3A98B

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
190
Chain Sequence
SGPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 190
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.920 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a98B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a98B02
5JHHA 2P0HA 4HDOA 1H4RA 2IYBA 1OY2A 4Z2MB 1FAOA 2N0YA 2HTHB 1M7EA 1RJ2A 1SHCA 4MY6A 4ZRIA 1PFJA 1V5PA 1WGUA 3SV1A 1OQNA 3PP2A 2DTCA 4HB2B 4KHBB 1ZVRA 2I5FA 4K2OA 3HQCA 2LKOA 4CHJA 3AU5A 2L2IA 4MK0A 3LJUX 2DKPA 2Z0OA 2G35A 3HK0A 4CHMA 5DHFB 4HAZB 3ML4A 3ODXA 4YL8A 1BTKA 1MIXA 2YSZA 1J19A 2K2UA 1U27A 4A6KA 5C5BA 2MWNB 1X1GA 2D2QA 4F7GA 3ULBA 2J0KA 1GC6A 4EJNA 2ZPYA 2DX1A 5HE2A 2W2WA 2DYQA 4B6HA 1BAKA 1E5WA 3ODWA 2H7EA 4IFSA 2LOZA 1MK7B 1WI1A 2D11A 3F5RA 2DLWA 1P5TA 4YONA 1ISNA 1W1GA 4HATB 1X11A 1KZGA 1Y19B 1K5DB 3D8EA 5CLQB 2MDXA 2K00A 3MDBC 1M7RA 2KGXB 1LW3A 3U7DA 5GOWB 3FEHA 2KCJA 1FB8A 4IOYX 1U5EA 1XCGA 3QWMA 3WYFB 2VSZA 3CXBB 3G9WA 4GZUA 5KQ4A 4DX8A 2HE7A 3TCAA 2ELBA 1DDVA 1EAZA 1U5GA 4K17A 1WVHA 1OMWA 1J0WA 1FHXA 1GC7A 3A98B 2M38A 2CRFA 1DROA 1QQGA 4NY0A 3SYXA 4GMVA 2RNRB 1V5UA 2XQNM 4NSWA 3KSYA 4L6EA 3TVVA 1WJMA 1UNQA 2V76A 2YRYA 1DDMA 2GCJA 1DDWA 2D9YA 2CY5A 1LB1A 4PQ0A 2Z0QA 1GG3A 4EKUA 4DBBA 2W2XC 1PMSA 3PVWA 5FI0A 2D4QA 1NU2A 1DYNA 1P3RA 1U5DA 1WG7A 2CAYA 2COCA 2COAA 2Q13A 3PVLA 2I1KA 2Y8GA 1NI2A 5L81A 2DHKA 4F7UP 1BTNA 1FGZA 2E2XA 1WGQA 3TFMA 2L1CA 1ZSQA 1UNRA 1AQCA 5D3VA 3RCPA 4HB4B 2NMBA 1X1FA 2DHIA 2OQBA 4HAYB 4K81A 5J3QA 5C16A 3AU4A 1XD4A 3A8PA 4HB0B 2YT0A 1BWNA 2ADZA 4KAXB 2Y7BA 3OANA 3T06A 2ROZB 1EF1A 2VKIA 2J59M 4ZRKA 3DXEA 3X23A 4HAXB 2AL6A 2YT1A 1RRPB 2DA0A 2CODA 2D9ZA 5DHAB 2D10A 5J3TA 1FHOA 5C79A 3P7ZA 1I2HA 2W2XD 4H8SA 5C5BB 2EC1A 1FHWA 3F0WA 2DKQA 4F7HA 3V5WA 2R09A 4A6FB 1Z87A 3BINA 2KUPA 3ODOA 4PNKA 3GYOA 3KRWA 1NTYA 1MAIA 5DH9B 3PEGA 2VRWB 5EFXA 2X18A 3DXCA 3WA0A 4P7IA 2N23A 2UZSA 3PVUA 1Q67A 4GN1A 5D3XA 5KQ1A 1V88A 2MFQA 3MPXA 4ZRJA 3ZVRA 2ELAA 2DN6A 1V5MA 1X05A 2J0JA 5JHGA 4MT7A 4HAUB 2PZ1A 2CY4A 1DBHA 2BCJA 3N7CA 3UZTA 1I7AA 3NSUA 2DX5A 2YS5A 2OTXA 4K2PA 2ROVA 2RGNB 1MKEA 2MKRA 2YS1A 4IAPA 3IVFA 2Y8FA 3VIAA 2EMSA 4DX90 1P6SA 2AEHA 4KVGB 2RVBB 1EVHA 1FOEA 1XR0B 1AWEA 2Z0PA 1U29A 2DHJA 2YVCA 4TKNA 1ZM0A 1U2BA 2UZRA 1TQZA 2GCLA 4HAWB 2QKMA 4D0NB 2YS3A 2LG1A 5HE0A 4CYEA 2DFKA 5J3YA 4Z2NA 3PZDA 4HB3B 4KHOA 1MPHA 1ZC3B 4WVFB 3QIJA 2JP2A 2I5CA 2P0DA 5D27A 2K2JA 2RSGA 2R0DA 5C6RA 2P0FA 1UEFA 4GPTB 3O96A 2COFA 2DYNA 3FSSA 3SNHA 1N3HA 2EMTA 2GS0A 1MIZB 2EJ8A 1Y5OA 3QBVB 1ZC4B 1PLSA 2UVMA 2I1JA 5KCVA 3D8FA 3GYPA 2P8VA 1IRSA 3SO6A 3FM8C 5LONB 2RUKB 3HW2B 4HHVA 5D3WA 4WJ7A 4GXBA 4A6FA 2J0MA 1SGHA 3TO1A 3U8ZA 1NTVA 4A6HA 1UPQA 1XKEA 1W1DA 3ULCA 4WSFA 5FI1A 1UNPA 3SUZA 2LYDA 2IFSA 3TW1A 2LOXA 4Y94A 2M14A 5CLLB 2D9XA 4KHAA 4GMXB 1QC6A 2LULA 4C0AA 1KI1B 2D9WA 3P6AA 5D3YA 3BJIA 1H10A 1XODA 1WJ1A 3D8DA 5DIFB 4XWXA 2D9VA 4EMOA 5JP4A 3KY9A 4TYZA 4HAVB 1XX0A 1FGYA 4BBKA 1V89A 2RLOA 1UPRA 1MK9B 2GJYA 4HDQA 1TJ6A 2YF0A 3PSCA 3ZDTA 3VOQA 5HE3A 3PG7A 4A5KA 3KRXA 3CIKA 1V61A 5DI9B 1KZ7A 3AJ4A 2FJLA 1W1HA 1K5GB 3KZ1A 5HE1A 1EGXA 5JLJB 2NZ8B 1X86A 3A8QA 4DXAB 2QKLA 3DXDA 1B55A 3M1IB 5LOPB 2H7DA 1U5FA 1TXDA
chains in the Genus database with same CATH superfamily
2P0HA 1PM5A 3SFZA 3AKZA 3SC3A 1HT2E 2ZAOA 1FAOA 5M4YB 4ZRIA 3DZDA 1RJ2A 1SHCA 1QUSA 2MR9A 4B08A 4XK8F 1IN5A 3PP2A 2JY8A 3T38A 4X66M 4GITA 4K2OA 3BBZA 4PD2A 4CHJA 4DR1M 2M60A 3B89A 5EXPA 1GJSA 3SBJA 2G35A 4DV1M 2YFQA 1NHWC 5DHFB 4II7A 3U6SA 4HAZB 3ODXA 3HX3A 1XMOM 1V34A 4BB9A 1MIXA 3VK8A 1AUAA 2K2UA 3T6PA 1HQYE 1U27A 4A6KA 4MH0E 2QZ4A 3UK6A 2MWNB 2F5SA 2D2QA 3ULBA 1GC6A 4LF6M 5HE2A 4MB7A 2DYQA 1BAKA 1WIVA 2XFTA 5I2MA 2KEBA 2KRUA 3EIHA 3D8BA 1XNQM 1WI1A 3R8FA 4NC6A 1P5TA 2K49A 4YONA 3L26A 3DA1A 3U61A 3LMMA 3J81S 2VDBB 3NWAA 5BPVA 3TE6A 1KZGA 5LMUM 2K00A 2LBCA 3HWSA 4LZZA 1XCGA 3G9WA 2F5QA 2P5TA 4DV7M 4DX8A 1QZMA 3IHPA 3TCAA 2ELBA 1WVHA 3U6QA 1N34M 4Z6YA 5ITYA 2CV2A 4FCVA 7CATA 1QQGA 3SYXA 2UU9M 4GMVA 4NSWA 2V1UA 5EJCA 4CSQA 1D0LA 4X65M 3UMMA 5F3WA 3F92A 2CHVA 4CJ6A 3FKEA 1GO5A 4Z8XA 5FTNA 2Z13A 1QZEA 1E32A 2GCJA 2R4EA 2DKLA 1MJGM 4QNRA 2C9OA 1GG3A 3SMPA 4DBBA 2W2XC 2COCA 1NU2A 1WG7A 2Q13A 2I1KA 2Y8GA 1NVMA 3FUXA 1I94M 1IY2A 4M0DA 2EUCA 2APLA 2WSFF 2XZUA 4LRSA 3LVVA 4AKHA 1AIPC 5C16A 3EIEA 4QXAB 4I4LA 3SARA 2Y7BA 3OANA 3LW5F 1EF1A 2LHGA 4ZRKA 3U6LA 3DXEA 3X23A 1GABA 4JI3M 4QNMA 1TH4A 5J3TA 4G4RA 2ERCA 2LVPC 3P7ZA 1I2HA 1N77A 2EC1A 1FHWA 1D0KA 3KS4A 3V5WA 1IFYA 3UZUA 3GLHE 1HNZM 4QJ3B 4LJ4A 3KRWA 2N35A 4DR5M 3K8ZA 3C3DA 3U6CA 3HJQA 1FJGM 5L8RF 2O01F 1HT1E 2AHMA 2Z59A 5FTJA 1NSFA 1NNUC 2KRKA 2DN6A 1N78A 4GNKB 4PDIA 2YT2A 4HAUB 2CY4A 2HAKA 3W0FA 4DV0M 4QHSA 5EP1A 3UZTA 1NHGC 4JYAM 2OTXA 4K2PA 2RGNB 2Y8FA 4DX90 1JQJC 1TH3A 2XLJA 1XR0B 2VF8A 3CTWB 3A42A 3KOWE 2KNVA 1U2BA 4Y28F 4HAWB 1EE8A 4NSOB 2DHRA 3HHWA 4CYEA 1I4WA 5J3YA 4Z2NA 1ZMVA 2OOAA 4HL4A 3QIJA 4QJ4B 3LCVB 5D27A 2RSGA 1OTRA 3FSSA 1R2YA 3SNHA 2GNOA 4JI6M 2HCBA 2KR0A 1ZQ9A 1QQWA 2D7HA 2EJ8A 4OVZB 1L2CA 5EQTA 2UVMA 3ZH9B 5H37D 2DZNB 1IXSB 4AZFA 3E46A 3W67A 2P8VA 4KO8A 1KFVA 3SO6A 1VEGA 2CHGA 3QAUA 4GXBA 2J0MA 3TO1A 3U60B 2DWZB 3U8ZA 4A6HA 1SXJB 2QBYB 4A3VB 3Q8XA 4DV6M 2LYDA 3L27A 1DO2A 2M14A 5CLLB 2G8LA 4PDGA 2D9XA 2DHYA 3CF0A 1VG5A 3HKPA 2CEAA 3KFUG 4C0AA 1IBLM 1KI1B 3TQSA 4X64M 3KOXE 3KS8A 1H10A 1XODA 1WJ1A 3GLIE 3MK6A 4DR7M 2R18A 3HU3A 4WW0A 5ITRA 4QHTA 1WGNA 4DV3M 5DFLA 3NW8A 4JXJA 1UPRA 4AW4A 4OU7A 4LFCM 2YF0A 4MM3B 4B7HA 3VOQA 2V6ZM 1QUTA 3KRXA 2L09A 4LF4M 4UN2B 2KZUA 5JLJB 4IBDA 2QKLA 2M5ZA 3SHFA 1U5FA 4WURA 4I5SA 4Q7JA 3NWDA 4RF0A 4FVMA 5JI2E 2IYBA 1JR3A 1MU5A 3SYKA 3V76A 4PCZA 1UM8A 2N0YA 2HTHB 4MY6A 4GHAA 3VKHA 1N33M 1V5PA 3GRRA 3RE8A 1PFJA 3SV1A 2JY7A 5E26A 2DTCA 4REZA 1N32M 3PXGA 1TF0B 2R46A 2L2IA 1HR0M 4NRVA 2CE7A 1IY0A 2DKPA 2Z0OA 5DNYA 2Z7JA 4GIPA 3HK0A 2DZOB 4OVZA 4JI8M 1G59A 2E5LM 4IJFA 2LVOC 3TL4X 2KNAA 2DX1A 2DAGA 1YSYA 1HJPA 2H7EA 1SXJA 4YY3M 2QBYA 2OO9A 1G3IA 1Y8GA 2RKOA 3IG5A 2WSCF 1RU3A 4R71A 1X11A 3I4YA 1D2NA 2R65A 3D8EA 3K9PA 3HU2A 1LW3A 3U7DA 5GOWB 4LZJA 2YQZA 1U5EA 3WYFB 1C7YA 2VSZA 3GLFB 2LWXA 4LJ6A 5A2QS 4LJAA 1EAZA 5KQ8A 5LMNM 1U5GA 4L4UA 4K17A 4M9SA 1FHXA 4NXMM 2CRFA 1KYIA 1VDDA 1WGLA 1LTMA 3E9SA 3FTEA 3VDPA 4OSNA 1WJMA 2V76A 3DCXA 3A45A 1C1KA 3HHYA 3LQRA 2C98A 1LB1A 3AOGA 