3A9WA

Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
total genus 118
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a9wA00
2ILTA 4UREA 4CMGA 5HWSA 3FN4A 3VPGA 2NWQA 1GPJA 3QWIA 4B8WA 3IKTA 2JFGA 3OIGA 2P91A 3OETA 4NI5A 3WQSB 4EEXA 4R3WA 2OBYA 3A28A 1OAAA 2BFOA 1QYWA 4I9NA 5EIOA 4CM8A 1G6KA 1VSUA 2WTBA 3AFMA 1TB4A 5LCXA 4BNTA 1NP3A 3VH4A 4RPGA 4KUEA 3PHHA 1P74A 4ND2A 3TZHA 3ANLA 2X5JO 4UVDA 2ZIZA 1JDJA 3GH3A 1H6AA 4OIMA 2BI8A 3RU9A 3FWZA 4CUKA 4YJGB 1ZZEA 1GTMA 3HDJA 3JQAD 4U0JA 4CMKA 2VZ9A 4GAEA 2X5KO 4E5MA 4TRNA 1PJ2A 1T26A 3IC5A 4YBZA 4DMLA 2DQ4A 5BNIA 3PFWO 1V35A 3ANNA 5KKAA 3UHAA 1U9JA 3CPSA 3LZ6A 1GYQA 3I9JA 2D5CA 5JYDA 1YJQA 4XIJA 3MTJA 3QLJA 1P1KA 1YS4A 5CDGA 2DTXA 2WWRA 3GUYA 5CPBA 3VZSA 1T2DA 3QW2A 3BZUA 3GDGA 4WUVA 4IIUA 5T6BA 3DTTA 1DBVO 3BHJA 5TQVA 1X7DA 4UVIA 3CUKA 3L9XA 2IXAA 5L53A 3GDOA 2PGJA 3DOCA 3RBXA 9LDTA 4BO9A 2BRUA 1XEAA 3OEWA 3OQ1A 4YJDA 5A4DA 4IIVA 1DB3A 1Q0LA 3L07A 4KUGA 3GAFA 4GGPA 1F12A 3NDJA 2XPCA 3K73O 4CLRA 1HDXA 4JIGA 2GZ2A 2OBNA 4L4XA 3E1KA 1U1IA 2IZZA 5A04A 3JQ7A 1HKUA 3JQDA 1E3WA 1DPGA 4OYRA 1LSUA 1P31A 1AN9A 3RWBA 5DCUA 3KLMX 4RPHA 4UVHA 4W6ZA 4O1MA 4ZVVA 4WLVA 1A71A 4XCVA 4A7PA 3HSKA 3SLKA 5EPOA 4J49A 1LSSA 5I9LA 4ZQFA 3ZHXA 1VJTA 1N1GA 4EDFA 3RBZA 4GLOA 3Q2KA 1UP7A 1SNYA 2DFVA 3OQ6A 5TSDA 2QG4A 3DZIA 4I9HA 3OP4A 4JJIA 1R4MB 3KYDB 1RYEA 2C0CA 2RAFA 3BMOB 1IHXA 3DMTA 4BQPA 1T1SA 3RKUA 3VHRA 5AXDA 5H83A 5CDYA 4LVCA 1HYGA 2VHXA 5L4NA 3ITKA 4ZA2A 2JHGA 2GF2A 4HFNA 2RCYA 1HYHA 1D3AA 2RHRA 5IN5A 1W6UA 3MCVA 5JCJA 2P9CA 2E82A 1O95A 2GASA 4IXWA 1LEHA 5A3VA 4AG3A 3DAFA 2Y93A 3K9QO 3HADA 4I5FA 2J8ZA 3MZ0A 2B36A 3OJLA 2Q2WA 4EI2A 2B35A 2IEBA 4Z9XA 5HTOA 4DBVO 2BLLA 1PJBA 3GRKA 1A7AA 2PH3A 3L6DA 1I5RA 3N7UA 3D3WA 1HDOA 3H6KA 3V1YA 4WLOA 3TFQA 3FNFA 1Z7BA 4GX2A 1VKOA 1K6JA 1J5PA 5T67A 4E2WA 3VTFA 2G82A 4ZJUA 5KJFA 4YQZA 1KOLA 4IUYA 3ZWNA 3S8MA 1TT5B 3IIEA 2QHXA 4BMSA 1BHSA 5JCJD 1I33A 3H4VA 1ISHA 1U8XX 2RIRA 2Z5LA 4G65A 3PGJA 1A9YA 2P5UA 2YFQA 3E6AA 4BGEA 5C7LO 3IUPA 4IDGA 3JQGB 4JBIA 4FW8A 5DP1A 1EUZA 1AGNA 1B2LA 1MG0A 4PGFA 1HE2A 3AM3A 5CEEA 4RPKA 3JD0A 4Z9FA 1BMDA 2HKIA 3AM5A 2FPIA 5B4TA 1GCUA 1I32A 1J4AA 1E7RA 4BKRA 5ENDA 4PLGA 1SB8A 3WFIA 2PZJA 3LC1O 3I6QA 1YO6A 4LK3A 1HETA 4QUKA 4ILKA 3VZRA 1GZ6A 3MWDB 2C7GA 1TT5A 1WLYA 4QFDA 1PGQA 1UJMA 4R68A 3U62A 3R3SA 2Y0EA 3E18A 3QVWA 3QV1A 4CM5A 2NU6A 4MVJA 5G4KA 5JY6A 2EG9A 4CLOB 5KVVA 1U3VA 4ITUA 4UUNA 4HFRA 4PRLA 3HZZA 4R4JA 2EW2A 4FSHA 5ICMA 3OH8A 2GR9A 2D8AA 3F9IA 5F1PA 5AYVA 1PZEA 2DTEA 1GZ3A 2W2LA 4WCFA 4BKPA 3ZV3A 4GVXA 1ZEMA 1ZNQO 4K26A 4L4SA 3DBRA 3GRPA 5DT9A 3L6OO 3HWRA 3ST7A 1CF2O 3UH1A 2UUOA 3LQFA 1SB9A 4TMFA 3AWDA 5JCXA 5HS4A 1JWBB 2QIOA 4OAQA 4CQMA 3WJ7A 2P4HX 4MP8A 2YUTA 4NFYA 4J0FA 4Y8VA 4GWGA 3UICA 4XDYA 5K9ZA 2ZJ1A 5B12A 3HN7A 3GNQA 5CHEA 4J1SA 1DIAA 3OBBA 4OSPA 4CODB 3M2TA 2O7QA 4WCDA 2PK3A 2Y1OA 3ZW8A 4L4RA 1KVQA 5A5FA 2NU7A 3OMLA 4EJMA 3GDFA 5HRUA 3FTPA 4BS9A 2FRDA 3DBHB 1ISFA 2ZK7A 3D4NA 3UGKA 4DYVA 1E3SA 5L9AA 3V1TC 1TEHA 4K9DA 3R1IA 3IKVA 5JY1A 3WSWA 1CJCA 1NVGA 4ALIA 3GZNA 4R01A 5KJCA 4IGFA 4Y6SA 3O26A 4XYBA 4YXFA 3DQPA 2Y1DA 4G81A 5B37A 3RQSA 4L9RA 4YA6A 4B79A 1QV6A 1HTBA 1RPNA 3E03A 4E32A 1M67A 4S3MA 1I3NA 3FF4A 4HFJA 3Q1LA 3DMTC 4LVUA 2AEFA 5TS3A 1XU7A 1ZK4A 4N5MA 3PHIA 3UFXA 3LT0A 4KOAA 2EERA 3ZI0A 1GL3A 3ABIA 5F5NA 4W7IA 1EFLA 1DFHA 3PIDA 5THKA 2GN9A 3R6DA 3LT4A 1O94A 3EK2A 4F46A 3UKOA 1X0VA 1ZK1A 3G17A 2HU2A 3JD1A 2NQTA 1ZMOA 5AOVA 4YACA 2JHFA 3RVDA 1KC3A 3WNVA 2POQX 1XSEA 3B6ZA 3LU1A 5ADHA 3CKYA 4B8ZA 5TF4A 4M49A 3WXBA 3NV9A 4IPTA 3DZHA 1ZKMA 4RF2A 3FCOA 4NNJA 5ITVA 1HYEA 1KC1A 2HUNA 1H6CA 1XWFA 4LCEA 5JS6A 1DHRA 1NFFA 4S1VA 4HX5A 1ULSA 2JCXA 4KWIA 1PJ4A 3ITDA 4LMPA 2H63A 4Q9NA 3DXFA 2I9PA 5FI5A 1C0LA 1EDZA 2P2SA 1F8GA 2C07A 5IDWA 2OOSA 2QX7A 4J90A 5HBRA 4AL4A 3Q11A 1WP4A 4WKGA 4CM4A 4B7CA 4RVFA 3OQBA 3NUGA 3C8MA 4YR9A 4L73A 1SMKA 1BXZA 2A92A 2JCYA 1KVTA 2YZ7A 3OHSX 2C2YA 4GPD1 3DBVO 4WECA 1PS9A 3I6IA 3R3JA 2X86A 2HMTA 3VH1A 2GN8A 3UAGA 1SCUA 5EMHA 2NVUA 2AA3A 3L0DA 3RASA 3HFGA 1C0KA 4OXYA 3KSDO 4H15A 3UUWA 2ZATA 3SJUA 3KTDA 3DFUA 4KMSA 4QQRA 3GA0A 2OZPA 1SEVA 1Y8RB 1E6WA 1ZK2A 2EJVA 4NFSA 2Y0CA 4BO0A 1M75A 1Y8RA 1O8CA 3BIOA 1IPEA 4R1SA 4AJOA 2R00C 3PEFA 3JQ9C 3LVFO 4YJFB 3WFJA 4FFMA 1R0LA 4XA8A 4CV1A 3D7LA 3JYPA 2D2IA 2HRZA 4UULA 1JVBA 1ULUA 4WOJA 3ZWMA 1YBMA 1K5HA 1O5IA 5DNAA 2BFMA 3AUUA 1RKXA 1LUAA 1V0JA 1GQQA 4LISA 3VOSA 5JAZA 3GGPA 5JNLA 2EIHA 1E7YA 1MC5A 1R0KA 1PL6A 3BMQB 3FWNA 4MOWA 4IDDA 1Z75A 4LGVA 4CM1A 1CQIA 1EZ4A 5IXYA 3G0OA 2NNLD 1IULA 1IOLA 3K6JA 4MVJM 4DGSA 4AJKA 2IYPA 2BELA 3JQ8B 4BNZA 3NYWA 3U5TA 3D5TA 4GBJA 4YT4A 1IYZA 3VPXA 2FR0A 2BGMA 2HJSA 1PIWA 3AI3A 2YDXA 2YFHA 3OJFA 4ZQBA 4XJSA 3P2OA 2R2GA 3HE3A 4GLLA 4XYLA 3UCFA 2A4KA 5F1OA 4XQ9A 1K3TA 2NM0A 4IMPA 3WGTA 1UUFA 3HDYA 3WGHA 3QP9A 2NTVA 1DOHA 1QG6A 2ZCUA 3D0OA 3HHPA 3N74A 3QVOA 4J4HA 4NG5A 4PZDA 3VKUA 2J5RA 3AI1A 4IBOA 3WQRA 4CL3A 4KWHA 3K2EA 1LRKA 2EKPA 1GZ4A 2YW9A 2VWGA 3Q3CA 3NX4A 4ZQHA 