9 A;  4PD2 A;  1ZM0 A;  5IT9 S;  2KA6 B;  2XEP A;  1Q67 A;  3DOA A;  4LZZ A;  1OFI A;  3GPU A;  3VKH A;  3MK6 A;  2R09 A;  5LON B;  4ZRJ A;  1M7E A;  2AHM A;  2O5R A;  4HLQ A;  5FTL A;  4HAZ B;  1TGU A;  3L29 A;  4JI5 M;  2I7P A;  4DV2 M;  1LB1 A;  2DX1 A;  4FD2 A;  3AFH A;  4DV6 M;  1FGZ A;  1E9R A;  2XQN M;  1G8P A;  4X65 M;  3GPY A;  2LNH C;  3GO8 A;  4MGI E;  4K81 A;  3FUU A;  2KW0 A;  5E26 A;  1NU2 A;  2FE8 A;  1Z59 A;  2M38 A;  1X86 A;  4DR4 M;  4JI1 M;  4HB3 B;  4HAY B;  1ZC3 B;  5HE3 A;  2HE7 A;  1J09 A;  4Y94 A;  5FTN A;  1W5S A;  4IAP A;  2F5S A;  5C1B A;  3AJ4 A;  2BCJ A;  3PVL A;  5LMN M;  4B7H A;  2UXC M;  3VDP A;  3JR4 A;  3LQR A;  3SAV A;  3FYD A;  2V6Z M;  3D8E A;  1H6U A;  3HW2 B;  4IBD A;  4KO8 A;  2CEA A;  3FUV A;  4X62 M;  1PJJ A;  3F0W A;  2L7H A;  4LGM A;  2DWZ B;  3VDU A;  4D81 A;  2QCU A;  5KPR A;  2OTX A;  3DXD A;  5EXT A;  4BLC A;  3U6C A;  2COA A;  2YT1 A;  2RGH A;  3IVF A;  1WJM A;  1DDM A;  3IG5 A;  5BR8 M;  2HTH B;  4DV4 M;  3MDB C;  2DHK A;  2EJ8 A;  4WW0 A;  3E9S A;  4MT7 A;  1Z87 A;  2LOX A;  2GJY A;  1HT2 E;  3L25 A;  3J27 B;  3D8B A;  2I1K A;  2NMB A;  4HDQ A;  1E94 E;  5EXP A;  5ITX E;  3GYO A;  2Y0Q A;  4FWG A;  1GL6 A;  3UK6 A;  1W1D A;  4XGI A;  3D8L A;  2KRK A;  3GPX A;  1H10 A;  1BAK A;  4PCZ A;  2L2I A;  4DUY M;  2LG1 A;  2W2X C;  1SXJ E;  3TL4 X;  5DYG A;  7CAT A;  2LXE A;  3KSX A;  5ITU A;  2Y7B A;  1AWE A;  4LFC M;  4JN6 A;  2VKI A;  4GZU A;  2F5N A;  2DLW A;  1M7R A;  1DGH A;  1XHB A;  3GLG A;  2CY5 A;  2R65 A;  3BIN A;  1Q3C A;  3DXE A;  5A2Q S;  3B9P A;  3L27 A;  5EP3 A;  2RLO A;  1UPQ A;  2YRY A;  5DHA B;  2RKO A;  3ULB A;  3WA0 A;  4LRT A;  4A3V B;  3NBI A;  1Y19 B;  2EMS A;  1C1K A;  4IJE A;  3W0L B;  4X66 M;  3QAU A;  2UZR A;  1DGH B;  4DX8 A;  3GLG B;  1U2B A;  1JR3 D;  2P0H A;  4HAW B;  3SMS A;  2UXD M;  3J2P B;  3SNH A;  1IQP A;  2EA0 A;  5CLL B;  1SXJ D;  4B7F A;  2Y21 A;  3U6M A;  1HR0 M;  1FB8 A;  2Y20 A;  2ROV A;  3Q8X A;  3GQ3 A;  2D9X A;  4I5S A;  4JI2 M;  4ZPX A;  1V88 A;  1OY2 A;  2HL7 A;  4NOO B;  3T38 A;  2EC1 A;  3HHZ A;  4KHP M;  1WI1 A;  4QNR A;  3U61 A;  4Z6Y A;  2K2J A;  5IWA M;  2AL6 A;  1G3I A;  2M14 A;  3FSS A;  3U6Q A;  1DYN A;  4MGK E;  3VK8 A;  2XZU A;  4LF5 M;  1XCG A;  3QBV B;  1FHO A;  3ML4 A;  3GLI A;  1GLN A;  2DWM A;  2MWN B;  2L7I A;  4JI8 M;  1QVR A;  1KZ7 A;  3RCP A;  1HQY E;  2CV2 A;  1UPR A;  3HHX A;  4FCT A;  5EP1 A;  1HNW M;  2ZAN A;  3UJN A;  3GQ4 A;  1SHC A;  2DHJ A;  4LF7 M;  1GC7 A;  4II7 A;  1DGG A;  3J7A S;  3WHK A;  2FJL A;  2G5G X;  1IY0 A;  3HKP A;  3TQS A;  5J3T A;  3KY9 