3BXWA 4EKUA 1QANA 1PMSA 3K2LA 3PVWA 4NSRA 1ORYB 1DYNA 3C58A 4CGYB 1R5LA 1XMQM 5KPTA 4L78A 1BTNA 1DV0A 5IWAM 2E2XA 2MGWA 2R2YA 1WGQA 1TTEA 2MROB 3TFMA 4RNAA 1TGUA 2L1CA 2D7GA 1IN8A 1R4GA 1V92A 2CHQA 2ZBKB 3U6EA 1UNRA 1K3XA 1AQCA 3GRYA 3MHVC 2Z14A 1PJIA 1PJTA 4HAYB 3TWKA 1SG9A 1XD4A 3AU4A 4HB0B 3I04M 3R9XB 4S12A 2ADZA 2K47A 4KAXB 2LVAA 4OX9M 2VKIA 3T1YM 4HAXB 3PFIA 2D10A 4JI4M 5C5BB 2F5PA 4AG6A 2K9DA 3J7AS 5ITUA 4KHPM 2DKQA 2V1CA 1XC8A 1Z87A 2MH8A 1R6BX 5C18A 4NXNM 2DNAA 2GUMA 2VRWB 3WA0A 4P7IA 4R3DA 5KQDA 1X37A 1IN4A 4GN1A 5KQ1A 3GLFA 3MPXA 4DBGB 3MJ5A 3AL0C 3ZVRA 2ELAA 5ITQA 4G4OA 2DXIA 1V5MA 3D8LA 2J0JA 5JHGA 2DAEA 4MT7A 1OAOC 1Q3BA 2PZ1A 2XZFA 1DBHA 2BCJA 4GHLA 2CFOA 1MN3A 4DV5M 2EA0A 1E94E 3NSUA 2DX5A 2DENA 5KPZA 2ROVA 3FE3A 4DR2M 1JR3D 2KZSA 1NNJA 2MKRA 2YS1A 2KXEA 4AI6A 3VIAA 2BWBA 2Z3XA 2JP7A 2AEHA 3VFDA 1H6UA 4KVGB 2RGOA 2RVBB 1DGGA 2GQFA 1VEKA 1AWEA 4B3RM 2Z0PA 2DHJA 3THGA 4LJ9A 4TKNA 1ZM0A 3UJNA 3GP1A 4DR4M 4GRIA 2LG1A 2DFKA 1ZC3B 2JP2A 3KDSE 2CV1A 4CISA 2MJ5B 4OT1A 2R0DA 5C6RA 1IXRC 3O96A 2DYNA 1N3HA 1L1ZA 2UXDM 2J7NA 2DWMA 1SXJD 3KW6A 3IECA 4LCBA 4L15A 4MGIE 4MGKE 1XXHB 3D8FA 1ZYIA 3L28A 3Q8GA 2X8AA 2FE8A 4WJ7A 3AJIB 5DYIA 3U6PA 2I7NA 3ULCA 4FWGA 3SMSA 2UUBM 3WHKA 3NBIA 2XEPA 1J09A 2IFSA 3TW1A 5LG4B 1NY6A 5I2SA 4Y94A 2BJVA 1G71A 4KHAA 1PJSA 3SAVA 4B7FA 2G5GX 4JI5M 5BR8M 3HSAA 3P6AA 3J7BA 3GPYA 3BJIA 2EKFA 2JUJA 3D8DA 3GLGB 5DIFB 3J2PB 4FCWA 3KY9A 2H1RA 4LFBM 2R0IA 1OKSA 2L4FA 1FGYA 1CUKA 4K0KM 2RLOA 2XFSA 1MK9B 1HNWM 1TJ6A 1QVRA 2HL7A 4NOOB 3PSCA 5HE3A 4KT0F 3CIKA 2UXCM 4IBEA 1KZ7A 1LV7A 4NRWA 3NWLA 5HE1A 5EP2A 1PJJA 1G8PA 4DXAB 1DGHB 3AOEC 4F1IA 2C5RA 5C1BA 4HDOA 1GJTA 2ZM6M 2WSEF 1OY2A 1IM2A 4Z2MB 3PNYA 4QOZC 8CATA 1M7EA 2JXNA 3SASA 1WGUA 2I7PA 3GO8A 1OQNA 4HB2B 2G3QA 4LGMA 4KHBB 4D6WA 1ZVRA 2I5FA 2Q2EB 1A5TA 3HQCA 2C96A 3AU5A 4LF9M 3UGJA 3LJUX 2L7HA 3ZCBB 1GL6A 4CIZA 4CHMA 3AFHA 4D81A 2CV0A 3IG8A 1NJFA 4DUZM 1J19A 3LCUA 1OAIA 3SYLA 1XXHA 5IREB 3A58A 4F7GA 2J0KA 5ITXA 4EJNA 2ZPYA 2FOIC 4B6HA 1E5WA 4F2LA 4IFSA 2KA6B 3FYCA 2D11A 1L2DA 3F5RA 2LVQD 3GPPA 1N75A 3SAUA 1ISNA 1K3WA 3AV0A 2XSZD 3QWLA 3U5ZB 4HATB 2JY6B 4JI7M 3HY5A 2MDXA 1OIPA 3MDBC 3HHZA 2DWLA 1XNRM 3GLGA 3CXBB 2ZANA 5KQ4A 1Z59A 2HE7A 2KIGA 5IZ7D 4G3OA 1QAQA 3A98B 2ZTDA 3U6MA 1G4AE 4JN6A 4QJ5B 2YR0A 2QENA 2O5RA 4LJ7A 2RNRB 3M6AA 1V5UA 2XQNM 3KSYA 3TVVA 3HIEA 2KUQA 1GLNA 2BJWA 2YRYA 4JI0M 1DDMA 4CHTB 5IRSA 1DGHA 2ZTCA 1T6OA 5FSWA 5EP4A 1WR1B 5IT9S 2D9YA 2Z0QA 1W5TA 1MI1A 1HQCA 1P3RA 2COAA 1QAOA 1Q3CA 1NI2A 2DHKA 3CF2A 3HJSA 4KHBA 1JR3E 4G4QA 3U12A 3NWFA 2A5YB 5D3VA 1DGFA 4HB4B 2OQBA 3T1HM 4PT5A 5J3QA 3RFWA 3A8PA 2CWBA 1BWNA 5E6JA 2R62A 1KSFX 1IXSA 2ROZB 2W82A 3H4JA 4DV4M 2J59M 4D82A 4MGYE 2YT1A 3SHGB 4XGIA 2CODA 4D80A 5DHAB 3U60A 3NBXX 1FHOA 3GPXA 4DR3M 4RF1A 3FRHA 2W2XD 4RKUF 1VDLA 3PNVA 1F4IA 2EJSA 3F0WA 4A6FB 2DAKA 2X4AA 2KUPA 3B7QA 3GYOA 2DZLA 1NTYA 4L6V6 5DH9B 3PEGA 4AG5A 1SXJE 2CUZA 5EFXA 2X18A 4AKGA 5FTKA 4TUWA 2FFJA 3M7GA 5FTMA 1EFUB 2Y0QA 3VLFB 1XB2B 1Q67A 2LHCA 2ZKMX 3K92A 1V88A 3KSJA 2Z8YM 3VK7A 4ZRJA 1IBKM 1GL7A 4IJEA 5FLXS 3TWLA 3HGIA 3QYBA 5DYGA 2C9CA 3N7CA 1I7AA 1DO0A 3HZJA 3TPZA 2BNKA 2DAMA 3MMPA 4GH9A 2VQFM 1IN6A 2EMSA 3B77A 2R44A 3I4VA 3I51A 3SATA 2R45A 3OTOM 1EVHA 1FOEA 4L8RC 3FTCA 4GC9A 1U29A 1L2BA 1WHCA 4BLCA 2UZRA 1TQZA 4BBAA 2QKMA 4D0NB 2JY5A 4KODA 1J7KA 4KHOA 4WVFB 2JWSA 3J80S 2P0DA 3T15A 1N36M 3WHLA 4JI2M 1Z5BA 1UEFA 4GPTB 2HHHM 4GMQA 1TDHA 1VQ1A 5KO3A 3L29A 1MIZB 3E4RA 2FNAA 3QBVB 1ZC4B 2LNHC 4JV5M 3GQ4A 3RGSA 3B7ZA 1IRSA 4G6ZA 3GLHB 3HW2B 4HHVA 1D0MA 3KP1E 3FYDA 4A6FA 3FUWA 1BVSA 1IXZA 3L2AA 1NTVA 3RGPA 3FUTA 1YUBA 5FI1A 3A46A 2JNHA 4B3TM 4IBIA 1V33A 2DVWB 1YE9A 2LULA 2XSZA 2F4VM 1YLAA 2FH0A 2D9VA 1NY5A 2C99A 3PVSA 1P3QQ 4HAVB 3GLFE 2LXEA 5EXSA 1V89A 2GJYA 3GQ5A 2KIEA 4P16A 1VEJA 4IBKA 2QPAA 3ZDTA 3GPUA 3PG7A 2H5XA 4A5KA 1V61A 2X49A 5DI9B 1NJGA 2FJLA 5ITTA 4NL4H 1W1HA 3KZ1A 2QNJA 3A8QA 1IY1A 4ITQA 2H7DA 3FRIA 3C9PA 1MX0A 5JHHA 3KXEC 1H4RA 4I81A 3DFZA 4LG2A 1JB0F 2B3TA 4LF7M 2L4EA 2O25A 3JR5A 3ILKA 4GKJM 1PJQA 1TH2A 1ZMWA 2LKOA 4MK0A 1ZV1A 4M0WA 2BWEA 1NO1A 3K9OA 2UUAM 4DUYM 2HKJA 1XWIA 1QYRA 3ML4A 3CF6E 4YL8A 1BTKA 2Y21A 4GC5A 1WJ7A 2YSZA 5C5BA 1X1GA 1L1TA 1XHBA 2K0BX 3GLHA 2LH0A 3BOSA 2W2WA 3ODWA 2LOZA 2EKKA 2Y20A 2YNMD 1MK7B 3HU1A 1PGYA 3GRUA 1PRBA 2DLWA 2KNZA 2DI0A 3ZQJA 1W1GA 4ZPXA 2Z4RA 2KDLA 1G41A 1Y19B 1K5DB 5CLQB 3GLIB 1IN7A 1M7RA 2KGXB 1ZAEA 2EO2A 4AQYM 3FEHA 4L16A 2KCJA 1FB8A 4IOYX 3QWMA 5EXXA 2DAIA 4GZUA 1R7RA 5JI3E 1DDVA 2VF7A 2R4JA 4LJ5A 4LY6A 1J0WA 1OMWA 2F5NA 3KOYE 1GC7A 3J27B 2M38A 1DROA 4AKIA 4LJ8A 1R2ZA 4NY0A 2Z4DA 2J5YA 3B7NA 2HWJA 3VDUA 2QQ8A 1OIZA 4L6EA 2RGHA 4XBOA 1UNQA 3FD9A 2CP8A 4FWDA 2FJUB 1DDWA 2JZ1A 2CY5A 4PQ0A 1OFIA 3FTDA 4LFAM 2L6OA 5FI0A 1ZMUA 2D4QA 1U5DA 2CAYA 1T3TA 2LTUA 3PVLA 5L81A 1DGBA 4F7UP 4FW9A 3ZC7B 4P17A 1FGZA 3GQ3A 1IBMM 3FVCA 4FD2A 3H4MA 3KSXA 1ZSQA 3RCPA 4IBFA 3KOZE 4MGHA 2NMBA 3U6OA 1X1FA 2DHIA 4K81A 4JI1M 2YT0A 4B7GA 4B3SM 3T06A 4IBCA 3FUVA 1OJLA 4WP2A 3KP0E 4DR6M 4W5WA 2AL6A 2OPFA 1RRPB 2LVNC 2DA0A 2D9ZA 2JA2A 3GRVA 3HJ8A 1Z5AA 4LF8M 3LQQA 5C79A 3I01M 1QDTA 4H8SA 5GKNA 1XXHE 2FS1A 4HEOA 3CGWA 4F7HA 2R09A 5ITXE 3BINA 3ODOA 4PNKA 3AOEA 4IBGA 2JZ0A 1MAIA 4IBBA 2NQ8C 3DXCA 3GLIA 1IQPA 2XGNA 4LF5M 2N23A 2UZSA 3PVUA 1NV9A 2L2DA 1T43A 1TR8A 4I8OA 3FTFA 5D3XA 4LGYA 2MFQA 2QHOB 1X05A 1QAMA 4LRTA 2K8EA 4M9XA 3GLGE 4R7GA 3KVWA 2QSFX 2VIIA 4QOSA 2QCUA 1FNNA 3W68A 2YS5A 3HHXA 4M9ZA 3B9PA 1SXJC 1MKEA 2NBVA 2UUCM 4IAPA 3IVFA 3OHMB 1J5EM 3SAWA 1P6SA 4GKKM 2XH9A 2L7IA 1E9SA 3C3EA 2D7EA 2YVCA 4IBJA 3LVWA 4FWHA 2GCLA 2YS3A 2K6BA 3W0LB 5HE0A 3PZDA 4HB3B 1MPHA 2QP9X 2Y0TA 5KPRA 4B3MM 4G4NA 2I5CA 4OW0A 1Q39A 2K2JA 1W5SA 4DV2M 3FUUA 2P0FA 4KLNA 1T77A 2ZAMA 2COFA 1Z5CA 5FTLA 2EMTA 2CRUA 5EP3A 2GS0A 1E9RA 3JR4A 2UXBM 4FCTA 1WXQA 1Y5OA 1PLSA 2F5OA 2I1JA 4ANRA 5KCVA 3GYPA 4IIWA 3FM8C 4HLQA 5LONB 2RUKB 5D3WA 1K82A 4HSIA 2XF3A 1SGHA 1QDRA 2OQ4A 1UPQA 1OQYA 1XKEA 1W1DA 3U5ZA 4WSFA 1UNPA 3SUZA 4GOUA 3DOAA 2LOXA 3U61B 2RRUA 3L25A 2Z4SA 1GKIA 4GMXB 1QC6A 2KHHA 3TWMA 2D9WA 2DWNA 3QYEA 5EXTA 5D3YA 1TDZA 3M0EA 4MGZE 2WZJA 3K1JA 4XWXA 1Q02A 4X62M 4EMOA 5JP4A 3U6DA 3B74A 2KW0A 3VKGA 2R6FA 4TYZA 4GEWA 1XX0A 4BBKA 3E21A 1OFHA 4HDQA 4DIXA 1GVNA 4EIWA 1Z6TA 3JAMS 4L1RA 1NV8A 2J7OA 3AJ4A 2OOBA 1S3SA 1K5GB 1EGXA 2NZ8B 1L8QA 4YHHM 2RRFA 1X86A 1HNXM 3DXDA 1B55A 1EIJA 2VQEM 3M1IB 5LOPB 1UFZA 1TXDA