5KWEA 4NJMB 1UH5A 4PFJA 3RUFA 3NTRA 5I7SA 1K0UA 4F6CA 3FNHA 3NT2A 1QR6A 1RM5A 2BFPA 3GEGA 4CMAA 3CEAA 4D43A 4DPMA 3UF0A 1K2WA 2PTGA 2HCTA 1S6YA 2X0RA 4P4LA 4R5MA 2GUGA 1SPXA 2V6MA 4QT0A 1HZJA 3JQCA 4UVGA 3AU9A 5JAMA 1N8KA 2EGHA 1C1DB 1IE3A 1X0XA 2YDYA 3QRWA 3WDSA 3EZYA 2W2KA 3VVBA 4XRGA 2O3RA 1MB4A 1KIFA 1KYQA 1M2WA 3PQDA 4KTVE 1FDTA 1HZZA 1VJ0A 1NQ5A 4KP7A 1PTJA 4EJ6A 4E33A 3E9MA 4FQ8A 1I0ZA 4FFOA 5LDHA 1VRWA 4E13A 1RM4A 1DRUA 1J49A 3GK3A 2OORA 4PZCA 4CJXA 2QRJA 1YH3A 3AFNA 4W99A 2C5AA 4DTIA 2Y99A 1N92A 2FN7A 3KBOA 3U4DA 4BO8A 4FFRA 5HS6A 3SXPA 1LLCA 2DBVO 1PGJA 1XQ1A 2B4RO 4LN1A 5ILOA 1AXGA 3UN1A 1LC0A 5CG2A 4FC6A 4D3SA 2NADA 4J6FA 2IYOA 5IAAA 1E3EA 4XZ3A 4E2YA 3W4KA 5BQFA 3ZWOA 2XAAA 1KERA 1KBZA 5H81A 3S55A 4Z6KA 1M6WA 4YTEA 1KY5A 3I9KA 1CIVA 3CH6A 4MVJD 2GZ3A 1R4NB 1MG5A 2J3HA 5DOVA 3WIDA 3LC7O 2B5WA 5KOIA 4W4TA 1Y8QA 1DO8A 1GDHA 4D45A 1AUPA 1Z45A 3E5RA 1IY8A 3LT2A 3OSUA 3QWHA 3B1FA 4IY1A 1B8VA 1PZHA 2AW5A 1LDMA 2W98A 2FOIA 1U5CA 2Q4BA 2UV8A 1M66A 3KO8A 1HDZA 1ZXLA 2NV6A 4JQCA 4ONEA 2FWMX 4JXKA 1D7OA 3BA1A 5KJEA 3ZV6A 3OA2A 2WEKA 2Q3EA 1A27A 4YAKA 3GY0A 3H5AA 4RDIA 4URFA 2DVMA 4Z3KA 4XJTA 3A14A 1KVSA 4E5PA 1LDBA 1MA0A 3AW9A 3S2IA 1X14A 3DWFA 5EN4A 2AQHA 2WDZA 2AQIA 4B3HA 2FZWA 2GSDA 4MP6A 1H0KA 1QP8A 2AG8A 4A2CA 2GYYA 3TPCA 3WIEA 4YT2A 4BNLA 3WGOA 1R37A 4UUMA 8LDHA 1PQPA 4D0SA 1GD1O 1XQ6A 4D79A 3CZRA 5JPIA 3PDJA 1PQUA 4CMIB 5C3MA 2DKNA 2TMGA 4KDEA 4PLCA 4AFNA 1FDVA 2WD7A 4RF3A 4M87A 4A73A 3RI3A 4OQZA 3BMCB 4A27A 4BO5A 1B3BA 3SJ7A 3BMQA 4XGNA 5I8ZA 4K6CA 2HDHA 2AHRA 5EQFA 1AXEA 2CVQA 4RORA 4BHTA 3PHJA 4XQGA 4KUHA 4K6FA 3H9UA 3RC1A 3P7MA 4E4YA 2C7VA 2Y0DA 1H93A 2WMDA 4ND3A 1NM5A 5JO0A 3DHYA 5I9NA 1RM3A 1XHLA 1LRJA 3AUTA 2NLOA 2Q49A 3MJVA 4YPOA 1Y7TA 4EJ0A 1C1DA 1V3VA 2BFAA 1HLDA 1Z73A 5TNXA 1PJTA 3WQQA 5K6AA 4O0LA 1DC3A 3TZQA 3UW3A 3CE6A 1PZFA 3WJAA 2J6IA 3BHMA 1A4UA 1QV7A 5DP2A 4B4VA 4CLHA 4ZHSA 3E9NA 1EVJA 2F1KA 4ALJA 4ZQGA 3BAZA 4Q3EA 2ZTVA 3F1LA 1MLDA 2G1UA 2VT3A 1N2SA 3JYLA 3NT5A 5BNTA 2I5PO 3JQFC 3A1NA 1B0AA 5TGDA 4XRRA 3SC6A 4AJJA 1DDOA 4Q3AA 5G0WA 1B3RA 3BMNA 1ARZA 4U8GA 2W2LD 1YB1A 1Y1PA 4U5QA 2PGLA 5B4UA 1JA9A 4M86A 1QLJA 4F6LA 2FMUA 4L76A 3IL2A 2X1HA 4BO3A 2C54A 4NMHA 5F21A 2EF1A 1E7MA 5FWNA 1EUDA 4MIOA 2QZ9A 1FDSA 1ISIA 3FD8A 3U9LA 1PR9A 4OOFA 4DXHA 1T24A 3G1UA 2EP5A 3VAZA 1YDEA 4E5NA 2R00A 1HDGO 2J5KA 3UCXA 2DC1A 1VM6A 3VZPA 3TJRA 1UZLA 4LRTB 3ZWPA 1MUUA 3DBLA 2TMDA 2EGGA 3KYCB 1LNQA 1P77A 2Y67A 3KB6A 3DAPA 4XGKA 2UVDA 4J1NA 3HNPA 2CVZA 3ZWAA 4LCJA 3ENNA 1HF3A 1GY8A 3ROQA 3DBRB 2E49A 4W9NA 2GGSA 1DXYA 2CMDA 2CVOA 2VNAA 2VN8A 3FHLA 2PZLA 2JCVA 1AHHA 1DIGA 3S2EA 4RZIA 3BMCA 4AJ2A 5HM8A 1IHYA 4UUOA 3GVCA 4J9UE 2CZCA 4J4BA 1KETA 1QXSA 2CF5A 4GH5A 4RQTA 4TZKA 3U4HA 4FFPA 3WYCA 3PHLA 2VWPA 4CLOA 1LQTA 2D1YA 1J6UA 2X8LA 2C5EA 1P33A 4CL8A 5DDIP 3MOGA 3UCEA 4QSMA 2NUAA 1WXDA 4JN6B 2PKRA 3AOEA 4R3NA 5AQ1A 4XIYA 2DFDA 4ND5A 4Y67A 2G17A 2O3JA 1UXGA 2H5LA 4NZ9A 4PVDA 3LYLA 4I8XA 4U0KA 1EBFA 4CLXA 1E6UA 4PG8A 4GMGA 2JL1A 2VYVA 3L77A 4FOSA 4O5OA 4Y98A 3A4VA 1PL7A 4CPDA 1ZUD1 3M1AA 1NQTA 3ZNOA 1GADO 1VLLA 4DQUA 4OXNA 1CERA 4IZIA 4ALKA 1SOVA 2DBRA 3IAHA 3RIHA 2X5OA 5TIIA 3GVHA 2I3AA 2V6FA 4YDRA 3HDHA 4NDNE 5JE8A 3K5PA 1GCOA 5GZ3A 3KYCA 3L9WA 1YQXA 3GG2A 2AG5A 4AJ1A 2AE1A 3ZWWA 1OC2A 5JDIA 4P4NA 1FDUA 3OJ0A 1WVGA 2HMUA 5FFFA 2HQ1A 3MJTA 2O3TA 2ZYAA 4PLZA 4KZPA 4PLHA 5C7OO 5L45A 4YRDA 3GAZA 4M1QA 3GG9A 2AEMA 4RLSA 4UEOA 3ZWXA 3CIFA 3JYNA 1A7KA 5IDXA 5COQA 4RVDA 3ZU2A 5DOZA 4YYZA 5FF9A 1GR0A 4R9RA 5L7YA 3ONFA 4I5EA 5DCWA 4EBFA 1ADCA 1UDCA 3ZGYA 3DEYX 3KV3O 1LSOA 4FS3A 5EJ2A 4YWJA 2X22A 4WNCA 3PRJA 3FTNA 3EDMA 1G0OA 1IB6A 1NPTO 1UP4A 1Y5MA 2I6TA 4NR0A 3AJRA 4GGOA 4P4GA 3RSHA 4B4UA 5JAIA 2X9VA 3INTA 3OIDA 4J7CA 4JBGA 4WCFC 1T4BA 2D3TA 1SEPA 3DHNA 1VC2A 2Y05A 4L74A 4K28A 4WEQA 4DIFA 5KKCA 3WB9A 2LDBA 3NT4A 2DBQA 2I99A 3QIVA 4M55A 2VRBA 4WASA 1DJQA 1LDGA 1F0YA 2EV9A 5G0TA 3TOZA 5G0VA 5L4SA 4DIOA 3ICCA 1VL6A 2OGUA 3DDNA 3F46A 1Y6JA 2EWMA 1P9LA 3H2ZA 1PQWA 3F5QA 1Y9AA 3T7EA 3ADPA 2J3IA 1FF9A 4O6VA 1F06A 5H82A 2C82A 2CF6A 2QRKA 3HQ4O 4FOOA 4J3FA 4IQ8A 4JNKA 5K0ZA 3A06A 4YJFA 3OJEA 2Y1GA 4R5HA 2XF8A 4WEOA 4ND1A 1S7CA 3I9LA 2O23A 3ORFA 5KTKA 2SCUA 4I08A 1NTOA 4ALLA 2B0JA 2BF7A 5DBGA 2GRAA 4R16A 1ZJZA 1O9BA 4HKTA 1DC4A 4YJHA 4DLLA 4DRYA 1SAYA 3E9QA 5TJ9A 1T2AA 2ET6A 2EW8A 2GD1O 4RPLA 3DOJA 3ICPA 1H2HA 4JROA 1LDYA 1HDRA 2DTDA 2YHIA 3GVIA 2YQ4A 4J1TA 3OM9A 1ZBQA 3K2BA 1EVZA 3RFVA 3JQAA 6LDHA 1KVRA 3EUWA 3U09A 4CM7A 3W8EA 1SOWA 4BV8A 2GNAA 2FPGA 1P0CA 1B7GO 8ADHA 3FR8A 3WS7A 2VRCA 1PJSA 2VWQA 4MP3A 3GGOA 3ZU3A 4D3DA 3JV7A 3C7AA 3OJOA 4ZRNA 4AVYA 4I1IA 4I5DA 1MGOA 1E1LA 1T2CA 2BHLA 4YAEA 1UXJA 4Z0TA 3W4JA 4CV0A 4WCFB 1KEPA 4J0EA 1XR3A 1E3IA 3VH3A 3PJEA 4E30A 1P1IA 1C1XA 4RZHA 1BRMA 1GUYA 3GN2A 1JU9A 1R12A 3KSUA 4WE3A 4Z9YA 4Q39A 5ENVA 4Q3NA 3GEMA 1X7HA 2BGKA 3H9GA 5JC1A 1X1EA 2P9GA 5AXBA 3RC7A 3QVXA 1UZNA 4RDHA 3HJAA 4BOYA 5CEJA 4BNNA 2FR8A 4E3ZA 3GPDG 1LC3A 2JKVA 3KEOA 1QORA 3PWKA 3CMCO 3BTOA 3WMXA 