A;  3FKE A;  3FEH A;  1QZM A;  2RGO A;  4GXB A;  3TPZ A;  4DV7 M;  4G4Q A;  3GLI B;  3K8Z A;  2Y0T A;  5EQT A;  2X18 A;  4MGH A;  3KP1 E;  4AZF A;  4DV5 M;  2DXI A;  1L1T A;  1J19 A;  2ELB A;  1MKE A;  2E2X A;  3MHV C;  4CGY B;  2XLJ A;  4EIW A;  2R4J A;  2D9W A;  2J0M A;  3FUW A;  5GKN A;  4IIW A;  3K1J A;  3W0F A;  1DO0 A;  2HCB A;  4LF4 M;  4LY6 A;  1N78 A;  4HAU B;  1XMO M;  2W2X D;  2YNM D;  3WYF B;  1FOE A;  3DFZ A;  4DBB A;  1Z5A A;  2COD A;  5JI3 E;  1J7K A;  2X49 A;  4LJ4 A;  1VDD A;  4GC9 A;  4R7G A;  2J0J A;  5D3X A;  3CTW B;  1U5E A;  1GC6 A;  3GRY A;  1Y5O A;  3LMM A;  2Z7J A;  3QIJ A;  2Y8G A;  4K17 A;  2XSZ A;  4OVZ A;  2PZ1 A;  3J80 S;  5ITQ A;  2YFQ A;  2D11 A;  1NY6 A;  1XKE A;  3EIE A;  3T15 A;  4B3S M;  3D8F A;  4S12 A;  1IY1 A;  1V5U A;  2QPA A;  2F4V M;  5JI2 E;  4HAT B;  1FAO A;  4H8S A;  4M9X A;  2P0F A;  5FI1 A;  3GRR A;  3J81 S;  4Z2N A;  1IN5 A;  2ERC A;  3M7G A;  3VFD A;  1YSY A;  2OPF A;  4OVZ B;  3U6E A;  3ODW A;  1MAI A;  1W1H A;  4KAX B;  4JYA M;  4MGY E;  3TVV A;  1RJ2 A;  4CYE A;  1EGX A;  5JLJ B;  1NTV A;  3HU3 A;  3GP1 A;  3AKZ A;  2UXB M;  3FTD A;  2D4Q A;  1IBK M;  3OTO M;  3FM8 C;  5C79 A;  4GC5 A;  4YHH M;  4AI6 A;  1WJ1 A;  3KXE C;  4GIP A;  3U8Z A;  3CF0 A;  4F7G A;  2J7N A;  8CAT A;  2XZF A;  4KVG B;  1IXS B;  4HB2 B;  4F7U P;  2KCJ A;  2RSG A;  2CFO A;  1EE8 A;  2D7H A;  3HJQ A;  4IBC A;  4AG5 A;  3L2A A;  4DV1 M;  3U6O A;  1LV7 A;  3KOW E;  1PFJ A;  2D9V A;  1G59 A;  2KEB A;  2L09 A;  3SAS A;  1I4W A;  4IBG A;  1K3X A;  1XR0 B;  2MFQ A;  1IN6 A;  1EF1 A;  3GRU A;  1SXJ C;  4DXA B;  4PNK A;  2BJV A;  2QEN A;  4CIS A;  1P5T A;  2FOI C;  4L15 A;  3K2L A;  4JI4 M;  2P8V A;  4GPT B;  3T1Y M;  2HHH M;  3TWM A;  1TJ6 A;  1IY2 A;  1UM8 A;  4MM3 B;  2ZAO A;  3SFZ A;  1XNR M;  4HHV A;  4NSO B;  4MGZ E;  2YS5 A;  3MJ5 A;  2F5O A;  3ZVR A;  4NSR A;  3SHG B;  4KHO A;  2JA2 A;  3SAW A;  2DTC A;  5FI0 A;  3CF6 E;  1U5G A;  2DN6 A;  1K5G B;  2DKP A;  1ZVR A;  3LQQ A;  2R4E A;  5KO3 A;  3SMP A;  1IN4 A;  2ZBK B;  2CE7 A;  1QAN A;  2YR0 A;  3U6L A;  3KW6 A;  3HWS A;  4B3T M;  3FTF A;  4K0K M;  2GS0 A;  4P16 A;  3O96 A;  1PJI A;  1IBM M;  4MB7 A;  3FTC A;  2FNA A;  2Q2E B;  4MH0 E;  4GMX B;  2QZ4 A;  1E32 A;  2DZN B;  1DBH A;  4KHA A;  2HKJ A;  3RGP A;  2X8A A;  5LOP B;  2C9O A;  1ZAE A;  3TFM A;  2YSZ A;  2YF0 A;  1NNU C;  2C98 A;  1IRS A;  3PXG A;  3M0E A;  1DGF A;  3PFI A;  4LF8 M;  4D82 A;  4LFA M;  3SYK A;  4KLN A;  3TO1 A;  4LFB M;  3KP0 E;  3TE6 A;  1L2C A;  2Z4R A;  4IBB A;  1XX0 A;  4L78 A;  4XBO A;  1S3S A;  1NVM A;  5DYI A;  1N77 A;  