chains in the Genus database with same CATH topology
1MX0A 5C1BA 5JHHA 3KXEC 4RF0A 1PM5A 2P0HA 4HDOA 3SFZA 1H4RA 4FVMA 4I81A 5JI2E 3DFZA 4LG2A 2IYBA 3AKZA 1JR3A 2ZM6M 1MU5A 3SC3A 3SYKA 1OY2A 4LF7M 1IM2A 4ZRIA 4Z2MB 3PNYA 1HT2E 2ZAOA 4QOZC 4PCZA 1FAOA 1UM8A 2N0YA 2HTHB 8CATA 3DZDA 3JR5A 4GHAA 3VKHA 1M7EA 1RJ2A 3SASA 1N33M 3ILKA 3GRRA 3RE8A 2I7PA 4B08A 1IN5A 1PFJA 1V5PA 1WGUA 3GO8A 4GKJM 5E26A 3SV1A 1OQNA 3PP2A 1TH2A 2DTCA 4HB2B 4TKNA 4LGMA 3T38A 4X66M 4GITA 4REZA 4KHBB 1ZVRA 1N32M 3PXGA 2Q2EB 2I5FA 4K2OA 4PD2A 3HQCA 2LKOA 2R46A 2C96A 4CHJA 3AU5A 2L2IA 4MK0A 4DR1M 4LF9M 4M0WA 1HR0M 4NRVA 2M60A 2CE7A 3UGJA 5EXPA 1IY0A 5FI0A 3LJUX 2L7HA 2DKPA 2Z0OA 3SBJA 5DNYA 2G35A 2UUAM 3ZCBB 4DUYM 2Z7JA 4GIPA 4DV1M 1GL6A 2HKJA 1XWIA 1NHWC 1QYRA 2YFQA 3HK0A 4CHMA 5DHFB 3AFHA 4D81A 2CV0A 4II7A 2DZOB 3U6SA 4HAZB 3ML4A 3IG8A 3ODXA 3CF6E 4YL8A 1XMOM 1BTKA 1NJFA 2Y21A 4GC5A 4OVZA 4BB9A 4DUZM 1MIXA 2YSZA 1J19A 3VK8A 4JI8M 2K2UA 1HQYE 1MK7B 1U27A 4A6KA 1G59A 4MH0E 3SYLA 1XXHA 5C5BA 2QZ4A 3UK6A 2MWNB 1X1GA 2F5SA 5IREB 1L1TA 4IJFA 2E5LM 2D2QA 1XHBA 3ULBA 4F7GA 2J0KA 1GC6A 5ITXA 3GLHA 3TL4X 4LF6M 4EJNA 2LH0A 2ZPYA 2DX1A 2FOIC 5HE2A 3BOSA 4MB7A 1YSYA 2DYQA 2W2WA 4B6HA 1BAKA 1E5WA 3ODWA 2H7EA 4IFSA 2XFTA 2LOZA 2YNMD 2KA6B 1SXJA 2KEBA 2Y20A 2KRUA 3FYCA 3EIHA 3D8BA 3HU1A 4YY3M 2QBYA 1XNQM 3GRUA 1WI1A 2D11A 1L2DA 3F5RA 3R8FA 1G3IA 3GPPA 1N75A 2DLWA 1P5TA 3SAUA 4YONA 2RKOA 3L26A 1ISNA 3IG5A 1K3WA 3AV0A 4ZPXA 1W1GA 2XSZD 3DA1A 3LMMA 3U61A 3J81S 3QWLA 3U5ZB 4HATB 1X11A 5BPVA 3I4YA 2Z4RA 3TE6A 1KZGA 1D2NA 2R65A 5LMUM 1G41A 1Y19B 1K5DB 3D8EA 4JI7M 5CLQB 3GLIB 2MDXA 1IN7A 2K00A 3MDBC 1M7RA 2KGXB 3HU2A 1LW3A 1ZAEA 5GOWB 3U7DA 3HHZA 2EO2A 3HWSA 4AQYM 2DWLA 4L16A 1XNRM 1FB8A 4LZZA 4LZJA 2KCJA 3FEHA 3GLGA 2YQZA 1U5EA 1XCGA 3QWMA 5EXXA 2VSZA 3CXBB 3G9WA 4IOYX 3WYFB 4GZUA 3GLFB 2F5QA 2ZANA 5KQ4A 2LWXA 2P5TA 4DV7M 4DX8A 4LJ6A 1Z59A 5A2QS 1R7RA 1QZMA 5JI3E 2HE7A 4LJAA 3TCAA 2ELBA 1DDVA 1EAZA 5KQ8A 5LMNM 1U5GA 4L4UA 4K17A 2R4JA 4LJ5A 4LY6A 5IZ7D 4M9SA 2F5NA 1J0WA 1OMWA 3KOYE 3U6QA 1N34M 1QAQA 1FHXA 1GC7A 3J27B 3A98B 5ITYA 4Z6YA 2CV2A 4NXMM 2CRFA 1KYIA 2M38A 1DROA 4FCVA 3U6MA 1G4AE 4JN6A 1VDDA 7CATA 4LJ8A 4AKIA 2YR0A 3E9SA 1R2ZA 2QENA 2O5RA 3FTEA 4LJ7A 2UU9M 1QQGA 4NY0A 3SYXA 4GMVA 3VDPA 2RNRB 3M6AA 1V5UA 3VDUA 2XQNM 4NSWA 3KSYA 2V1UA 4L6EA 5EJCA 3TVVA 2RGHA 4XBOA 4X65M 3UMMA 5F3WA 1WJMA 1UNQA 2V76A 2CHVA 3FKEA 3FD9A 1GLNA 2BJWA 3A45A 1C1KA 3HHYA 4Z8XA 4FWDA 5FTNA 4JI0M 2YRYA 3LQRA 4MY6A 1DDMA 4CHTB 1E32A 1DGHA 2GCJA 2C98A 2R4EA 1DDWA 5FSWA 5EP4A 5IT9S 2D9YA 2CY5A 1LB1A 3AOGA 4PQ0A 1OFIA 2C9OA 4QNRA 1GG3A 2Z0QA 3SMPA 4DBBA 1W5TA 4EKUA 3FTDA 1QANA 2W2XC 4LFAM 1PMSA 3K2LA 2L6OA 3PVWA 4NSRA 1HQCA 1NU2A 1ORYB 1DYNA 1P3RA 3C58A 1U5DA 1WG7A 2CAYA 2COCA 2COAA 4CGYB 1QAOA 2Q13A 1T3TA 3PVLA 1Q3CA 1XMQM 2I1KA 2Y8GA 1NI2A 1NVMA 5L81A 2DHKA 5KPTA 3FUXA 1DGBA 4L78A 4F7UP 4FW9A 3ZC7B 1BTNA 3CF2A 3HJSA 1I94M 1IY2A 5IWAM 1FGZA 2E2XA 1WGQA 3TFMA 3GQ3A 4RNAA 1IBMM 4G4QA 1TGUA 2L1CA 4FD2A 3H4MA 2D7GA 1IN8A 3KSXA 1ZSQA 4M0DA 2EUCA 2CHQA 2ZBKB 2A5YB 3U6EA 1UNRA 1K3XA 1AQCA 5D3VA 3RCPA 3GRYA 3MHVC 4IBFA 1DGFA 4LRSA 3KOZE 4MGHA 2XZUA 2DHJA 4HB4B 1PJIA 3LVVA 2NMBA 3U6OA 4AKHA 1X1FA 2DHIA 2OQBA 3T1HM 4PT5A 4HAYB 3TWKA 4JI1M 3RFWA 4K81A 5C16A 1XD4A 3A8PA 3EIEA 3AU4A 4HB0B 2YT0A 1BWNA 4B7GA 4B3SM 4I4LA 4S12A 5E6JA 3R9XB 2R62A 2ADZA 2K47A 4KAXB 1KSFX 3SARA 4OX9M 2Y7BA 3OANA 4IBCA 2ROZB 3FUVA 3T06A 2W82A 4DV4M 1EF1A 2VKIA 1OJLA 2J59M 4ZRKA 3KP0E 3U6LA 4DR6M 3DXEA 3X23A 4D82A 3T1YM 4HAXB 4MGYE 4W5WA 2OPFA 2AL6A 3PFIA 2YT1A 1RRPB 3SHGB 4XGIA 2DA0A 2CODA 4D80A 2JA2A 3GRVA 2D9ZA 5DHAB 4JI3M 4QNMA 1TH4A 3U60A 4JI4M 2D10A 3HJ8A 4G4RA 5J3TA 1Z5AA 2ERCA 4LF8M 3LQQA 3GPXA 4DR3M 3P7ZA 1I2HA 1N77A 5C79A 1FHOA 4RF1A 2F5PA 4AG6A 2EC1A 3PNVA 2J0MA 2W2XD 4H8SA 5C5BB 3J7AS 5GKNA 1FHWA 5ITUA 4KHPM 3F0WA 2DKQA 3KS4A 2V1CA 4F7HA 3V5WA 2R09A 4A6FB 3UZUA 2X4AA 5ITXE 1XC8A 1Z87A 3BINA 2KUPA 1HNZM 3ODOA 1R6BX 4PNKA 5C18A 3GYOA 4LJ4A 3AOEA 4IBGA 4NXNM 3KRWA 1NTYA 1MAIA 5DH9B 3PEGA 4AG5A 2VRWB 4IBBA 2NQ8C 1SXJE 2CUZA 3K8ZA 4DR5M 3HJQA 3U6CA 1FJGM 5EFXA 2X18A 3DXCA 4AKGA 3WA0A 5FTKA 4P7IA 3GLIA 4TUWA 1IQPA 2FFJA 3M7GA 1HT1E 4R3DA 2AHMA 5KQDA 5FTMA 2XGNA 4LF5M 2N23A 2UZSA 5FTJA 2Y0QA 3VLFB 3PVUA 1X37A 1IN4A 1Q67A 4GN1A 3K92A 4I8OA 3FTFA 1NSFA 5D3XA 5KQ1A 4LGYA 3GLFA 1V88A 1NNUC 2MFQA 3MPXA 3MJ5A 2KRKA 3KSJA 3AL0C 3VK7A 4ZRJA 3ZVRA 1IBKM 2ELAA 1GL7A 5ITQA 4G4OA 2DXIA 2DN6A 1N78A 1V5MA 3D8LA 1QAMA 4IJEA 1X05A 2J0JA 5JHGA 4LRTA 4PDIA 4MT7A 4M9XA 1Q3BA 5FLXS 4R7GA 3KVWA 3TWLA 2PZ1A 4HAUB 3HGIA 2VIIA 2CY4A 4QOSA 2QCUA 2XZFA 5DYGA 2C9CA 3W0FA 4GHLA 1DBHA 4DV0M 2BCJA 2CFOA 4QHSA 5EP1A 1I7AA 3UZTA 4DV5M 1FNNA 1DO0A 2EA0A 1E94E 1NHGC 4JYAM 2DX5A 3NSUA 2YS5A 3HHXA 3TPZA 5KPZA 2OTXA 4K2PA 4M9ZA 2ROVA 2BNKA 4DR2M 3B9PA 1JR3D 2RGNB 4GH9A 2VQFM 2KZSA 1SXJC 1MKEA 1NNJA 2MKRA 5J3QA 2YS1A 2UUCM 4IAPA 3IVFA 1IN6A 2KXEA 2Y8FA 4AI6A 3VIAA 2EMSA 1J5EM 4DX90 3SAWA 1SHCA 2Z3XA 1JQJC 1P6SA 1TH3A 3I4VA 3VFDA 1H6UA 3I51A 2XLJA 2R45A 2RGOA 3SATA 1DGGA 2AEHA 2RVBB 4KVGB 3OTOM 4GKKM 2XH9A 1EVHA 1FOEA 1XR0B 2L7IA 4L8RC 4B3RM 3FTCA 1AWEA 1E9SA 4GC9A 3CTWB 2Z0PA 1U29A 1L2BA 2D7EA 3A42A 3KOWE 4LJ9A 3THGA 4IBJA 4BLCA 1U2BA 3LVWA 3UJNA 1ZM0A 2UZRA 3GP1A 2YVCA 4DR4M 4FWHA 1TQZA 4BBAA 2GCLA 1EE8A 4HAWB 2QKMA 4GRIA 2YS3A 4D0NB 4NSOB 2DHRA 4KODA 3HHWA 2LG1A 3W0LB 5HE0A 1J7KA 4CYEA 1I4WA 2DFKA 5J3YA 4Z2NA 3PZDA 4HB3B 4KHOA 1MPHA 2QP9X 2Y0TA 1ZC3B 4HL4A 4WVFB 3QIJA 5KPRA 4B3MM 4G4NA 2JP2A 3J80S 3KDSE 2CV1A 4CISA 2I5CA 3T15A 2P0DA 4OW0A 3N7CA 1Q39A 5D27A 1N36M 2K2JA 2RSGA 3WHLA 1W5SA 4DV2M 4JI2M 2R0DA 5C6RA 3FUUA 1Z5BA 2P0FA 4KLNA 1UEFA 1IXRC 4GPTB 2ZAMA 3O96A 2COFA 2DYNA 2HHHM 1R2YA 3FSSA 3SNHA 1Z5CA 5FTLA 1N3HA 4GMQA 1TDHA 4JI6M 2EMTA 2HCBA 1ZQ9A 1WVHA 5EP3A 5KO3A 3L29A 1L1ZA 2UXDM 1MIZB 3E4RA 2GS0A 1E9RA 1QQWA 3JR4A 2FNAA 2J7NA 2UXBM 2D7HA 4FCTA 2DWMA 2EJ8A 1SXJD 3KW6A 4OVZB 1L2CA 5EQTA 1WXQA 1Y5OA 3QBVB 1ZC4B 1PLSA 4LCBA 2UVMA 4L15A 2LNHC 3ZH9B 2F5OA 4JV5M 3GQ4A 5H37D 4MGIE 2DZNB 4MGKE 1IXSB 3RGSA 1XXHB 4AZFA 2I1JA 5KCVA 3D8FA 3GYPA 2P8VA 4KO8A 1IRSA 4G6ZA 1KFVA 3SO6A 3L28A 4IIWA 3FM8C 3GLHB 4HLQA 5LONB 2RUKB 3HW2B 2CHGA 4HHVA 5D3WA 2X8AA 3QAUA 2FE8A 1K82A 3KP1E 3FYDA 4WJ7A 4GXBA 4A6FA 