1GUZA 2NACA 3EVNA 1DIHA 3O8QB 3TZCA 3ZU5A 4FFNA 1HEUA 1PWXA 4PLFA 4KTTE 2EP7A 1Q0QA 4NFHA 4IDFA 2Q1TA 2NQ8A 5K6AC 3KYBA 5JMWA 2CDBA 1O89A 5AXCA 1EUCA 4FC7A 1D4FA 1H6BA 1EQUA 4Z0HO 3RJ9A 4B4WA 1NHGA 2VHZA 1ENYA 5T8KC 4CR8A 3RUIA 3QWAA 2Q50A 4G5HA 3C7DB 3ZH2A 1CDOA 3JD2A 2ZB4A 4P38A 5KJ1A 3EY4A 2X58A 4PG7A 4E21A 2VZ0A 3AK4A 3TWOA 1UDAA 4JGBA 5GZ1A 2CSUA 2J5QA 3AUSA 3RUEA 2Y1CA 2WYVA 3H8VA 3VDQA 1N7GA 1Q1NA 3U4CA 1B14A 4BV9A 5JSFA 1OFGA 3F4LA 2V6BA 3MWEB 3WX0A 5CEFA 2QYTA 2WM3A 1NAHA 1H9BA 1YL7A 1YWGO 3P5SA 1DLJA 1R0SA 4ZRMA 1U3WA 1I36A 4CLEA 4JCOA 2HK7A 4DQXA 1U28A 5TJHA 4RF5A 4OO3A 4MVJF 4HNHA 4GX0A 5A9RA 4CMCA 1PWZA 3UVEA 4YRAA 4CMEA 1DIRA 3KVOA 3TDKA 2DAPA 3PJFA 4BNYA 1L1FA 4NQZA 1I2ZA 3U3XA 1MC4A 3ZV5A 5IFLA 3GC6A 3AUAA 2XXJA 4II2A 4BNHA 3H7AA 1E7WA 4WLEA 1WDKA 1P1JA 5JYEA 4ESOA 1ZSYA 4IS2A 3HB5X 4BB5A 4OHUA 3JQFA 3NAQA 3JQBC 3KEQA 4MVJG 2B83A 3ZV4A 4ALNA 3GVPA 3GUCA 3ZCXA 1VPDA 1W73A 2CDAA 2VOJA 1TXGA 3Q0EA 4NJMA 5U4QA 3KETA 2PFGA 1VL8A 3TL2A 4MKXA 4ROSA 3D3EA 1I10A 3PTZA 2AEJA 1NASA 1MX3A 1NQAO 1PX0A 3FR7A 4NH4A 4U6SA 3BTSA 4Y6PA 3KLPX 3GPIA 1CEQA 3I83A 4XDZA 3V1UA 1PS8A 4RVHA 1HE4A 5A02A 3PVZA 3IUSA 4L0QA 4MVJI 4GWKA 1X1TA 4NBVA 3SX2A 3W6ZA 4EUHA 5C5IA 1EDOA 3DTYA 1NBOA 4NIMA 3PPIA 2B5VA 2IEDA 3N58A 3TRIA 2YV1A 3EW7A 4OGWA 3I5MA 1JKJA 4XKJA 1VSVA 4CLDA 1NFRA 1DFGA 2WE8A 1EMDA 1T1RA 2QZZA 1XIVA 5CDTA 1LJ8A 5CFZA 1BVUA 4XB1A 2CUKA 5I7EA 1P44A 2DBZA 5A9TA 4MVJP 2AXQA 2O4CA 1YB5A 1IZ9A 5CAEA 3UOGA 3BYZA 4W9NC 4YEDA 5COAA 3PYLA 2DLDA 3OFSA 3V2GA 1H9AA 3QVTA 1WWKA 2WSBA 3TSCA 4NJOA 2D0IA 3I4FA 3JQAB 4IINA 4CV3A 4BNXA 1FDWA 4AJHA 3JQ9A 1EVYA 3NGLA 4IJVA 5TT1A 5CG1A 4DLAA 3FNEA 4YCAA 1UAGA 2Z1NA 5JO9A 1QLHA 1YGYA 3WNQA 1B8PA 5L7WA 1QYXA 2BD0A 1T2FA 3AOEC 4FJ0A 3H2SA 3NEPX 3WR5A 1CRWG 4BO6A 2ZB3A 3QA9A 4DIBA 2VQ3A 1ONPA 2J3JA 4FD3A 1WDLA 5F3RA 2ZTMA 2PKQO 4O63O 4CM8B 4CV2A 1V3TA 2EJWA 4E0BA 1HDYA 2PH5A 1CWUA 3CZMA 1DFIA 5A05A 4NK5A 1E92A 3DBHA 3ETEA 5L95A 1ONNA 5DBFA 1ZSVA 4CMBA 1KEVA 5G4LA 3FPCA 3B20A 2D59A 3C1OA 1Z82A 1E6EA 3C24A 2VHYA 3LLVA 4LRSB 1QMGA 5C7IO 3BMOA 3NTQA 1IZ0A 1ID1A 3WG9A 1FMCA 1QRRA 1WZEA 3DL2A 3H3FA 3RUHA 4DPLA 3GZ4A 3W4IA 4DLBA 3ETDA 3NRCA 1JN0A 2PZKA 4WLNA 4KQXA 4UAGA 3WGYA 4JLWA 1E3LA 3H65A 1YRLA 4HWKA 5L3ZA 4AJNA 4DVJA 4OKNA 4ZN6A 5KVQA 1E0DA 1VJ1A 4YT8A 5DCYA 2Y1EA 3MJ4A 4ID9A 1XCBA 4DREA 1LLQA 1QKIA 3FSRA 3OECA 3CTMA 2F00A 4AJPA 2PZMA 1I2BA 3KUXA 2E6UX 3EZLA 2O2SA 1NVTA 4L75A 4AICA 2JD1A 1MXHA 5BR7A 4CR6A 4DA9A 2W90A 3JYOA 1N9GA 2NSDA 4WLUA 4EYEA 3H5RA 1XYGA 3GFBA 4HP8A 2EHDA 4YAGA 3NJ8A 1YL5A 1GQYA 1EFKA 4AJ4A 4IM7A 5A03A 3ZWBA 1ADGA 3GR6A 1MFPA 4CMIA 5JDCA 5JDIC 1U4SA 4F45A 2EKLA 2H1SA 4YJGA 3V2UA 2FR1A 4FJ1A 3CINA 3WLFA 2DM6A 4YAJA 4C7KA 1YB4A 1ZW1A 2AMFA 1U4OA 2V65A 2X7HA 1YL6A 4HXYA 3A9WA 3DZBA 4WK6A 1JKIA 2EKQA 3PXXA 1U7TA 4JJGA 1I3KA 4LSWA 5L4LA 1V8BA 1NYTA 5DF1A 1LI4A 4R1TA 2IODA 3K30A 4FFLA 3WWZA 2O2YA 3T4EA 1LX6A 4DUPA 5ES3A 2E48A 1D1TA 2J3KA 3T4XA 3ENKA 1KY4A 4J16A 1R66A 1HDCA 1EVIA 2LDXA 2NU9A 5L40A 2JAPA 3KOUA 2JFHA 2PA3A 2VYVD 3GF4A 1ZK3A 3ANMA 3RAJA 1K6IA 1LRLA 1GFSA 2WE7A 5G4KB 2WD8A 4XGIA 2NU8A 3DC2A 4N5LA 1VI2A 2VNSA 4HV4A 1WZIA 5BSGA 2HRBA 2VRCD 5IJZA 1ENOA 4RPJA 5KVCA 1R15A 3PZRA 4CMEC 1DC5A 1LA2A 4PN3A 3WGIA 2NTJA 4E12A 4BIIA 1G1AA 5U1PA 4YQYA 3JQ6A 3IP1A 3DONA 4NU6A 1H6DA 3V5NA 3W1VA 4U7WA 2PWZA 3LT1A 3TL3A 5IF3A 1A5ZA 2GLXA 4RCVA 4PZEA 4C4OA 2HO5A 4RO0A 3EHEA 3ETGA 3AY7A 1DRVA 4OJNA 1UXIA 2ZCVA 3VPHA 3ZHYA 2I65A 1LLDA 3ADOA 1ZVMA 5C37A 4OH1A 4FGSA 4JP3A 4TRMA 5J23A 4D7AA 2C59A 1Q0HA 4NBRA 3KYDA 4CM9D 2A35A 1C0PA 3M6IA 4UEKA 3EGOA 3E5MA 1HSZA 1YOVA 5EQDA 3PLNA 4IS3A 2Y1FA 2FY8A 2P9EA 4BO2A 4BMNA 1TI7A 4NPCA 1DAPA 1O6ZA 3KRTA 2HMWA 1K6XA 2W2KB 4G2NA 3GMDA 2X4GA 4KDFA 4QFCA 4CQMB 3GLQA 1E1MA 4WJZA 3DB2A 3O03A 4DL9A 1W8DA 3B1JA 3ONDA 4BO1A 1U3TA 4DPKA 3NDRA 3ZU4A 3S2FA 2PR2A 4RL6A 3RKRA 1D8AA 1ML3A 1E7SA 1U7HA 2YY7A 2G0TA 3EMKA 4EUFA 1EQ2A 3JQEA 5IZCA 5KVSA 3H9QA 4CR7A 3EC7A 3PK0A 1RJWA 3F1KA 1N9GB 4CM9A 4A03A 1XLTA 2Q4EA 4RF4A 1BGVA 4R54A 2FSSA 4RGBA 1PGOA 3OF2A 1GYRA 5EINA 4FPXA 3FNGA 3GHHA 4DYDA 2VUSA 1AE1A 1OC4A 1NVMB 1PSDA 1IPFA 3F5SA 5CP8A 3FI9A 3G49A 1BWSA 4D0RA 4D46A 2Q2QA 3FBTA 3OA0A 3DMYA 1Z74A 4HUJA 4B3IA 3AM4A 4YVFA 4GI2A 1WAMA 3W8DA 3RJ5A 5L51A 2Z1MA 4MJLA 5BSHA 4BNKA 4A10A 3RROA 3NJ4A 4IQGA 4YRBA 3IS3A 1C3VA 3DBLB 4QO7A 1YQDA 3BMNB 5CPFA 2YHUA 2VTEA 1I3LA 2X6TA 4QTZA 1I2CA 3K96A 1P45A 5AXAA 3GT0A 5ER6A 3JQ7B 4XX0A 1WDMA 2CDCA 3BHIA 3G79A 2UAGA 4J2HA 1TA4A 4BNVA 4L8VA 3LK7A 3ZN2A 2Q99A 3VTZA 2OUIA 2BMAA 1IUKA 3P19A 3DZJA 4PG5A 3GNTA 5JC8A 1JLLA 2NVBA 5JDCC 4HNGA 3DZKA 1NPYA 1YKFA 4U6QA 3K31A 3D64A 2PGDA 4Q3BA 3MOIA 4NBUA 5JLAA 1XG5A 4M89A 4J4TA 2FSVA 4X54A 3VH2A 3GHYA 2GN6A 2VZ8A 1QYDA 5TLSA 1B8UA 3QWFA 3GZNB 1Z6ZA 5GZ6A 3UXYA 4PVCA 1Q7GA 3AU8A 2O3UA 4MINA 3JD3A 1YONA 3TOXA 5KNLA 4XR9A 3LF2A 2Q1SA 4D44A 2BI7A 3KHUA 2X0JA 1T4DA 3I52A 5LC1A 4C7JA 2VCYA 3ZHBA 1X13A 1HE5A 1XELA 3F4BA 1E1KA 1HE3A 2WD7B 4B4OA 5CDSA 3LC2O 1WPQA 