1U29 A;  1UNP A;  2D10 A;  2DWN A;  4LJ8 A;  5FTK A;  4QNM A;  4JI7 M;  4GKK M;  1DDW A;  1I94 M;  4CHM A;  4RF0 A;  4NSW A;  3D8D A;  4I4L A;  3SAU A;  4G4R A;  2VQE M;  5JHG A;  1U5F A;  5EXS A;  1NNJ A;  4LRS A;  2J59 M;  4RF1 A;  3BJI A;  1NTY A;  1MPH A;  3VK7 A;  4QOZ C;  4JI3 M;  1X11 A;  1BTK A;  1KSF X;  4GMV A;  2P5T A;  2OQ4 A;  1OMW A;  2VRW B;  1D2N A;  1GG3 A;  3A8P A;  4DV3 M;  1PM5 A;  4WUR A;  1EAZ A;  3U6P A;  3HU1 A;  3JR5 A;  3AU4 A;  3SO6 A;  4BBK A;  3M6A A;  4P7I A;  1TH3 A;  3WHL A;  1E9S A;  2LUL A;  2L6O A;  3F5R A;  5DIF B;  2W82 A;  1TH4 A;  4LCB A;  3SHF A;  1P6S A;  2KXE A;  4LJ9 A;  1L8Q A;  1HNX M;  4FWD A;  1GVN A;  4ITQ A;  2I1J A;  4KHB B;  3V5W A;  2QKM A;  2M5Z A;  2EMT A;  1ORY B;  3U7D A;  4HB0 B;  3TWL A;  3ILK A;  3FD9 A;  4PT5 A;  2W2W A;  1MX0 A;  1AQC A;  2H7E A;  4IOY X;  5HE0 A;  4JXJ A;  4IBK A;  5HE1 A;  2CV0 A;  4B3R M;  4Z2M B;  2V76 A;  4AQY M;  2UUC M;  1DDV A;  3HJ8 A;  5IRE B;  4B08 A;  3U61 B;  2D7E A;  5FLX S;  1N32 M;  5J3Y A;  3X23 A;  3ZDT A;  5KCV A;  4MY6 A;  3U60 A;  1PMS A;  2V1C A;  3HQC A;  4IJF A;  4DR1 M;  2R45 A;  1N33 M;  1IM2 A;  5KQD A;  3SYX A;  3AOE A;  4LJA A;  4RNA A;  1SGH A;  2I5F A;  1N3H A;  2DVW B;  4G4O A;  5EP4 A;  4G6Z A;  5FTM A;  2CHG A;  1L1Z A;  3P6A A;  2Z0Q A;  1NSF A;  3DZD A;  2UUB M;  3DXC A;  4EKU A;  3TCA A;  2CUZ A;  5DNY A;  3ZH9 B;  4M9S A;  1KFV A;  3ODO A;  3SC3 A;  3PVW A;  1XNQ M;  3FUT A;  4D0N B;  1V5M A;  1X05 A;  3FTE A;  1QQW A;  4A6K A;  3U6D A;  1XWI A;  3EIH A;  1R6B X;  1NY5 A;  3KZ1 A;  3CF2 A;  4DR5 M;  4OU7 A;  2QKL A;  4LGY A;  3QWM A;  2R18 A;  2XFS A;  5E6J A;  4DR7 M;  2L1C A;  3GPP A;  3M1I B;  4DR3 M;  2UUA M;  4GKJ M;  1H4R A;  2N0Y A;  3C58 A;  2EUC A;  2KZU A;  2UU9 M;  4L6E A;  5D3Y A;  5EFX A;  5JHH A;  4I8O A;  3GRV A;  2ZM6 M;  1X37 A;  1N36 M;  4TYZ A;  4M0D A;  1QQG A;  5ITY A;  3PSC A;  2XGN A;  1UNQ A;  5F3W A;  3RE8 A;  2RUK B;  1IXZ A;  1NHW C;  4HL4 A;  1XMQ M;  1R2Y A;  1GKI A;  2G8L A;  2XF3 A;  1PLS A;  2ZPY A;  4JI0 M;  3PVU A;  5CLQ B;  3LJU X;  3GQ5 A;  5D3V A;  4IBF A;  4WJ7 A;  3G9W A;  1NJF A;  2XSZ D;  3L28 A;  2QP9 X;  3CIK A;  1HNZ M;  3KFU G;  1HT1 E;  4GH9 A;  4G4N A;  1DRO A;  1ZSQ A;  4MK0 A;  3SYL A;  3J7B A;  4GHA A;  4PDG A;  1TDZ A;  2I5C A;  3KSY A;  5C5B A;  3U5Z A;  4LJ5 A;  5EP2 A;  1MIX A;  4HAX B;  4AKI A;  5C6R A;  1JQJ C;  2R62 A;  2DZO B;  4QHS A;  4FCV A;  3TWK A;  3DA1 A;  4LF9 M;  1J0W A;  3K92 A;  4JV5 M;  1OQN A;  3PG7 A;  1G41 A;  2R46 A;  2Q13 A;  2RVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...