2XF3A 3FUWA 1SGHA 3U60B 3AJIB 5DYIA 1IXZA 2DWZB 2I7NA 3L2AA 3U6PA 3TO1A 1NTVA 3U8ZA 2OQ4A 1UPQA 4A6HA 1SXJB 1XKEA 1W1DA 2QBYB 3RGPA 3U5ZA 2D4QA 3ULCA 4WSFA 3FUTA 4FWGA 1YUBA 4A3VB 3Q8XA 3SMSA 2UUBM 5FI1A 4DV6M 1UNPA 3A46A 3WHKA 3SUZA 3NBIA 2XEPA 2LYDA 1J09A 3DOAA 2IFSA 3TW1A 2LOXA 1NY6A 3L27A 4Y94A 2BJVA 1DO2A 3U61B 4B3TM 4IBIA 2M14A 5CLLB 2G8LA 4PDGA 2D9XA 3L25A 4KHAA 3SAVA 3CF0A 2Z4SA 1GKIA 2G5GX 3HKPA 4B7FA 2CEAA 2DVWB 4JI5M 1YE9A 3KFUG 1QC6A 2LULA 4GMXB 4C0AA 5BR8M 1IBLM 3TWMA 2XSZA 1KI1B 2D9WA 2DWNA 3P6AA 3TQSA 5D3YA 5EXTA 3J7BA 4X64M 3KOXE 3GPYA 1TDZA 2F4VM 3M0EA 3KS8A 1H10A 1XODA 3BJIA 1WJ1A 3D8DA 4MGZE 3MK6A 4DR7M 3GLGB 5DIFB 3J2PB 3K1JA 4XWXA 2D9VA 1NY5A 4FCWA 2C99A 3PVSA 4X62M 4EMOA 5JP4A 3HU3A 2R18A 3U6DA 4WW0A 5ITRA 3KY9A 2KW0A 3VKGA 2H1RA 4QHTA 4TYZA 4LFBM 4HAVB 1XX0A 4DV3M 1FGYA 4BBKA 2LXEA 4K0KM 5EXSA 4JXJA 1V89A 1OFHA 2RLOA 2XFSA 1UPRA 1MK9B 1HNWM 2GJYA 3GQ5A 4HDQA 4P16A 4AW4A 4OU7A 4LFCM 1TJ6A 1QVRA 1GVNA 4EIWA 2YF0A 4IBKA 2HL7A 2QPAA 4MM3B 4NOOB 4B7HA 3PSCA 5HE3A 3VOQA 3ZDTA 2V6ZM 3GPUA 3PG7A 4A5KA 1Z6TA 3KRXA 2L09A 3JAMS 3CIKA 1V61A 2UXCM 2X49A 5DI9B 4IBEA 4LF4M 2J7OA 1KZ7A 3AJ4A 1LV7A 1NJGA 1S3SA 4NRWA 5ITTA 2FJLA 4NL4H 2KZUA 3NWLA 1W1HA 1K5GB 3KZ1A 5HE1A 1EGXA 5JLJB 4IBDA 5EP2A 2NZ8B 1PJJA 1G8PA 1L8QA 4YHHM 1X86A 3A8QA 4DXAB 1HNXM 2QKLA 1B55A 2M5ZA 1IY1A 1DGHB 4ITQA 3DXDA 2VQEM 3M1IB 3SHFA 3AOEC 5LOPB 2H7DA 1U5FA 1TXDA 4WURA 4I5SA 2C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHH A;  2P0H A;  4HDO A;  1H4R A;  2IYB A;  1OY2 A;  4Z2M B;  1FAO A;  2N0Y A;  2HTH B;  1M7E A;  1RJ2 A;  1SHC A;  4MY6 A;  4ZRI A;  1PFJ A;  1V5P A;  1WGU A;  3SV1 A;  1OQN A;  3PP2 A;  2DTC A;  4HB2 B;  4KHB B;  1ZVR A;  2I5F A;  4K2O A;  3HQC A;  2LKO A;  4CHJ A;  3AU5 A;  2L2I A;  4MK0 A;  3LJU X;  2DKP A;  2Z0O A;  2G35 A;  3HK0 A;  4CHM A;  5DHF B;  4HAZ B;  3ML4 A;  3ODX A;  4YL8 A;  1BTK A;  1MIX A;  2YSZ A;  1J19 A;  2K2U A;  1U27 A;  4A6K A;  5C5B A;  2MWN B;  1X1G A;  2D2Q A;  4F7G A;  3ULB A;  2J0K A;  1GC6 A;  4EJN A;  2ZPY A;  2DX1 A;  5HE2 A;  2W2W A;  2DYQ A;  4B6H A;  1BAK A;  1E5W A;  3ODW A;  2H7E A;  4IFS A;  2LOZ A;  1MK7 B;  1WI1 A;  2D11 A;  3F5R A;  2DLW A;  1P5T A;  4YON A;  1ISN A;  1W1G A;  4HAT B;  1X11 A;  1KZG A;  1Y19 B;  1K5D B;  3D8E A;  5CLQ B;  2MDX A;  2K00 A;  3MDB C;  1M7R A;  2KGX B;  1LW3 A;  3U7D A;  5GOW B;  3FEH A;  2KCJ A;  1FB8 A;  4IOY X;  1U5E A;  1XCG A;  3QWM A;  3WYF B;  2VSZ A;  3CXB B;  3G9W A;  4GZU A;  5KQ4 A;  4DX8 A;  2HE7 A;  3TCA A;  2ELB A;  1DDV A;  1EAZ A;  1U5G A;  4K17 A;  1WVH A;  1OMW A;  1J0W A;  1FHX A;  1GC7 A;  3A98 B;  2M38 A;  2CRF A;  1DRO A;  1QQG A;  4NY0 A;  3SYX A;  4GMV A;  2RNR B;  1V5U A;  2XQN M;  4NSW A;  3KSY A;  4L6E A;  3TVV A;  1WJM A;  1UNQ A;  2V76 A;  2YRY A;  1DDM A;  2GCJ A;  1DDW A;  2D9Y A;  2CY5 A;  1LB1 A;  4PQ0 A;  2Z0Q A;  1GG3 A;  4EKU A;  4DBB A;  2W2X C;  1PMS A;  3PVW A;  5FI0 A;  2D4Q A;  1NU2 A;  1DYN A;  1P3R A;  1U5D A;  1WG7 A;  2CAY A;  2COC A;  2COA A;  2Q13 A;  3PVL A;  2I1K A;  2Y8G A;  1NI2 A;  5L81 A;  2DHK A;  4F7U P;  1BTN A;  1FGZ A;  2E2X A;  1WGQ A;  3TFM A;  2L1C A;  1ZSQ A;  1UNR A;  1AQC A;  5D3V A;  3RCP A;  4HB4 B;  2NMB A;  1X1F A;  2DHI A;  2OQB A;  4HAY B;  4K81 A;  5J3Q A;  5C16 A;  3AU4 A;  1XD4 A;  3A8P A;  4HB0 B;  2YT0 A;  1BWN A;  2ADZ A;  4KAX B;  2Y7B A;  3OAN A;  3T06 A;  2ROZ B;  1EF1 A;  2VKI A;  2J59 M;  4ZRK A;  3DXE A;  3X23 A;  4HAX B;  2AL6 A;  2YT1 A;  1RRP B;  2DA0 A;  2COD A;  2D9Z A;  5DHA B;  2D10 A;  5J3T A;  1FHO A;  5C79 A;  3P7Z A;  1I2H A;  2W2X D;  4H8S A;  5C5B B;  2EC1 A;  1FHW A;  3F0W A;  2DKQ A;  4F7H A;  3V5W A;  2R09 A;  4A6F B;  1Z87 A;  3BIN A;  2KUP A;  3ODO A;  4PNK A;  3GYO A;  3KRW A;  1NTY A;  1MAI A;  5DH9 B;  3PEG A;  2VRW B;  5EFX A;  2X18 A;  3DXC A;  3WA0 A;  4P7I A;  2N23 A;  2UZS A;  3PVU A;  1Q67 A;  4GN1 A;  5D3X A;  5KQ1 A;  1V88 A;  2MFQ A;  3MPX A;  4ZRJ A;  3ZVR A;  2ELA A;  2DN6 A;  1V5M A;  1X05 A;  2J0J A;  5JHG A;  4MT7 A;  4HAU B;  2PZ1 A;  2CY4 A;  1DBH A;  2BCJ A;  3N7C A;  3UZT A;  1I7A A;  3NSU A;  2DX5 A;  2YS5 A;  2OTX A;  4K2P A;  2ROV A;  2RGN B;  1MKE A;  2MKR A;  2YS1 A;  4IAP A;  3IVF A;  2Y8F A;  3VIA A;  2EMS A;  4DX9 0;  1P6S A;  2AEH A;  4KVG B;  2RVB B;  1EVH A;  1FOE A;  1XR0 B;  1AWE A;  2Z0P A;  1U29 A;  2DHJ A;  2YVC A;  4TKN A;  1ZM0 A;  1U2B A;  2UZR A;  1TQZ A;  2GCL A;  4HAW B;  2QKM A;  4D0N B;  2YS3 A;  2LG1 A;  5HE0 A;  4CYE A;  2DFK A;  5J3Y A;  4Z2N A;  3PZD A;  4HB3 B;  4KHO A;  1MPH A;  1ZC3 B;  4WVF B;  3QIJ A;  2JP2 A;  2I5C A;  2P0D A;  5D27 A;  2K2J A;  2RSG A;  2R0D A;  5C6R A;  2P0F A;  1UEF A;  4GPT B;  3O96 A;  2COF A;  2DYN A;  3FSS A;  3SNH A;  1N3H A;  2EMT A;  2GS0 A;  1MIZ B;  2EJ8 A;  1Y5O A;  3QBV B;  1ZC4 B;  1PLS A;  2UVM A;  2I1J A;  5KCV A;  3D8F A;  3GYP A;  2P8V A;  1IRS A;  3SO6 A;  3FM8 C;  5LON B;  2RUK B;  3HW2 B;  4HHV A;  5D3W A;  4WJ7 A;  4GXB A;  4A6F A;  2J0M A;  1SGH A;  3TO1 A;  3U8Z A;  1NTV A;  4A6H A;  1UPQ A;  1XKE A;  1W1D A;  3ULC A;  4WSF A;  5FI1 A;  1UNP A;  3SUZ A;  2LYD A;  2IFS A;  3TW1 A;  2LOX A;  4Y94 A;  2M14 A;  5CLL B;  2D9X A;  4KHA A;  4GMX B;  1QC6 A;  2LUL A;  4C0A A;  1KI1 B;  2D9W A;  3P6A A;  5D3Y A;  3BJI A;  1H10 A;  1XOD A;  1WJ1 A;  3D8D A;  5DIF B;  4XWX A;  2D9V A;  4EMO A;  5JP4 A;  3KY9 A;  4TYZ A;  4HAV B;  1XX0 A;  1FGY A;  4BBK A;  1V89 A;  2RLO A;  1UPR A;  1MK9 B;  2GJY A;  4HDQ A;  1TJ6 A;  2YF0 A;  3PSC A;  3ZDT A;  3VOQ A;  5HE3 A;  3PG7 A;  4A5K A;  3KRX A;  3CIK A;  1V61 A;  5DI9 B;  1KZ7 A;  3AJ4 A;  2FJL A;  1W1H A;  1K5G B;  3KZ1 A;  5HE1 A;  1EGX A;  5JLJ B;  2NZ8 B;  1X86 A;  3A8Q A;  4DXA B;  2QKL A;  3DXD A;  1B55 A;  3M1I B;  5LOP B;  2H7D A;  1U5F A;  1TXD A; 
#chains in the Genus database with same CATH topology