3IJRA 5IG2A 1SBYA 4H3VA 4J43A 2BH9A 2ZB8A 3O8QA 4TKMA 4LW8A 2VHVA 2WJPA 1I24A 2QRLA 5B4VA 1N5DA 4IJWA 1BVRA 3ON5A 1KVUA 3HN2A 5AVOA 2PY6A 3WICA 4YJHB 1GQ2A 1DC6A 4FB5A 4GVLA 3WTBA 1XKQA 1BG6A 1ADBA 3M2PA 4PLWA 3S1LA 4ZICA 2ZYGA 1ZXBA 2IZ1A 2YHIB 3RCBA 1NPDA 1FK8A 5B1YA 4TVBA 4YAIA 1I8TA 2YJZA 2BGLA 3I23A 3WYEA 4CUJA 4GSLA 3QY9A 3MJSA 1W0CA 5T8KA 4OL9A 5KIAA 1WMAA 2B4QA 1L7DA 1ONOA 4J7UA 3Q9UA 4XB2A 4CLRB 3DFZA 2V6GA 1T2EA 2E37A 2EXXA 3WWYA 1ZK0A 2VWHA 3O9ZA 3JQBA 3G3EA 4JX8A 4PCVA 2B37A 4E6PA 4RV9A 2PD4A 5A9SA 2EEZA 4N7RA 3GQVA 4Y6RA 4BB6A 1C0IA 3RC2A 1UZMA 3X2EA 2ZB7A 2YQ5A 4IDCA 2XXBA 1YOVB 4XYGA 1U3UA 4YB8A 3AY6A 3PI7A 1LDNA 3BTUA 2GN4A 1TLTA 1DAOA 2D4AA 2ZQZA 4JJFA 5G0SA 4MIEA 1EE2A 2UDPA 3IQDB 3GN1A 3COSA 1DSSG 3PDUA 1YQGA 1NWCA 3AOGA 1Q7CA 5L7TA 4KQWA 2PLAA 4A0SA 5KCZA 3PQFA 1NR1A 4WNIA 5COBA 3RFXA 4BKQA 2O4UX 1I30A 4W7HA 1GEEA 5DULA 4ALMA 4TKLA 4IXTA 1Y8QB 4OKIA 1ZEJA 1LDEA 4GKBA 1Z7EA 2VOEA 3VKVA 4BNFA 1FJHA 3GGGA 4RLHA 3EVTA 3ROMA 4EEZA 4OSOA 1JAYA 3V8BA 1AHIA 4R41A 1MFZA 1YJ8A 1GYPA 2Y66A 1YDWA 2IDZA 1GU7A 4OQYA 1LTHR 4HADA 3F6YA 5LDGA 5IZ4A 1E5QA 5T57A 3X2FA 3LSYA 1WW8A 5GMOA 4DMMA 2JD2A 2X0IA 2VT2A 3CSDA 4PLVA 2CY0A 1LQUA 4OOEA 1JWAB 2OFPA 4IDEA 3IDSA 4UEJA 4P8RA 3LLSA 1TVEA 2G76A 2RH8A 3RUCA 1HXHA 1GV0A 1V6AA 2H6EA 3B70A 1A72A 3C7CB 4TRRA 4UVEA 4XYEA 4Z3DA 3ZWYA 4D3FA 4MIYA 4Q3DA 3E8XA 4BUCA 5JAQA 1XU9A 3PQEA 2IZ0A 4JK3A 1JTVA 1SO8A 3M1LA 5F5LA 1OBFO 1P0FA 2JJYA 2OO5A 4BNWA 2GZ1A 4R9SA 2O7SA 2W8ZA 4NBTA 2HMSA 1E77A 5A06A 2GDZA 1K89A 1PGNA 4J1QA 3U0BA 4FIZA 2UYYA 1OZAA 3ZWVA 3GVXA 4BO7A 2OL4A 5ICSA 3L6EA 2PD3A 3STHA 3U4IA 1NX6A 1DIBA 3PHGA 1BXGB 4FN4A 4NBWA 1UAYA 5EL0A 3AI2A 2I66A 3C3XA 2C20A 2RH4A 3FBGA 4FDAA 1G0NA 4IZHA 4BNIA 4QX6A 3ZNQA 4B3JA 3ROKA 3CMMA 1FXSA 2HK9A 3LF1A 4QXMA 3OEYA 4GL4A 4AJEA 3WYBA 2HLPA 4CM3A 3D4OA 3JTMA 3PP8A 4K1LA 6ADHA 1GUFA 3KZVA 1DRWA 3I4CA 3VDRA 1ADFA 1DLIA 1KEWA 1E5LA 1KS9A 3Q9NA 4RVGA 3SC4A 1Y9EA 1C1XB 3IOYA 5I7VA 3FRJA 1OMOA 3Q2IA 3K8ZA 1CYDA 3QHAA 4CUZA 2QQ5A 4IQ0A 5BSEA 5FI3A 1ISJA 3INGA 1ZCJA 4EZBA 4R51A 3H9EO 5JXWA 2OP1A 4E2ZA 1GEGA 4WGGA 4R1UA 3KXDA 2QW8A 4TRJA 5DN9A 5DZSA 4BNUA 1RWBA 1ISMA 1E1NA 4BKOA 1NHWA 2E4AA 1Q7BA 2GCGA 3R0IA 3ROPA 4ZQEA 4CQLA 1KEUA 3L4BA 4J2OA 3TFOA 4CQLB 5IDQA 2HJRA 4TSKA 3IJPA 7MDHA 5EESA 4RVUA 1Q2XA 1P1FA 3WBFA 4BNGA 2ZTLA 2FP4A 4J9VA 1P1HA 1ZO8A 3D5QA 2A94A 3DAGA 1HL3A 3H9JA 5JMPA 5A5EA 5IXSA 5MGBA 3HDQA 1PGPA 2VUTA 3NKLA 2AE2A 1DEHA 4GSKA 3KM0A 2X23A 5G2OA 4P22A 2W4QA 5ILGA 2IXBA 2UUPA 1P3DA 1L7EA 4IMRA 3I1JA 5JBIA 1PJCA 1P1RA 1T25A 2P68A 3DO5A 5GY7A 4EW6A 2I3GA 3WMWA 3RUDA 1PZGA 2X9GA 3HG7A 5ER9A 4BVAA 1UXHA 2I76A 3PJGA 1EK5A 5MDHA 2ZYDA 4ZGWA 1ZH8A 4QECA 2R6JA 4GX5A 4ZU3A 1SZJG 1ISGA 2DPHA 3IP3A 3MEQA 2X9NA 2C29D 2PD6A 1NXQA 3BXXA 1X7GA 1M76A 1X15A 1ZJYA 3OICA 3PWSA 4R69A 1B26A 1BXGA 4BQRA 1ENZA 4DC0A 2O50A 3JQ8A 4XEHA 2RBEA 1LSJA 2ZKLA 3VVCA 4EUEA 2WYWA 4MO2A 4JBHA 2QYSA 3F47A 1E7QA 3D4PA 1Y5RA 4FGWA 1HT0A 4FR5A 2CNBA 1I3MA 3W8FA 1Y81A 4M8SA 4LSMA 3I9NA 3PFFA 4Z0PA 3JD4A 2WYUA 3S2GA 3VC7A 3B1KA 4BGUA 4MKZA 5TC4A 3TZ6A 4FBGA 3SEFA 3CXRA 1XDWA 5DBIA 3RU7A 3H3JA 4E5YA 2Q2VA 3NDIA 1D1SA 1EK6A 5ITWA 1BXKA 5BSFA 3HFSA 3WGQA 3ZHZA 3PIIA 4R1NA 4BO4A 1B16A 2FHSA 1V9LA 5HA5A 3VPFA 4QEDA 4RQUA 4CM4B 4XQEA 5CDUA 5A9SB 4Q3CA 2DU8A 4N18A 1QSGA 3KSZO 2HSDA 4H16A 4B7UA 5G0UA 1MV8A 4HY3A 2NVUB 2YV2A 1OOEA 4HFMA 2DT5A 2GO1A 3F3SA 4E31A 2JAHA 3O38A 4CQMD 1WNTA 4N5NA 2DUWA 3VZQA 4TVOA 3QJ5A 3QWBA 4CM6A 1B15A 2Q45A 3PGXA 1R4NA 2VHWA 4FCCA 3K92A 1NFQA 3E48A 4W82A 3JSAA 1XA0A 2NVWA 1UR5A 1UXKA 4TQGA 4CMHA 5BT9A 1HRDA 1CQJA 1RYDA 2P4QA 3MJEA 3WTCA 2GPTA 5KJ6A 3O4RA 1JAXA 2VUUA 1NQOA 1R16A 4E5KA 4RJTA 1F8FA 1PS0A 2RHCA 4INAA 4EGFA 2JD0A 3I9MA 2AQ8A 3JYQA 3RUAA 1XGKA 2OMEA 4WPGA 4D42A 3PWZA 4GQAA 2GERA 1JW9B 1CETA 4GX1A 4FJ2A 4QO8A 4BKUA 1V3UA 3ONEA 2D5AA 4BNJA 3D3WB 4NK4A 3FPLA 4NU5A 1YE3A 1E3JA 2CFCA 1DHTA 2FPPA 3OIFA 4IJKA 1LU9A 3QQPA 2P5YA 4ND4A 4OM8A 2ZJ0A 4EITA 1F14A 1HSOA 2CD9A 3MJCA 4H7PA 5T64A 1R6DA 4OMUA 3RFTA 4MKRA 3TZKA 4B7XA 3GNSA 1BDMA 3TQHA 3U49A 3WGGA 2O3SA 4PRKA 5IZCC 1C14A 1HLPA 1PU2A 3PYXA 4GMFA 1N7HA 3ULKA 1H5QA 5IN4A 2C2XA 3RD5A 1ORRA 3TF5A 1GAEO 3C1AA 3DR3A 1H94A 1U5AA 4MDHA 3PLRA 2A9FA 1GPDG 3W6UA 1LLUA 9LDBA 1ZSNA 1BTOA 1YVEI 2B4TO 7ADHA 1NR7A 3JCZA 4OXKA 3C1TA 2B69A 1BW9B 4WOKA 1EBUA 2NTNA 3V2HA 3DHEA 2VYNA 2YYYA 1ZMTA 5A3JA 2Q46A 3RC9A 2HK8A 5I7FA 5THQA 3NTOA 3EAGA 3IMFA 2PV7A 3P2YA 4CMJA 4DBZA 3I9OA 1PJLA 2ZTUA 3T7CA 2X0NA 1OI7A 2H9IA 3BTVA 3D1LA 4PG6A 3VPSA 4J91A 3GFGA 4IJUA 4MPDA 3ZNNA 1EE9A 1PJQA 3WGZA 1N1EA 5I8WA 3DZGA 3QSGA 3QE3A 3HB4X 1LBEA 4YT5A 4BNMA 2G5CA 3GEDA 4D41A 3WBBA 3SVTA 3ASVA 4XR4A 2IE0A 1MXFA 3L4BC 2OXIA 1YXMA 1VKNA 1BSVA 1R4MA 5JFOA 1TT7A 3TN7A 1U2GA 1NNUA 4TROA 3ZWCA 2AQKA 1J0XO 1M6HA 1WMBA 2O3QA 4TZTA 4JP2A 3C85A 1YBVA 1A9ZA 2OP0A 1PEDA 4BMVA 1GV1A 1A4IA 2FZEA 2XOXA 4A5OA 1HWYA 5A1TA 2O48X 3SBOA 1I01A 2DPGA 5FEUA 1NAIA 3WLEA 4PLTA 3ZZNA 2IRWA 1U2DA 4ZD6A 4II3A 3RBVA 3NGXA 