 2P0H A;  1PM5 A;  3SFZ A;  3AKZ A;  3SC3 A;  1HT2 E;  2ZAO A;  1FAO A;  5M4Y B;  4ZRI A;  3DZD A;  1RJ2 A;  1SHC A;  1QUS A;  2MR9 A;  4B08 A;  4XK8 F;  1IN5 A;  3PP2 A;  2JY8 A;  3T38 A;  4X66 M;  4GIT A;  4K2O A;  3BBZ A;  4PD2 A;  4CHJ A;  4DR1 M;  2M60 A;  3B89 A;  5EXP A;  1GJS A;  3SBJ A;  2G35 A;  4DV1 M;  2YFQ A;  1NHW C;  5DHF B;  4II7 A;  3U6S A;  4HAZ B;  3ODX A;  3HX3 A;  1XMO M;  1V34 A;  4BB9 A;  1MIX A;  3VK8 A;  1AUA A;  2K2U A;  3T6P A;  1HQY E;  1U27 A;  4A6K A;  4MH0 E;  2QZ4 A;  3UK6 A;  2MWN B;  2F5S A;  2D2Q A;  3ULB A;  1GC6 A;  4LF6 M;  5HE2 A;  4MB7 A;  2DYQ A;  1BAK A;  1WIV A;  2XFT A;  5I2M A;  2KEB A;  2KRU A;  3EIH A;  3D8B A;  1XNQ M;  1WI1 A;  3R8F A;  4NC6 A;  1P5T A;  2K49 A;  4YON A;  3L26 A;  3DA1 A;  3U61 A;  3LMM A;  3J81 S;  2VDB B;  3NWA A;  5BPV A;  3TE6 A;  1KZG A;  5LMU M;  2K00 A;  2LBC A;  3HWS A;  4LZZ A;  1XCG A;  3G9W A;  2F5Q A;  2P5T A;  4DV7 M;  4DX8 A;  1QZM A;  3IHP A;  3TCA A;  2ELB A;  1WVH A;  3U6Q A;  1N34 M;  4Z6Y A;  5ITY A;  2CV2 A;  4FCV A;  7CAT A;  1QQG A;  3SYX A;  2UU9 M;  4GMV A;  4NSW A;  2V1U A;  5EJC A;  4CSQ A;  1D0L A;  4X65 M;  3UMM A;  5F3W A;  3F92 A;  2CHV A;  4CJ6 A;  3FKE A;  1GO5 A;  4Z8X A;  5FTN A;  2Z13 A;  1QZE A;  1E32 A;  2GCJ A;  2R4E A;  2DKL A;  1MJG M;  4QNR A;  2C9O A;  1GG3 A;  3SMP A;  4DBB A;  2W2X C;  2COC A;  1NU2 A;  1WG7 A;  2Q13 A;  2I1K A;  2Y8G A;  1NVM A;  3FUX A;  1I94 M;  1IY2 A;  4M0D A;  2EUC A;  2APL A;  2WSF F;  2XZU A;  4LRS A;  3LVV A;  4AKH A;  1AIP C;  5C16 A;  3EIE A;  4QXA B;  4I4L A;  3SAR A;  2Y7B A;  3OAN A;  3LW5 F;  1EF1 A;  2LHG A;  4ZRK A;  3U6L A;  3DXE A;  3X23 A;  1GAB A;  4JI3 M;  4QNM A;  1TH4 A;  5J3T A;  4G4R A;  2ERC A;  2LVP C;  3P7Z A;  1I2H A;  1N77 A;  2EC1 A;  1FHW A;  1D0K A;  3KS4 A;  3V5W A;  1IFY A;  3UZU A;  3GLH E;  1HNZ M;  4QJ3 B;  4LJ4 A;  3KRW A;  2N35 A;  4DR5 M;  3K8Z A;  3C3D A;  3U6C A;  3HJQ A;  1FJG M;  5L8R F;  2O01 F;  1HT1 E;  2AHM A;  2Z59 A;  5FTJ A;  1NSF A;  1NNU C;  2KRK A;  2DN6 A;  1N78 A;  4GNK B;  4PDI A;  2YT2 A;  4HAU B;  2CY4 A;  2HAK A;  3W0F A;  4DV0 M;  4QHS A;  5EP1 A;  3UZT A;  1NHG C;  4JYA M;  2OTX A;  4K2P A;  2RGN B;  2Y8F A;  4DX9 0;  1JQJ C;  1TH3 A;  2XLJ A;  1XR0 B;  2VF8 A;  3CTW B;  3A42 A;  3KOW E;  2KNV A;  1U2B A;  4Y28 F;  4HAW B;  1EE8 A;  4NSO B;  2DHR A;  3HHW A;  4CYE A;  1I4W A;  5J3Y A;  4Z2N A;  1ZMV A;  2OOA A;  4HL4 A;  3QIJ A;  4QJ4 B;  3LCV B;  5D27 A;  2RSG A;  1OTR A;  3FSS A;  1R2Y A;  3SNH A;  2GNO A;  4JI6 M;  2HCB A;  2KR0 A;  1ZQ9 A;  1QQW A;  2D7H A;  2EJ8 A;  4OVZ B;  1L2C A;  5EQT A;  2UVM A;  3ZH9 B;  5H37 D;  2DZN B;  1IXS B;  4AZF A;  3E46 A;  3W67 A;  2P8V A;  4KO8 A;  1KFV A;  3SO6 A;  1VEG A;  2CHG A;  3QAU A;  4GXB A;  2J0M A;  3TO1 A;  3U60 B;  2DWZ B;  3U8Z A;  4A6H A;  1SXJ B;  2QBY B;  4A3V B;  3Q8X A;  4DV6 M;  2LYD A;  3L27 A;  1DO2 A;  2M14 A;  5CLL B;  2G8L A;  4PDG A;  2D9X A;  2DHY A;  3CF0 A;  1VG5 A;  3HKP A;  2CEA A;  3KFU G;  4C0A A;  1IBL M;  1KI1 B;  3TQS A;  4X64 M;  3KOX E;  3KS8 A;  1H10 A;  1XOD A;  1WJ1 A;  3GLI E;  3MK6 A;  4DR7 M;  2R18 A;  3HU3 A;  4WW0 A;  5ITR A;  4QHT A;  1WGN A;  4DV3 M;  5DFL A;  3NW8 A;  4JXJ A;  1UPR A;  4AW4 A;  4OU7 A;  4LFC M;  2YF0 A;  4MM3 B;  4B7H A;  3VOQ A;  2V6Z M;  1QUT A;  3KRX A;  2L09 A;  4LF4 M;  4UN2 B;  2KZU A;  5JLJ B;  4IBD A;  2QKL A;  2M5Z A;  3SHF A;  1U5F A;  4WUR A;  4I5S A;  4Q7J A;  3NWD A;  4RF0 A;  4FVM A;  5JI2 E;  2IYB A;  1JR3 A;  1MU5 A;  3SYK A;  3V76 A;  4PCZ A;  1UM8 A;  2N0Y A;  2HTH B;  4MY6 A;  4GHA A;  3VKH A;  1N33 M;  1V5P A;  3GRR A;  3RE8 A;  1PFJ A;  3SV1 A;  2JY7 A;  5E26 A;  2DTC A;  4REZ A;  1N32 M;  3PXG A;  1TF0 B;  2R46 A;  2L2I A;  1HR0 M;  4NRV A;  2CE7 A;  1IY0 A;  2DKP A;  2Z0O A;  5DNY A;  2Z7J A;  4GIP A;  3HK0 A;  2DZO B;  4OVZ A;  4JI8 M;  1G59 A;  2E5L M;  4IJF A;  2LVO C;  3TL4 X;  2KNA A;  2DX1 A;  2DAG A;  1YSY A;  1HJP A;  2H7E A;  1SXJ A;  4YY3 M;  2QBY A;  2OO9 A;  1G3I A;  1Y8G A;  2RKO A;  3IG5 A;  2WSC F;  1RU3 A;  4R71 A;  1X11 A;  3I4Y A;  1D2N A;  2R65 A;  3D8E A;  3K9P A;  3HU2 A;  1LW3 A;  3U7D A;  5GOW B;  4LZJ A;  2YQZ A;  1U5E A;  3WYF B;  1C7Y A;  2VSZ A;  3GLF B;  2LWX A;  4LJ6 A;  5A2Q S;  4LJA A;  1EAZ A;  5KQ8 A;  5LMN M;  1U5G A;  4L4U A;  4K17 A;  4M9S A;  1FHX A;  4NXM M;  2CRF A;  1KYI A;  1VDD A;  1WGL A;  1LTM A;  3E9S A;  3FTE A;  3VDP A;  4OSN A;  1WJM A;  2V76 A;  3DCX A;  3A45 A;  1C1K A;  3HHY A;  3LQR A;  2C98 A;  1LB1 A;  3AOG A;  3BXW A;  4EKU A;  1QAN A;  1PMS A;  3K2L A;  3PVW A;  4NSR A;  1ORY B;  1DYN A;  3C58 A;  4CGY B;  1R5L A;  1XMQ M;  5KPT A;  4L78 A;  1BTN A;  1DV0 A;  5IWA M;  2E2X A;  2MGW A;  2R2Y A;  1WGQ A;  1TTE A;  2MRO B;  3TFM A;  4RNA A;  1TGU A;  2L1C A;  2D7G A;  1IN8 A;  1R4G A;  1V92 A;  2CHQ A;  2ZBK B;  3U6E A;  1UNR A;  1K3X A;  1AQC A;  3GRY A;  3MHV C;  2Z14 A;  1PJI A;  1PJT A;  4HAY B;  3TWK A;  1SG9 A;  1XD4 A;  3AU4 A;  4HB0 B;  3I04 M;  3R9X B;  4S12 A;  2ADZ A;  2K47 A;  4KAX B;  2LVA A;  4OX9 M;  2VKI A;  3T1Y M;  4HAX B;  3PFI A;  2D10 A;  4JI4 M;  5C5B B;  2F5P A;  4AG6 A;  2K9D A;  3J7A S;  5ITU A;  4KHP M;  2DKQ A;  2V1C A;  1XC8 A;  1Z87 A;  2MH8 A;  1R6B X;  5C18 A;  4NXN M;  2DNA A;  2GUM A;  2VRW B;  3WA0 A;  4P7I A;  4R3D A;  5KQD A;  1X37 A;  1IN4 A;  4GN1 A;  5KQ1 A;  3GLF A;  3MPX A;  4DBG B;  3MJ5 A;  3AL0 C;  3ZVR A;  2ELA A;  5ITQ A;  4G4O A;  2DXI A;  1V5M A;  3D8L A;  2J0J A;  5JHG A;  2DAE A;  4MT7 A;  1OAO C;  1Q3B A;  2PZ1 A;  2XZF A;  1DBH A;  2BCJ A;  4GHL A;  2CFO A;  1MN3 A;  4DV5 M;  2EA0 A;  1E94 E;  3NSU A;  2DX5 A;  2DEN A;  5KPZ A;  2ROV A;  3FE3 A;  4DR2 M;  1JR3 D;  2KZS A;  1NNJ A;  2MKR A;  2YS1 A;  2KXE A;  4AI6 A;  3VIA A;  2BWB A;  2Z3X A;  2JP7 A;  2AEH A;  3VFD A;  1H6U A;  4KVG B;  2RGO A;  2RVB B;  1DGG A;  2GQF A;  1VEK A;  1AWE A;  4B3R M;  2Z0P A;  2DHJ A;  3THG A;  4LJ9 A;  4TKN A;  1ZM0 A;  3UJN A;  3GP1 A;  4DR4 M;  4GRI A;  2LG1 A;  2DFK A;  1ZC3 B;  2JP2 A;  3KDS E;  2CV1 A;  4CIS A;  2MJ5 B;  4OT1 A;  2R0D A;  5C6R A;  1IXR C;  3O96 A;  2DYN A;  1N3H A;  1L1Z A;  2UXD M;  2J7N A;  2DWM A;  1SXJ D;  3KW6 A;  3IEC A;  4LCB A;  4L15 A;  4MGI E;  4MGK E;  1XXH B;  3D8F A;  1ZYI A;  3L28 A;  3Q8G A;  2X8A A;  2FE8 A;  4WJ7 A;  3AJI B;  5DYI A;  3U6P A;  2I7N A;  3ULC A;  4FWG A;  3SMS A;  2UUB M;  3WHK A;  3NBI A;  2XEP A;  1J09 A;  2IFS A;  3TW1 A;  5LG4 B;  1NY6 A;  5I2S A;  4Y94 A;  2BJV A;  1G71 A;  4KHA A;  1PJS A;  3SAV A;  4B7F A;  2G5G X;  4JI5 M;  5BR8 M;  3HSA A;  3P6A A;  3J7B A;  3GPY A;  3BJI A;  2EKF A;  2JUJ A;  3D8D A;  3GLG B;  5DIF B;  3J2P B;  4FCW A;  3KY9 A;  2H1R A;  4LFB M;  2R0I A;  1OKS A;  2L4F A;  1FGY A;  1CUK A;  4K0K M;  2RLO A;  2XFS A;  1MK9 B;  1HNW M;  1TJ6 A;  1QVR A;  2HL7 A;  4NOO B;  3PSC A;  5HE3 A;  4KT0 F;  3CIK A;  2UXC M;  4IBE A;  1KZ7 A;  1LV7 A;  4NRW A;  3NWL A;  5HE1 A;  5EP2 A;  1PJJ A;  1G8P A;  4DXA B;  1DGH B;  3AOE C;  4F1I A;  2C5R A;  5C1B A;  4HDO A;  1GJT A;  2ZM6 M;  2WSE F;  1OY2 A;  1IM2 A;  4Z2M B;  3PNY A;  4QOZ C;  8CAT A;  1M7E A;  2JXN A;  3SAS A;  1WGU A;  2I7P A;  3GO8 A;  1OQN A;  4HB2 B;  2G3Q A;  4LGM A;  4KHB B;  4D6W A;  1ZVR A;  2I5F A;  2Q2E B;  1A5T A;  3HQC A;  2C96 A;  3AU5 A;  4LF9 M;  3UGJ A;  3LJU X;  2L7H A;  3ZCB B;  1GL6 A;  4CIZ A;  4CHM A;  3AFH A;  4D81 A;  2CV0 A;  3IG8 A;  1NJF A;  4DUZ M;  1J19 A;  3LCU A;  1OAI A;  3SYL A;  1XXH A;  5IRE B;  3A58 A;  4F7G A;  2J0K A;  5ITX A;  4EJN A;  2ZPY A;  2FOI C;  4B6H A;  1E5W A;  4F2L A;  4IFS A;  2KA6 B;  3FYC A;  2D11 A;  1L2D A;  3F5R A;  2LVQ D;  3GPP A;  1N75 A;  3SAU A;  1ISN A;  1K3W A;  3AV0 A;  2XSZ D;  3QWL A;  3U5Z B;  4HAT B;  2JY6 B;  4JI7 M;  3HY5 A;  2MDX A;  1OIP A;  3MDB C;  3HHZ A;  2DWL A;  1XNR M;  3GLG A;  3CXB B;  2ZAN A;  5KQ4 A;  1Z59 A;  2HE7 A;  2KIG A;  5IZ7 D;  4G3O A;  1QAQ A;  3A98 B;  2ZTD A;  3U6M A;  1G4A E;  4JN6 A;  4QJ5 B;  2YR0 A;  2QEN A;  2O5R A;  4LJ7 A;  2RNR B;  3M6A A;  1V5U A;  2XQN M;  3KSY A;  3TVV A;  3HIE A;  2KUQ A;  1GLN A;  2BJW A;  2YRY A;  4JI0 M;  1DDM A;  4CHT B;  5IRS A;  1DGH A;  2ZTC A;  1T6O A;  5FSW A;  5EP4 A;  1WR1 B;  5IT9 S;  2D9Y A;  2Z0Q A;  1W5T A;  1MI1 A;  1HQC A;  1P3R A;  2COA A;  1QAO A;  1Q3C A;  1NI2 A;  2DHK A;  3CF2 A;  3HJS A;  4KHB A;  1JR3 E;  4G4Q A;  3U12 A;  3NWF A;  2A5Y B;  5D3V A;  1DGF A;  4HB4 B;  2OQB A;  3T1H M;  4PT5 A;  5J3Q A;  3RFW A;  3A8P A;  2CWB A;  1BWN A;  5E6J A;  2R62 A;  1KSF X;  1IXS A;  2ROZ B;  2W82 A;  3H4J A;  4DV4 M;  2J59 M;  4D82 A;  4MGY E;  2YT1 A;  3SHG B;  4XGI A;  2COD A;  4D80 A;  5DHA B;  3U60 A;  3NBX X;  1FHO A;  3GPX A;  4DR3 M;  4RF1 A;  3FRH A;  2W2X D;  4RKU F;  1VDL A;  3PNV A;  1F4I A;  2EJS A;  3F0W A;  4A6F B;  2DAK A;  2X4A A;  2KUP A;  3B7Q A;  3GYO A;  2DZL A;  1NTY A;  4L6V 6;  5DH9 B;  3PEG A;  4AG5 A;  1SXJ E;  2CUZ A;  5EFX A;  2X18 A;  4AKG A;  5FTK A;  4TUW A;  2FFJ A;  3M7G A;  5FTM A;  1EFU B;  2Y0Q A;  3VLF B;  1XB2 B;  1Q67 A;  2LHC A;  2ZKM X;  3K92 A;  1V88 A;  3KSJ A;  2Z8Y M;  3VK7 A;  4ZRJ A;  1IBK M;  1GL7 A;  4IJE A;  5FLX S;  3TWL A;  3HGI A;  3QYB A;  5DYG A;  2C9C A;  3N7C A;  1I7A A;  1DO0 A;  3HZJ A;  3TPZ A;  2BNK A;  2DAM A;  3MMP A;  4GH9 A;  2VQF M;  1IN6 A;  2EMS A;  3B77 A;  2R44 A;  3I4V A;  3I51 A;  3SAT A;  2R45 A;  3OTO M;  1EVH A;  1FOE A;  4L8R C;  3FTC A;  4GC9 A;  1U29 A;  1L2B A;  1WHC A;  4BLC A;  2UZR A;  1TQZ A;  4BBA A;  2QKM A;  4D0N B;  2JY5 A;  4KOD A;  1J7K A;  4KHO A;  4WVF B;  2JWS A;  3J80 S;  2P0D A;  3T15 A;  1N36 M;  3WHL A;  4JI2 M;  1Z5B A;  1UEF A;  4GPT B;  2HHH M;  4GMQ A;  1TDH A;  1VQ1 A;  5KO3 A;  3L29 A;  1MIZ B;  3E4R A;  2FNA A;  3QBV B;  1ZC4 B;  2LNH C;  4JV5 M;  3GQ4 A;  3RGS A;  3B7Z A;  1IRS A;  4G6Z A;  3GLH B;  3HW2 B;  4HHV A;  1D0M A;  3KP1 E;  3FYD A;  4A6F A;  3FUW A;  1BVS A;  1IXZ A;  3L2A A;  1NTV A;  3RGP A;  3FUT A;  1YUB A;  5FI1 A;  3A46 A;  2JNH A;  4B3T M;  4IBI A;  1V33 A;  2DVW B;  1YE9 A;  2LUL A;  2XSZ A;  2F4V M;  1YLA A;  2FH0 A;  2D9V A;  1NY5 A;  2C99 A;  3PVS A;  1P3Q Q;  4HAV B;  3GLF E;  2LXE A;  5EXS A;  1V89 A;  2GJY A;  3GQ5 A;  2KIE A;  4P16 A;  1VEJ A;  4IBK A;  2QPA A;  3ZDT A;  3GPU A;  3PG7 A;  2H5X A;  4A5K A;  1V61 A;  2X49 A;  5DI9 B;  1NJG A;  2FJL A;  5ITT A;  4NL4 H;  1W1H A;  3KZ1 A;  2QNJ A;  3A8Q A;  1IY1 A;  4ITQ A;  2H7D A;  3FRI A;  3C9P A;  1MX0 A;  5JHH A;  3KXE C;  1H4R A;  4I81 A;  3DFZ A;  4LG2 A;  1JB0 F;  2B3T A;  4LF7 M;  2L4E A;  2O25 A;  3JR5 A;  3ILK A;  4GKJ M;  1PJQ A;  1TH2 A;  1ZMW A;  2LKO A;  4MK0 A;  1ZV1 A;  4M0W A;  2BWE A;  1NO1 A;  3K9O A;  2UUA M;  4DUY M;  2HKJ A;  1XWI A;  1QYR A;  3ML4 A;  3CF6 E;  4YL8 A;  1BTK A;  2Y21 A;  4GC5 A;  1WJ7 A;  2YSZ A;  5C5B A;  1X1G A;  1L1T A;  1XHB A;  2K0B X;  3GLH A;  2LH0 A;  3BOS A;  2W2W A;  3ODW A;  2LOZ A;  2EKK A;  2Y20 A;  2YNM D;  1MK7 B;  3HU1 A;  1PGY A;  3GRU A;  1PRB A;  2DLW A;  2KNZ A;  2DI0 A;  3ZQJ A;  1W1G A;  4ZPX A;  2Z4R A;  2KDL A;  1G41 A;  1Y19 B;  1K5D B;  5CLQ B;  3GLI B;  1IN7 A;  1M7R A;  2KGX B;  1ZAE A;  2EO2 A;  4AQY M;  3FEH A;  4L16 A;  2KCJ A;  1FB8 A;  4IOY X;  3QWM A;  5EXX A;  2DAI A;  4GZU A;  1R7R A;  5JI3 E;  1DDV A;  2VF7 A;  2R4J A;  4LJ5 A;  4LY6 A;  1J0W A;  1OMW A;  2F5N A;  3KOY E;  1GC7 A;  3J27 B;  2M38 A;  1DRO A;  4AKI A;  4LJ8 A;  1R2Z A;  4NY0 A;  2Z4D A;  2J5Y A;  3B7N A;  2HWJ A;  3VDU A;  2QQ8 A;  1OIZ A;  4L6E A;  2RGH A;  4XBO A;  1UNQ A;  3FD9 A;  2CP8 A;  4FWD A;  2FJU B;  1DDW A;  2JZ1 A;  2CY5 A;  4PQ0 A;  1OFI A;  3FTD A;  4LFA M;  2L6O A;  5FI0 A;  1ZMU A;  2D4Q A;  1U5D A;  2CAY A;  1T3T A;  2LTU A;  3PVL A;  5L81 A;  1DGB A;  4F7U P;  4FW9 A;  3ZC7 B;  4P17 A;  1FGZ A;  3GQ3 A;  1IBM M;  3FVC A;  4FD2 A;  3H4M A;  3KSX A;  1ZSQ A;  3RCP A;  4IBF A;  3KOZ E;  4MGH A;  2NMB A;  3U6O A;  1X1F A;  2DHI A;  4K81 A;  4JI1 M;  2YT0 A;  4B7G A;  4B3S M;  3T06 A;  4IBC A;  3FUV A;  1OJL A;  4WP2 A;  3KP0 E;  4DR6 M;  4W5W A;  2AL6 A;  2OPF A;  1RRP B;  2LVN C;  2DA0 A;  2D9Z A;  2JA2 A;  3GRV A;  3HJ8 A;  1Z5A A;  4LF8 M;  3LQQ A;  5C79 A;  3I01 M;  1QDT A;  4H8S A;  5GKN A;  1XXH E;  2FS1 A;  4HEO A;  3CGW A;  4F7H A;  2R09 A;  5ITX E;  3BIN A;  3ODO A;  4PNK A;  3AOE A;  4IBG A;  2JZ0 A;  1MAI A;  4IBB A;  2NQ8 C;  3DXC A;  3GLI A;  1IQP A;  2XGN A;  4LF5 M;  2N23 A;  2UZS A;  3PVU A;  1NV9 A;  2L2D A;  1T43 A;  1TR8 A;  4I8O A;  3FTF A;  5D3X A;  4LGY A;  2MFQ A;  2QHO B;  1X05 A;  1QAM A;  4LRT A;  2K8E A;  4M9X A;  3GLG E;  4R7G A;  3KVW A;  2QSF X;  2VII A;  4QOS A;  2QCU A;  1FNN A;  3W68 A;  2YS5 A;  3HHX A;  4M9Z A;  3B9P A;  1SXJ C;  1MKE A;  2NBV A;  2UUC M;  4IAP A;  3IVF A;  3OHM B;  1J5E M;  3SAW A;  1P6S A;  4GKK M;  2XH9 A;  2L7I A;  1E9S A;  3C3E A;  2D7E A;  2YVC A;  4IBJ A;  3LVW A;  4FWH A;  2GCL A;  2YS3 A;  2K6B A;  3W0L B;  5HE0 A;  3PZD A;  4HB3 B;  1MPH A;  2QP9 X;  2Y0T A;  5KPR A;  4B3M M;  4G4N A;  2I5C A;  