5EERA 2Z95A 1E3WB 2BKAA 1F17A 4MVJH 4IGEA 4UUPA 1JVSA 3GOHA 4XWYA 3QVSA 4TWRA 1SC6A 3LDHA 1PJ3A 1PR3A 3WSVA 1H2BA 4XYMA 1NWHA 3L4SO 2YV3A 3H5NA 4IDAA 1QYCA 2Y68A 4PIVA 1EEHA 4PG4A 4E2XA 1VL0A 2PNFA 1BDBA 3G1TA 5U9CA 3PYMA 1RM0A 3HUDA 1DJNA 1QYVA 3MTGA 4F3YA 4HBGA 1BW9A 2OHXA 4Y9DA 4PLPA 4AJLA 5I9MA 3ASUA 4XQCA 4WLFA 5FYDA 4BGVA 3E82A 5BNFA 4DQVA 3ZDFA 4GKVA 3PJDA 3I3OA 4I9UA 2PKQP 2JFFA 1O0SA 3INRA 4PLYA 5F1KA 3AY3A 1JQBA 4BGIA 1LXCA 4NHEA 3EYWA 1ZFNA 1UP6A 1IL0A 1ZIDA 3GMSA 3WOHA 3PZBA 2Q1WA 2V7PA 4DWVA 4O59O 1VE9A 3Q6IA 4I5GA 3ZNPA 3DOOA 2DUUA 2ZQYA 2I67A 5TRTA 5TT0A 1MP0A 3ZW9A 1PL8A 4XD2A 5TX7A 1U8FO 4LMRA 1ENPA 3SLGA 1W4ZA 5JW6A 2VTDA 5T5QA 4BL5A 4M54A 3JQGA 3TNLA 2HMVA 2VYND 3DZFA 4AJIA 4RVSA 2HAEA 2Q1UA 1UDBA 1YBAA 5IDYA 4N54A 1JKFA 4DC1A 4J7XA 4MVJE 4IDBA 4A26A
chains in the Genus database with same CATH superfamily
2ILTA 5HWSA 1G5TA 2N1MA 1O9HA 2VS1A 4B8WA 1GPJA 2UYCA 2H4WA 3OIGA 4B4KA 4EFKA 3UMSA 2AWNA 3WQSB 4EEXA 2QTGA 4I9NA 1OAAA 5EIOA 1QYWA 1YUNA 1O8BA 2X7XA 3NBXX 4R8RA 4AURA 1GTVA 2F3QA 5BPFA 1TCVA 5CBPB 3CLUD 2GKSA 2ZRGA 1SXHA 4BNTA 3C70A 3HNOA 5DSTA 1JHDA 2IHBA 4M8LA 1FEZA 4DDTA 1CE8A 1QZ3A 2I0FA 4TTJA 3TZHA 5F64A 5CJJA 3HA2A 3MWDA 3KPYA 4YDHB 4RMHA 4BNDB 1UF9A 2O2EA 2C3MA 3HY3A 3K6KA 5IARA 3WGMA 3ABSB 2BI8A 3GEHA 4FYYA 2AUTA 4F3CA 4RD0A 4YJGB 4BP3A 4JWKA 4LF9B 3A36A 4DWJA 2VZ9A 5TB5A 5IEBA 4IOKA 5F9MA 4TRNA 1ESDA 3TTWA 4JA0A 2ERYA 3IC5A 4L1KA 4YBZA 4C29A 1QU3A 1LGYA 1JX6A 3W90A 3OI7A 3PFWO 5KKAA 4MW4A 2VEOA 4NOKA 4M1TA 1CY6A 3L7AA 4P83A 4U9UA 5AKXA 5EZQA 4MK4A 3HA3A 5BOSB 2FA9A 1S3IA 1SIWA 2GPJA 4QARA 2BGRA 1EGQA 2X2FA 4GZ5A 2DTXA 5HF8A 3LK6A 1O6BA 3IDAA 1LWNA 3UB3A 2ZRQA 4JT4A 3BWYA 4ZJZA 1T2DA 3QW2A 4YCNA 2Z8XA 4WUVA 1J24A 2J3DA 4X7PA 1FDRA 3U39A 4FWTA 4CG2A 3UGTA 5CLLA 3LD9A 1DBVO 1FLVA 3BHJA 4UVIA 3CUKA 5L53A 3QTLA 3K53A 2UZ1A 1G2IA 9LDTA 2ANCA 1GZ5A 4PR3A 3UJAA 4I4IA 1RCUA 1LBTA 1OWLA 3G88A 4CKBA 1JQJC 3WDMA 1G21B 3L07A 3QHQA 4DM7A 4KUGA 1HLFA 4GGPA 4GR4A 1UT8A 2ACVA 2PZ8A 1UPCA 2BPOA 1F12A 3CNQS 3T3PB 1R9MA 3WBKA 1SXPA 1H2FA 4J8PA 1QHNA 2XDAA 1KK3A 3LPAA 3E1KA 4HATA 4L4XA 5AK0A 1SH7A 4MUIA 2R5WA 1GGKA 4I0WB 1IXZA 2E4UA 2GFQA 4P81A 1MHPA 4P5EA 2C84A 5TE9A 2QTLA 2XNDD 1EIZA 1NOJA 2I3ZA 3T06B 1LBHA 1AN0A 2HF7A 2QMHA 1P31A 3QG1A 1MOZA 1J22A 1LW6E 4LTNA 2QD1A 5EKUA 3EC2A 4OAOA 4JA2A 3R75A 3L82B 2QLTA 2C99A 2WOJA 3N7AA 3PC7A 1K4MA 5LD2B 3PEYA 3ODPA 1V96A 2KSQA 4M4SA 1U2RA 4UVHA 3MMXA 1R64A 2W2XA 5CXXA 4ZVVA 4A7PA 4C7OB 3HSKA 2XQVA 2I80A 5TQ0A 3H17A 3SLKA 4LK2A 3FFXA 2G4LA 5EPOA 5EZYF 1LSSA 4KXLA 4C05A 2BVNA 2JHCA 4PAMA 3PLAE 1M33A 1VJTA 1NI5A 3K1TA 3RBZA 4GLOA 5H70A 7ABPA 2YVAA 1FRNA 1SNYA 3OQ6A 4TWBA 5TSDA 3PQ7A 2HNBA 4DJ5X 1AGPA 3M5DA 4BQNA 5LYJA 4WI1A 2N3ZA 1MGPA 5ICFA 5DM1A 3HHEA 3DMTA 4KFRA 1J9ZA 4KE8A 5B1EA 2RGEA 3K9CA 2FZ5A 2FJ0A 4GRIA 5A0TA 3E05A 3V1NA 2ZJ6A 2ZRFA 2VHQA 1K63A 3GD5A 3CUEF 2RHRA 3CRMA 3A6HA 5IN5A 1QU2A 4BMOB 4K05A 4L3WA 2QTCA 3HUEA 1EM8A 2QP4A 4BQQA 5JCJA 2NU8B 5K0CA 3I53A 1O95A 421PA 3E9CA 1C30A 2IUSA 4O4LB 5EJ9A 3K9QO 1KDVA 2Y9MB 5K3FB 2J8ZA 2QLFA 4EX7A 2B36A 4I55F 4OHVA 2VJMB 4JI7B 3EIXA 2VSQA 4UEWA 4UPVA 2H2HA 2OCPA 4MQ5A 1M2VA 3DTNA 1YS1X 3L4EA 1Q44A 3GJYA 3P9XA 4ITVA 4COKA 1P2VA 2J08A 5SYAA 1D0IA 5HTOA 5EVJA 1EZ1A 4DBVO 2ZI7A 2BLLA 2AFRA 4QOGA 1M1ZA 4CYMA 5IPFA 1XNGA 2Q3JA 1MX9A 1HM5A 2VXBA 3N7UA 3OEHD 3QKRA 2IQIA 3ZGZA 1T5TA 4RZSA 3ZKWB 3G0GA 5KNBD 4WLOA 3MUOA 4HQOA 1ZS9A 1HI9A 3VTKA 3GZTB 3BN3A 3KLNA 4MW9A 4GX2A 2FLKA 4O4JF 1RRGA 2B4AA 5FTLA 3O4JA 3AR5A 2ZAIA 4KWTA 1Y3BE 2YMPA 3NU1A 4G4SP 5KJFA 1ZXXA 1X1CA 3WRWA 5LMZA 5IKOA 1DXQA 3ZWNA 4XCXA 3DEJA 2X41A 3S8MA 3UHPA 1TT5B 3N2LA 3ZCTA 3V4RA 3QNUA 2XUPA 3CEHA 2WF7A 4FDVA 5D3ZA 5JCJD 2FQ1A 1XPOA 3KPWA 4LFCB 4RFSA 1IMJA 3VSAA 1MHTA 3PGJA 1L4MA 2WM8A 3IO3A 2BFNA 1A9YA 1QIMA 2G07A 3LP6A 3PPVA 1HEYA 1CY7A 4HDSA 4RAOA 5LZ5A 1QDLB 4XLZA 4K0KB 4F12A 2V7TA 1TTHA 1VCIA 3IUPA 2IJGX 5IBPA 4R2WA 5GQSA 4MKHA 3U2QA 5GVSA 3HO1A 1B2LA 2JIZD 3H5WA 4XUDA 4AIIA 1XZQA 2NZJA 4UXHA 5CEEA 5HJ2A 3JD0A 4WZBE 4FNMA 1CR1A 3T35A 1Z8HA 4DMFA 2IBMA 3MF4A 4N0PA 3VJRA 1J4AA 1QFXA 1E7RA 3L7LA 4PRZA 3U7JA 4EQ6B 2CXRA 1T15A 4F85A 3KQNA 3HTXA 5TQ2B 2ZUEA 1SB8A 3PQ4A 1J06A 3TL6A 4EJ2A 4UBNA 3I6QA 1RLUA 2GM5A 4U7GA 5FRDA 4B4UA 4QUKA 5JAIA 3MIZA 1YU6A 3NVMB 1DEAA 2C7GA 4XWAA 4JMLA 1LV8A 1TT5A 4QFDA 1B00A 1XMSA 1S9DA 2YZ2A 4Q3LA 2XMBA 4RTKA 2Y0EA 3SHWA 1XV5A 4UHJA 3QV1A 3WO1A 4CIXA 3PC4A 2WU3A 4CM5A 1UCFA 2CHUA 3AIOA 1T1EA 4MVJA 5JY6A 4X66B 1DCKA 1AHNA 5DHAA 1TKCA 3T7KA 4DZZA 2XWSA 1N8TA 2DPXA 1RHQA 3L93A 3WK5A 4JD5A 5C18A 5AHKA 3A6FA 3OH8A 4TVKA 1QC5B 2VJDA 2I1LA 1E2EA 5IJXA 4F1KA 3HJFA 3VPDA 1I94B 1CNMA 2HCFA 2DTEA 2XOEA 2BGNA 3CFYA 1N6IA 2EJBA 4WCFA 1JQKA 3VSBA 3FPJA 1Z83A 3ZXYA 5IVPA 4K26A 4PS0A 5DT9A 3GRPA 3BCUA 1Z39A 1O97C 2B4KA 2CLDX 3L6OO 1VHLA 3N8HA 2GRJA 3ST7A 3WMFA 2GPWA 3UT0A 3P4UA 1UJ6A 2UUOA 5HF9A 3OO1A 4TMFA 1QOQB 3N3AC 5HS4A 4DZRA 1CUGA 4UBMA 1WXXA 2C4NA 4QELA 5MF6A 3A4NA 1KYWA 2YUTA 1PO7A 4NFYA 1XDUA 3CWQA 