4OW0 A;  1Q39 A;  2K2J A;  1W5S A;  4DV2 M;  3FUU A;  2P0F A;  4KLN A;  1T77 A;  2ZAM A;  2COF A;  1Z5C A;  5FTL A;  2EMT A;  2CRU A;  5EP3 A;  2GS0 A;  1E9R A;  3JR4 A;  2UXB M;  4FCT A;  1WXQ A;  1Y5O A;  1PLS A;  2F5O A;  2I1J A;  4ANR A;  5KCV A;  3GYP A;  4IIW A;  3FM8 C;  4HLQ A;  5LON B;  2RUK B;  5D3W A;  1K82 A;  4HSI A;  2XF3 A;  1SGH A;  1QDR A;  2OQ4 A;  1UPQ A;  1OQY A;  1XKE A;  1W1D A;  3U5Z A;  4WSF A;  1UNP A;  3SUZ A;  4GOU A;  3DOA A;  2LOX A;  3U61 B;  2RRU A;  3L25 A;  2Z4S A;  1GKI A;  4GMX B;  1QC6 A;  2KHH A;  3TWM A;  2D9W A;  2DWN A;  3QYE A;  5EXT A;  5D3Y A;  1TDZ A;  3M0E A;  4MGZ E;  2WZJ A;  3K1J A;  4XWX A;  1Q02 A;  4X62 M;  4EMO A;  5JP4 A;  3U6D A;  3B74 A;  2KW0 A;  3VKG A;  2R6F A;  4TYZ A;  4GEW A;  1XX0 A;  4BBK A;  3E21 A;  1OFH A;  4HDQ A;  4DIX A;  1GVN A;  4EIW A;  1Z6T A;  3JAM S;  4L1R A;  1NV8 A;  2J7O A;  3AJ4 A;  2OOB A;  1S3S A;  1K5G B;  1EGX A;  2NZ8 B;  1L8Q A;  4YHH M;  2RRF A;  1X86 A;  1HNX M;  3DXD A;  1B55 A;  1EIJ A;  2VQE M;  3M1I B;  5LOP B;  1UFZ A;  1TXD A; 
#chains in the Genus database with same CATH homology
 1MX0 A;  5C1B A;  5JHH A;  3KXE C;  4RF0 A;  1PM5 A;  2P0H A;  4HDO A;  3SFZ A;  1H4R A;  4FVM A;  4I81 A;  5JI2 E;  3DFZ A;  4LG2 A;  2IYB A;  3AKZ A;  1JR3 A;  2ZM6 M;  1MU5 A;  3SC3 A;  3SYK A;  1OY2 A;  4LF7 M;  1IM2 A;  4ZRI A;  4Z2M B;  3PNY A;  1HT2 E;  2ZAO A;  4QOZ C;  4PCZ A;  1FAO A;  1UM8 A;  2N0Y A;  2HTH B;  8CAT A;  3DZD A;  3JR5 A;  4GHA A;  3VKH A;  1M7E A;  1RJ2 A;  3SAS A;  1N33 M;  3ILK A;  3GRR A;  3RE8 A;  2I7P A;  4B08 A;  1IN5 A;  1PFJ A;  1V5P A;  1WGU A;  3GO8 A;  4GKJ M;  5E26 A;  3SV1 A;  1OQN A;  3PP2 A;  1TH2 A;  2DTC A;  4HB2 B;  4TKN A;  4LGM A;  3T38 A;  4X66 M;  4GIT A;  4REZ A;  4KHB B;  1ZVR A;  1N32 M;  3PXG A;  2Q2E B;  2I5F A;  4K2O A;  4PD2 A;  3HQC A;  2LKO A;  2R46 A;  2C96 A;  4CHJ A;  3AU5 A;  2L2I A;  4MK0 A;  4DR1 M;  4LF9 M;  4M0W A;  1HR0 M;  4NRV A;  2M60 A;  2CE7 A;  3UGJ A;  5EXP A;  1IY0 A;  5FI0 A;  3LJU X;  2L7H A;  2DKP A;  2Z0O A;  3SBJ A;  5DNY A;  2G35 A;  2UUA M;  3ZCB B;  4DUY M;  2Z7J A;  4GIP A;  4DV1 M;  1GL6 A;  2HKJ A;  1XWI A;  1NHW C;  1QYR A;  2YFQ A;  3HK0 A;  4CHM A;  5DHF B;  3AFH A;  4D81 A;  2CV0 A;  4II7 A;  2DZO B;  3U6S A;  4HAZ B;  3ML4 A;  3IG8 A;  3ODX A;  3CF6 E;  4YL8 A;  1XMO M;  1BTK A;  1NJF A;  2Y21 A;  4GC5 A;  4OVZ A;  4BB9 A;  4DUZ M;  1MIX A;  2YSZ A;  1J19 A;  3VK8 A;  4JI8 M;  2K2U A;  1HQY E;  1MK7 B;  1U27 A;  4A6K A;  1G59 A;  4MH0 E;  3SYL A;  1XXH A;  5C5B A;  2QZ4 A;  3UK6 A;  2MWN B;  1X1G A;  2F5S A;  5IRE B;  1L1T A;  4IJF A;  2E5L M;  2D2Q A;  1XHB A;  3ULB A;  4F7G A;  2J0K A;  1GC6 A;  5ITX A;  3GLH A;  3TL4 X;  4LF6 M;  4EJN A;  2LH0 A;  2ZPY A;  2DX1 A;  2FOI C;  5HE2 A;  3BOS A;  4MB7 A;  1YSY A;  2DYQ A;  2W2W A;  4B6H A;  1BAK A;  1E5W A;  3ODW A;  2H7E A;  4IFS A;  2XFT A;  2LOZ A;  2YNM D;  2KA6 B;  1SXJ A;  2KEB A;  2Y20 A;  2KRU A;  3FYC A;  3EIH A;  3D8B A;  3HU1 A;  4YY3 M;  2QBY A;  1XNQ M;  3GRU A;  1WI1 A;  2D11 A;  1L2D A;  3F5R A;  3R8F A;  1G3I A;  3GPP A;  1N75 A;  2DLW A;  1P5T A;  3SAU A;  4YON A;  2RKO A;  3L26 A;  1ISN A;  3IG5 A;  1K3W A;  3AV0 A;  4ZPX A;  1W1G A;  2XSZ D;  3DA1 A;  3LMM A;  3U61 A;  3J81 S;  3QWL A;  3U5Z B;  4HAT B;  1X11 A;  5BPV A;  3I4Y A;  2Z4R A;  3TE6 A;  1KZG A;  1D2N A;  2R65 A;  5LMU M;  1G41 A;  1Y19 B;  1K5D B;  3D8E A;  4JI7 M;  5CLQ B;  3GLI B;  2MDX A;  1IN7 A;  2K00 A;  3MDB C;  1M7R A;  2KGX B;  3HU2 A;  1LW3 A;  1ZAE A;  5GOW B;  3U7D A;  3HHZ A;  2EO2 A;  3HWS A;  4AQY M;  2DWL A;  4L16 A;  1XNR M;  1FB8 A;  4LZZ A;  4LZJ A;  2KCJ A;  3FEH A;  3GLG A;  2YQZ A;  1U5E A;  1XCG A;  3QWM A;  5EXX A;  2VSZ A;  3CXB B;  3G9W A;  4IOY X;  3WYF B;  4GZU A;  3GLF B;  2F5Q A;  2ZAN A;  5KQ4 A;  2LWX A;  2P5T A;  4DV7 M;  4DX8 A;  4LJ6 A;  1Z59 A;  5A2Q S;  1R7R A;  1QZM A;  5JI3 E;  2HE7 A;  4LJA A;  3TCA A;  2ELB A;  1DDV A;  1EAZ A;  5KQ8 A;  5LMN M;  1U5G A;  4L4U A;  4K17 A;  2R4J A;  4LJ5 A;  4LY6 A;  5IZ7 D;  4M9S A;  2F5N A;  1J0W A;  1OMW A;  3KOY E;  3U6Q A;  1N34 M;  1QAQ A;  1FHX A;  1GC7 A;  3J27 B;  3A98 B;  5ITY A;  4Z6Y A;  2CV2 A;  4NXM M;  2CRF A;  1KYI A;  2M38 A;  1DRO A;  4FCV A;  3U6M A;  1G4A E;  4JN6 A;  1VDD A;  7CAT A;  4LJ8 A;  4AKI A;  2YR0 A;  3E9S A;  1R2Z A;  2QEN A;  2O5R A;  3FTE A;  4LJ7 A;  2UU9 M;  1QQG A;  4NY0 A;  3SYX A;  4GMV A;  3VDP A;  2RNR B;  3M6A A;  1V5U A;  3VDU A;  2XQN M;  4NSW A;  3KSY A;  2V1U A;  4L6E A;  5EJC A;  3TVV A;  2RGH A;  4XBO A;  4X65 M;  3UMM A;  5F3W A;  1WJM A;  1UNQ A;  2V76 A;  2CHV A;  3FKE A;  3FD9 A;  1GLN A;  2BJW A;  3A45 A;  1C1K A;  3HHY A;  4Z8X A;  4FWD A;  5FTN A;  4JI0 M;  2YRY A;  3LQR A;  4MY6 A;  1DDM A;  4CHT B;  1E32 A;  1DGH A;  2GCJ A;  2C98 A;  2R4E A;  1DDW A;  5FSW A;  5EP4 A;  5IT9 S;  2D9Y A;  2CY5 A;  1LB1 A;  3AOG A;  4PQ0 A;  1OFI A;  2C9O A;  4QNR A;  1GG3 A;  2Z0Q A;  3SMP A;  4DBB A;  1W5T A;  4EKU A;  3FTD A;  1QAN A;  2W2X C;  4LFA M;  1PMS A;  3K2L A;  2L6O A;  3PVW A;  4NSR A;  1HQC A;  1NU2 A;  1ORY B;  1DYN A;  1P3R A;  3C58 A;  1U5D A;  1WG7 A;  2CAY A;  2COC A;  2COA A;  4CGY B;  1QAO A;  2Q13 A;  1T3T A;  3PVL A;  1Q3C A;  1XMQ M;  2I1K A;  2Y8G A;  1NI2 A;  1NVM A;  5L81 A;  2DHK A;  5KPT A;  3FUX A;  1DGB A;  4L78 A;  4F7U P;  4FW9 A;  3ZC7 B;  1BTN A;  3CF2 A;  3HJS A;  1I94 M;  1IY2 A;  5IWA M;  1FGZ A;  2E2X A;  1WGQ A;  3TFM A;  3GQ3 A;  4RNA A;  1IBM M;  4G4Q A;  1TGU A;  2L1C A;  4FD2 A;  3H4M A;  2D7G A;  1IN8 A;  3KSX A;  1ZSQ A;  4M0D A;  2EUC A;  2CHQ A;  2ZBK B;  2A5Y B;  3U6E A;  1UNR A;  1K3X A;  1AQC A;  5D3V A;  3RCP A;  3GRY A;  3MHV C;  4IBF A;  1DGF A;  4LRS A;  3KOZ E;  4MGH A;  2XZU A;  2DHJ A;  4HB4 B;  1PJI A;  3LVV A;  2NMB A;  3U6O A;  4AKH A;  1X1F A;  2DHI A;  2OQB A;  3T1H M;  4PT5 A;  4HAY B;  3TWK A;  4JI1 M;  3RFW A;  4K81 A;  5C16 A;  1XD4 A;  3A8P A;  3EIE A;  3AU4 A;  4HB0 B;  2YT0 A;  1BWN A;  4B7G A;  4B3S M;  4I4L A;  4S12 A;  5E6J A;  3R9X B;  2R62 A;  2ADZ A;  2K47 A;  4KAX B;  1KSF X;  3SAR A;  4OX9 M;  2Y7B A;  3OAN A;  4IBC A;  2ROZ B;  3FUV A;  3T06 A;  2W82 A;  4DV4 M;  1EF1 A;  2VKI A;  1OJL A;  2J59 M;  4ZRK A;  3KP0 E;  3U6L A;  4DR6 M;  3DXE A;  3X23 A;  4D82 A;  3T1Y M;  4HAX B;  4MGY E;  4W5W A;  2OPF A;  2AL6 A;  3PFI A;  2YT1 A;  1RRP B;  3SHG B;  4XGI A;  2DA0 A;  2COD A;  4D80 A;  2JA2 A;  3GRV A;  2D9Z A;  5DHA B;  4JI3 M;  4QNM A;  1TH4 A;  3U60 A;  4JI4 M;  2D10 A;  3HJ8 A;  4G4R A;  5J3T A;  1Z5A A;  2ERC A;  4LF8 M;  3LQQ A;  3GPX A;  4DR3 M;  3P7Z A;  1I2H A;  1N77 A;  5C79 A;  1FHO A;  4RF1 A;  2F5P A;  4AG6 A;  2EC1 A;  3PNV A;  2J0M A;  2W2X D;  4H8S A;  5C5B B;  3J7A S;  5GKN A;  1FHW A;  5ITU A;  4KHP M;  3F0W A;  2DKQ A;  3KS4 A;  2V1C A;  4F7H A;  3V5W A;  2R09 A;  4A6F B;  3UZU A;  2X4A A;  5ITX E;  1XC8 A;  1Z87 A;  3BIN A;  2KUP A;  1HNZ M;  3ODO A;  1R6B X;  4PNK A;  5C18 A;  3GYO A;  4LJ4 A;  3AOE A;  4IBG A;  4NXN M;  3KRW A;  1NTY A;  1MAI A;  5DH9 B;  3PEG A;  4AG5 A;  2VRW B;  4IBB A;  2NQ8 C;  1SXJ E;  2CUZ A;  3K8Z A;  4DR5 M;  3HJQ A;  3U6C A;  1FJG M;  5EFX A;  2X18 A;  3DXC A;  4AKG A;  3WA0 A;  5FTK A;  4P7I A;  3GLI A;  4TUW A;  1IQP A;  2FFJ A;  3M7G A;  1HT1 E;  4R3D A;  2AHM A;  5KQD A;  5FTM A;  2XGN A;  4LF5 M;  2N23 A;  2UZS A;  5FTJ A;  2Y0Q A;  3VLF B;  3PVU A;  1X37 A;  1IN4 A;  1Q67 A;  4GN1 A;  3K92 A;  4I8O A;  3FTF A;  1NSF A;  5D3X A;  5KQ1 A;  4LGY A;  3GLF A;  1V88 A;  1NNU C;  2MFQ A;  3MPX A;  3MJ5 A;  2KRK A;  3KSJ A;  3AL0 C;  3VK7 A;  4ZRJ A;  3ZVR A;  1IBK M;  2ELA A;  1GL7 A;  5ITQ A;  4G4O A;  2DXI A;  2DN6 A;  1N78 A;  1V5M A;  3D8L A;  1QAM A;  4IJE A;  1X05 A;  2J0J A;  5JHG A;  4LRT A;  4PDI A;  4MT7 A;  4M9X A;  1Q3B A;  5FLX S;  4R7G A;  3KVW A;  3TWL A;  2PZ1 A;  4HAU B;  3HGI A;  2VII A;  2CY4 A;  4QOS A;  2QCU A;  2XZF A;  5DYG A;  2C9C A;  3W0F A;  4GHL A;  1DBH A;  4DV0 M;  2BCJ A;  2CFO A;  4QHS A;  5EP1 A;  1I7A A;  3UZT A;  4DV5 M;  1FNN A;  1DO0 A;  2EA0 A;  1E94 E;  1NHG C;  4JYA M;  2DX5 A;  3NSU A;  2YS5 A;  3HHX A;  3TPZ A;  5KPZ A;  2OTX A;  4K2P A;  4M9Z A;  2ROV A;  2BNK A;  4DR2 M;  3B9P A;  1JR3 D;  2RGN B;  4GH9 A;  2VQF M;  2KZS A;  1SXJ C;  1MKE A;  1NNJ A;  2MKR A;  5J3Q A;  2YS1 A;  2UUC M;  4IAP A;  3IVF A;  1IN6 A;  2KXE A;  2Y8F A;  4AI6 A;  3VIA A;  2EMS A;  1J5E M;  4DX9 0;  3SAW A;  1SHC A;  2Z3X A;  1JQJ C;  1P6S A;  1TH3 A;  3I4V A;  3VFD A;  1H6U A;  3I51 A;  2XLJ A;  2R45 A;  2RGO A;  3SAT A;  1DGG A;  2AEH A;  2RVB B;  4KVG B;  3OTO M;  4GKK M;  2XH9 A;  1EVH A;  1FOE A;  1XR0 B;  2L7I A;  4L8R C;  4B3R M;  3FTC A;  1AWE A;  1E9S A;  4GC9 A;  3CTW B;  2Z0P A;  1U29 A;  1L2B A;  2D7E A;  3A42 A;  3KOW E;  4LJ9 A;  3THG A;  4IBJ A;  4BLC A;  1U2B A;  3LVW A;  3UJN A;  1ZM0 A;  2UZR A;  3GP1 A;  2YVC A;  4DR4 M;  4FWH A;  1TQZ A;  4BBA A;  2GCL A;  1EE8 A;  4HAW B;  2QKM A;  4GRI A;  2YS3 A;  4D0N B;  4NSO B;  2DHR A;  4KOD A;  3HHW A;  2LG1 A;  3W0L B;  5HE0 A;  1J7K A;  4CYE A;  1I4W A;  2DFK A;  5J3Y A;  4Z2N A;  3PZD A;  4HB3 B;  4KHO A;  1MPH A;  2QP9 X;  2Y0T A;  1ZC3 B;  4HL4 A;  4WVF B;  3QIJ A;  5KPR A;  4B3M M;  4G4N A;  2JP2 A;  3J80 S;  3KDS E;  2CV1 A;  4CIS A;  2I5C A;  3T15 A;  2P0D A;  4OW0 A;  3N7C A;  1Q39 A;  5D27 A;  1N36 M;  2K2J A;  2RSG A;  3WHL A;  1W5S A;  4DV2 M;  4JI2 M;  2R0D A;  5C6R A;  3FUU A;  1Z5B A;  2P0F A;  4KLN A;  1UEF A;  1IXR C;  4GPT B;  2ZAM A;  3O96 A;  2COF A;  2DYN A;  2HHH M;  1R2Y A;  3FSS A;  3SNH A;  1Z5C A;  5FTL A;  1N3H A;  4GMQ A;  1TDH A;  4JI6 M;  2EMT A;  2HCB A;  1ZQ9 A;  1WVH A;  5EP3 A;  5KO3 A;  3L29 A;  1L1Z A;  2UXD M;  1MIZ B;  3E4R A;  2GS0 A;  1E9R A;  1QQW A;  3JR4 A;  2FNA A;  2J7N A;  2UXB M;  2D7H A;  4FCT A;  2DWM A;  2EJ8 A;  1SXJ D;  3KW6 A;  4OVZ B;  1L2C A;  5EQT A;  1WXQ A;  1Y5O A;  3QBV B;  1ZC4 B;  1PLS A;  4LCB A;  2UVM A;  4L15 A;  2LNH C;  3ZH9 B;  2F5O A;  4JV5 M;  3GQ4 A;  5H37 D;  4MGI E;  2DZN B;  4MGK E;  1IXS B;  3RGS A;  1XXH B;  4AZF A;  2I1J A;  5KCV A;  3D8F A;  3GYP A;  2P8V A;  4KO8 A;  1IRS A;  4G6Z A;  1KFV A;  3SO6 A;  3L28 A;  4IIW A;  3FM8 C;  3GLH B;  4HLQ A;  5LON B;  2RUK B;  3HW2 B;  2CHG A;  4HHV A;  5D3W A;  2X8A A;  3QAU A;  2FE8 A;  1K82 A;  3KP1 E;  3FYD A;  4WJ7 A;  4GXB A;  4A6F A;  2XF3 A;  3FUW A;  1SGH A;  3U60 B;  3AJI B;  5DYI A;  1IXZ A;  2DWZ B;  2I7N A;  3L2A A;  3U6P A;  3TO1 A;  1NTV A;  3U8Z A;  2OQ4 A;  1UPQ A;  4A6H A;  1SXJ B;  1XKE A;  1W1D A;  2QBY B;  3RGP A;  3U5Z A;  2D4Q A;  3ULC A;  4WSF A;  3FUT A;  4FWG A;  1YUB A;  4A3V B;  3Q8X A;  3SMS A;  2UUB M;  5FI1 A;  4DV6 M;  1UNP A;  3A46 A;  3WHK A;  3SUZ A;  3NBI A;  2XEP A;  2LYD A;  1J09 A;  3DOA A;  2IFS A;  3TW1 A;  2LOX A;  1NY6 A;  3L27 A;  4Y94 A;  2BJV A;  1DO2 A;  3U61 B;  4B3T M;  4IBI A;  2M14 A;  5CLL B;  2G8L A;  4PDG A;  2D9X A;  3L25 A;  4KHA A;  3SAV A;  3CF0 A;  2Z4S A;  1GKI A;  2G5G X;  3HKP A;  4B7F A;  2CEA A;  2DVW B;  4JI5 M;  1YE9 A;  3KFU G;  1QC6 A;  2LUL A;  4GMX B;  4C0A A;  5BR8 M;  1IBL M;  3TWM A;  2XSZ A;  1KI1 B;  2D9W A;  2DWN A;  3P6A A;  3TQS A;  5D3Y A;  5EXT A;  3J7B A;  4X64 M;  3KOX E;  3GPY A;  1TDZ A;  2F4V M;  3M0E A;  3KS8 A;  1H10 A;  1XOD A;  3BJI A;  1WJ1 A;  3D8D A;  4MGZ E;  3MK6 A;  4DR7 M;  3GLG B;  5DIF B;  3J2P B;  3K1J A;  4XWX A;  2D9V A;  1NY5 A;  4FCW A;  2C99 A;  3PVS A;  4X62 M;  4EMO A;  5JP4 A;  3HU3 A;  2R18 A;  3U6D A;  4WW0 A;  5ITR A;  3KY9 A;  2KW0 A;  3VKG A;  2H1R A;  4QHT A;  4TYZ A;  4LFB M;  4HAV B;  1XX0 A;  4DV3 M;  1FGY A;  4BBK A;  2LXE A;  4K0K M;  5EXS A;  4JXJ A;  1V89 A;  1OFH A;  2RLO A;  2XFS A;  1UPR A;  1MK9 B;  1HNW M;  2GJY A;  3GQ5 A;  4HDQ A;  4P16 A;  4AW4 A;  4OU7 A;  4LFC M;  1TJ6 A;  1QVR A;  1GVN A;  4EIW A;  2YF0 A;  4IBK A;  2HL7 A;  2QPA A;  4MM3 B;  4NOO B;  4B7H A;  3PSC A;  5HE3 A;  3VOQ A;  3ZDT A;  2V6Z M;  3GPU A;  3PG7 A;  4A5K A;  1Z6T A;  3KRX A;  2L09 A;  3JAM S;  3CIK A;  1V61 A;  2UXC M;  2X49 A;  5DI9 B;  4IBE A;  4LF4 M;  2J7O A;  1KZ7 A;  3AJ4 A;  1LV7 A;  1NJG A;  1S3S A;  4NRW A;  5ITT A;  2FJL A;  4NL4 H;  2KZU A;  3NWL A;  1W1H A;  1K5G B;  3KZ1 A;  5HE1 A;  1EGX A;  5JLJ B;  4IBD A;  5EP2 A;  2NZ8 B;  1PJJ A;  1G8P A;  1L8Q A;  4YHH M;  1X86 A;  3A8Q A;  4DXA B;  1HNX M;  2QKL A;  1B55 A;  2M5Z A;  1IY1 A;  1DGH B;  4ITQ A;  3DXD A;  2VQE M;  3M1I B;  3SHF A;  3AOE C;  5LOP B;  2H7D A;  1U5F A;  1TXD A;  4WUR A;  4I5S A;  2C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...