5T4FA 3ZQJA 3OA0A 4XDYA 2OBMA 4CKBB 1KP2A 4MAAA 2LCIA 3GI1A 2ZJ1A 4HXEB 5B12A 3TRHA 3GNQA 4DA4A 1P72A 4TTVA 1D5CA 2W48A 4DJFC 2AUMA 4QLBA 2ZT8A 2NO6A 4OSPA 4CODB 4Z54A 1NXWA 2OQ2A 3AX6A 2W2NA 2PK3A 2Y1OA 1Y4ZA 3FYCA 3HZRA 2JIZA 3OU7A 1IWPB 1CE8B 2BCEA 4IUBS 2DLNA 3CCFA 3UMVA 5A5FA 2F43B 1TD1A 2FFAA 2WT8A 2Z0MA 3OMLA 1EAMA 4D4HA 2JDID 3HBFA 4HXFB 4EJMA 1H3EA 1T9AA 2H92A 2FPIB 4Y0VA 1GILA 3L1KA 1UM8A 2ZK7A 4EEKA 3PVSA 2A1IA 1I4OA 2DHRA 2VP5A 5F7OA 5L9AA 3KCNA 3EDRA 2BM0A 1IY1A 1YV9A 2PUVA 4G1FA 4IIXA 3R1IA 3RH0A 1UWKA 2V6IA 3HYCA 3IKVA 3ORYA 2G6BA 2H85A 3TLEA 1XZMA 3PQ2A 5KZMB 3WSWA 2OPBA 2FUEA 3BB4A 1QAOA 1JLMA 3AR9A 4NAVA 2R66A 1A9PA 2JEOA 3WK4A 1WZNA 5UKDA 3TIXB 1X7ZA 1W75A 4LJ9A 4UQOA 2H16A 3NAZA 1TVCA 2R96A 4PC7A 4OFWA 4WHMA 3JYHA 3VR5D 4F11A 4G81A 3QXCA 1FW8A 5JG7A 1Q1QA 3DL7A 1QV6A 1HTBA 1RPNA 2PQ6A 3C5HA 3HACA 4H1HA 4CGZA 3ZDBA 3WA6A 1QIHA 3WLKX 1M67A 4WBNA 3NGMA 2H5JA 3NH6A 1ZJ6A 2RJNA 4RJ2A 1BEZA 1GSIA 3DMTC 3MGGA 4PRYA 3JRXA 2OG2A 1XU7A 3UFXA 2VJPA 4FYIA 2R87A 4NDZA 1B6SA 4KOAA 2EERA 3AL0C 1GL3A 2JKYA 2YL2A 3PIDA 1WU8A 3KEGA 4URVR 1P2TA 2GN9A 2REQB 4GOJA 1NI3A 5HILA 4BEVA 1Z5UA 3RV4A 1T5DX 2G70A 5TPWB 3UKOA 2YXEA 4HGPA 3G17A 3G2MA 1CT9A 3JD1A 2NQTA 4RJLA 1ICEA 3QVJA 4OHCA 3SJCA 1RJEA 1JG6A 2JHFA 1CUFA 1XEWX 2C4VA 2R6FA 3E2MA 3HCCA 3QOWA 2OZLA 4IF4A 4Q9KA 3OSZA 2Z5GA 4D9KA 1HUQA 1L7XA 3E7WA 1BS9A 2YY5A 2ZU0C 4FYJA 1Z8DA 4L4ZA 5ADHA 2HREA 1W30A 1KMQA 1NLZA 3PNOA 2NSYA 3CLSD 4FGJA 4H2DA 5ITVA 4ESVA 1KRXA 4HTAA 5HFNA 3T41A 1MTZA 5IJ9A 3EQ8A 1J2RA 4FMPA 3D6UA 4LZAA 4KFUA 4IHJB 4ODIA 5IM5A 4CTNA 1UADA 2QD2A 5JADA 3ZDEA 1H23A 1Z9BA 2Q4DA 2DGDA 2HNAA 3TOCA 3L1HA 2UYGA 1ULSA 1WY7A 5CA0A 4JWTA 2LR0A 3ITDA 4F3RA 3GA7A 1IOVA 2Y1WA 1Z0FA 4D96A 4P84A 3M3HA 3C6ZA 2P2SA 2QRUA 1ZD9A 4B80A 2OOSA 2C95A 4KQKA 2QX7A 2ZUCA 3ESQA 4H3SA 4L7VA 5HBRA 3U26A 4AL4A 2X3UA 4HRVA 1TF7A 4JGIA 4OQFA 3WHKA 2H11A 1O4VA 3C8MA 3T1NA 2IY9A 1E9AA 1YFLA 1R50A 3WB0A 1SOAA 3EEBA 2GAIA 4FGZA 2A92A 3OCWA 1E3DA 4DAEA 4F5DA 1AUQA 3M81A 3OHSX 1KVTA 1SVKA 4HF7A 4LYAA 5AK6A 3SQDA 2XZTA 4EO4A 2OTCA 4YLYA 1KEZA 4REOA 3DYBA 3I6IA 2PJRA 2HMTA 2QRMA 4JNCA 5DBOA 5E9QA 2FW1A 2QNBA 3H87A 1TECE 2YOGA 4GXQA 4QPZA 3HR4A 4RJJA 3L0DA 5EMHA 1RAFA 1GKKA 3HFGA 3DG9A 5BRJA 2N47A 2WP8J 3D2LA 2ODAA 3KSDO 3CF6R 5KVAA 1Y1QA 3ER9A 1UWVA 2P0EA 3LUDA 4B09A 2EW1A 3OZVA 1E6WA 2HI0A 4BO0A 2VSFA 3CWCA 4RIEA 2QTZA 3BIOA 1GPAA 1ZCAA 4R1SA 3S7TA 3PEFA 5F7JA 2ZSDA 5CX1A 5DV9A 1W9MA 1BHJA 5FTMA 4U7HA 3X2EA 5KPDA 1EK1A 1IFXA 2HUPA 3WVNA 5JZSA 3W2HA 3JYPA 4KAAA 2D2IA 2HRZA 3HN6A 3HCFA 1HURA 3G2IA 4LBVA 2PS9A 4WZBA 5MN4A 2P65A 1K5HA 2IELA 3G68A 2VHEA 1EVLA 1CHNA 2FSHA 2OESA 2WPNA 3FBWA 1GCAA 3NQ41 1RKXA 1YGPA 4AP5A 1Y34E 3VYRB 1LUAA 3IBFA 1U0FA 1F51E 3OPMA 4FHZA 4MCHA 5B1HA 3RS4A 2C5FA 1PFGA 1R0KA 2Y71A 4A0RA 1PL6A 4L5IA 4O2AA 4BFTA 2NXEA 4CKCB 2HWWA 4HUQB 1KMIY 5HZGA 3SHQA 4WXRA 4LHVA 5C46F 2F64A 1EZ4A 3D6JA 3KAJA 3NDPA 4R2KA 3E81A 3FLAA 2BFFB 3LQ4A 2I91A 3W1EA 3PWTA 4QXRA 3JW8A 3B3GA 3D5TA 4V03A 3TYXA 5KAMA 4MQUA 3G2LA 3RARA 1AOXA 1NF9A 2P9HA 4Q9HA 3USZA 4TYWA 2AOTB 2XI4A 3H99A 4AQYB 5FFNA 2BGMA 2HJSA 2JH8A 4XX1A 2HPVA 2V8BA 4FK8A 4RAQA 3GLIB 4FZRA 3A6PC 5KUTA 2YFHA 3BRQA 3OPQA 3QZUA 1TA9A 2SKCA 4U2CA 2R2GA 4PZAA 4GLLA 4XYLA 1C3LA 3UCFA 4AMYA 2CXOA 4YP9A 2IFTA 4B85A 3M4NA 4IMPA 2I62A 3HDYA 2O7RA 3GJXC 1LTKA 3QOFA 4FBLA 3MTDA 2G08A 2ZCUA 3N74A 4PZDA 1JDTA 1EK0A 3DKKA 2GJ9A 3E23A 3AI1A 521PA 1O77A 3NONA 4KWHA 3K2EA 1LRKA 5DHQA 4GL2A 2OKGA 4CG0A 2ECPA 5KWEA 2H9YA 1TADA 1GHTA 3GFVA 4NFLA 4UHCA 4TT3D 4B3TB 4LIPD 1K0UA 1EDBA 3B3QA 4MZXA 1RAGA 2FH5B 4O02B 5BUCA 1YE8A 4XVCA 2XVAA 4R6XA 4MEJA 3UF0A 3HDVA 1PFKA 4X94A 2GUGA 3PT9A 3FUCA 4FHDA 4B81A 1SPXA 4UHKA 4QT0A 2QG9A 5F4ZA 3AU9A 3PFGA 4EARA 4ZV4A 3KR1A 1K68A 2YJGA 5SZKB 1IBLB 1IE3A 2NXNA 4D25A 2YR0A 1LLFA 3T94A 1RYZA 4XRGA 2IZ5A 3QBEA 2O3RA 4RSGA 1KPHA 3E84A 4PW0A 4RZ2A 1KIFA 3M6FA 3LW7A 2IH4A 1WSDA 3UKDA 3Q5DA 2PQ0A 4MS1B 2H1RA 4IKEA 1M2WA 3FNRA 4KTVE 3W04A 1JVNA 1QGUB 2MINB 1Z2DA 1PYGA 2HGZA 1HZZA 1VJ0A 2JC3A 4KP7A 4X3OA 2NUAB 3OOJA 1YB6A 3PFCA 4FQ8A 4FFOA 2H3HA 4LHSA 4KCGA 3GK3A 1SK8A 3DM9B 4IIHA 1UMBB 1KQNA 1NULA 5AKHA 1XFAA 5CLIA 3V8QA 1YH3A 1I1OA 1ZRHA 1E6CA 1CY4A 1FFSA 2FGJA 1UBSB 2Y99A 3WKDA 4DTIA 1OAOA 2BDEA 5JWOA 3KBOA 3SQNA 4BO8A 5P21A 5IH7A 2AB0A 1JTEA 4MVYA 5DTJA 1LLCA 3S27A 2FQXA 5BY2A 1KDRA 5ALUA 1SXGA 1N75A 1TEXA 2MSDB 1Z6QA 3PC6A 4LN1A 3B2EA 3CVJA 1P9NA 5ILOA 1Z37A 2R47A 2CE2X 4FLMA 4HCJA 4CEIB 5TDHA 4WBSA 3BWCA 3OG9A 3AR4A 4IICA 5REQA 2QJOA 3L84A 2D0PB 2HYIC 4J6FA 1DWQA 5KQGA 3DA8A 4XZ3A 5PNTA 1SUSA 3A9RA 2GEJA 3A0RB 3M5PA 4M0MA 2XAAA 3ZQKA 1KERA 2CLHB 3EG9B 2ODBA 1KY5A 2PQ2A 1CIVA 1WQ4A 3CH6A 3K1JA 4RQBA 3AKZA 1FP4A 4DSTA 3LC7O 1MRSA 5E6UB 5CA0F 3DVRX 5KOIA 1CUYA 4TWJA 4GIBA 4UARA 4W4TA 1TLLA 1SXJE 2OC4A 2WA1A 2G7MC 4A8PA 1IQRA 4D45A 3EW9A 3LP8A 1F5SA 1T35A 2H9AA 2QMEA 4XVQA 3VBCA 3TGPA 1BA3A 1JQ5A 2NG1A 1OXVA 1XBTA 3B1FA 3QWHA 3G7UA 4KZKA 2VSXA 1B8VA 1PZHA 2AW5A 1K9VF 2ZCJA 2GZSA 1RKUA 1KL7A 2FOIA 2YJ6A 3IP9A 4KPGA 5JMWA 2CXUA 4BX3A 4EG5A 2QQEA 1RP7A 1KZ9A 2ZULA 3KD2A 2ZUTA 1JH9A 4MTCA 2GEKA 4RADA 5B7GA 2WEKA 1PNOA 1SR8A 1ZHFA 2XTZA 1A27A 3GZJA 3WRYC 4YAKA 2C9DA 5ETJA 1BCRA 3WI7A 4DSAA 4XJTA 1G21A 3A14A 5I7EA 4GEKA 5ES4B 1NNSA 2HBRA 1X9HA 4TSRA 3N2EA 3UNXA 2DR3A 2AQHA 1Z5OA 2XCLA 2WDZA 4TSFD 4YRNA 5CB4B 4BXOB 2PS1A 4IL5A 4NZZA 3VNVA 1YJAA 5F2OA 1MW8X 4MP6A 4K1XA 1QP8A 4A2CA 2GYYA 3WIEA 3W0LB 5JAOA 3QXGA 3SNHA 1UBHS 4DR7B 1GZDA 4B7AA 1K88A 1MO5A 4Q4HB 5AKIA 1MEEA 4N6NA 2FUG1 3CLRD 2OR3A 4MUXA 1X38A 3QE9Y 1NVWQ 3CH5A 1IJBA 2OAQ1 5SY6A 9ATCA 3D1VA 4J16C 2NZXA 3KZ1E 1U2DC 1ZAYA 2YV5A 2WFMA 3LE8A 4BX9A 3LY9A 1S2IA 5AKKA 3BSYA 4A73A 2AKAB 1NRIA 3PNPA 4PIPA 4LGCA 3BMCB 3RI3A 1NZFA 1B3BA 2F17A 2J4FA 1MJGA 3ABZA 3WWCA 4UM9B 4Z5XA 1QB7A 1J39A 3UBTA 4RIFA 4M7WA 1SU8A 1IZ7A 2HDHA 2PX5A 1D9ZA 2YYZA 3E3NA 3M89A 1Q77A 1A2OA 1XVLA 2BJWA 4RORA 1TW3A 4K6FA 4KNWA 3WIOA 4OMFG 4B3BA 5KDLA 1FUUA 3B6EA 3DPSA 2IUFA 3BJMA 1XWIA 1Q20A 1W94A 1H3NA 3KUKA 3RPEA 2ZT6A 3S6JA 3G5UA 3RRMA 2DWOA 3WMRA 3WLHA 3OO0A 1GPLA 3QI7A 2DOKA 4QRHA 1XHLA 1LRJA 2DSTA 4C76A 3IQEA 1M2OB 5D1NA 1Y7TA 3AXTA 4XJXA 5FOSA 2HSWA 2VDMB 4O3FA 3Q15C 1X87A 2PJZA 1OTYA 2ODPA 1NSFA 5TNXA 1FUYB 1PJTA 5ICGA 3WQQA 2X8JA 1G5IA 3UW3A 1UC4B 1ETHA 1PZFA 3HJBA 1M7BA 5DP2A 3K0CA 4LHYA 1KPIA 3E9NA 3DKRA 3E27A 4GT1A 1SHTX 3DLAA 5BQ5A 1N2EA 1PV2A 3F1LA 2IDKA 2ZWOA 4ILEA 4OREX 1CDZA 1ZAKA 3TAHA 2H1CA 1N2SA 1LKZA 3GFTA 3FOBA 3IP7A 5BNTA 1TD9A 4UTXA 5HKKA 3A1NA 1XC7A 3GH1A 2CYCA 3SC6A 1AK2A 2IOFK 4GWLA 4OY3A 3IMKA 3LDGA 1L8AA 4Q3AA 1ARZA 4U8GA 3REQB 1JG7A 1YB1A 2WAOA 4GU5A 1ESNA 1PDVA 2WW8A 4U5QA 5IVKA 2YWDA 1JA9A 5B4UA 3BOSA 3H2YA 2HEIA 1WULS 3STTA 2HQSA 1U6KA 3HSSA 4U2KA 2FMUA 3EUFA 5KYVA 3SEZA 1FU8A 2X1HA 4FXPA 4JFAA 2C54A 4NMHA 1NP7A 4KREA 4F4DA 1EX1A 1NJFA 2ZRNA 1U2ZA 1FDSA 4ON9A 4OOFA 2H1VA 4B2YA 1O7JA 1J70A 1ORWA 3FTQA 3IQGX 3GPLA 2WTXA 1FVFA 4MS1A 1Y3FE 2EP5A 3BDAA 1L7MA 2EFYA 4UW9A 2RARA 3SN6A 2XDQA 3NR2A 2R00A 3QOXA 3WP0A 2VKTA 4AZSA 2Q7OE 3U3MA 1TIKA 1PN3A 2J0QA 1NE2A 1K98A 2J0UA 1VPEA 2DC1A 3C3WA 4YCDA 5FADA 2Q0XA 1INLA 1AZLA 2GYVA 4LYYA 3I2FA 4XASA 4TV9A 4LRTB 4BIMA 3EY9A 1AQUA 2PSFA 1H8HD 3FOAA 1XMJA 3BD9A 3S2YA 5KQMA 5ADVA 3EPHA 1A5AB 1LFDB 4PNHA 4WY2A 3ZWAA 3HNPA 1Y1KE 3IAUA 3K70B 3R6WA 3MILA 3GJ6A 4G5GA 4TMTA 2GXAA 2O6LA 1GY8A 3ROQA 3ZS8A 3ME5A 4BFXA 3AESB 4F3KA 2IS1A 2G4VA 5IYZF 3TKAA 5FBKA 3FHLA 1GITA 1RHJA 1BAPA 2JNWA 1LF5A 2M98A 3TTSA 4A2PA 3BKXA 4WADA 2JBHA 4WX2B 1AHHA 1FX0A 2G83A 4DNFA 1EZZA 3IELA 4JVNA 3H1PA 3KLBA 3QKSB 3MD0A 3I3SR 3OCJA 4FZ5A 2E4ZA 1IHYA 4PHCA 3GVCA 4RH0A 1VSTA 2CZCA 4J9UE 4TT3A 4UUOA 5FXMA 4YGXB 4HGYA 5F52A 3T5MA 3ZJTA 3U4HA 3CLTC 4FFPA 3PHLA 2VWPA 3WL5A 1JJAA 4DLPA 1LQTA 3DNPA 1J6UA 2X8LA 1BN7A 2DBYA 2FW0A 5ELXA 1G8MA 1O6CA 2W11A 2PT6A 4OA8A 3SFZA 4OBEA 4AWBA 5FWXA 4JN6B 4QUHA 4JBYA 2HHJA 4P82A 4R3NA 4B83A 4B33A 5AQ1A 2DFDA 4ARZA 2G17A 2W70A 5EPUA 2O3JA 1KXZA 5TGTA 3ND8A 3NIWA 1WXIA 4AKTA 3LYLA 4I8XA 3R5TA 4G5YA 1E6UA 3AIKA 2R751 1F4LA 1NVVQ 2R7KA 4HDKB 2JIBA 4QODA 4Y98A 5K3DA 5LD2C 4MV6A 3M1AA 1U3DA 4R71A 4QJIA 2O7VA 1WVMA 1XCJA 3Q10A 4V0QA 4DQUA 1CERA 4EMBA 3NHBA 2OO5C 1KFCB 4OLBA 1WTCA 2VKQA 1J0EA 1PR0A 3FDFA 2OLEA 3I2IA 1DKRA 3TI9A 1O0BA 2H0QA 4B3GA 3F67A 5BRAA 1XTJA 3M49A 2HJ9A 5JMTA 2V6FA 1LBQA 4AX4A 1X7WA 4IJMA 4MA5A 3LG2A 4C01A 4Q5IA 3WY9A 4YHBA 5K01A 4IILA 3N2GB 3ZXSA 1J99A 4EOGA 4I4TF 3K5PA 5BW5A 3HXKA 2IPAB 4XVHA 1XQVA 3L9WA 3KR2A 4D3ZA 3L05A 5AKYA 4AJ1A 5CB4A 3PDWA 1OC2A 4P4NA 3UHFA 4R40A 5BW6B 2M6RA 1Q74A 3M82A 1SQSA 4KIJA 721PA 3MJTA 2X40A 5AESA 1ECLA 1AK9A 4YRDA 2YRXA 2G36A 1PUJA 2VC2B 2XCIA 1YRWA 3H0EA 3PL1A 3GQBA 3KB8A 4LJ4A 4E3WA 1RWPA 1Q5PA 1T1IA 2PLWA 3CIFA 1WNFA 1KJZA 1O95C 3ZU2A 4YYZA 4R9RA 3CG4A 1KWGA 3WLJA 3MT8A 5DCWA 4K9QA 2JLRA 2HMAA 1UDCA 4D6PA 1CUIA 3K4QA 4EBFA 5HRAA 4YP6A 2XZOA 1ZDMA 5AQEA 3KXKA 2RONA 2X22A 1SCKA 3RK0A 1V71A 4XD7A 3W9YA 1G0OA 3CRNA 1NPTO 4C0KA 4D9HA 1A5SB 4NR0A 4QPJC 2H59A 4P4GA 1CUUA 1KEEA 1U5BB 4OXRA 1NKVA 3INTA 2CKDA 4WCFC 1T4BA 1OBVA 4P3KA 2A33A 1DBQA 1V7QA 2Y05A 3FSGD 4K28A 4JJ8A 5E7IA 3WB9A 1OZGA 4BFCA 2LDBA 4BMYA 1VMEA 1NATA 4F97A 3OP1A 2XUZA 5CVDA 2GF9A 3L8HA 2VQSA 2XRMA 1SKYE 1XRMA 4MS3B 1PR4A 5G0VA 2P2CA 2X3YA 4ZDKA 1XP8A 2G9VA 3SNKA 1XQWA 2OGUA 3I12A 3KOYA 4H17A 5ESWA 2BDUA 2ONKA 4NPAA 1MB0A 1QTQA 1N57A 3U4AA 1TUBA 1PQWA 3AEYA 3H5OA 3U37A 3NBMA 3BH0A 1JSCA 5H82A 5I8ZA 4CMJA 2CF6A 1RSZA 4EH1A 4JNKA 2IVZA 3Q4GA 2UYQA 4MB6A 3SVLA 2XF8A 3LA6A 1P0MA 1G6HA 1S7CA 2JVIA 2Q5EA 5CNIA 1XVAA 1GOTA 1UBLS 2NZVG 3BL6A 4ZU1X 4DSOA 4C7VA 4JLBA 1FRFS 5FTKA 1B23P 3C15C 3GJRA 5EYPB 5GONA 4L02A 3OQJA 3SX0A 3QTBA 3LX6A 2GRAA 4R16A 4XWOA 1O9BA 1DX6A 2Z3WA 2Z1DA 2QT1A 4J94A 4DRYA 1GGNA 2QMOA 3NPAA 2KBEA 1AKWA 1GTZA 2H5EA 2HFKA 1QGUA 5TJ9A 4IDQA 1R8QA 1SUFA 3ICPA 4TN1A 1UC8A 5DBHX 1CC1S 4PNZA 1UK6A 1LFAA 3H1TA 4HH3C 4POOA 3ZDXB 3M4YA 2NSLA 3ODGA 1U7PA 3MGAA 5BWOA 1EVZA 3GRAA 3JQAA 3N0VA 4HGZA 3E3OA 3ZHOA 4FM9A 3CZPA 1YQ9A 2GNAA 3A1UA 4FCVA 1X7YB 1P7WA 3U3ZA 5TV2A 1H2EA 1XZEA 4M7PA 3HLKA 1QCDA 3CLRC 4C0QC 1X1SA 1PJSA 2P1DA 1JB9A 3JAMA 4MP3A 1FQOA 3K5HA 4WJKB 3ETJA 3PPWA 1X1BA 4YBRA 2REBA 3OJOA 4QLOA 3D8TA 1Q1EA 4I1IA 1QO7A 1MGOA 3W4JA 2BHLA 4M0FA 1YR9A 4Q9LA 3RJMA 5B3LA 1A4RA 3NC0C 4JLSA 5JQWA 4EA7A 2IXEA 3L8CA 1XDDA 5C1DA 3KKMA 3PJEA 1YDGA 3LTEA 2JFYA 4E30A 3SZ3A 1UPUA 3D7NA 1GN9A 2QAGB 2WAMA 4NXNB 4LDJA 3GN2A 1PW5A 3R9IA 3J81A 2ST1A 3ESAA 3GAAA 4UUAA 4Q39A 3RABA 1OPXA 3AETB 3B6JA 1X1EA 2LKCA 5AK5A 4PZ0A 2V9PA 1H66A 5DM2A 3VXKA 4RDHA 3TMYA 2FRXA 1V5FA 5ED4A 3CB4A 3GPDG 4U00A 3AHIA 4OYRA 3RSHA 4YUZA 3CCBA 3CMCO 3TXXA 3AL3A 4GOKA 2NACA 3D02A 3R3YA 4NP6A 3TXAA 2Y92A 3DZDA 3ZU5A 4F6RB 4ZTZB 3EIEA 4UEQA 4WN9B 3SYRA 4ZDWA 4XOIA 2GXUA 2EP7A 3T5TA 1JIIA 4AQ7A 2ZM6B 1A2QA 1J8YF 4JZYA 4ZT4A 2ZAGA 1HQKA 2NQ8A 3NHWA 1T3HA 1DAMA 2FXVA 1K6MA 3NBKA 3TB4A 5AXCA 2G6TA 4LE1A 3ZEAA 3RJ9A 2HA6A 2ODWA 1DP4A 2WMYA 3B89A 1NHGA 3DNFA 2QYHA 4OGKA 4L5YA 2Z6UA 1JA1A 5T8KC 3IHKA 3T9DA 3RUIA 1WETA 4K7JA 4D9EA 3QWAA 1RKVA 2GLUA 4P34A 3DZCA 3C7DB 1DTWA 3AILA 1JEYA 3PSAA 1AM4D 4C3VA 4FI3C 3SSNA 4ZV9A 3EY4A 3QU4A 4MQLA 5CM2Z 1JRLA 3RBAA 3WMEA 4E21A 4ZMSA 1O1YA 1HT2E 4EABA 1SKUA 2GTHA 2G1JA 1U2EA 1IRIA 4K40A 5GZ1A 4G0WA 2J5QA 3RU2A 1WE2A 3LRTA 2IGBA 1VXOA 5ERGB 3OZXA 2OFWA 3PUYA 1WXQA 3CGGA 5FPTA 3RVPA 4B73A 3U7EB 5JSFA 5E6SA 4BCCA 2V6BA 4CCWA 4X44A 4HZIA 5C4GB 3WX0A 2QYTA 4MHSA 3EIQA 1H9BA 1Q91A 5J59A 5LXTB 2GN1A 1OFUX 5K51A 2I1VB 3QMPA 1FXWA 4RANA 4AULA 1N2CB 1RCFA 1YIAA 3ROGA 1PSWA 4CLEA 5EZSA 2H1LA 4RF5A 2QXTA 4C22A 4HNHA 1W5FA 4I1UA 4LCBA 4GX0A 3ZS9A 1PWZA 3H1EA 1DCTA 4PQFA 1Q15A 2REQA 2M2IA 5JSZA 1QNLA 1NVFA 2BHNA 5EPEA 1V9SA 3G2PA 1CUWA 1E2GA 4I4LA 1CEXA 4WACA 4BNYA 4F5EA 3NBYC 1L5MA 3ZV5A 2GO7A 3H7AA 5HRCA 3NTXA 4JI3B 3FIUA 3BSWA 4AG5A 3P0FA 3M6UA 4DJDC 3CIOA 2HJHA 4HDKA 2J32A 1WDKA 1SD2A 2PO7A 5J4LA 3TNDA 2J7PD 5AK4A 4BB5A 2PLFA 5C8YB 2CN1A 1JEAA 1QOZA 1U02A 1KE1A 3ZYZA 4AAYA 1UPFA 1F20A 4MVJG 4Y7CA 1JILA 1ZH0A 1Z26A 3HRHA 3JQRA 3ZHQA 5D1HA 2B2XA 2BISA 5C4MA 1N2ZA 2TS1A 1II8A 4NJMA 5U4QA 2KE5A 1JJFA 2MU1A 4PYMA 3D3EA 1BVHA 4PCUA 4C4AA 1T2NA 4MW0A 1NQAO 3NW9A 2LD4A 1JIUA 2D0OB 2VAMA 1PQ4A 4MYDA 4U6SA 4TYNA 4O25A 3K4HA 4WFKA 1N33B 4X1KA 2QAJA 2ZR9A 1SRQA 3USES 4EY5A 3EIWA 3K0KA 4RVHA 1VPVA 1VBFA 4REQB 1SCJA 4GWKA 4EUHA 3SZUA 3W6ZA 1EDOA 1NBOA 2WJYA 3A1SA 3PPIA 4NIMA 3UT5B 3VX3A 2FFJA 4UJ3A 1MIHA 3EW7A 1FYWA 2HWYA 3I5MA 3D8BA 4XKJA 1BS2A 1VSVA 4CLDA 1W4AA 1D2GA 3RS8A 1P4SA 3RWOA 1PT8A 1WZCA 1XIVA 2ANBA 4Q7LA 1HT1E 1K92A 1L5LA 4C07A 4MQMA 1SIUA 1UMDA 3N2YA 5CFZA 1KYXA 2XCOA 3L7NA 4BMPB 4JASB 5B5SA 3NWJA 5IM4A 4OMDA 4H1WA 1WKCA 3HM9A 5EEGA 3ZD9A 2HA2A 4FUQA 3RIMA 6YASA 4UCQA 2VHTA 3M3DA 1D0SA 4R8SA 2P79A 3NMUF 1B74A 3KZOA 3V2GA 2V1XA 1L5NA 3UUFA 1VHJA 4CEIA 3UC9A 5IJAA 2QTWB 3DC7A 5ALSA 2HBQA 1DV1A 1JHYA 1MT0A 4FEEA 4TSFA 5CYPA 2IHYA 4CV3A 1PFYA 3EA0A 3JASB 3ZI4A 2FSUA 2ZYRA 3JQ9A 5FAXA 5L6LB 1S2MA 5TT1A 2R4UA 4DLAA 2JI4A 2Z1NA 5JO9A 3H7IA 1QLHA 5DYYA 4LX8A 1YGYA 3WNQA 1KDOA 2BBOA 5F77A 2JH9A 4QJ5A 4JJ7A 4MH0R 4ZGBA 3BPSA 4PX5A 2E5LB 1N0UA 1T2FA 3AOEC 4FUTA 5JNTA 1CRWG 4GOXA 2ZB3A 2PRYA 3QA9A 3ONNA 5ALIA 2EBHX 4FD3A 5F3RA 4YXWA 3FWYA 2PKQO 4CM8B 4IEEA 2EJWA 2ZIXA 4TPKA 5FUWA 3TE6A 2XJ9A 4IDNA 4E0BA 4QOEA 4BQOA 5A05A 1KI2A 4CG1A 4NK5A 3DBHA 3ETEA 4L5JA 3EXG2 4LKOA 3SSMA 3ZGXA 4TMVA 4CMBA 2JGIA 3K9LA 2O52A 4CCSA 3D0QA 4Z4CA 3FPCA 5CMLA 1S8AA 2D59A 2FOLA 2NUTB 1TE2A 4IUDS 1E6EA 3C24A 2VHYA 5DLPA 2ZR8A 4RFSB 5DLEA 4P2GA 3SYKA 1RPTA 5AVRA 5C7IO 5AT1A 3BMOA 1Z56C 2C4HA 4W9RA 2BI4A 2JGDA 2HHHB 3WG9A 1G3IA 1WZEA 5C5CA 4UBKA 1JR3E 1MKYA 1NUUA 4LPKA 3T5DA 3DV2A 4LXUA 3ETDA 2D54A 2QI9F 4R1OA 3PUWA 2PZKA 4PSAA 3SJZA 4KQXA 4Q4AB 1EM8B 3VOTA 4HWKA 1OI4A 2OBBA 4YFVA 4BWYA 2GK7A 2BEUB 2RFLA 2BKLA 2NTYC 2FK7A 2O06A 4RPIA 4ZN6A 2GFIA 1E0DA 2HMYB 1ORTA 2FWJA 5DCYA 1QQ5A 1SVLA 3OT1B 5ADWA 2AGVA 4LJ5A 4YPVA 4A91A 1KAMA 3FCXA 1QKIA 3FY4A 1JHVA 1BJRE 4QPCA 2P2YA 3FA2A 3KTAA 1Z5PA 3CTMA 2F00A 4GEGA 4IVPA 4Q1BA 4JI0B 1N34B 3QENA 3MELA 4OX9B 3EZLA 3K9GA 4UNNA 1HNWB 3E3MA 4L5BA 2N42A 2HH9A 2J46A 1QH9A 3PBKA 4AZ0A 1KSFX 4NCBA 2A1UA 2QVGA 2WF8A 2ZYUX 4R8VA 1DKQA 4YMUA 1BJTA 1V8FA 5JAMA 3DS8A 1N9GA 1NL3A 2R8BA 4WFQA 3WV5A 2QE7D 3OOWA 3W9SA 4EHLA 5HKKD 2WZDA 2C0PA 2DECA 2DH6A 4EYEA 2EHDA 3UYLA 1QGOA 1A98A 4DR4B 4HGOA 2GCOA 2C9BA 2DUNA 3ZWBA 4FZJA 1ADGA 2OB2A 2UZIR 3GR6A 1R74A 4NJEB 1JZTA 5JDCA 2ENWA 2H1SA 2JI6A 3HBAA 3V2UA 1EJ2A 2FR1A 4FJ1A 4C9BA 4I1YA 2Q5HA 2F4NA 1ZW1A 2AMFA 3TLBA 2IVFA 2BAGA 1K7YA 3A9WA 4YWHA 4XEUA 1XVVA 1UMCB 3VBEA 4KIUA 3K94A 1J23A 4DV5B 2IOQA 3N75A 3HU2A 2QDXA 2PGAA 2IPMA 1AKYA 2DRIA 3WWZA 1ZD3A 2J0VA 3T4EA 1DBPA 1Y6RA 1LX6A 4QDZA 2IK8A 4MPTA 3UWSA 3OLXA 3CWZA 3PDIB 3DW1X 3X2SA 1C8VB 3ZZTA 1KY4A 1M1YA 1QE0A 1YZYA 4J16A 1GTSA 5CCDA 4PHHA 3THYB 2LDXA 2BBTA 2NU9A 3DEKA 2JAPA 5DLDA 4H3KB 1GUDA 4Z4QA 2H2IA 1RQGA 5LFAA 3KL4A 4AJ9A 1G7TA 1N2JA 4N8SA 2JFHA 2PA3A 1JEYB 3Q5EA 3GF4A 1ZK3A 4K5QA 1FDOA 7MHTA 1FX1A 2XQJA 1FQJA 3SGLA 1GG2A 1AZSC 5ADUS 1BC5A 1E99A 2GAAA 3VGPA 5KQSA </